KEGG   Rhizobium etli CIAT 652: RHECIAT_PA0000101Help
Entry
RHECIAT_PA0000101 CDS       T00720                                 

Gene name
agaL2
Definition
(GenBank) alpha-galactosidase protein
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
rec  Rhizobium etli CIAT 652
Pathway
rec00052  Galactose metabolism
rec00561  Glycerolipid metabolism
rec00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:rec00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    RHECIAT_PA0000101 (agaL2)
  Lipid metabolism
   00561 Glycerolipid metabolism
    RHECIAT_PA0000101 (agaL2)
   00600 Sphingolipid metabolism
    RHECIAT_PA0000101 (agaL2)
Enzymes [BR:rec01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     RHECIAT_PA0000101 (agaL2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4 Glyco_hydro_4C
Motif
Other DBs
NCBI-ProteinID: ACE93447
UniProt: B3Q191
Position
pA:114896..116266
Genome map
AA seq 456 aa AA seqDB search
MAANPKITFIGAGSTVFMKNIIGDVLQRPALSGATIALMDLNPQRLEESAIVVNKLISTL
GVKAKAETYSDQRKALSGADFVVVAFQIGGYEPCTVTDFEVPKKYGLRQTIADTLGVGGI
MRGLRTVPHLWKVCEDMLAVCPEAIMLQYVNPMAINTWAIAEKYPTIRQVGLCHSVQGTA
MELAHDLDIPYEEIRYRAAGINHMAFYLKFEHRQADGSYRNLYPDLLRAYREGRAPKPGW
NPRCPNKVRYEMLTRLGYFVTESSEHFAEYTPYFIKEGRDDLIEKFGIPLDEYPKRCIEQ
IERWKGQAEAYRSADKIEVTPSKEYASSIINSVWTGEPSVIYGNVRNNGCITSLPENCAA
EVPCLVDASGIQPTFIGDLPPQLTALMRTNINVQELTVQALMTENREHIYHAAMMDPHTA
AELDLDQIWSLVDDLLASHGDWLPEWARTSKKVQAA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaaatcccaaaatcacgttcatcggagctggctccaccgtcttcatgaagaac
atcatcggcgacgtgttgcagcgtccggcgctctcgggcgcgacgatcgccctgatggac
ctcaacccgcagcggttggaagaaagcgccatcgtcgtcaacaagctgatctcgacgctc
ggcgtcaaagccaaggccgagacctattccgaccagcgcaaggcgctatcaggcgccgat
ttcgtcgtcgtcgccttccagatcggcggctatgagccctgcaccgtcaccgatttcgag
gtgccgaagaaatacggcctgcgccagacgatcgccgatacgctcggcgtcggcggcatc
atgcggggcttgcgcaccgtgccgcatctctggaaggtctgcgaggacatgctcgccgtc
tgccccgaggcgatcatgctgcaatatgtcaacccgatggcgatcaacacctgggcgatc
gcggagaaatatccgaccatccgccaggtcggcctctgccactcggtgcagggcacggcg
atggaactggcccacgacctcgacattccctatgaggaaatccgctaccgcgccgccggc
atcaaccacatggccttctatctcaaattcgagcaccgccaggccgacggctcctaccgc
aatctctatcccgatctcttgcgcgcctatcgcgagggcagggcgccgaagcccggctgg
aacccgcgctgcccgaacaaggtgcgctacgagatgctgacgcggctcggctatttcgtc
accgaaagctcggagcatttcgccgaatacacgccctatttcatcaaggaggggcgcgac
gacctgatcgagaaattcggcattccgctcgatgaatatccgaagcgctgcatcgagcag
atcgagcgctggaagggccaggcggaggcctatcgcagtgccgacaagatcgaggtgacg
ccgtcgaaggaatacgcctcctcgatcatcaactcggtctggaccggcgaaccctcggtg
atttacggcaacgtccgcaacaatggctgcatcacctcgctgccggaaaattgcgccgcc
gaagtgccctgcctcgtcgacgcctccggcatccagccgacgttcatcggcgacctgccg
ccgcagctgacggcactgatgcgcaccaatatcaacgtgcaggaactgacggtgcaggcg
ctgatgacggaaaatcgcgagcacatctaccacgccgcgatgatggacccgcacacggcc
gccgaactcgacctcgaccagatctggtcgctggtcgacgacctgctcgccagccacggc
gactggctgccggaatgggcccgcacatcgaagaaagttcaggccgcctga

DBGET integrated database retrieval system