KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0004042Help
Entry
RHECIAT_CH0004042 CDS       T00720                                 

Gene name
acsA2
Definition
(GenBank) acetyl-CoA synthetase protein
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rec  Rhizobium etli CIAT 652
Pathway
rec00010  Glycolysis / Gluconeogenesis
rec00620  Pyruvate metabolism
rec00640  Propanoate metabolism
rec00680  Methane metabolism
rec01100  Metabolic pathways
rec01110  Biosynthesis of secondary metabolites
rec01120  Microbial metabolism in diverse environments
rec01130  Biosynthesis of antibiotics
rec01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rec00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHECIAT_CH0004042 (acsA2)
   00620 Pyruvate metabolism
    RHECIAT_CH0004042 (acsA2)
   00640 Propanoate metabolism
    RHECIAT_CH0004042 (acsA2)
  Energy metabolism
   00680 Methane metabolism
    RHECIAT_CH0004042 (acsA2)
Enzymes [BR:rec01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     RHECIAT_CH0004042 (acsA2)
Lipid biosynthesis proteins [BR:rec01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   RHECIAT_CH0004042 (acsA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ACE92973
UniProt: B3PP98
Position
complement(4110197..4111828)
Genome map
AA seq 543 aa AA seqDB search
MQLPPHDRYDDLYRDFSWRIPEDFNIGRAVSDDWAARAPERVCLEHFSPDGHHRSMTYRA
LTDRSSAFANALVSLGIGRGDRVALLLPQSFETVIAHVAIYKAGAVALPLALLFGVEALE
YRLKAAGAAAVVTNGFGLDRIRQIRDRLPVLKHVVSIDGPNDEALGFAELADTHPSVFDV
AETGPNDPALMIFTSGTTGPPKGALHGHRVLPGHIPGMQFAHEGFPRAGDKVWTPSDWAW
AGGLLNALLPSLLLGVPVVSSPAQKFDADMAYRIMAEMKVRNAFIPPTALRLMRSVSDPR
SKYDLVLRTIGSAGEALGRETYEWARRTLGITVNEFYGQTECNFVLSSSAAYRVTRAGAI
GRAVPGHRVAIVGEAGDELAAGEPGQIAIASPDPVMFLGYWNDEAATEKKFVKGWLLTGD
IGRQNEEGYVTFEGRDDDVITSSGYRIGPAEIEDCLIGHPAVQLAAAVGKPDAVRTEIVK
AYIVLAPGHSPSEALAADIREWVKMRLSMHEYPREVEFVESLPLTTTGKVIRRLLREKAA
AEG
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgcaattgccccctcacgatcgctatgacgatctctatcgtgatttctcctggcggatt
ccggaggatttcaatatcggccgcgccgtcagcgacgattgggcagcccgggcgccggag
cgcgtctgcctcgaacatttcagccccgacggccatcatcgctcgatgacctaccgcgcg
ctcaccgaccgttcctcggccttcgccaatgcgctggtttcgctcgggatcggacgcggc
gatcgtgtcgcgctgctcttgccgcagtccttcgaaacagtgatcgcgcatgtggcgatc
tacaaggccggcgcggttgcgctgccgctggcgctgctcttcggcgtcgaggcgctggaa
taccggctgaaggcggcaggggcagcggccgtcgtcaccaatggtttcggtcttgatcgc
atccggcagatccgtgaccgcctgccggtgctgaaacatgtggtcagcatcgacgggcca
aatgacgaggcgctgggatttgccgaactggcggatactcacccttcggtcttcgacgtc
gccgagaccggtccgaacgatccggcgctgatgatctttacctcgggcacgacagggccg
ccgaagggcgcgctgcatggccaccgtgttctccccgggcatattcccggcatgcagttc
gcccatgagggttttccgcgtgccggcgacaaggtctggacgccgtccgactgggcctgg
gccggcggcctgctcaacgcgctgctgccgagccttctgcttggcgttcccgtcgtctcc
tcgccggcgcagaaattcgatgctgacatggcctaccggatcatggcggagatgaaggtg
cgcaatgccttcattccaccgacggcgttgaggctgatgcgctcggtttccgatccgcgt
tcgaaatatgatctcgtgctgcgcacgatcggctctgccggggaggcgctcggccgcgag
acctatgaatgggcgcggcgcacgctcggcatcaccgtcaatgaattctacggccagacg
gaatgcaatttcgtgctttcatcgagtgctgcctatcgcgtgaccagggccggtgccatc
ggcagggcggtaccgggacaccgtgtcgcgatcgtcggtgaagcgggggatgagctggcg
gccggcgagccgggccagatcgccatcgccagtcccgatcccgtcatgttccttggctat
tggaacgatgaggcggcgaccgagaaaaaattcgtcaagggctggctgcttaccggcgat
atcggccgccagaatgaagagggctacgtcaccttcgaaggccgcgacgacgacgtcatc
acctcttcgggatatcgcatcggcccggccgaaatcgaggactgcctgatcggccatccc
gccgtgcagcttgccgctgccgtcggcaagcccgatgccgtgcggacggagatcgtcaag
gcctatatcgtgctggcaccgggccattcgccgagcgaggcgctggccgccgacatcagg
gaatgggtgaagatgcggctttcgatgcacgaatatccgcgcgaggtggaattcgtcgag
tcactgccgctgacgaccacgggcaaggtgatccgccggctgctgcgggaaaaggcggca
gccgaaggctga

DBGET integrated database retrieval system