KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0003862Help
Entry
RHECIAT_CH0003862 CDS       T00720                                 

Gene name
glgBch
Definition
(GenBank) 1,4-alpha-glucan branching enzyme (alpha amylase protein)
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rec  Rhizobium etli CIAT 652
Pathway
rec00500  Starch and sucrose metabolism
rec01100  Metabolic pathways
rec01110  Biosynthesis of secondary metabolites
Module
rec_M00565  Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:rec00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RHECIAT_CH0003862 (glgBch)
Enzymes [BR:rec01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     RHECIAT_CH0003862 (glgBch)
Exosome [BR:rec04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RHECIAT_CH0003862 (glgBch)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase AMPK1_CBM
Motif
Other DBs
NCBI-ProteinID: ACE92799
UniProt: B3PZZ9
Position
3907245..3909452
Genome map
AA seq 735 aa AA seqDB search
MKTPKTVPEVKLSWEISADEIKAILAGSHSNPFAVLGVHQAGDTFVARCFIPGAEEVTAM
TLDGSVIGELKQLHADGFFAGPVSLTRLQPVRYRARRGDAEWAVTDPYSFGPVLGPMDDY
FAREGSHLRLFDKMGAHLIRHDGAQGIHFAVWAPNAQRVSVVGDFNNWDGRRHVMRLRAD
SGIWEIFAPDVPIGVAYKFEIRGHDGVLLPLKADPFARRSELRPKTASVAAAELEQVWED
EAHLKHWRETDKRRQPISIYEVHAASWQRRQDGTMLTWDELASSLIPYCVDMGFTHIEFL
PITEHPYDPSWGYQTTGLYAPTARFGEPEGFARFVNGCHKVGIGVILDWVPAHFPTDEHG
LGWFDGTALYEHEDPRKGFHPDWNTAIYNFGRTEVVSYLVNNALYWAEKFHLDGLRVDAV
ASMLYLDYSRKHGEWIPNEYGGNENLEAVRFLQDLNTRIYGQHSNVMTIAEESTSWPKVS
QPVHEGGLGFGFKWNMGFMHDTLSYMKRDPVHRKHHHNELTFGLLYAYSENFVLPLSHDE
VVHGKGSLIAKMPGDDWQKFANLRAYYAYMWGYPGKKLLFMGQEFAQWSEWSEAKSLDWN
LLQYRMHEGMRRLVRDLNFTYRSKPALHERDCEGDGFEWLVADDGENSVFAWLRKAPGQK
PVAVITNFTPVYRENYSIRLPLAGRWREILNTDADIYGGSGKGNGGRVQAVDAGGNITCS
ITLPPLATIMLEPEN
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgccgaaaacagtccctgaagtaaagctttcctgggaaatttcggcagatgaa
atcaaggcgatccttgccggctcgcattccaatccctttgccgtcctaggcgtgcatcag
gccggcgacaccttcgtcgcccgctgcttcattccgggcgccgaagaagtgaccgccatg
acactcgacggcagcgtcatcggcgagctgaagcaattgcatgccgacggctttttcgcc
ggtccggtgtcgctgacaaggctgcagccggtgcgctaccgcgcccggcgcggcgatgcc
gaatgggccgtcaccgacccctacagcttcgggccggtgctcggccctatggacgattat
ttcgcccgcgaaggctcgcatctgcgtctgttcgacaagatgggcgcccacctcattcgc
catgacggcgcccagggcatccacttcgccgtctgggccccgaatgcgcagcgcgtctcg
gtcgtcggcgatttcaacaattgggacggtcgccgtcacgtcatgcggctgcgtgccgac
agcggcatctgggaaatctttgcccctgacgtgccgatcggcgttgcctacaaattcgag
atccgcggccatgacggcgtcctgctgccgctgaaggctgatcccttcgcccggcgcagc
gagttgcggccgaagaccgcctcggtcgccgccgccgaactggagcaggtctgggaggac
gaggcccatctgaagcattggcgcgagaccgacaagcgccgccagccgatctcgatctat
gaggttcatgccgcctcctggcagcgccggcaggacggcacgatgctgacctgggacgag
cttgcctcgagcctcattccctattgcgtcgacatgggtttcacccatatcgaattcctg
ccgattaccgaacatccctacgatccttcctggggctaccagacgaccggcctctacgcg
ccgaccgcccgcttcggcgagccggagggttttgcccgtttcgtcaatggctgccacaag
gtcggcatcggcgtcatcctcgactgggtgccggcgcattttccgaccgacgaacatggc
ctcggctggttcgacggcacggcgctctatgagcacgaagatccgcgcaagggcttccat
cccgactggaacacggcgatctacaatttcggccgcaccgaggtcgtttcctatctcgtc
aacaacgccctctattgggcggagaagttccatctcgacggcctgcgggtcgatgccgtc
gcctcgatgctctatctcgattattcccgcaaacacggcgaatggatcccgaacgagtac
ggcggcaacgaaaacctcgaagctgtccgcttcctgcaagacctcaatacccggatctat
ggccagcattccaatgtcatgactatcgccgaggaatcgacctcctggccgaaagtctcg
caacccgtgcatgaaggcggcctcggcttcggcttcaaatggaacatgggcttcatgcac
gacacgctgagctacatgaaacgcgatccggtgcaccgtaagcaccatcacaacgagctt
accttcggcctgctctatgcctattcggaaaatttcgtcctgccgctgtcgcatgacgag
gtcgtccacggaaaaggctcgctgattgccaagatgccgggagacgattggcagaaattc
gccaatctgcgcgcctattacgcctatatgtggggctatcccggcaagaagctgttgttc
atgggccaggaattcgcccagtggagcgagtggagcgaagcgaagtcgctcgattggaac
ctgcttcaataccgtatgcacgagggcatgcgccgcctggtgcgtgatctcaacttcacc
taccgcagcaagccggcgctgcacgagcgtgattgcgagggcgacggcttcgaatggctg
gtcgccgacgacggcgagaattccgtcttcgcctggctgcgcaaggcgccgggccagaag
ccggtcgccgtcatcaccaacttcacgcctgtttatcgcgagaactattcgatccgcctg
ccactggcgggccgctggcgggaaattctgaataccgatgccgacatctacggcggcagc
ggcaagggcaatggcgggcgcgtgcaggccgtcgatgccggcggcaacatcacctgctcg
atcaccctgccgcccttggcgacaattatgcttgaacctgaaaattaa

DBGET integrated database retrieval system