KEGG   Rhizobium etli CIAT 652: RHECIAT_PA0000313Help
Entry
RHECIAT_PA0000313 CDS       T00720                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
rec  Rhizobium etli CIAT 652
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rec00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RHECIAT_PA0000313
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    RHECIAT_PA0000313
Enzymes [BR:rec01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     RHECIAT_PA0000313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pA:complement(334720..336747)
Genome map
AA seq 675 aa AA seqDB search
MTMSTPRPNALRLETLWNPPADGKEFSYVLRLKNLGSEPLSNFSLCVSGPGRVDPAGRVE
GATVSKRLSNFTEFQPPAGFVLGAGETWTVSVYALSWQFRHWTDGATSAYLALADGSTIV
LGVEPTRSSVSNAGLKRGAEIYPVPANAPVQISVIPWPNHVAVAARRPLPAGFAPRAQSS
EGEAAAKGFAALVDHLFAVEGIVRSEAEGAVPVILQDAAGFGPEAYRLSFDEERLTIEAS
GRTGFLYGLVTLGQIWRGARLHPGVFQFPASGEIVDEPAMGWRGLHLDVARQFYGAAEVK
KLLAVLAWNKLNRFHWHLSDDEAWRVEIDAYPALTEIGAWRGHGLAVPPLLGSSPARTGG
YYTKSVIREIVAHAKSFGIEIVPEIDMPGHCYAMQQAIPELRDPAEKGSYYSVQGFPDNC
INPAREQTYEIVETILAELIELFPFKVIHLGADEVPLGAWSGSPAALERLRDVAGDAVAD
AHAKRLNVVTNTHGADDIHGSGAAILQAEFLERVQRFLASKGCITGGWEEAAHGDVIDRE
KSYLCSWRNVEVSAELAERGYQMVVCPGQVYYLDMALRPDWDEPGASWAGNSDAEKLYKF
DPLSGWTASQKQKLLGIQACIWSEPMTDRAVFDRLVFPRISGLAETGWTKPSAKSWERFK
ALAGLMPLLYGLQES
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
gtgacgatgtcgacaccgcgaccgaacgccctgcggcttgaaaccctttggaacccgccc
gccgacggcaaggaattctcctatgtcctgcgcctcaagaacctcggcagcgaaccgctt
tcgaatttttccctctgcgtcagcggccccggccgcgtcgatccggccggacgcgtcgaa
ggcgcgacggtctcaaagcggctttccaatttcaccgaattccagccgccggccggtttc
gttctcggcgccggcgagacctggacggtctccgtctatgcgctgagctggcagttccgt
cactggacggacggtgcgacgagcgcctatctcgcgcttgccgatggcagcaccatcgtg
ctcggcgtcgagccgacgcgctcttcggtcagcaacgcgggcctgaagcgtggcgccgag
atctatccggttcccgccaatgcgcccgttcagatctcggtcattccctggccgaaccat
gtcgcggtcgccgcgcgccggccgctgccggccggttttgccccgcgggcgcagagcagc
gaaggggaggcggcggcgaaaggcttcgcggcgctggtcgaccatctcttcgccgtcgaa
ggcatcgtgcgcagcgaggctgaaggcgcagtgccggtcatcctgcaggatgccgccggc
ttcggtcccgaagcctatcggctgagcttcgacgaggagaggctgaccattgaggcgagc
ggccgcaccggctttctctatggcctcgtcacactcggccagatctggcgcggcgccagg
ctgcatcccggcgttttccaatttcccgcatccggcgagatcgtcgacgagccggcaatg
ggctggcgcggcctgcatctcgatgtcgcccgccagttctatggcgccgccgaagtcaag
aagctgctggcggtgcttgcctggaacaagctcaaccgcttccactggcatctttccgac
gacgaggcctggcgcgtcgagatcgacgcctatcccgccctgaccgagatcggcgcctgg
cgcggccacggccttgccgtgccgccgctgctcgggtcaagcccggcccggacgggcggc
tactacaccaaatcagtcatccgcgagatcgtcgcccatgcgaagagcttcggcatcgag
atcgtgcccgagatcgatatgcccggccattgctacgccatgcagcaggcgatcccggag
ctgcgcgatccggccgagaagggcagctattactcggtccagggctttcccgacaattgc
atcaatccggcccgcgagcagacctacgagatcgtcgagacgatccttgccgaactgatc
gagctctttccgttcaaggtcatccatctcggcgccgacgaggtgccgctcggcgcgtgg
tccggctcgccggcagcgttggaacgcctgcgggatgtcgccggcgacgcggttgccgat
gcccatgccaagcggctgaacgtcgtcaccaacacgcacggcgccgacgatatccacggc
tcgggcgcagcgatcctgcaggcggagttcctggagcgcgtccagcgtttcctggcgagc
aagggctgcatcaccggcggctgggaggaggcggcgcatggcgacgtcatcgacagggag
aagagctatctctgcagctggcgcaatgtcgaggtctcggccgagcttgccgaacgcggc
tatcaaatggtcgtctgccccggccaggtctactacctcgacatggcgctgaggcccgat
tgggacgaaccgggcgccagctgggcggggaattccgatgcggaaaagctctataagttc
gatccgctcagtggctggacggcgagccagaaacagaagctgctcggcatccaggcctgc
atctggtcggagccgatgaccgaccgcgccgtcttcgatcgcctggtttttccgcgcatc
tcggggcttgccgaaaccggctggacgaagccatccgccaagtcctgggaacgcttcaag
gcgctcgccgggttgatgccgctgctttacgggctgcaggaatcttga

DBGET integrated database retrieval system