KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0004180Help
Entry
RHECIAT_CH0004180 CDS       T00720                                 

Gene name
sdhD
Definition
succinate dehydrogenase, membrane anchor subunit (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rec  Rhizobium etli CIAT 652
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rec00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RHECIAT_CH0004180 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RHECIAT_CH0004180 (sdhD)
   00650 Butanoate metabolism
    RHECIAT_CH0004180 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    RHECIAT_CH0004180 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4256306..4256686)
Genome map
AA seq 126 aa AA seqDB search
MDMRTPLGKVRGLGSAKEGTSHFWRQRLTAVSNIPLILFFVIFMIAYAGAPYADVVRALS
NPFVAVVMGLMVISGVIHMKLGMQVIIEDYVHGEFGKIALLMLNTFFAIVIAGLCLFAIL
KIAFVG
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggatatgcgcacccccctcggcaaggttcgcgggctcggctccgccaaggaaggcacc
agccatttctggcgtcagcggctgaccgccgtctccaacattccgttgatcctgttcttc
gtcatcttcatgatcgcctatgccggcgcgccctatgcagatgtggtccgcgcgctgtcg
aacccgttcgtcgccgtggtcatgggtctgatggtgatctcgggcgtcatccatatgaag
ctcggcatgcaggtcatcatcgaggattacgtgcatggcgagttcggcaagatcgcgctg
ctgatgctgaacaccttcttcgcgatcgtcatcgccggcctctgtctcttcgccattctg
aaaatcgcattcgtaggataa

DBGET integrated database retrieval system