KEGG   Rhizobium etli CIAT 652: RHECIAT_PB0000128Help
Entry
RHECIAT_PB0000128 CDS       T00720                                 

Gene name
adhE
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
rec  Rhizobium etli CIAT 652
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rec00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RHECIAT_PB0000128 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHECIAT_PB0000128 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    RHECIAT_PB0000128 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    RHECIAT_PB0000128 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RHECIAT_PB0000128 (adhE)
   00626 Naphthalene degradation
    RHECIAT_PB0000128 (adhE)
Enzymes [BR:rec01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RHECIAT_PB0000128 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pB:141935..143062
Genome map
AA seq 375 aa AA seqDB search
MQMRSVILRESGLPKPYSNSKPLKIELVELTPPGPMEVLVKIKAAGVCHSDLSAINGDRP
RPLPVALGHEASGVVAAIGPSVEKVEVGDHVVMSFLPVCGHCSYCAEGRASLCEPGYQAN
AAGTLLSGGKHIRLRGYEINHHSGVSAFSEYAVVSASSVVKVTKDIDLATAALFGCAVMT
GVGAVMNTCGVRPGRSVAVIGLGGVGLSAILGAVASGASDIVAIDLIQAKLDLAKELGAT
KTFLATSPNIVAQVKGATSGGVDYAIEMAGSKKAFELAYEITRRGGMTATAGLASANSRF
EVSPLPLVGEERTIKGSYMGSCVPSRDIPRYIDLYLKGKLPVDKLLSSTGPLDEINEVFD
RLDRAEINRHLVLMD
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgcagatgcgttcggtaatcctcagggagtcgggtctgccgaagccctattcaaattcg
aaacctcttaagattgagcttgtggaactgacgccgcctggccccatggaggtgttggtc
aagatcaaggctgccggtgtctgccactctgacctgtccgcaatcaatggggacagaccg
cgtccgcttccagtcgctctaggccatgaggcatctggcgtcgtcgcagcaatcggaccg
agtgtcgagaaggttgaggttggtgaccatgtagtcatgtcatttctgccggtttgtggc
cattgctcatattgcgctgaaggccgcgccagcctctgcgaaccgggctaccaggccaat
gctgcaggaacgcttctatccggcggcaagcacatccgtttgagaggatacgaaattaac
caccatagcggcgtttctgcgttttccgaatatgctgtcgtgtcggcgagctcggtagtc
aaagtgaccaaagatatcgatttggcgacagctgctctcttcggctgtgccgttatgacc
ggcgttggagctgtgatgaacacgtgtggggtccgcccaggccgtagtgtggcggtaatc
gggctcggcggcgtaggcctttcggcgatacttggcgctgttgcgagcggtgcaagcgat
atcgtggcgatcgacctaatccaagcgaagctggatcttgccaaggagctgggagcgacg
aagacttttttggccacctcgccgaatattgttgcccaagtaaaaggcgcgacaagcggc
ggggtagactacgcgatagagatggctggatccaaaaaggcattcgagcttgcatatgag
attacccggcgcggagggatgaccgctacggccggactggccagcgcaaattcccgtttc
gaggtttcgcccttgccgttggtcggagaggagagaacgatcaagggcagctatatgggt
tcctgcgtgccatcgcgcgacataccccgctatatcgacctttacctcaaaggtaagctg
ccagtggacaaattgctgtcgagcactggcccccttgatgagatcaatgaggttttcgac
cgtcttgacagggccgagatcaatcgacacctagtcttgatggactga

DBGET integrated database retrieval system