KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0003679Help
Entry
RHECIAT_CH0003679 CDS       T00720                                 

Gene name
xfp
Definition
phosphoketolase (EC:4.1.2.22)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
rec  Rhizobium etli CIAT 652
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rec00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RHECIAT_CH0003679 (xfp)
Enzymes [BR:rec01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     RHECIAT_CH0003679 (xfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3714233..3716620
Genome map
AA seq 795 aa AA seqDB search
MEKHISTAAALTEAELGLIDRYWRAANYLSVGQIYLLANPLLREPLKPEHIKPRLLGHWG
TTPGLNFIYAHLNRLIRGRDLDVIYICGPGHGGPGMVANTYLEGSYSEIYPDISEDAEGM
RKLFRQFSFPGGIPSHAAPETPGSIHEGGELGYALVHAYGAAFDNPDLIVACVIGDGEAE
TGPLAASWHSNKFLNPARDGAVLPILHLNGYKIANPTILGRAADDDLRRLFEGYGYEPFF
VDGHEPRDMHRQMAATLDLIFDRIRDIQQQARNGKAADGCPRWPMIVLRSPKGWTGPKEV
DGKKVEGFWRAHQVPVSNCREDDGHRKILEDWMRGYDPEDLFDTGGRLKPELRALAPAGK
RRMGANPHANGGLLRRELAVPDLRDYAVDIGRRGSVVAQSTQILGHYLRDTMKLNAETAN
FRIFGPDETESNRLGSVFEVTDRVWMEDIEPYDIHLSRDGRVVEVLSEHLCQGWLEGYLL
TGRHGLFSCYEAFIHIIDSMFNQHAKWLKVTGELEWRKPISSLNYLLTSHVWRQDHNGFS
HQDPGFIDLVANKKADIVRIYLPPDANTLLWVGDHCLRTYDRINVIVAGKQPEPQWLSMD
EAVKHCEAGIGIWHWASNEEEAVAPDLVMACAGDVPTMETLAAVDLLRKAVPALKIRTVN
AVDLLALQSSDQHPHGLTDEAFDAIFTSDKPVIFAYHGYPYLIHRLTYKRTNHENIHVRG
FIEEGTTTTPFDMTVLNELDRYHLAIEAIERVPGLKEKAADALAAFHDKLAEHHAYVREY
GEDMPEVRNWTWPTA
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagcatatctcgaccgccgccgccctgaccgaggccgaactcggcctgatcgac
cgctactggcgggccgccaactatctctcggtcggccagatctacctgcttgccaatccg
ctgctgcgcgagccgctgaaaccggagcacatcaagccgcgcctgctcggccactggggc
acgacgcccggcctcaacttcatctatgcgcatctcaaccgcctgatccgcggccgcgat
ctcgacgtcatctatatatgcggccccggtcatggtgggccgggcatggttgccaacacc
tatctcgaaggcagctatagtgagatctatcctgatatctccgaggatgccgaaggcatg
cgcaagctcttccggcaattctccttccctggcggcatcccgagccacgcggcaccggaa
acgccaggatcgatccatgagggcggcgaactcggctacgccctcgtccacgcctatggc
gccgccttcgacaatcccgacctgatcgtcgcctgcgtcattggcgacggcgaggccgaa
accgggccgttggcggcgagctggcattccaacaagttcctcaatcccgcccgcgacggc
gccgtgctgccgatcctgcatctgaacggctacaagatcgccaacccgaccattctcggc
cgtgccgctgacgatgatctccgccgtcttttcgaagggtacggctatgaaccgttcttc
gtcgacggccatgagccacgcgatatgcatcggcagatggccgcgacgctggacctgatc
ttcgaccgcatccgcgacattcagcaacaggcccgcaacggcaaggctgcagacggctgc
ccgcgctggccgatgatcgtgctgcgcagccccaagggctggacgggcccgaaggaggtc
gacggcaagaaggtggaaggcttctggcgcgcccatcaggtgccggtttccaactgccgg
gaggacgatggccaccgcaagatcctcgaggactggatgcgcggttatgatccggaagac
ctgttcgatacgggaggccggttgaagcctgagctgcgggcactcgcccctgccggcaaa
cgccgtatgggcgccaatccgcatgccaatggcggcctattgcgcagggagttggctgtt
cccgatcttagggactatgccgtcgacatcggcaggcgcggcagtgttgtggcgcagtcg
acgcaaatcctcggccactatctgcgcgacacgatgaagctcaacgccgagacagcgaat
ttccggatcttcggccccgacgagacggaatcgaaccgtctcggcagcgtttttgaagtc
accgaccgtgtctggatggaggatatcgaaccctatgatatccatctctcgcgcgatggg
cgcgtcgtggaggtgctctccgaacatctctgccagggttggctggaaggctacctcttg
accggccgccacggcctgttctcctgctatgaggctttcatccacatcatcgactccatg
ttcaaccagcacgccaaatggctgaaggtgacgggcgagctggagtggcgaaagccgatc
tcctcgctgaactacctgctgacctcgcatgtttggcgccaggaccataacggcttcagc
caccaggatcccggtttcatcgatctcgtcgccaacaagaaggcggatatcgtccgcatc
tatctgccgccggatgccaataccctgctctgggtcggcgatcattgcctgcgcacctat
gaccgcatcaatgtcatcgtcgccggcaagcagccggagccgcaatggctgtcgatggac
gaagcggtgaaacattgcgaagccggcatcggcatctggcactgggcaagcaacgaggaa
gaggccgtcgcgcccgacctcgtcatggcctgcgccggcgacgtgccgaccatggagacg
ctcgccgccgtcgacctcttgcgcaaggccgtgccggcgctgaagatccgcactgtcaac
gccgtcgatctgctggcgctgcaatccagcgaccagcatccgcacggcctgaccgacgag
gccttcgatgcgatcttcacgtcagacaagcctgtcatcttcgcctatcacggctatccc
tatctcattcaccgcctgacctataagcgcaccaaccacgagaacatccacgtccgcggc
ttcatcgaagagggcacgacgacgacgcccttcgacatgaccgtcctcaacgaactcgac
cgctatcatctcgcgatcgaagcgattgagcgcgtaccgggcctgaaggaaaaggcggcg
gatgcacttgccgccttccacgacaagcttgccgagcatcacgcctatgtcagggaatac
ggcgaggacatgccggaggtacggaactggacgtggccgacggcgtga

DBGET integrated database retrieval system