KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0004323Help
Entry
RHECIAT_CH0004323 CDS       T00720                                 

Gene name
galM
Definition
aldose-1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
rec  Rhizobium etli CIAT 652
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rec00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rec00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4403463..4404485
Genome map
AA seq 340 aa AA seqDB search
MSDKLEREVFGKTKAGETVYRVVIKGGGLTAKIISWGAVIQDLRLEGHDAPLSLGFEEFD
SYPLYSAYFGATPGRCANRIGGGKFTLDGKDHQLEPNENGLTHLHGGSDNIAKRNWTIVE
HDVDRVVLKIVDPDGRAGYPGNCTIQATFWVHGNGELSITYESTSDQPTLANVCQHAYFN
LDGREDALGHDIMIAADHYLPTDERQVPTGEIRSVAGTEFDLREMTPMKRFVGSEQVLYD
HNFCLSAERTAKRSVALARSLYSGVSLEVRSTEPGVQFYAGFKLNTGAPGLGGRKYGPFA
GFCLETQVWPDAINHQGFPNAVLRPGEVLRQETDYIFTKS
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacaagttggagcgggaagttttcgggaagacgaaggcgggcgaaaccgtctat
cgtgtcgtcatcaagggcggcgggctgacggccaagatcatcagctggggcgcggtcatt
caggatctgcgccttgagggtcatgacgcgccgctctcgctcggcttcgaggagttcgac
agctacccgctctattccgcttatttcggcgccacgcccggccgctgcgccaaccggatc
ggcggcggcaaattcacgctcgacggcaaggaccatcagctcgagccgaacgaaaacggc
ctcacgcatctgcatggcggcagcgacaatatcgccaaacgcaactggacgatcgtcgaa
catgacgttgaccgcgtggtgctgaagatcgtcgatcccgatggccgcgccggctatcct
ggcaattgcaccatccaggcaacgttctgggtgcacggcaacggcgaactgtcgattacc
tatgaatcgaccagcgaccagccgacgctcgccaatgtctgccagcacgcctatttcaat
ctcgatggccgcgaggatgcgctcggccacgacatcatgatcgccgccgatcactatctg
ccgaccgatgaacggcaggtgccgaccggcgagatccgttccgttgccggtaccgaattc
gatcttcgcgaaatgacgccgatgaagcggttcgtcggcagcgaacaggtgctgtacgac
cataatttctgcctgtcagccgaacgtaccgccaagcgcagcgtcgcactggcccgcagc
ctctattccggtgtgtcgctggaagtgcgcagcaccgagccgggcgtgcagttctatgcc
ggattcaagctcaataccggggcgcccggcctcggcgggcgcaaatacggccccttcgcc
ggcttctgcctggaaacgcaggtctggccggatgccatcaatcatcagggtttcccgaat
gcggtgctgcgccccggcgaagtgctgcgccaggagacggattatatcttcaccaagagc
tga

DBGET integrated database retrieval system