KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0003826Help
Entry
RHECIAT_CH0003826 CDS       T00720                                 

Gene name
pldB
Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
rec  Rhizobium etli CIAT 652
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:rec00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3865860..3866834
Genome map
AA seq 324 aa AA seqDB search
MDQVLYSTPDNPAPENRTEGYFETHDGHQLRYAVFRSGGQVAKGTVVILHGRNEYIEKYF
ETIRDLTAKGLWVATFDLRGQGGSPRLMKRRNHGHIRRFADYEHDLDTFLEKVVLPDTRL
PFYLLAHSTGGLIALSAAPYLTTRIDRMVLSAPFIGLTGQAASPRVIRTLAGTLTALGLG
FLPLTSKLKEPDFSDNPLTSDEHRFDRNVAMMKAHPELTLGPPTARWLTEAFRTMDRVTS
PNHLFSITIPTIVIAPTRDGVVPYTAQERLSRYFRAGQLVPINGARHEIFQERDIYRAAA
LAAFHAFIPGSDAEENQDVAALGT
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggatcaggttctctattcgacgcccgacaatcccgccccggaaaaccgcacggaaggg
tattttgaaacccatgatggccaccagttgcgttacgccgtctttcgctccggcggccag
gtcgccaagggcaccgtggtcattctccatggccgcaacgaatatatcgagaagtatttc
gagacgatccgcgacctgacggcgaaaggcctctgggtcgcgaccttcgatctgcgcggc
cagggcggttcgccgcggctgatgaagcgccgcaatcacggtcacatccgccgctttgcc
gattatgagcacgatctcgacaccttcctcgagaaggtggtgctgccggatacgcgcctg
cctttctacctgctcgcccattccaccggtgggctgatcgcgctgtcggccgcgccttat
ctgaccacccgcatcgaccgcatggtgctgtccgcccccttcatcggcctgaccggccag
gcagcctcgccacgtgtcatccgtacccttgccggcacgctgactgctctcggccttggt
ttcctgccattgacctcgaaattgaaggagcctgatttcagcgacaacccgctgacttcg
gacgagcaccgcttcgaccgcaatgtcgcaatgatgaaggctcatccggagctgacgctc
ggtccgccgaccgcccgctggctcaccgaggcgttccgcaccatggatcgggtcacctca
cccaaccatctcttttcgatcaccatcccgaccatcgtgatcgccccgacgcgtgacggc
gtcgttccctataccgcacaagagcggctctcgcgctatttccgcgccggtcagctcgtg
ccgatcaacggcgcccgccatgaaatctttcaggaacgggatatctaccgcgctgcggcg
ctggcggccttccatgccttcattcccggcagcgatgccgaggagaaccaggatgtggcc
gccctcggcacgtga

DBGET integrated database retrieval system