KEGG   Rhizobium etli CIAT 652: RHECIAT_PC0000732Help
Entry
RHECIAT_PC0000732 CDS       T00720                                 

Gene name
speBc
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
rec  Rhizobium etli CIAT 652
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rec00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    RHECIAT_PC0000732 (speBc)
Enzymes [BR:rec01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     RHECIAT_PC0000732 (speBc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pC:786265..787317
Genome map
AA seq 350 aa AA seqDB search
MAFDHEKLQQLRQKFSEGHGGNIHDPEFRAVADKIFSASGTRAAPFSGVPTLLDAPYRQI
DAENPDFGDLDVALIGVPMDLGVTNRPGSRFGPRALRAIERVGPYNHVLKCAPLFEAKVA
DIGDVPFRSRYRLELSHEDIERRFRQIVSAGVLPLAVGGDHSITHPILKAVGEKRPVGLI
HIDAHCDTGGAYDLTKFHHGGPFRNAVLDGVLDPTRTIQIGIRGAAEYLWEFSYEAGMTV
IHAEDIARMGIDAITDKARAIVGDGPTYLSFDVDSLDPAFAPGTGTPEIGGLTSREALAI
LHGLKGIDFVGGDVVEVAPQYDATTNTAHVAAQMLFEILSLIRFSPSLKL
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggcattcgaccacgagaaactgcagcaattgcgtcagaaattttccgaaggacatgga
ggcaacattcatgatccggaattccgtgccgtagcggacaagatcttttcggcaagcggc
acgcgtgctgcgccatttagcggcgtgccgaccctgctcgatgctccttatcggcagatt
gacgccgaaaatccagactttggcgatctcgacgtcgccttgattggggttccgatggat
ctcggcgtcaccaatcgcccaggttcgcgtttcggaccgcgggcgctgcgggcgatcgaa
cgggtcgggccttacaatcacgtcctgaaatgcgctcccctctttgaagcgaaggtcgcc
gatatcggcgatgtgccgtttcgcagccgctatcggctggaacttagtcacgaggatatc
gagcgccgcttccgacagatcgtcagcgccggcgtcctaccgcttgctgtcggcggagac
cattcgattacacatcccatcctgaaggccgtcggcgagaagcgcccggtcgggctgatc
catatcgacgcccattgcgataccggaggagcctacgacctgacgaagttccatcacgga
gggccgtttaggaatgcggtcctggatggggttctcgatcccacgcgcaccattcagatc
ggtattcgtggtgctgcggaatatctgtgggagttctcgtatgaagccggcatgaccgtc
atccatgccgaagatattgcccgcatgggtatcgatgccatcaccgacaaagcgcgtgcg
atcgtaggagacggcccaacctatctctccttcgacgtcgacagcctcgatcccgctttt
gcccccggcacgggtacgcctgaaatcggcgggctgaccagccgagaggcgctggcaatc
ctccacggattgaagggcatcgatttcgtcgggggtgatgtggtggaagtcgctccgcaa
tatgacgccaccacgaatacagcccacgtggcggctcagatgctcttcgagattctcagc
ctcatccgcttcagcccgtctttgaagctctag

DBGET integrated database retrieval system