KEGG   Rhizobium etli CIAT 652: RHECIAT_PC0000002Help
Entry
RHECIAT_PC0000002 CDS       T00720                                 

Definition
putative di-heme cytochrome c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
rec  Rhizobium etli CIAT 652
Brite
Enzymes [BR:rec01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     RHECIAT_PC0000002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pC:complement(1828..2811)
Genome map
AA seq 327 aa AA seqDB search
MRFLVAASLFAMAAAQSAAADLSAYKRPLTVPFERMTPYSPQLATLGKMLFFDPRLSGNK
NMTCASCHNPSFGFETPVKTPIGAANTALARQAPTVLNVAWVSPFFWDGRAQNLEEQAAG
PITAAAEMNGKLETAVAEMQNIPDYKAWFGEVFPDKGITRETILTAIATYERTVVSNWSP
FDRWVDGDENAVSDSAKRGFEVFTGSAGCSACHSGWNFTDNKFHDIGLPDEDMGRFKIDP
SSPNNQHAFKTPGLRNTLYRGPYMHDGSLKSMDEVIAHYESGGVGRPSQDAAMMPFLLTD
QERDDLIAFLGTLTAEKQDIPLPTLPN
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcgttttctggttgcagcttccctctttgcaatggccgcagcccagtccgcggcggcc
gatctttccgcctacaagcggccgctgacggtgcctttcgagaggatgacgccctattcg
ccgcaactcgcgacgctcggcaagatgttgttcttcgatccccggctttccggcaacaag
aacatgacctgcgccagctgtcataatccttccttcggcttcgagacgccggtgaagaca
ccgatcggcgcggccaataccgcgctcgcccggcaggcaccgacggttctgaacgtcgcc
tgggtgtcccccttcttctgggatggccgcgcgcagaatctggaggagcaggcggcgggc
cccatcaccgcagctgccgagatgaacggcaagctcgagaccgctgtcgctgaaatgcag
aacattcccgattacaaggcgtggtttggcgaggtcttccccgacaagggcatcacaagg
gagacgatcctgacggcgatcgccacctatgagcggaccgtggtttccaactggtcgccc
ttcgaccgctgggtggatggcgacgagaacgcggtctccgacagcgccaagcgcggcttc
gaggtctttaccggtagcgccggctgttccgcgtgccactccggctggaatttcactgac
aacaagttccatgacatcggcctgccggatgaggatatgggccgcttcaagatcgatccg
agcagtccgaacaatcagcatgctttcaagacgccgggactgcgaaacacgctctatcgc
ggcccctatatgcacgatggcagcctgaagagcatggacgaggtgatcgcccattatgaa
agcggcggcgtcggccgcccctcgcaagatgccgccatgatgcccttcctgctgacggac
caggagcgcgatgatctgatcgcctttttgggaactctgaccgccgagaagcaggacatt
cccctgccgacgttgccaaactga

DBGET integrated database retrieval system