KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0003815Help
Entry
RHECIAT_CH0003815 CDS       T00720                                 

Gene name
exoN
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase protein
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rec  Rhizobium etli CIAT 652
Pathway
rec00040  Pentose and glucuronate interconversions
rec00052  Galactose metabolism
rec00500  Starch and sucrose metabolism
rec00520  Amino sugar and nucleotide sugar metabolism
rec01100  Metabolic pathways
rec01130  Biosynthesis of antibiotics
Module
rec_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rec00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RHECIAT_CH0003815 (exoN)
   00052 Galactose metabolism
    RHECIAT_CH0003815 (exoN)
   00500 Starch and sucrose metabolism
    RHECIAT_CH0003815 (exoN)
   00520 Amino sugar and nucleotide sugar metabolism
    RHECIAT_CH0003815 (exoN)
Enzymes [BR:rec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     RHECIAT_CH0003815 (exoN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 DNA_mis_repair
Motif
Other DBs
NCBI-ProteinID: ACE92753
UniProt: B3PZV3
Position
complement(3850046..3850954)
Genome map
AA seq 302 aa AA seqDB search
MTKQEADVAQHNKVRKAVFPVAGLGTRFLPATKAVPKEMLTVVDKPIIQYVVDEAIEAGI
EHLVFVTGRNKHVIEDYFDIHFELEQTLRERAKKAEITLLAQQLPKAGTVSFTRQQEPLG
LGHAVWCAREIVGDEPFALLLPDMIMKGDTGCMKGMIDLYGQSGGNIIAVEECAPDQAHK
YGIVGVGEAIGEGFRITGMVEKPAKGTAPSNFFINGRYILQPEIFKILETQERGAGNEIQ
LTDGMLKLLKEQDFAGYHFRGTTYDCGAKDGFILANVAYALERADIRPTVEGGFKELLAG
LR
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagcaggaggccgatgtggctcagcacaacaaagttcgtaaagcagtatttccg
gtggccgggttggggacgcgattcctgccggcgacaaaggctgttccgaaggaaatgttg
accgtcgtcgacaagccgatcattcaatatgtcgtcgacgaggcgatcgaggccgggatc
gaacatctggttttcgtcaccgggcgcaacaagcacgtcatcgaagactatttcgacatt
catttcgagctggagcagacgctgcgcgagcgcgcgaagaaggcggaaatcacccttctc
gcccagcaattgccgaaggccggaacggtgagcttcacccgccagcaggagccgctcggc
ctcggtcacgcggtctggtgcgcccgcgaaatcgtcggtgacgaacctttcgcgctgctg
ctgcccgacatgatcatgaagggcgacacgggctgcatgaaggggatgatcgacctttac
ggccagagcggcggcaatatcatcgccgttgaggaatgcgcgcccgaccaggcgcataaa
tacggcatcgtcggcgtcggtgaggcgatcggcgagggcttccgcatcaccggcatggtg
gaaaagcccgccaagggaacggcgccttccaacttcttcatcaacggccgctacatcctg
cagccggagatcttcaagatcctcgaaacccaggagcgcggcgccggcaacgagatccag
ctcaccgacggcatgctgaagctgctgaaggaacaggattttgccgggtaccacttccgc
ggcacgacctacgactgcggtgccaaggatggcttcatcctggcaaatgtcgcctacgcc
ctcgagcgcgccgatatccgcccgaccgtcgaaggcggcttcaaggaattgcttgccggc
ctgaggtaa

DBGET integrated database retrieval system