KEGG   Rhizobium etli CIAT 652: RHECIAT_PC0000665Help
Entry
RHECIAT_PC0000665 CDS       T00720                                 

Definition
putative glucoamylase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
rec  Rhizobium etli CIAT 652
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rec00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RHECIAT_PC0000665
Enzymes [BR:rec01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     RHECIAT_PC0000665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pC:717585..719012
Genome map
AA seq 475 aa AA seqDB search
MTVALWSQSMTGANAAHIGANAPTVKPRPAFAQTDLVALSRYFSLLMMRNITSDGYVIED
PASPGVFSAPGCVIAAPSYPANTPGVDQDYVFNWVRDGAITAIEIALAGLLPVPGGVLPS
LVDYVNFAALCQANAKNSDTVTLGHACFTITGEVRPWSEQNDGPAIQSIAIMTLFDQLDG
ATQTIAKQLVEANLSYLLEVYQNKTTNLWEEYEGYSFFARAVQLRFFREISTNTIGIAVP
AGVADAISWLESQLATHWNGQLYVSILDAAEQAGYDANIDIVSSVCYGGIEPTDTKLLAT
AAILRRQWADPSSSNYYPVNGADAAKGLGPLFGRYPGDHYDGDVAAPVAGGHPWALCTAN
FAEFQYRLANTIEASGALPLDQFSEPFFAELGLGASSSPADASAALRASSDAMLRAIVYH
SDHYELSEQFDGTVGYEKSVRNLTWSYASFLSAVRARAAAPAAKSKPRNSRGPKS
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgacagttgcgctttggagtcagtcaatgacgggtgcgaacgcggcccatatcggcgcc
aatgcgccgacagtcaaaccgcggcctgccttcgcgcagaccgatctggtcgcattgtcg
cgctatttttctcttctgatgatgcgcaacatcaccagcgatggctatgtcatcgaggat
ccggcatcgcccggcgtcttctccgcccccggctgcgtcatcgccgcaccttcctatcca
gcaaacacgccgggtgtcgaccaggactatgttttcaactgggtccgcgacggggccatt
acggccatcgagatcgcgcttgccggcttgctgcccgttccgggcggggttttgccgagc
ctcgtcgactatgtgaacttcgccgcgctctgccaggcgaatgcgaagaattccgatacc
gtcacacttggccacgcctgcttcaccatcaccggcgaggttcgtccgtggtcggagcag
aatgatgggccggccattcagtcgattgcgatcatgaccttgttcgatcagctggatggc
gccacccagacgatcgccaaacaactggtcgaggccaacctctcttatcttctcgaagtt
taccagaacaagaccacaaatctctgggaggaatacgagggctattcgttttttgcaaga
gccgtacagctgcgctttttccgggaaatttccacaaacacgatcggcattgcggtgcct
gcaggggtggccgatgccatctcctggttggaaagccagctggcaacccactggaacggg
cagctctatgtgagcattctggatgccgcggagcaagccggttacgacgcgaacatcgat
atcgtctcttcggtctgctatggcgggatcgagccgaccgataccaagcttctggcaacg
gcggccatcctgcggcgccagtgggccgatccttcgtcttcgaactattacccggtcaat
ggcgccgacgcggccaaagggctcggaccactcttcgggcgctatccaggcgatcattac
gatggcgatgtggcggctcctgttgccggcgggcatccctgggctctgtgcaccgccaac
ttcgccgagtttcaatatcggcttgccaataccatcgaggccagcggcgccctccccctc
gatcaattctccgaacccttcttcgcagaactgggacttggcgcatccagcagccccgcc
gacgcgtcggccgctttgcgggcttcgtctgacgccatgctgcgcgccatcgtctatcac
agcgatcactatgaactgagcgaacagttcgatggaaccgttggctacgagaaaagcgtc
cggaatctgacctggagctatgcctccttcctctcggcagtcagggcccgcgccgccgcc
ccggccgccaagtccaagccccgaaactctcgcggcccgaaatcatga

DBGET integrated database retrieval system