KEGG   Rhizobium etli CIAT 652: RHECIAT_PC0000455Help
Entry
RHECIAT_PC0000455 CDS       T00720                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
rec  Rhizobium etli CIAT 652
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rec00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pC:complement(480891..482798)
Genome map
AA seq 635 aa AA seqDB search
MRSWELESLARRHGIIPTRPSPDNREVAISGRTKRKLLSALKVDLSAAVDRETAGTRQEP
KQTLKEIPRSYLPEFLSCTRIWGISLQLYELRSARNWGIGDFEDLVVMTDLAGSLGADFI
GLNPLHAPFLADPDRCSPYEPSSRQHLNPLYIAVDCVPGFVLSRELDQKLERLRRTDLVD
YAEVAAVKLQALRDLWPGWRGQSPVDKAYAPADFDLFVSQGGDELRRHALFECLSLSMAG
RGAGAGWQTWPADFQRADSAAVAEFERDHQDDVRFHMWLQWLAHRQMMQAAERAVKAGMR
IGLYLDLAVGEAVDGSATWSQPEVYISKATIGSPPDPFAVDGQDWHLAGYLPSRIASGET
SPFRRMVTAAMRYAGAIRIDHAPALRRLFLVPLGSSPEGGGYVRYPQERLLQILAETSAE
HRCLVIGEALGMIPEDLPDDLAAARILSYRILSYEQDEDGFKSPDTYPVLALACISTHDH
QTLAGWWRGADIQDRREHGIVPPDLTEEHLEHRKRERKSLKAALRAAGLGLPQRLDATAS
REALRELTVSAYRYIARTPSLLVAVRLADLTDEKNPTNIPGTSDSYPNWKPKLSVLLEDM
MSSPLVKRVTEAMREERPQNRRARERMGSRRILNR
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgaggtcctgggagctcgaaagtctcgcccgccggcacggcatcatcccgacaaggccc
agtcccgacaatcgggaagtggcgatctccggccggaccaagcgcaagctactttcggca
ctgaaggttgacttgtcggctgcggttgatcgcgagacggccgggacgcggcaggagccg
aagcagacgctcaaggagatcccgaggtcatacctgccggagtttctttcctgcacgcgg
atctggggcatcagcctgcagctctacgagcttcgttcggcgcgcaactggggcatagga
gacttcgaggatcttgtcgtcatgacggatctggcaggatcgctcggcgccgatttcatc
ggactcaatccgcttcatgcgccttttcttgccgatcccgaccgctgcagtccctatgaa
ccgtccagccgccagcatctcaacccgctctatattgccgtcgactgcgtccccggattt
gtcttgagtcgagagctcgaccaaaagttggagaggcttcgccggaccgatctcgtcgat
tatgctgaggtggctgcggtcaagcttcaggcgctgcgcgatctctggccggggtggcgg
gggcagagcccagtcgacaaggcttatgctccggccgatttcgacctcttcgtgtcgcaa
ggcggcgacgagctgcggcggcacgcactgttcgaatgcctgtcgctgtccatggccggg
cgcggcgccggcgccggctggcagacatggcccgcagattttcagcgcgccgacagcgca
gccgtcgcagaattcgagcgcgatcatcaagacgatgtgcggttccatatgtggctgcag
tggctcgcccaccggcagatgatgcaggcggcggagcgggcagtgaaggccggtatgcgg
atcgggctctatctcgatcttgcggtgggcgaggcagtcgacggctcggcgacatggagc
cagccagaggtctatatttccaaggccaccatcggcagtccacccgatcccttcgccgtt
gacgggcaggactggcatcttgccggctatctgccgtccaggatcgcatcgggagaaact
tctcccttccgtcggatggtgacggctgcgatgcgctatgcgggcgcgatccgcatcgac
catgccccggcgctccggcgactctttctggtgccgctcggcagcagcccggagggcggc
ggctatgtgcgctatccccaggaaaggctcctgcagatcctggccgaaacgtccgccgag
catcgatgccttgtcatcggcgaagccttgggaatgatccccgaagacctgcccgacgat
ctggcggcggcccgcattctctcttatcggatcctgtcctatgaacaggacgaagacggc
ttcaaatcgccggatacctatcccgttcttgccttggcctgcatttcgacgcacgatcac
cagaccctggccggctggtggcgcggcgccgacattcaggaccggcgcgagcacggcatc
gtcccgccggatctcactgaagaacatctcgaacaccgcaagcgcgagcggaaaagcctg
aaggcggcactcagggccgccggtctcggcctgccccaacgtcttgacgcaacggcaagt
cgggaagcgctgagagaattgaccgtcagcgcctatcgctacatcgccagaaccccgtca
cttctcgtcgcggtgcgcctcgccgatctcaccgacgagaaaaacccgaccaatattcca
ggcaccagcgacagctatccgaattggaagccgaagttgtcggttttgctcgaggacatg
atgtcgagcccgctcgtcaagcgcgtaacggaggcgatgcgcgaggaaaggccgcaaaat
cgtagggcacgggaacgaatgggaagccggcggattctgaatagatag

DBGET integrated database retrieval system