KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0004323Help
Entry
RHECIAT_CH0004323 CDS       T00720                                 

Gene name
galM
Definition
aldose-1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
rec  Rhizobium etli CIAT 652
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rec00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHECIAT_CH0004323 (galM)
   00052 Galactose metabolism
    RHECIAT_CH0004323 (galM)
Enzymes [BR:rec01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     RHECIAT_CH0004323 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4403463..4404485
Genome map
AA seq 340 aa AA seqDB search
MSDKLEREVFGKTKAGETVYRVVIKGGGLTAKIISWGAVIQDLRLEGHDAPLSLGFEEFD
SYPLYSAYFGATPGRCANRIGGGKFTLDGKDHQLEPNENGLTHLHGGSDNIAKRNWTIVE
HDVDRVVLKIVDPDGRAGYPGNCTIQATFWVHGNGELSITYESTSDQPTLANVCQHAYFN
LDGREDALGHDIMIAADHYLPTDERQVPTGEIRSVAGTEFDLREMTPMKRFVGSEQVLYD
HNFCLSAERTAKRSVALARSLYSGVSLEVRSTEPGVQFYAGFKLNTGAPGLGGRKYGPFA
GFCLETQVWPDAINHQGFPNAVLRPGEVLRQETDYIFTKS
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacaagttggagcgggaagttttcgggaagacgaaggcgggcgaaaccgtctat
cgtgtcgtcatcaagggcggcgggctgacggccaagatcatcagctggggcgcggtcatt
caggatctgcgccttgagggtcatgacgcgccgctctcgctcggcttcgaggagttcgac
agctacccgctctattccgcttatttcggcgccacgcccggccgctgcgccaaccggatc
ggcggcggcaaattcacgctcgacggcaaggaccatcagctcgagccgaacgaaaacggc
ctcacgcatctgcatggcggcagcgacaatatcgccaaacgcaactggacgatcgtcgaa
catgacgttgaccgcgtggtgctgaagatcgtcgatcccgatggccgcgccggctatcct
ggcaattgcaccatccaggcaacgttctgggtgcacggcaacggcgaactgtcgattacc
tatgaatcgaccagcgaccagccgacgctcgccaatgtctgccagcacgcctatttcaat
ctcgatggccgcgaggatgcgctcggccacgacatcatgatcgccgccgatcactatctg
ccgaccgatgaacggcaggtgccgaccggcgagatccgttccgttgccggtaccgaattc
gatcttcgcgaaatgacgccgatgaagcggttcgtcggcagcgaacaggtgctgtacgac
cataatttctgcctgtcagccgaacgtaccgccaagcgcagcgtcgcactggcccgcagc
ctctattccggtgtgtcgctggaagtgcgcagcaccgagccgggcgtgcagttctatgcc
ggattcaagctcaataccggggcgcccggcctcggcgggcgcaaatacggccccttcgcc
ggcttctgcctggaaacgcaggtctggccggatgccatcaatcatcagggtttcccgaat
gcggtgctgcgccccggcgaagtgctgcgccaggagacggattatatcttcaccaagagc
tga

DBGET integrated database retrieval system