KEGG   Rhizobium etli CIAT 652: RHECIAT_PC0000788Help
Entry
RHECIAT_PC0000788 CDS       T00720                                 

Definition
putative glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
rec  Rhizobium etli CIAT 652
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rec00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RHECIAT_PC0000788
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    RHECIAT_PC0000788
Enzymes [BR:rec01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     RHECIAT_PC0000788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pC:845957..846958
Genome map
AA seq 333 aa AA seqDB search
MSFTINQDAHAVLLPAFASLDFDEVMVPFLENGGWSILIGETRAEYVARSMSDERLRSET
AEFFAARLKKLTKLRPELIVAVDQELAGIERLKGIVPELPRLDEALAMDRKELENRCFEM
AVAARALGVALFLAPVADVVTGTNPWLEKRTMSSDPIEVARLVQAFVTGVQRAGIASATK
HFPGFNDLAGDPAVEDVALETPLDEILANAATFRAAIHAGSKAVMVGPTVVRSIDPTEPA
CTSPAIISLLRKEFGFSGLIVSDDLDAPATMRDRSLAETAIASLVAGADLLLVAGSANLE
NLSSAIVDAVERGTLPATRLAEAADRIRRMAAT
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
gtgagttttactataaatcaggatgctcatgctgtcctgctgccagcattcgccagcctc
gacttcgacgaggtgatggtgccgttccttgaaaacgggggctggtccatcctgattgga
gaaacgcgggcggaatatgtcgccagatcgatgtccgacgaacgtctgcgatccgagacg
gctgaatttttcgcggcacgtcttaagaagctgacgaagcttcggcctgagctgattgta
gccgtcgatcaggagttggctggtatcgagcgtctcaagggcatcgtcccggagctgccg
cgtctcgatgaggcccttgcgatggacagaaaggagctcgaaaatcgctgctttgagatg
gctgtcgccgcccgagcgcttggtgtcgcactctttctcgctccggtagccgatgtcgtc
accggcacgaacccgtggcttgaaaagcggacgatgagttccgaccctattgaggtcgcg
cgtctggtgcaggcctttgtcacgggggtccaacgcgcgggaattgcttcggcgaccaag
cattttccaggctttaacgatctcgcgggagatccggctgttgaggacgttgctcttgaa
acgccgcttgacgaaatcttggctaacgcggccacgttcagggcagcaattcacgccggc
tcaaaggcggtcatggtcggaccgacggttgttcgctcgatcgatccaaccgagcccgcc
tgcacgtctccggcgatcatctctttgctacgaaaagagttcggtttttcaggtctgatc
gtcagcgacgacctcgacgctcctgcaaccatgcgcgatcgctcgctcgcggaaacggca
atcgcatcattggtcgcaggcgccgatcttttgctcgttgcaggcagcgccaatcttgaa
aatctttcctcagcgatagtcgatgctgtcgaacgcggcacgctcccagcgacgcgactg
gcggaagccgcggatcgaatacgcaggatggcagccacatga

DBGET integrated database retrieval system