KEGG   Roseibacterium elongatum: roselon_03164Help
Entry
roselon_03164     CDS       T03060                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
red  Roseibacterium elongatum
Pathway
red00620  Pyruvate metabolism
red00680  Methane metabolism
red01100  Metabolic pathways
red01120  Microbial metabolism in diverse environments
red01200  Carbon metabolism
Module
red_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:red00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    roselon_03164
  Energy metabolism
   00680 Methane metabolism
    roselon_03164
Enzymes [BR:red01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     roselon_03164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AHM05429
UniProt: W8RW88
Position
complement(3028773..3031538)
Genome map
AA seq 921 aa AA seqDB search
MTDLDLTAINRQQKTDETLRFLMRCFGDVLDGLGARDSAAALPWQALWDGPGQGQGVPDL
TSEDLRAYVIALQLLAQSEENAIAQTRRADEARGGLDQDAGSWDQHFARLKAAGHDGPSL
ARALAKIRVEPVLTAHPTEAKRRTVLAHHRALYRLLVERENTMWTDAERSDLRTAACTEI
ERLWRTGHVHLEKPTVADERASILYYLSTALPETLPWINHRLGAAWHRAGFDPDLRAERR
GRPQLRFGDWVGGDRDGHPLVDAATTQDTLTLFRAEALALHERQLAALAERLSLSEHRFA
PPDALFAWIDRRAAALGEAGAAAVARNPGEPYRQAVNLIAAALPPAEGEIGPGRYTEARA
YHAELLHLRRWLIEAGAGRLAEADLDPLLDLAECFGFHLATLDIRQNSAYHDRAMAELLQ
GSAGPEGAAFPSWPAARRADLMRRELATPRPFVAPGTSVGPVADDMLALYRVLARHVGRH
GTAGLGALIVSMTRGAEDLWAVYLFAREAGLLQHGPDGPWLPLPVVPLLETIDDLERCEE
VLEAFLDCDVVWRSLMTQAERSGEDLPVQQVMIGYSDSGKDGGVVASFWALYRAQTRLVA
LGRRRGVRIRFFHGRGGAIGRGAGPTHRFLSALPPGAAGGDLRMTEQGETIAQKYANRVT
AAHHLELLMAGTLGATLHPRTDPPELLAAMDFLAETSFAAWRALVEAEGFLEFFAEATPI
DVIEQSRHGSRPARRTGKRSLTDLRAIPWVFAWNQARFLLPGWYGLGTALERLQTEAPDQ
FAALVNAKAEATRWPPIHFLVSNAATALARADTAQMQAYAGLVQDREVAERFLSRILAEH
ARTGAMLGTIYGAPLAEIRPEVQQGLDRRHAALVPLHAKQRKLLMQWRAAQTAGDEKAAG
DQVHDLLLTVNAIAAGIGATG
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaccttgatctgaccgccatcaaccgccagcagaaaaccgacgagacgctacgc
ttcctgatgcgctgtttcggcgatgtcctggacgggctcggggcccgggacagtgccgcg
gcgctgccctggcaggccctgtgggacggtccggggcaggggcagggggtgcccgatctg
acctcggaagatttgcgcgcctatgtgattgccttgcagcttctggctcagtccgaggaa
aacgccatcgcgcaaacgcgtcgggccgacgaggcccgaggtggtctggaccaagatgcc
ggctcatgggaccagcatttcgccaggctgaaggcggccggccatgatggcccctcgctg
gcacgggcgctggccaagatccgggtcgagccggtcctgaccgcacatcccaccgaagcc
aagcggcgcaccgtgcttgcgcatcacagggcgctttaccggctgctggtcgagcgcgag
aacaccatgtggaccgacgcagagcgcagcgatctgcgcaccgccgcctgcaccgagatc
gagcggctgtggcgcaccgggcatgtccatctcgaaaagccgaccgttgccgatgaacgc
gccagcatcctgtactatctgtccacggcgcttcccgaaacgctgccatggatcaaccac
cggcttggcgctgcgtggcaccgggccgggttcgatcccgatctgcgcgccgagcgtcgc
gggcggccccagctccgctttggcgattgggtcggtggcgaccgcgatggccatccgctg
gtcgacgccgccacgacacaagacacgctgaccctgtttcgtgccgaagcgctggccctg
catgaaagacagcttgcggctctggccgagcgtctgagcctgtcggaacaccgctttgcg
ccgccggacgcactctttgcctggatcgaccggcgggccgccgcgttgggagaggccggc
gcggcggcggttgcgcgcaatcccggcgagccctaccgccaggcggtgaacctgattgcc
gccgcgctgcccccggccgagggtgagatcgggcccgggcgctataccgaggcacgggcc
tatcacgccgagttgctgcacctacgccgctggctgatcgaggccggggccggacgcctg
gccgaggccgatctcgacccgcttctcgatctggcggaatgcttcgggtttcatctggca
acgctcgatatccggcagaacagcgcctatcacgaccgcgcgatggccgagctgctgcaa
ggctccgccggccctgagggggccgcgttcccctcctggccagccgcgcggcgcgccgac
ctgatgcgccgggaattggcgacgccgcggcccttcgttgcgcccggcacctcggtcggg
cccgtggccgacgacatgctggccctctaccgggtactggcccggcatgtgggccgccat
ggcaccgcggggcttggggcgctgatcgtgagcatgacccgaggggccgaagacctctgg
gccgtctacctctttgcgcgtgaggcgggtttgctccaacacgggcccgacgggccctgg
ctgccgctgcccgtcgtgccgctgctggaaaccatcgacgatctggagcgctgcgaagag
gtgctggaggcgtttctcgattgcgacgtggtctggcggtcgctgatgacccaggccgag
cgctcgggcgaagacctgcccgtgcagcaggtcatgatcggctatagcgatagcggcaag
gatggcggcgtggtggccagcttctgggcgctgtaccgggcgcaaacccggctcgtggcg
ctcgggcgtcggcgtggcgtccgcatccgctttttccatggccgcggcggtgcgatcggg
cgcggggcggggccgacgcatcgctttctcagcgcgctgccccccggcgcggcgggcggc
gacctgcgcatgaccgaacagggcgagaccatcgcgcagaaatacgccaaccgcgtgacc
gccgcccaccatctcgaattgctgatggccggaaccctgggcgccaccttgcacccccgc
accgacccgcccgagcttttggcggcgatggatttcctcgccgagaccagcttcgccgca
tggcgcgccctggtggaggccgaggggtttctggagttcttcgccgaagccacgcccatc
gatgtcatcgagcagagccggcacggctcgcgacctgcgcggcggaccggcaaacgcagc
ctgaccgacctgcgggccattccctgggtctttgcctggaatcaggcgcggttcctgctg
cccggctggtatggtcttggcacggcattggaacgcctgcagaccgaggcgcccgaccag
ttcgccgcgcttgtcaacgccaaggccgaggcgacacgctggcccccgatccatttcctc
gtatcgaatgcggcgaccgcgctggcccgcgcggatacggcccagatgcaggcctatgcc
gggctggttcaggatcgggaggtggcagagcggttcttgtcgcggatcctcgccgaacac
gcccgcacgggcgcgatgcttggcacgatttacggcgctccgctggccgagatccggccc
gaggtccagcagggcctcgaccggcgccatgctgccctggtccccttgcatgccaagcaa
cgcaagctcctcatgcagtggcgcgccgcacagaccgccggcgacgaaaaggccgccggc
gaccaggtccatgacctgctcctgaccgtgaacgccatcgcggccggtatcggggcgaca
gggtaa

DBGET integrated database retrieval system