KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0004132Help
Entry
RHECIAT_CH0004132 CDS       T00720                                 

Gene name
argI
Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
rec  Rhizobium etli CIAT 652
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rec01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:rec00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4202917..4203852
Genome map
AA seq 311 aa AA seqDB search
MNIQSRSVTLIGAPLEEGSGRRGAAMGPAALRIAGVDQTLIDLGHDVADNGDLRIVPAMD
LPNHPKAHNLRTVGAFTRALESSVYDVAASGRFPLILGGDHSLSMGSVSGMTRYAADKGR
PLFVLWLDAHADFNSPATSPSGNIHGMPVAFFCGEAEFAEILPKDRPFVDPKHVFQVGIR
SVDAREREEIHEHGVNVFDMRAIDEQGIAAIMRYILDVVAKANGLLHVSLDLDFLDPDIA
PGVGTTVPGGATFREAHLVMEMLSDSGLVSSLDLVELNPFLDDRGKSARILVELTASLFG
RRIFDRPTRAA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccaatcgcgatctgtcaccctcatcggcgctccattggaggaaggctccggc
cgcagaggtgctgccatgggccccgcggcgctgcgcatcgccggcgtcgaccagacgctg
atcgatctcggccacgatgtcgcggataacggcgatctcaggatcgtaccggcgatggac
ctgccgaatcatcccaaggcccataatctgagaaccgtcggcgccttcactcgcgctctc
gaaagcagcgtctatgatgtcgccgcctccggccgctttccgctcattctcggcggcgac
cacagcctttccatgggcagcgtctccggcatgacccgttatgccgccgacaagggtcgc
ccgctcttcgtgctctggctcgatgcccatgccgatttcaattctccggccacctccccc
tccggcaatattcacggcatgccagtcgccttcttctgcggcgaggcggagttcgccgag
atcctcccgaaggaccgtcccttcgtcgatccgaaacatgtcttccaggtcggcattcgc
tcggtcgatgcgcgcgagcgcgaagaaatccacgaacacggtgtcaacgtcttcgatatg
cgcgcgatcgacgaacagggcatcgccgccatcatgcggtatattctcgatgtcgtcgcc
aaggccaacggcctgctgcatgtcagcctcgatctggatttcctcgatcccgatattgcc
cccggcgtcggcacgacggtgcccggtggcgcgaccttccgcgaggcccatctggtcatg
gaaatgctgtccgacagcggtctcgtctcgtcgctcgatctcgtcgagctcaatccgttt
ctcgacgatcgtggcaagagcgcccggatattggtggaactaacggcaagtctcttcggc
cgccgcattttcgatcgtccaacccgtgccgcatga

DBGET integrated database retrieval system