KEGG   Rhizobium etli CIAT 652: RHECIAT_PC0000966Help
Entry
RHECIAT_PC0000966 CDS       T00720                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rec  Rhizobium etli CIAT 652
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:rec01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:rec01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rec00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:rec00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:rec00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pC:1066040..1066843
Genome map
AA seq 267 aa AA seqDB search
MVVWVGTSFKMNKTLEEALAFARRLADVDLERDPHVQRFVIPSFTAVREVKRVLSETSVK
VGAQNMHWEDAGAWTGEVSPLMLKDCRLDLVELGHSERREHFGETDETVGLKVAAAIRHG
LTPLVCIGETLQERNEGRADAVLRRQVEAALRGVDTEAGEAPILLAYEPVWAIGVNGIPA
TADYASERHGKIAEVAKSILGRPVPVLYGGSVNPGNCEELIGQPDIDGLFIGRSAWSVEG
YLDILGRVSAAIDRSSPRQTASERKLP
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggtcgtctgggtcggcaccagcttcaagatgaacaagacgcttgaggaagcgctcgcc
ttcgcgcgccgcctcgccgatgtggatcttgaacgcgatccccacgtacagcgcttcgtc
atcccctccttcacggcggtgcgcgaggtcaagcgcgtgctttccgagacctcggtgaag
gtcggcgcccagaacatgcattgggaggatgccggcgcctggaccggcgaagtttcgccc
ctgatgctgaaggattgccggctcgatctcgtcgagctcggccattccgaacggcgcgaa
catttcggcgagaccgacgaaaccgtcggcctcaaggttgccgccgcgatccgccacggc
ctgacgccgctggtctgcatcggcgagaccctgcaggagcgcaacgagggccgggccgac
gccgtgctgcggcggcaggtcgaggccgccctgcggggcgtcgacaccgaggccggcgag
gctccgatcctgcttgcctacgagccggtctgggcaatcggcgtcaacggcattccggcg
acggccgattatgcctccgagcggcacggcaagatcgccgaagtggcgaaatccattctc
ggccgtccggtgcctgttctctacggcggcagcgtcaatcccggcaattgcgaggaactg
atcggccagcccgatatcgacggcctgttcatcggccgctccgcctggtccgtcgaaggc
tatctcgacattctcggccgcgtcagcgcggcgatcgaccgctcatccccacgccagacg
gcgagtgaaaggaaactgccatga

DBGET integrated database retrieval system