KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0003960Help
Entry
RHECIAT_CH0003960 CDS       T00720                                 

Gene name
hexA
Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
rec  Rhizobium etli CIAT 652
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:rec00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:rec00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4015530..4017440)
Genome map
AA seq 636 aa AA seqDB search
MADYRLETSWRPVENSFGRLTFTLFNLSTEPLSGFSLAYTTETRVADNHVCDGGSLKRQV
AHFHEFLPPEGLSVRPGGHWRFTVEGLTREPKHVSAGVKSAYLTLAEGRHVPVEFSDLHL
EGRDGGAAAPLLPAGSVPDPYSLLPWPLLLGLKAGELPVILYPAEKTRPDAIKSLSLVLA
LYQRLYLAANAPFSLSAIKGGRAIRFATESSIAGSAYELRFTAHEIVLSSADEAGRQYGL
ISLAQLMHGARADRERFKFPNFGTIADQPRYDWRGCHLDVARQFYPVADVTRLIDILAWN
KLNIFHWHLTDDEAWRLEIKAYPALTEIGARRGPDEVLVPQLGDGAETRAGHYTQDDVRQ
IVAHAASLHIEVVPEIDIPGHGTATLLSLPELVDGQEAPDSYRAVQGYPNNALNPAVEFT
YEFLGKVFDEVVALFPSEYLHIGGDEVAQRAWLTSPLCSALMEREKLAGTPELQAYFLKR
IKAMLSQRGKKLAGWNEVSHGGGVDRDGTLLMAWEKPELGLALAEDGYDVVMTPGHAYYL
DMAQAEAWAEPGAAWAGYSSPEHTYAYEAEGDLPEALQEKMRGIQACIWTENFVSRAYFN
RLVFPRLSAVAEAAWTPLTRKDWDRFAAIVRMWPIL
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atggccgattatcgtctggaaacaagctggcgcccggtcgaaaacagtttcgggcgcttg
accttcacgctcttcaatctctcgaccgagccgctgtccggcttctcgctcgcctacacg
acggagacgcgggtcgccgacaatcatgtttgtgacggcggcagcctaaagcggcaggtg
gcgcatttccatgagttcctgccgccagaggggctgagcgtgcggccgggcggacattgg
cgctttacggtcgaagggctcacgagagagccgaaacatgtcagcgctggcgtcaagtcg
gcctatctaacactcgccgaaggccgccatgttcccgtggagttcagcgatctccatttg
gaaggccgcgacggcggggcggcggcgccgcttctgccggctggctcagtcccggacccg
tattcgctgctgccgtggccgctcttgctcggactgaaggcgggagagctgcccgtcatt
ctctatccggccgagaagacgcgccccgacgcgatcaaatcgctctccctggtgcttgcg
ctatatcagcgcctttatcttgctgcgaatgcgccgttttcgttgagcgccatcaaaggc
gggcgcgccattcgtttcgcaaccgaatcgtcgatcgccggctccgcctacgagttgcgt
ttcaccgcacatgagattgtgctgtcgagcgcggatgaagcagggcgccaatatgggctg
atcagcctggcgcagctaatgcacggcgctcgcgccgatcgcgagcgcttcaaatttccc
aatttcggcacgatcgccgaccagccgcggtatgactggcgcggctgccatctcgatgtc
gccaggcagttctatccggtcgccgacgtcacccggctgatcgatattcttgcctggaac
aagctcaacatctttcattggcacctgaccgacgacgaagcttggcggctggagatcaag
gcctatccggctttgacggagatcggcgcgcggcgcgggccggacgaggtgctggtgccg
cagctcggcgacggagcggaaacacgcgccggccactacacgcaggacgacgtccgccag
atcgtggcgcatgccgcttcgctgcatatcgaggtggtgccggaaatcgacattccgggt
cacggcaccgcgacgctactctcgctgcccgagctcgtcgacgggcaggaggcgcccgac
agctaccgggcggtgcaaggctatcccaacaacgcactcaatccggcggtcgaattcacc
tatgaattcctcggcaaggtgttcgacgaggtggtagcgttgtttcccagcgaatatctt
catatcggtggcgacgaggtggcgcagcgggcgtggcttacctcgccgctctgcagcgcg
ctgatggagcgggagaagcttgccggcacccccgaactacaagcctatttcctcaaacgc
atcaaggccatgctttcgcagcgcggcaagaagctcgccggctggaacgaggtctcacac
ggcggcggcgtcgatcgcgacggcacgctgctgatggcctgggaaaagcccgagctcggc
ctggcactggctgaagacggctacgatgtggtgatgacaccgggacacgcttattatctc
gacatggcccaggctgaggcctgggccgagcctggcgcggcgtgggcaggttattcgtcg
ccggaacatacctatgcttacgaggccgagggcgatctgcccgaagcactgcaggagaag
atgcgtggtatccaggcctgcatctggaccgagaacttcgtctcgcgcgcctacttcaat
cgcctggtctttccccgcctctcggctgttgccgaagcggcctggacgccgttgacgcgc
aaggactgggaccggtttgcagcgatcgtgcggatgtggccaatactttaa

DBGET integrated database retrieval system