KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0004220Help
Entry
RHECIAT_CH0004220 CDS       T00720                                 

Definition
acyl-CoA thioesterase (EC:3.1.2.-)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
rec  Rhizobium etli CIAT 652
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:rec00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    RHECIAT_CH0004220
Enzymes [BR:rec01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     RHECIAT_CH0004220
   3.1.2  Thioester hydrolases
    3.1.2.-  
     RHECIAT_CH0004220
Lipid biosynthesis proteins [BR:rec01004]
 Fatty acid synthase
  Component type
   RHECIAT_CH0004220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4291925..4292569)
Genome map
AA seq 214 aa AA seqDB search
MRFKVAALQFTVIAVSLIFTGAAAARTINLVGFGDSLMAGYQLPPGNGFPEKLQAALKAK
GLDVAIANAGVSGDTTTGGLARIDWSVPDGTDGVILELGANDALRGIPPEESEKNLDQMI
GRLKQRGIAVLLVGMMAPPNMGADYAARFNPIYRKLSEKHGVRLYDFFLDGVALDAGLKL
DDGMHPNARGVDVMVEKMEADVTNFVGTISSVKK
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgagatttaaagttgccgcccttcaattcaccgtcattgccgtctcgctgatttttacc
ggtgccgccgcggcccggacgatcaatctggtcgggttcggggacagcctgatggcaggc
tatcagctgccgcccgggaacggctttccggagaagctgcaggccgctttgaaggcgaag
gggctcgacgtcgccattgccaatgctggcgtctcgggcgacacgacgaccggggggctt
gcccggatcgactggtcggtgcccgacggcaccgacggcgtcatcctggagctcggcgcc
aacgatgcgctgcgcggcatcccgccggaagagagcgagaagaacctcgaccagatgatt
ggccggctgaagcagcgcggcatcgccgtgctgctcgtcggcatgatggcgccgcccaat
atgggggcggactatgccgcacgcttcaatccgatttatcggaaactttccgagaaacat
ggagttcggctgtatgatttcttcctagacggggtggcgctcgatgccgggctgaaactc
gacgacgggatgcatccgaatgcaaggggtgtcgacgtcatggtcgaaaagatggaagcc
gatgtcacaaatttcgtcgggacgatttctagtgtgaagaaatag

DBGET integrated database retrieval system