KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0003453Help
Entry
RHECIAT_CH0003453 CDS       T00720                                 

Gene name
pssTch1
Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
rec  Rhizobium etli CIAT 652
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3478492..3479565
Genome map
AA seq 357 aa AA seqDB search
MNRRRFLASVPLALSCFHAGAVLARTPAKPGLRAIADSKSFRFGSAIDLQNISDPAACEL
YVDNVNSITPRNELKWKATEKSPGVFSFGGADRMVAFARKNNMRVYGHTLIWYRVPDWVS
EITDARALRTVMNRHIKQVVARYKGSIDAWDVVNEPLEYDAPDLRNCVFRRLLGDDYIRM
SFDMAHETNPAATLVLNETHLEKKSATFEQKRGHILKIVEDLVARQTPINAVGLQAHFRP
GLDRIDPEGMRRFCAALKDMGIGVYITELDASCHFLKHDQGFTPAAYADIFRDVITVAAE
HGDLKGVTVWGMSEKYGEPDETETDADGACTKRINLYDDNNAPRSSADGVRQAIEAM
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaacaggagacgtttcctcgcttcggttccgctcgccttgtcttgtttccatgcgggc
gcggtgctggcgagaacgccggcaaaaccagggctgcgcgccattgccgacagcaaatcg
ttccggttcggatcggcaatcgacctgcagaatatcagcgacccggccgcctgcgagctc
tatgtcgacaacgtcaattcgataacgccgcgcaatgaattgaagtggaaagcgacggaa
aagagtcccggcgttttttccttcgggggcgccgacaggatggttgcattcgcgcgaaaa
aacaacatgagggtttatgggcatacactgatctggtatcgcgtcccggattgggtgtca
gagatcaccgacgcgcgagcccttcggacggtcatgaaccgtcatataaaacaggttgtc
gctcgctataaggggtcgatcgatgcctgggatgtggtgaacgagccgttggagtatgat
gcgcccgacctgcggaattgtgttttccgacgccttcttggcgacgattatattcgcatg
agtttcgatatggcgcacgagaccaatccggctgcgacgctggttctcaacgaaacgcat
cttgagaaaaaatccgccaccttcgaacaaaagcgcgggcacattctcaagatcgtcgag
gatctcgtcgccaggcagaccccgatcaacgcggtcgggctgcaggcgcatttccgcccg
ggtctcgaccggatagatccggaaggaatgaggcgattctgcgcggctctgaaggacatg
ggaattggtgtctatatcaccgaactcgatgcatcctgccacttcctgaagcatgaccaa
ggcttcacgccggccgcctacgccgatattttccgcgacgtgatcaccgtggcggccgaa
cacggcgacttgaaaggcgtcaccgtatggggcatgtcggagaaatacggcgagcccgat
gaaacggagaccgatgccgatggagcctgcacgaagcgcattaatctctacgatgacaac
aacgcgccgcgcagttcagctgatggcgtcaggcaggcaatagaggcgatgtga

DBGET integrated database retrieval system