KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0003764Help
Entry
RHECIAT_CH0003764 CDS       T00720                                 

Gene name
cheB2
Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
rec  Rhizobium etli CIAT 652
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:rec00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RHECIAT_CH0003764 (cheB2)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    RHECIAT_CH0003764 (cheB2)
Enzymes [BR:rec01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     RHECIAT_CH0003764 (cheB2)
Two-component system [BR:rec02022]
 CheA family
  CheA-CheYBV
   RHECIAT_CH0003764 (cheB2)
Bacterial motility proteins [BR:rec02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    RHECIAT_CH0003764 (cheB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3799705..3800802)
Genome map
AA seq 365 aa AA seqDB search
MAKKIRVLIIDDSASIRQTLAHVLEQDPDIEIMAVASDPFVAARKLLEEVPDVITLDVEM
PRMDGITFLRKLMAQRPIPVVMCSSLTEAGSQTLIQALEAGAVDVILKSKIGAADSLSDD
AIRIREIVKSASHARLPTVRRAAGTARSASADGPAKKLTADAMLPPPTGRAMAKTTEMVV
CVGASTGGTEALREFLEELPANAPGMVIVQHMPEKFTDAFAKRLNGLCEVEVKEAVDGDP
VLRGHVLIAPGDKHTLLERQGARYHVSVKTGPLVSRHRPSVDVLFRSAARSAGSNAMGII
MTGMGDDGARGMLEMHEAGAYTVAQDEASSVVFGMPKEAIAKGGVDRVLPLGQIAREVML
TQQKF
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggctaagaaaatccgcgttctcatcatcgacgattccgccagcatccgtcagacgctg
gcgcatgtgctggagcaggatcccgatatcgagatcatggcggtggcctcggaccccttt
gtggcggcgcgcaagctgctggaggaggtccccgacgtcatcacgctcgatgtcgagatg
ccacgcatggacggcatcacgttcctgcgcaagctgatggcacagcggccgatccctgtc
gtgatgtgctcgtcgctgacggaagcgggttcgcaaacgctgatccaggcgctggaggcc
ggtgccgtcgacgtcattctgaaatcgaagatcggggccgccgacagtctttccgatgat
gcgatacgcattcgcgaaatcgtcaagagtgcctcgcatgcgcggcttcccaccgtccgc
cgcgccgccggaaccgcgcgctcggcttcggccgacggaccggccaagaagctgacggcg
gatgcgatgctgccgccgccgacgggtcgggctatggcgaagacgaccgagatggtcgtc
tgcgtcggcgcctccaccggcggcacggaggcgctgcgtgaatttctggaggaactgccg
gccaatgcgcctggcatggtgatcgtccagcatatgccggaaaaattcaccgacgccttt
gccaagcggctgaacgggctctgcgaggtcgaggtcaaggaggcggtcgacggcgacccg
gtgctgcgcgggcatgtgctgattgcacctggcgacaagcacacgctgctcgaacgccag
ggcgcgcgctatcatgtcagcgtcaagaccgggccgctggtgtcgcgccaccggccttct
gtcgacgtgcttttccgttcggcggcgcgttccgccggctcgaacgccatgggcatcatc
atgaccggcatgggcgatgatggcgcgcgcggcatgctggaaatgcacgaggccggcgct
tacacggtggcgcaggacgaggcgagttccgtagttttcggcatgccgaaggaggcgatc
gccaaaggcggcgtcgaccgcgtcttgccgctcggtcagatcgctcgcgaagtgatgctg
acgcagcagaaattctga

DBGET integrated database retrieval system