KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0004042Help
Entry
RHECIAT_CH0004042 CDS       T00720                                 

Gene name
acsA2
Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rec  Rhizobium etli CIAT 652
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:rec01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rec00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:rec00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:rec00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:rec00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4110197..4111828)
Genome map
AA seq 543 aa AA seqDB search
MQLPPHDRYDDLYRDFSWRIPEDFNIGRAVSDDWAARAPERVCLEHFSPDGHHRSMTYRA
LTDRSSAFANALVSLGIGRGDRVALLLPQSFETVIAHVAIYKAGAVALPLALLFGVEALE
YRLKAAGAAAVVTNGFGLDRIRQIRDRLPVLKHVVSIDGPNDEALGFAELADTHPSVFDV
AETGPNDPALMIFTSGTTGPPKGALHGHRVLPGHIPGMQFAHEGFPRAGDKVWTPSDWAW
AGGLLNALLPSLLLGVPVVSSPAQKFDADMAYRIMAEMKVRNAFIPPTALRLMRSVSDPR
SKYDLVLRTIGSAGEALGRETYEWARRTLGITVNEFYGQTECNFVLSSSAAYRVTRAGAI
GRAVPGHRVAIVGEAGDELAAGEPGQIAIASPDPVMFLGYWNDEAATEKKFVKGWLLTGD
IGRQNEEGYVTFEGRDDDVITSSGYRIGPAEIEDCLIGHPAVQLAAAVGKPDAVRTEIVK
AYIVLAPGHSPSEALAADIREWVKMRLSMHEYPREVEFVESLPLTTTGKVIRRLLREKAA
AEG
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgcaattgccccctcacgatcgctatgacgatctctatcgtgatttctcctggcggatt
ccggaggatttcaatatcggccgcgccgtcagcgacgattgggcagcccgggcgccggag
cgcgtctgcctcgaacatttcagccccgacggccatcatcgctcgatgacctaccgcgcg
ctcaccgaccgttcctcggccttcgccaatgcgctggtttcgctcgggatcggacgcggc
gatcgtgtcgcgctgctcttgccgcagtccttcgaaacagtgatcgcgcatgtggcgatc
tacaaggccggcgcggttgcgctgccgctggcgctgctcttcggcgtcgaggcgctggaa
taccggctgaaggcggcaggggcagcggccgtcgtcaccaatggtttcggtcttgatcgc
atccggcagatccgtgaccgcctgccggtgctgaaacatgtggtcagcatcgacgggcca
aatgacgaggcgctgggatttgccgaactggcggatactcacccttcggtcttcgacgtc
gccgagaccggtccgaacgatccggcgctgatgatctttacctcgggcacgacagggccg
ccgaagggcgcgctgcatggccaccgtgttctccccgggcatattcccggcatgcagttc
gcccatgagggttttccgcgtgccggcgacaaggtctggacgccgtccgactgggcctgg
gccggcggcctgctcaacgcgctgctgccgagccttctgcttggcgttcccgtcgtctcc
tcgccggcgcagaaattcgatgctgacatggcctaccggatcatggcggagatgaaggtg
cgcaatgccttcattccaccgacggcgttgaggctgatgcgctcggtttccgatccgcgt
tcgaaatatgatctcgtgctgcgcacgatcggctctgccggggaggcgctcggccgcgag
acctatgaatgggcgcggcgcacgctcggcatcaccgtcaatgaattctacggccagacg
gaatgcaatttcgtgctttcatcgagtgctgcctatcgcgtgaccagggccggtgccatc
ggcagggcggtaccgggacaccgtgtcgcgatcgtcggtgaagcgggggatgagctggcg
gccggcgagccgggccagatcgccatcgccagtcccgatcccgtcatgttccttggctat
tggaacgatgaggcggcgaccgagaaaaaattcgtcaagggctggctgcttaccggcgat
atcggccgccagaatgaagagggctacgtcaccttcgaaggccgcgacgacgacgtcatc
acctcttcgggatatcgcatcggcccggccgaaatcgaggactgcctgatcggccatccc
gccgtgcagcttgccgctgccgtcggcaagcccgatgccgtgcggacggagatcgtcaag
gcctatatcgtgctggcaccgggccattcgccgagcgaggcgctggccgccgacatcagg
gaatgggtgaagatgcggctttcgatgcacgaatatccgcgcgaggtggaattcgtcgag
tcactgccgctgacgaccacgggcaaggtgatccgccggctgctgcgggaaaaggcggca
gccgaaggctga

DBGET integrated database retrieval system