KEGG   Roseibacterium elongatum: roselon_00994Help
Entry
roselon_00994     CDS       T03060                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase / Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
red  Roseibacterium elongatum
Pathway
red00071  Fatty acid degradation
red00072  Synthesis and degradation of ketone bodies
red00280  Valine, leucine and isoleucine degradation
red00310  Lysine degradation
red00362  Benzoate degradation
red00380  Tryptophan metabolism
red00620  Pyruvate metabolism
red00630  Glyoxylate and dicarboxylate metabolism
red00640  Propanoate metabolism
red00650  Butanoate metabolism
red00900  Terpenoid backbone biosynthesis
red01100  Metabolic pathways
red01110  Biosynthesis of secondary metabolites
red01120  Microbial metabolism in diverse environments
red01130  Biosynthesis of antibiotics
red01200  Carbon metabolism
red01212  Fatty acid metabolism
red02020  Two-component system
Brite
KEGG Orthology (KO) [BR:red00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    roselon_00994
   00630 Glyoxylate and dicarboxylate metabolism
    roselon_00994
   00640 Propanoate metabolism
    roselon_00994
   00650 Butanoate metabolism
    roselon_00994
  Lipid metabolism
   00071 Fatty acid degradation
    roselon_00994
   00072 Synthesis and degradation of ketone bodies
    roselon_00994
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    roselon_00994
   00310 Lysine degradation
    roselon_00994
   00380 Tryptophan metabolism
    roselon_00994
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    roselon_00994
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    roselon_00994
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    roselon_00994
Enzymes [BR:red01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     roselon_00994
Exosome [BR:red04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   roselon_00994
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHM03394
UniProt: W8RQG0
Position
complement(976829..978007)
Genome map
AA seq 392 aa AA seqDB search
MDDIVILSGARTAIGTFGGSLAGVAPIDLGATAAKAALERAGVEGGQIGHVAYGHVINTE
PRDMYLSRVAAMQAGIPDTTPAMNVNRLCGSGAQAIVSVIQSLAMGDAAFGLAGGAESMS
RAPYIIPAARWGQKMGDVGTRDMMLGALNCPFGTGHMGVTAENVAKEHDISREAQDAFAL
ESQTRAARAIEEGRFKAQIVPVEVKVKRDLVPFDTDEHPKATTAEALAGLRTVFQKDGTV
TAGNASGINDGAAALVLARAEAAEKAGLTPRARVLGYAHAGVRPEVMGIGPVPAVENLLA
KTGLSVADFDVIESNEAFAAQALAVNKGLGLDPARVNPNGGAIALGHPVGATGAIIAVKA
LYELERIGGSKALITMCIGGGQGIALAIERVG
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggacgatatcgtgatcctgtcgggcgcgcgcaccgcgatcggcacctttggcggatcg
ctcgccggtgtggcgccgatagacctgggcgcgacggcggccaaggcggcgctggagcgg
gccggggtcgaaggcggtcagatcggccatgtcgcctatgggcatgtgatcaataccgaa
ccgcgcgacatgtatctcagccgcgtcgccgcgatgcaggccggtatccccgacacgacg
cccgcgatgaacgtcaaccgactgtgcgggtcgggcgcgcaggccatcgtgtcggtgatc
cagtcgctggcgatgggcgatgccgcgttcggccttgccgggggggccgaaagcatgagc
cgggcgccctacatcattccggcggcccgctgggggcagaagatgggcgatgtcggcacc
cgcgacatgatgctcggcgcgcttaactgtccctttggaaccggccatatgggtgtgacg
gcggaaaacgtcgccaaagagcatgacatcagccgcgaggcacaggatgcctttgccttg
gaaagccagacgcgcgccgccagggccatcgaggagggccgtttcaaggcgcagatcgtc
cccgtcgaggtgaaggtgaagcgcgatctcgtgccttttgataccgacgaacaccccaag
gccaccacggccgaggccttggccggcctgcgcaccgtgttccaaaaggacggcacggta
accgccggcaatgcctcgggcatcaatgacggtgccgcggcgctggtgctggcccgtgcc
gaggccgccgaaaaggccggcctgacgccacgtgcccgtgttctgggctatgcccatgcc
ggggtgcggcccgaggtgatggggatcggcccggtccccgcggtcgagaacctgctggcg
aaaaccggcctgtcggtcgccgatttcgacgtgatcgagtcgaacgaggcctttgccgcg
caggccttggcggtgaacaagggcctcgggctggacccggcccgcgtgaaccccaatggc
ggggccatcgcgctgggccatccggtcggggcgaccggcgcgatcatcgccgtcaaggcg
ctctacgagttggagcggatcggcgggagcaaggcgctgatcaccatgtgtatcggcggc
ggccagggcattgcgctggccatcgagcgggtgggctga

DBGET integrated database retrieval system