KEGG   Rhizobium etli CIAT 652: RHECIAT_PC0000966Help
Entry
RHECIAT_PC0000966 CDS       T00720                                 

Gene name
tpiAc
Definition
(GenBank) triosephosphate isomerase protein
  KO
K21910  
L-erythrulose 1-phosphate isomerase [EC:5.3.1.33]
Organism
rec  Rhizobium etli CIAT 652
Brite
Enzymes [BR:rec01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.33  L-erythrulose 1-phosphate isomerase
     RHECIAT_PC0000966 (tpiAc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
pC:1066040..1066843
Genome map
AA seq 267 aa AA seqDB search
MVVWVGTSFKMNKTLEEALAFARRLADVDLERDPHVQRFVIPSFTAVREVKRVLSETSVK
VGAQNMHWEDAGAWTGEVSPLMLKDCRLDLVELGHSERREHFGETDETVGLKVAAAIRHG
LTPLVCIGETLQERNEGRADAVLRRQVEAALRGVDTEAGEAPILLAYEPVWAIGVNGIPA
TADYASERHGKIAEVAKSILGRPVPVLYGGSVNPGNCEELIGQPDIDGLFIGRSAWSVEG
YLDILGRVSAAIDRSSPRQTASERKLP
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggtcgtctgggtcggcaccagcttcaagatgaacaagacgcttgaggaagcgctcgcc
ttcgcgcgccgcctcgccgatgtggatcttgaacgcgatccccacgtacagcgcttcgtc
atcccctccttcacggcggtgcgcgaggtcaagcgcgtgctttccgagacctcggtgaag
gtcggcgcccagaacatgcattgggaggatgccggcgcctggaccggcgaagtttcgccc
ctgatgctgaaggattgccggctcgatctcgtcgagctcggccattccgaacggcgcgaa
catttcggcgagaccgacgaaaccgtcggcctcaaggttgccgccgcgatccgccacggc
ctgacgccgctggtctgcatcggcgagaccctgcaggagcgcaacgagggccgggccgac
gccgtgctgcggcggcaggtcgaggccgccctgcggggcgtcgacaccgaggccggcgag
gctccgatcctgcttgcctacgagccggtctgggcaatcggcgtcaacggcattccggcg
acggccgattatgcctccgagcggcacggcaagatcgccgaagtggcgaaatccattctc
ggccgtccggtgcctgttctctacggcggcagcgtcaatcccggcaattgcgaggaactg
atcggccagcccgatatcgacggcctgttcatcggccgctccgcctggtccgtcgaaggc
tatctcgacattctcggccgcgtcagcgcggcgatcgaccgctcatccccacgccagacg
gcgagtgaaaggaaactgccatga

DBGET integrated database retrieval system