KEGG   Roseibacterium elongatum: roselon_03164Help
Entry
roselon_03164     CDS       T03060                                 

Definition
Phosphoenolpyruvate carboxylase (EC:4.1.1.31)
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
red  Roseibacterium elongatum
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:red00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    roselon_03164
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    roselon_03164
  Energy metabolism
   00680 Methane metabolism
    roselon_03164
Enzymes [BR:red01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     roselon_03164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(3028773..3031538)
Genome map
AA seq 921 aa AA seqDB search
MTDLDLTAINRQQKTDETLRFLMRCFGDVLDGLGARDSAAALPWQALWDGPGQGQGVPDL
TSEDLRAYVIALQLLAQSEENAIAQTRRADEARGGLDQDAGSWDQHFARLKAAGHDGPSL
ARALAKIRVEPVLTAHPTEAKRRTVLAHHRALYRLLVERENTMWTDAERSDLRTAACTEI
ERLWRTGHVHLEKPTVADERASILYYLSTALPETLPWINHRLGAAWHRAGFDPDLRAERR
GRPQLRFGDWVGGDRDGHPLVDAATTQDTLTLFRAEALALHERQLAALAERLSLSEHRFA
PPDALFAWIDRRAAALGEAGAAAVARNPGEPYRQAVNLIAAALPPAEGEIGPGRYTEARA
YHAELLHLRRWLIEAGAGRLAEADLDPLLDLAECFGFHLATLDIRQNSAYHDRAMAELLQ
GSAGPEGAAFPSWPAARRADLMRRELATPRPFVAPGTSVGPVADDMLALYRVLARHVGRH
GTAGLGALIVSMTRGAEDLWAVYLFAREAGLLQHGPDGPWLPLPVVPLLETIDDLERCEE
VLEAFLDCDVVWRSLMTQAERSGEDLPVQQVMIGYSDSGKDGGVVASFWALYRAQTRLVA
LGRRRGVRIRFFHGRGGAIGRGAGPTHRFLSALPPGAAGGDLRMTEQGETIAQKYANRVT
AAHHLELLMAGTLGATLHPRTDPPELLAAMDFLAETSFAAWRALVEAEGFLEFFAEATPI
DVIEQSRHGSRPARRTGKRSLTDLRAIPWVFAWNQARFLLPGWYGLGTALERLQTEAPDQ
FAALVNAKAEATRWPPIHFLVSNAATALARADTAQMQAYAGLVQDREVAERFLSRILAEH
ARTGAMLGTIYGAPLAEIRPEVQQGLDRRHAALVPLHAKQRKLLMQWRAAQTAGDEKAAG
DQVHDLLLTVNAIAAGIGATG
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaccttgatctgaccgccatcaaccgccagcagaaaaccgacgagacgctacgc
ttcctgatgcgctgtttcggcgatgtcctggacgggctcggggcccgggacagtgccgcg
gcgctgccctggcaggccctgtgggacggtccggggcaggggcagggggtgcccgatctg
acctcggaagatttgcgcgcctatgtgattgccttgcagcttctggctcagtccgaggaa
aacgccatcgcgcaaacgcgtcgggccgacgaggcccgaggtggtctggaccaagatgcc
ggctcatgggaccagcatttcgccaggctgaaggcggccggccatgatggcccctcgctg
gcacgggcgctggccaagatccgggtcgagccggtcctgaccgcacatcccaccgaagcc
aagcggcgcaccgtgcttgcgcatcacagggcgctttaccggctgctggtcgagcgcgag
aacaccatgtggaccgacgcagagcgcagcgatctgcgcaccgccgcctgcaccgagatc
gagcggctgtggcgcaccgggcatgtccatctcgaaaagccgaccgttgccgatgaacgc
gccagcatcctgtactatctgtccacggcgcttcccgaaacgctgccatggatcaaccac
cggcttggcgctgcgtggcaccgggccgggttcgatcccgatctgcgcgccgagcgtcgc
gggcggccccagctccgctttggcgattgggtcggtggcgaccgcgatggccatccgctg
gtcgacgccgccacgacacaagacacgctgaccctgtttcgtgccgaagcgctggccctg
catgaaagacagcttgcggctctggccgagcgtctgagcctgtcggaacaccgctttgcg
ccgccggacgcactctttgcctggatcgaccggcgggccgccgcgttgggagaggccggc
gcggcggcggttgcgcgcaatcccggcgagccctaccgccaggcggtgaacctgattgcc
gccgcgctgcccccggccgagggtgagatcgggcccgggcgctataccgaggcacgggcc
tatcacgccgagttgctgcacctacgccgctggctgatcgaggccggggccggacgcctg
gccgaggccgatctcgacccgcttctcgatctggcggaatgcttcgggtttcatctggca
acgctcgatatccggcagaacagcgcctatcacgaccgcgcgatggccgagctgctgcaa
ggctccgccggccctgagggggccgcgttcccctcctggccagccgcgcggcgcgccgac
ctgatgcgccgggaattggcgacgccgcggcccttcgttgcgcccggcacctcggtcggg
cccgtggccgacgacatgctggccctctaccgggtactggcccggcatgtgggccgccat
ggcaccgcggggcttggggcgctgatcgtgagcatgacccgaggggccgaagacctctgg
gccgtctacctctttgcgcgtgaggcgggtttgctccaacacgggcccgacgggccctgg
ctgccgctgcccgtcgtgccgctgctggaaaccatcgacgatctggagcgctgcgaagag
gtgctggaggcgtttctcgattgcgacgtggtctggcggtcgctgatgacccaggccgag
cgctcgggcgaagacctgcccgtgcagcaggtcatgatcggctatagcgatagcggcaag
gatggcggcgtggtggccagcttctgggcgctgtaccgggcgcaaacccggctcgtggcg
ctcgggcgtcggcgtggcgtccgcatccgctttttccatggccgcggcggtgcgatcggg
cgcggggcggggccgacgcatcgctttctcagcgcgctgccccccggcgcggcgggcggc
gacctgcgcatgaccgaacagggcgagaccatcgcgcagaaatacgccaaccgcgtgacc
gccgcccaccatctcgaattgctgatggccggaaccctgggcgccaccttgcacccccgc
accgacccgcccgagcttttggcggcgatggatttcctcgccgagaccagcttcgccgca
tggcgcgccctggtggaggccgaggggtttctggagttcttcgccgaagccacgcccatc
gatgtcatcgagcagagccggcacggctcgcgacctgcgcggcggaccggcaaacgcagc
ctgaccgacctgcgggccattccctgggtctttgcctggaatcaggcgcggttcctgctg
cccggctggtatggtcttggcacggcattggaacgcctgcagaccgaggcgcccgaccag
ttcgccgcgcttgtcaacgccaaggccgaggcgacacgctggcccccgatccatttcctc
gtatcgaatgcggcgaccgcgctggcccgcgcggatacggcccagatgcaggcctatgcc
gggctggttcaggatcgggaggtggcagagcggttcttgtcgcggatcctcgccgaacac
gcccgcacgggcgcgatgcttggcacgatttacggcgctccgctggccgagatccggccc
gaggtccagcagggcctcgaccggcgccatgctgccctggtccccttgcatgccaagcaa
cgcaagctcctcatgcagtggcgcgccgcacagaccgccggcgacgaaaaggccgccggc
gaccaggtccatgacctgctcctgaccgtgaacgccatcgcggccggtatcggggcgaca
gggtaa

DBGET integrated database retrieval system