KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0004168Help
Entry
RHECIAT_CH0004168 CDS       T00720                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rec  Rhizobium etli CIAT 652
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rec00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RHECIAT_CH0004168 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RHECIAT_CH0004168 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    RHECIAT_CH0004168 (sucB)
Enzymes [BR:rec01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RHECIAT_CH0004168 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4242055..4243320)
Genome map
AA seq 421 aa AA seqDB search
MATEIRVPTLGESVSEATVGTWFKKVGDAIKADEPILELETDKVTIEVPAPVSGTLSEIV
AAAGETVGLGALLGQIAEGAVAAAAPAAAQPAAAPAQSAPAAPAQPAPVAAAAASSSSAS
VSTMPPAPAAAKMLAESKLSADQVDGSGKRGQVLKGDVIAAVARGISAPAAAPAAAPAAA
RGPSTVEDASREERVKMTRLRQTIAKRLKDAQNTAAMLTTYNEVDMKAVMDLRNKYKDIF
EKKHGVKLGFMGFFTKAVTHALKELPAVNAEIDGTDVIYKNYCHVGMAVGTDKGLVVPVI
RDADQMSIAEIEKDLGRLAKAARDGSLSMADMQGGTFTITNGGVYGSLMSSPILNAPQSG
ILGMHKIQERPVAIGGQVVIRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERLVLD
L
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggccacagaaatccgcgttccaactctcggtgaatccgtcagcgaggcaaccgtcggc
acctggttcaagaaggtcggcgacgccatcaaggccgacgagccgattctcgagcttgaa
accgacaaggtgaccatcgaagtgccggcaccggtctccggcacgctttccgaaatcgtc
gctgccgccggcgaaaccgtcggtctcggcgcgctgctcggccagatcgccgaaggtgcc
gtcgctgccgccgcgccggctgccgctcaaccggccgccgctcctgcccagtcagctccg
gctgctcccgctcagccggcaccggttgccgctgcggctgcatcgtcgtcgagcgcttcc
gtctccaccatgccgccggcaccggcggctgcgaagatgctggccgaaagcaagctttcg
gccgaccaggtcgacggcagcggcaaacgcggccaggtgctgaagggcgatgtcattgct
gccgtcgccaggggtatttcagctccggcagccgccccggcggcagcgcccgccgctgcg
cgcggcccgtcgacggtcgaggatgcctcgcgcgaagagcgcgtgaagatgacgcgcctg
cgccagacgatcgccaagcgcctcaaggacgcgcagaacaccgccgccatgctcaccacc
tataacgaggtggacatgaaggcagtcatggacctgcgcaacaagtacaaggacattttc
gagaagaagcacggcgtcaagctcggcttcatgggcttcttcaccaaggcagtaacgcac
gcgctgaaggaattgccggcggtcaatgccgagatcgacggcaccgacgtcatctacaag
aactactgccatgtcggcatggccgtcggcacagacaagggcctggttgttcctgtcatc
cgcgatgccgaccagatgtcgatcgccgaaatcgagaaggacctcggccgtcttgccaag
gcagcccgtgacggctcgctctccatggctgacatgcagggcggcaccttcaccattacc
aatggcggtgtttacggctcgctgatgtcctcgccgatcctcaacgcaccgcagtcgggc
attctcggcatgcacaagatccaggaacggccggttgcaatcggcggccaggtggtcatc
cgtccgatgatgtatctggcgctttcctacgatcaccgcatcgtcgacggcaaggaagca
gtcaccttcctcgtgcgcgtcaaggaaagcctggaagatccggaacgcctggttctcgat
ctctaa

DBGET integrated database retrieval system