KEGG   Rhizobium etli CIAT 652: RHECIAT_PC0000806Help
Entry
RHECIAT_PC0000806 CDS       T00720                                 

Definition
putative 1-aminocyclopropane-1-carboxylate deaminase (EC:3.5.99.7)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
rec  Rhizobium etli CIAT 652
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:rec00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    RHECIAT_PC0000806
Enzymes [BR:rec01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     RHECIAT_PC0000806
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pC:complement(868660..869691)
Genome map
AA seq 343 aa AA seqDB search
MSALETLGRVPRLDLRGFVSPVQRLERFSEAIGVEVWCKRDDIGSVGLAGNKVRKLEVEL
AHAVACGATHLVAEGSRLSNATRAVAAASAALGLKCTLLLCHDEPHEPVGNLMLDGLFGA
DLRFVGDVSWTDLARHSVSVVSELEQSGERVYRLPIGCASERSCLGFALAYGELCQQMRE
HGRNVGTIVHASSSGGTHAGLVLGNALHGFETDIRGIVVAEDVYPDVVGTYLSFARGGAR
LIDAEVELTRDHINVTQAYVGEGYGLPADGIYEAIDLLATKEGLLVDPVYSGKTIAAIID
LAAKGELNGPVVFWHTGGYHALFDPRYAKRIWSALDRLAGIVL
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctctcgaaactcttggacgcgtgccgcgtctcgatctgcgtgggtttgtttcg
ccggtacagcgtctcgaacgcttcagtgaggcgatcggagtcgaagtctggtgcaagcgg
gacgacatcggctctgtcggtctcgcgggcaacaaggtccgcaagctggaggtcgaactg
gctcatgccgtcgcttgcggtgcaacgcacctagtcgcggaaggctctcgcctttcaaac
gcgacgcgcgcggtggccgctgccagcgctgctctcggactgaaatgcacactgctccta
tgtcatgacgagccgcacgaacctgtcggcaatctgatgcttgatggtcttttcggcgcc
gatcttcgatttgtgggcgatgtgagctggacggatctagctcgacattcagtgtccgtc
gtcagtgagctcgaacaatccggagaacgcgtttatcgacttcccatcggatgtgcttct
gaacgcagttgcttggggtttgccctggcatatggtgaactttgccagcaaatgcgcgag
cacggacgcaatgtcgggacaatcgtccatgcaagctcgtcgggcggaacccatgcgggg
ctcgtcctcgggaatgcgctccacggttttgagaccgacattcgtggcattgtcgtcgcg
gaggacgtctatcctgacgtagttggcacatatctttccttcgcacgcggcggcgcacgc
cttatcgatgcagaagtcgaattgacgcgagatcatatcaacgtcacgcaagcatatgtt
ggtgagggatatggactgcccgctgacggcatatatgaggcgatcgatttgctcgcgacg
aaagagggcttgctggtcgatcctgtctatagcgggaagacgatcgcggcgatcatcgat
cttgccgcgaagggtgagctaaacggccctgttgtcttctggcatacaggcgggtatcac
gcgctcttcgaccctcgctatgcaaagcgaatctggtcggcacttgaccgccttgcaggc
atcgtgctgtga

DBGET integrated database retrieval system