GenomeNet

Database: RefSeq
Entry: NC_004916
LinkDB: NC_004916
Original site: NC_004916 
LOCUS       NC_004916             384502 bp    DNA     linear   CON 18-JUN-2017
DEFINITION  Leishmania major strain Friedlin complete genome, chromosome 3.
ACCESSION   NC_004916 AC125735
VERSION     NC_004916.2
DBLINK      BioProject: PRJNA15564
            BioSample: SAMEA3138173
            Assembly: GCF_000002725.2
KEYWORDS    RefSeq; complete genome.
SOURCE      Leishmania major strain Friedlin
  ORGANISM  Leishmania major strain Friedlin
            Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae;
            Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Rogers,M.B., Hilley,J.D., Dickens,N.J., Wilkes,J., Bates,P.A.,
            Depledge,D.P., Harris,D., Her,Y., Herzyk,P., Imamura,H., Otto,T.D.,
            Sanders,M., Seeger,K., Dujardin,J.C., Berriman,M., Smith,D.F.,
            Hertz-Fowler,C. and Mottram,J.C.
  TITLE     Chromosome and gene copy number variation allow major structural
            change between species and strains of Leishmania
  JOURNAL   Genome Res. 21 (12), 2129-2142 (2011)
   PUBMED   22038252
REFERENCE   2
  AUTHORS   Ivens,A.C., Peacock,C.S., Worthey,E.A., Murphy,L., Aggarwal,G.,
            Berriman,M., Sisk,E., Rajandream,M.A., Adlem,E., Aert,R.,
            Anupama,A., Apostolou,Z., Attipoe,P., Bason,N., Bauser,C., Beck,A.,
            Beverley,S.M., Bianchettin,G., Borzym,K., Bothe,G., Bruschi,C.V.,
            Collins,M., Cadag,E., Ciarloni,L., Clayton,C., Coulson,R.M.,
            Cronin,A., Cruz,A.K., Davies,R.M., De Gaudenzi,J., Dobson,D.E.,
            Duesterhoeft,A., Fazelina,G., Fosker,N., Frasch,A.C., Fraser,A.,
            Fuchs,M., Gabel,C., Goble,A., Goffeau,A., Harris,D.,
            Hertz-Fowler,C., Hilbert,H., Horn,D., Huang,Y., Klages,S.,
            Knights,A., Kube,M., Larke,N., Litvin,L., Lord,A., Louie,T.,
            Marra,M., Masuy,D., Matthews,K., Michaeli,S., Mottram,J.C.,
            Muller-Auer,S., Munden,H., Nelson,S., Norbertczak,H., Oliver,K.,
            O'neil,S., Pentony,M., Pohl,T.M., Price,C., Purnelle,B.,
            Quail,M.A., Rabbinowitsch,E., Reinhardt,R., Rieger,M., Rinta,J.,
            Robben,J., Robertson,L., Ruiz,J.C., Rutter,S., Saunders,D.,
            Schafer,M., Schein,J., Schwartz,D.C., Seeger,K., Seyler,A.,
            Sharp,S., Shin,H., Sivam,D., Squares,R., Squares,S., Tosato,V.,
            Vogt,C., Volckaert,G., Wambutt,R., Warren,T., Wedler,H.,
            Woodward,J., Zhou,S., Zimmermann,W., Smith,D.F., Blackwell,J.M.,
            Stuart,K.D., Barrell,B. and Myler,P.J.
  TITLE     The genome of the kinetoplastid parasite, Leishmania major
  JOURNAL   Science 309 (5733), 436-442 (2005)
   PUBMED   16020728
REFERENCE   3  (bases 1 to 384502)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 384502)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire, CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR796399.
            On Jun 1, 2012 this sequence version replaced NC_004916.1.
            Data release policy www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..384502
                     /organism="Leishmania major strain Friedlin"
                     /mol_type="genomic DNA"
                     /strain="Friedlin"
                     /db_xref="taxon:347515"
                     /chromosome="3"
     gene            complement(<1165..>4176)
                     /locus_tag="LMJF_03_0010"
                     /db_xref="GeneID:12981546"
     mRNA            complement(<1165..>4176)
                     /locus_tag="LMJF_03_0010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721632.1"
                     /db_xref="GeneID:12981546"
     CDS             complement(1165..4176)
                     /locus_tag="LMJF_03_0010"
                     /note="previous protein_id=AAM68971.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721680.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981546"
                     /db_xref="GOA:E9ACE9"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:E9ACE9"
                     /translation="MAASHCSVALGLTVLISHLFSPSLLSMADPSSSLSPVTRSGINL
                     DDRYTCCVCTSPMIPAVRNNHCDHYICLRCSFMCESRCPLCRADAEWATDSDLSCTIA
                     NELRDALVAESLNRLRSILGSTSRATVRDIIAGHLDPTRFTVDLSSVCEDLQRIQRYE
                     ATVGSTKAEEDADEDYVFYCHSHLQLNALQSRRHTRILFCTAPSFSDPTSISAFHRLR
                     VLHLQGCRQLRSLPPLSDARDLRVLVVYRCGIRSVGGLGDCPQVETVVFCECAELADV
                     TGLTRLANATSLSLIDCSKVLDVSPLSSATKLQHVSLKGTSISNIAGFSGSAATLHVI
                     SAQGCTQLTSIDPLSAMRKLRQVRLAGTGVVDLSPLQASMATITLLDVERCTELQSIQ
                     CLSAAASLRELYCGGTKVKDVTPLKLIAPILTVVHLENCYDLENIAALSQASGLRDID
                     LSHTKVHNIDALQASADTLEVLLVGHCTALRDLSPIATASRLRRVDVQSTGVQSLEFL
                     RASACTLEVVCADNCPLSDISPLRGATKLREVRLARTTVDSLDDLRASAPSLQCLFLG
                     GCTRIGDISLLMHATQLREVYLTNTGISNIEALQPSAANLEVLAIGGCGRISDIAPLL
                     VATKLRLVYLWGTNISNIHGIRFSVPSLEVLDIGGCSRVSEISSLLNASKLREVRLHN
                     TAIQSIEALRPSAGCLEWVELVGCTHISDISPLSTAKKLREVYLTNTAVSSIDPLRCS
                     APSLEVIALGNCAEVSDLSALAAATKLREAYLWGTKINSIKALKSSMASLTVLEVTRC
                     TKISDVSTLSGALRLRRVDLANTSITSIDALVPVASSLEFINVSGCMMIKDFGPLGAA
                     TSVKTVWMRKLRLDSLNVLRPVTGTLEKVDVSGCLNLRDISALDSATKLREVCLQNTS
                     IDSLDALKASASALTVVNANSCVNLTSIEALESATRLTEVRLSNTRISSLQPLCASAA
                     CVQIVDVSGCVNLRNTAALANAPSMRQLTHD"
     STS             5053..6581
                     /standard_name="ha2747"
                     /db_xref="UniSTS:515592"
     gene            <5472..>6278
                     /locus_tag="LMJF_03_0020"
                     /db_xref="GeneID:12983156"
     mRNA            <5472..>6278
                     /locus_tag="LMJF_03_0020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721633.1"
                     /db_xref="GeneID:12983156"
     CDS             5472..6278
                     /locus_tag="LMJF_03_0020"
                     /note="previous protein_id=AAP75891.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721681.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12983156"
                     /db_xref="UniProtKB/TrEMBL:E9ACF0"
                     /translation="MTTGAADKKHLVPLLEFLRFVSERGRSQRARFPKRINGVTDLKC
                     EPCDSGIEADWLPVKQGFNCEVAYSSSYDSSPSASRENAVSILRTEEWRKRSRSDDEI
                     SEVIVGSSAPIDCELDSMTTGKGCVTSKYFDFSLIDLGAVPMIEPAVEVLTKGVAKRM
                     HGKGCCYVLPGTSMVVTGDIVDVSLASETVLVSPDRGLRVGLEWVSIRRVFHVPKNIA
                     AVREEAAFRIQRIIQAERRGERTPRFSPVQLAEIAEDLSSSLSPDSDEDA"
     gene            <6700..>8235
                     /locus_tag="LMJF_03_0030"
                     /db_xref="GeneID:12983157"
     mRNA            <6700..>8235
                     /locus_tag="LMJF_03_0030"
                     /product="D-3-phosphoglycerate dehydrogenase-like protein"
                     /transcript_id="XM_003721634.1"
                     /db_xref="GeneID:12983157"
     CDS             6700..8235
                     /locus_tag="LMJF_03_0030"
                     /EC_number="1.1.1.95"
                     /note="previous protein_id=AAM68972.2"
                     /codon_start=1
                     /product="D-3-phosphoglycerate dehydrogenase-like protein"
                     /protein_id="XP_003721682.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12983157"
                     /db_xref="GOA:E9ACF1"
                     /db_xref="InterPro:IPR006139"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR029015"
                     /db_xref="InterPro:IPR029752"
                     /db_xref="InterPro:IPR029753"
                     /db_xref="UniProtKB/TrEMBL:E9ACF1"
                     /translation="MGIALCVIAVCAADKGLVDCRARGDVLFRNPVAIHSFASWRLLA
                     QSIFELWVYKVSAPLSCCTRNYIDCISYLDNKEYFPSDLHFASALACRISFAGVHKKI
                     TTMPSLIDPPYHALLLEGVNPIAKELLESKGCIVEYIPNALPRDTLLEKIRDVHFLGI
                     RSKTQVTQAILDAAPKLLGIGCFCIGTNQVDLDYATTRGVAVFNSPFANTRSVAELVI
                     GEIISLSRKMTQRSEEVHRGVWNKTHVGCYEVRGKTVGIVGYGHIGSQVGVLAEALGM
                     NVVFYDVLPTLAIGNATKFTHINDLLTFSDFVTIHVPETDVTKGMIGEEQIRLMKKGS
                     YLINASRGTVVDLEALAKALREGHLAGAAIDVYPEEPGSNKELHRTPLQGISNVILTP
                     HVGGSTCEAQEAIGVEVGTALAKFVTSGITAGAVNFPELVRPPVDRSKFRLTNVHANV
                     PGALNEINKVAVDLGCNMGMQFLSTSKAIGYLIMDVDKDVAVELRKRISALKYSIRTL
                     IIR"
     gene            <9000..>10307
                     /locus_tag="LMJF_03_0040"
                     /db_xref="GeneID:12983158"
     mRNA            <9000..>10307
                     /locus_tag="LMJF_03_0040"
                     /product="2-aminoethylphosphonate:pyruvateaminotransferas
                     e-like protein"
                     /transcript_id="XM_003721635.1"
                     /db_xref="GeneID:12983158"
     CDS             9000..10307
                     /locus_tag="LMJF_03_0040"
                     /note="previous protein_id=AAM68973.1"
                     /codon_start=1
                     /product="2-aminoethylphosphonate:pyruvateaminotransferas
                     e-like protein"
                     /protein_id="XP_003721683.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12983158"
                     /db_xref="GOA:E9ACF2"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="InterPro:IPR012703"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR024169"
                     /db_xref="UniProtKB/TrEMBL:E9ACF2"
                     /translation="MKMISFNVFRHVESPACCPPASFVADLSITSKKNTHKHLLSFFI
                     FPLFLESLSVMLPTQKPVLFTPGPLMTSDTVKEAMLTDYASRDIRFVQAVKFIREELI
                     SVAGLDPQKWACILQQGSGSMGIEAAISTIFPRTGGKFLLINSGKYSEKQACVVKRLQ
                     FPMVMLKMGEGEELKMSALESIIRANPDITTVGFVHHETSTGMLYPAEQIAEVVRREL
                     PKAKIIIDGISAFGGIPCDYEKACDVLVAAPNKCLHSVPGISIILARRLLIEAAKGCA
                     RSATLDLSMQLMSFDKSGQFAVTPPVHVVMALQQALVEYKRDGGLSGRQKTYQAKAQL
                     VREAVKAMGFTLFLGESKPSCANVVVCVNMPRDPRWNFKRFYTYLNERGLIIYPGKAS
                     HAETFRFGIIGHTSLANCERLMKCAKEALKSMGIDHLQRKSNM"
     gene            <13514..>14686
                     /locus_tag="LMJF_03_0060"
                     /db_xref="GeneID:12983159"
     mRNA            <13514..>14686
                     /locus_tag="LMJF_03_0060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721636.1"
                     /db_xref="GeneID:12983159"
     CDS             13514..14686
                     /locus_tag="LMJF_03_0060"
                     /note="previous protein_id=AAM68974.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721684.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12983159"
                     /db_xref="GOA:E9ACF3"
                     /db_xref="InterPro:IPR003402"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9ACF3"
                     /translation="MLPATLRLLLSVSVAALVLYYVRKHFSTPKGGAKKLKRGKEPAG
                     RKPFKGVAPQKIDIFTTNVCAAFPEMSVDAVRRLFPRKFEVHGHVVVIRLNDGTSVEE
                     LRPLARFFAESFAPVLVDVVLLDVDGIVGELRRPSLQILFQADTALTEYATSLRRTVQ
                     RRWGGARKRGQPSCMTSDAVESTLNRWTASPTFTAHVENGVIYSFDVSRVMFSSGNTT
                     ERIHFGTVTAADEVVVDMFCGIGYFTLPLAMHGNVAAIHALEKNPDSIDFVKLNAVLN
                     KVDHLIHPVCGDNREVGEELLGKCDRVLMGYIPTCKSFLPRAASFLKRNEAGRSSGVV
                     HYHFLADKLCAAQEALRDVQDELGEEVAAFVRIADLRCVKSYAPKRFHFVADLVFE"
     gene            <15550..>18051
                     /locus_tag="LMJF_03_0070"
                     /db_xref="GeneID:12983160"
     mRNA            <15550..>18051
                     /locus_tag="LMJF_03_0070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721637.1"
                     /db_xref="GeneID:12983160"
     CDS             15550..18051
                     /locus_tag="LMJF_03_0070"
                     /note="previous protein_id=AAM68975.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721685.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12983160"
                     /db_xref="UniProtKB/TrEMBL:E9ACF4"
                     /translation="MEEQELSKIIITEAARCSQGRLDSETTAQVARFLSDAKGRNHVY
                     QCCLDLAQDPGRRPRIMMFLVNYVQSFPPSRQCLESIKGFCKAHPSGDVSQDLLKLVG
                     ALLREAPLEGLSSSIARSSRQGYASEFALLADFSAPSPGSGGGGSVPISAVPYMKWMG
                     VSVKKNEGVKCYSEVMYQRVWCPPYVDQFPLLCLESTVERQASIMSTFSANYKTNPNV
                     MQATLFFMKQLCDGYVSKLVLSEPQLHFRSVTICYLPMLLEMMESDYLCVRNHVYDFI
                     FNLGVHVQLIDPAGVYPGCTEALEQEVVWMALTVTERQAVLKICDETTWAAAAKCLVA
                     VVPPCYRHLADCRVLFQVLQLPGLWELHPEAFTALAQAFARSLLSNKDVDVAAADNLV
                     VDELAFAKLGSSAMSDILTIYRHCTTPGARKALFQLLVACAARRQGVNGARSGVRMSG
                     QLSPEARAGAFRDLMSVDFFWYVFPLLYYMSETVQQELPRRIADGLVKSDFDGTKKSW
                     NVVLPLVENMLGLLAEDAELESYTQARFKAVEVLRRRDETAFLAALQVLLSEVAGTLP
                     LLLEGQREASDTKMCTAAWRLAFVSLRWSARYLPDDAHRALTDKLVRNLVFYKDGRGH
                     IGNRARVGQMCASLLFSLNLLCRTSPQCDAVTFRTVLEVVLFDRGDAMDTRTAMALYH
                     HLIEYLCVPTRSSFHLNTANDVSDISAMIIRERAMCINSAAVQLVGLRVLWGMYRSLD
                     QSQVAAVCRARHVLVLLLCHQSTDRRGVEVRTWRTVLTDPYPPVALLAAEKIIHIFKA
                     EEKPNTAVEINGEAFRDVYHDAMRILEKGERKRIY"
     gene            <18825..>20711
                     /gene="GAT"
                     /locus_tag="LMJF_03_0080"
                     /db_xref="GeneID:12983161"
     mRNA            <18825..>20711
                     /gene="GAT"
                     /locus_tag="LMJF_03_0080"
                     /product="glycerol-3-phosphate acyl transferase"
                     /transcript_id="XM_003721638.1"
                     /db_xref="GeneID:12983161"
     CDS             18825..20711
                     /gene="GAT"
                     /locus_tag="LMJF_03_0080"
                     /EC_number="2.3.1.15"
                     /note="previous protein_id=AAM68976.2"
                     /codon_start=1
                     /product="glycerol-3-phosphate acyl transferase"
                     /protein_id="XP_003721686.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12983161"
                     /db_xref="GOA:E9ACF5"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="UniProtKB/TrEMBL:E9ACF5"
                     /translation="MAPTSALKPKDRIVASTRRSKFVLCEECHQNVPIEEWPDHRDRL
                     RKVSLVEEVSRFHHTLVRLMGEFLMWVLRSVYFREVTVVGRENIPCTGAVVFYGNHQN
                     QFIDALMMHSHCGRPVRFLMAEKSFQRPVIGTLGRIFNSVPVVRPQDVPLVDGEGKLV
                     RTEGKFIVGAGTHFSRLSKGDVLSWGVPGNAKCRAQVSRITSDEEVEVTVPIPAEHEV
                     HTPTSFKYSVRIDHSEMYAQVYDTLQKNHCIGIFPEGGSHDHTSLLPLKAGVALFSLG
                     AAERHISVKIVPVGLTYLYGHKFRSRAYIEFGEAFSPPDDLVKLFDTDKRKATGLFLE
                     QLNAALRAVTINVPDYKTLSFLHSFRQLYQPPNCMLSGHDYLRLIRRLGNVIEEQRKS
                     AEFAEFREKVENYSDFCKALMIRDSQAATLKRLLNADNEALQVGLLLRRVFALYLMAV
                     ILVPFFVVGLPIGGIIKYLALKQTKRALSESSVKIVGADVTGSFKVLFAFAVVPGVFL
                     LVTFIVFLYSDSRTALVILFSLPMAMYVSLLILQEAIMELRAALPLLMSLVSQHMQFK
                     KLYERREDLARQARLIVHKYDPQLEEEIKVHGNAGDSNDDLNREPSLFSLRYNVRRRQ
                     ATNS"
     gene            <21973..>23676
                     /locus_tag="LMJF_03_0090"
                     /db_xref="GeneID:12981545"
     mRNA            <21973..>23676
                     /locus_tag="LMJF_03_0090"
                     /product="putative DNA primase large subunit"
                     /transcript_id="XM_003721639.1"
                     /db_xref="GeneID:12981545"
     CDS             21973..23676
                     /locus_tag="LMJF_03_0090"
                     /note="previous protein_id=AAM68977.1"
                     /codon_start=1
                     /product="putative DNA primase large subunit"
                     /protein_id="XP_003721687.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981545"
                     /db_xref="GOA:E9ACF6"
                     /db_xref="InterPro:IPR007238"
                     /db_xref="InterPro:IPR016558"
                     /db_xref="UniProtKB/TrEMBL:E9ACF6"
                     /translation="MQAITASTPSQQYSVGAGIEKPLGVTTSADWMTMYERKPHGNST
                     LFELEAMVAKRMEFLAWVDQQINSPQAKNFDSVLDAIIARLPEERRSSAATDGSRVKM
                     ISLGYDETAAGGCSDRRSSSRGSTGSAAGANQAASIVFAPEEDVTSHLLCRFAFCMSE
                     RWRDWLVRTERVLLTARIKMEMAKRPFTFLVDLMKRNGLPCAPLTDKQLADPMLQEYL
                     EYRRVKAESARESEGRVENYYAVPLSLATRLIKKRYVLCRAGQAILFRDQVQEVFLTV
                     FCARLNRGLHNAYLARVKQQALEEETAKSTVMAMLDAFLQQFISDPVDTLQEGVAGSV
                     RARDVQRLAQAHFPPCMRAIDWHLRREGHLKHHGRFMYGLFLKSIGLSLEDSLELFAT
                     LMKVKGGGSVEAFAKTAYGYNVRHNYGMEGKKMSYSSASCATILGLPPVVDQHDCHGC
                     PFRFRDEGALRTMLGKETENPKGCDYPSVRPTPGDIEDIVSDSKAQHYTRACYKYFMA
                     THPGARRDTLFRSPYEYYSVSLEFETPSDGTESARPSAVPGKRTSVVLNEDVLRFRTS
                     P"
     gene            <25140..>25634
                     /locus_tag="LMJF_03_0100"
                     /db_xref="GeneID:12983162"
     mRNA            <25140..>25634
                     /locus_tag="LMJF_03_0100"
                     /product="putative cytochrome c oxidase assembly protein"
                     /transcript_id="XM_003721640.1"
                     /db_xref="GeneID:12983162"
     CDS             25140..25634
                     /locus_tag="LMJF_03_0100"
                     /EC_number="1.9.3.1"
                     /note="previous protein_id=AAM68978.2"
                     /codon_start=1
                     /product="putative cytochrome c oxidase assembly protein"
                     /protein_id="XP_003721688.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12983162"
                     /db_xref="GOA:E9ACF7"
                     /db_xref="InterPro:IPR007533"
                     /db_xref="InterPro:IPR023471"
                     /db_xref="UniProtKB/TrEMBL:E9ACF7"
                     /translation="MYCAPTGRGADPKFYTPDAARKRDEQDKSYPVPKKLLKVRFLSD
                     VGNTMPIAFVPLQREVEVLVGEPALAFYSAYNRSNRTLLGVSSYTIAPPEVTNYLNKI
                     QCFCFEEQRFKPHELVEMPVFFYIDRDFLNDSMVNWLDEVIVNYTFFNLEKTKDYIFR
                     PNAR"
     gene            <26692..>29559
                     /locus_tag="LMJF_03_0110"
                     /db_xref="GeneID:12983163"
     mRNA            <26692..>29559
                     /locus_tag="LMJF_03_0110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721641.1"
                     /db_xref="GeneID:12983163"
     CDS             26692..29559
                     /locus_tag="LMJF_03_0110"
                     /note="previous protein_id=AAM68979.2"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721689.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12983163"
                     /db_xref="InterPro:IPR001715"
                     /db_xref="UniProtKB/TrEMBL:E9ACF8"
                     /translation="MQAANRGPHVISLSLPVSFAEGAVPSFHNSVAAASLPSPPLFSR
                     VPDKHGRCTGVCKRTHTHTHAHRTMKGMPTLVIGRKELFSFADRYSSRRLSDYSSLAD
                     GEVLCCLFNLVFPDLRIRPAPAQTHSSTQRAHANWEQLFRRFARLHIPLAFLDPAALR
                     TGSVECGFSTLVLFYFFHHLSKRPDFSAEFALDVAEEVTTYLQSTECIATLLLGGALQ
                     WAAVPEPLAQTLRAHPFFHTTAEAEMAQEEEAAHTYRSMFARRRTGSANSMHHLPATR
                     RAHSRTTEQHSGIGGPSSMRPASSSPPSAASSSTPGFKGTADSPPPRPPLRNAATQST
                     RSSTSRLPSSDDVDSCADLCRLEHQCSSERRTRSAEACGVSQPTAPNQRSSSRRSASS
                     SRSSRNSHSSTMSALSCRSSGTANMDVAQPSCVPYHSASSVSAATGSRGSAVSSLRAR
                     DAALEAALQSKEAECESLQMQVAQLLTLLANTRAADTASAATNGGSHVRSPRPRAAAA
                     QRGDTADGTSTARLQLHYADSIEELETQLRAYREAGDKRQAPSSPSPAPAAPAPPPPS
                     GATMDKAALEAEIAALTADIVDDETGTTVVDVHEKANLLHCLMLEHLQEAPRNRKQMQ
                     RWLWSIVAAHHTMEGRLMAAVGLLRLWSATLPAAGAGAAVVANSSAANREACTAAQRS
                     QSTVAAPFSAASPGSDLDTADSEGACHKEMTALRSAHHAELEALHAREHQLAAALQAA
                     QANNAATVQRAVRRERLWKSLCASVYAAEQASYAITECRTAEEVEERLRQREEHYGIV
                     ESLTQQLVEDGQQKVATSTQHQEIEATTGSPTPCRSLQTLVAHLQEERAEILRDVARL
                     HDALASLQGEKGPTACADVVKVPKASLSLSAYASTAVAPFFSDDLQRKSAAVADGGAA
                     GTSTDRYECKPSSATYSSGPVRAHRGLTSLLQLREGEEFSA"
     gene            <30321..>33098
                     /locus_tag="LMJF_03_0120"
                     /db_xref="GeneID:12983164"
     mRNA            <30321..>33098
                     /locus_tag="LMJF_03_0120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721642.1"
                     /db_xref="GeneID:12983164"
     CDS             30321..33098
                     /locus_tag="LMJF_03_0120"
                     /note="previous protein_id=AAM68980.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721690.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12983164"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="UniProtKB/TrEMBL:E9ACF9"
                     /translation="MSVTASSSRGSGGSEEVEVCGRGRGIRCIDLPAVFSTPQECEML
                     AVITAFDLSRNELQELTSLQPLRSLTRLNASYNRISLVDGLPLSLTQLNLAHNKLEHL
                     DCVSQLVHLRELDVSFNRLTSLVGLHSRVPLEVLRADDNRIDRTSGLKELRSLRMASL
                     SNNYVEDVDELLFVSTTPSLQLLNLVGNPVTRARRYRQTLAELQPSLVSLDGAPLTRA
                     ADYENAAQTYRVSSTAVPPAAAHTPLPLATPKMATTRSQRALAQGRHDSAREPLATVK
                     APATLSAGVMSVCSSVSGSPSRRGRCGGAAQSVAANASIGVSSITLDNSPNERPRGQP
                     PQPVRRATANPTTAHPHQPAMAVSRGALSGPRSACAEPCHNHSAAAEPPQHPRGSPAR
                     AEERTEDANDTDGDVPPVVEDSCRGCRVVDASVRTPEQAHRQVGYASLHATPATGGAA
                     ERLRSGGRVRPFPSPASPQRCAASQQDLDSTTAQLHDSLVAKEQLEKECQTLRRACKR
                     AEGQLAEARRVISQQLAELSQLRLERDALRESEGTILERLEKEKRSGRTRASHHSDEV
                     ATLQTQYERMKTFYETQLADTRRELAAERARLLRLSNNGSCGERAAAATDRVDVAERG
                     QRSPLADEGQRAVAPAENGTSELPAAASANPLRSLSPASRSASSSPPKTRDHGPGGAA
                     PSIDAVAQQLTSWLYASLTGDGHAAEGDEGVVATAVVSELRRSLLRDPSASTARAHAD
                     QASQPQESADAAKDSVGTTATAVRRILETFISEHIGQLAGPPQQIVDRSAPVQSPTVA
                     AAAVDAPTPVDAGGSAPSQAREAVKHIEAGEPAVACLLPSRLPSSPRCSSAVPTHISV
                     DKDDDDDADTDAELTVVISPPASCAVAGIDQSVAVAALPAPPRLPASAHNKRVNAAKA
                     FLKGMESLLDS"
     gene            <34115..>34663
                     /locus_tag="LMJF_03_0130"
                     /db_xref="GeneID:12983165"
     mRNA            <34115..>34663
                     /locus_tag="LMJF_03_0130"
                     /product="putative acetyltransferase"
                     /transcript_id="XM_003721643.1"
                     /db_xref="GeneID:12983165"
     CDS             34115..34663
                     /locus_tag="LMJF_03_0130"
                     /note="previous protein_id=AAM68981.2"
                     /codon_start=1
                     /product="putative acetyltransferase"
                     /protein_id="XP_003721691.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12983165"
                     /db_xref="GOA:E9ACG0"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:E9ACG0"
                     /translation="MSVPYEEKAFPPLKGLHIRPMNDSRLCERIKVLDDYCFPVKYTE
                     SYYNDYVRNSFHEFNQLAFYHDILVGSITCRLEKTATDGEHVLYIMTIGVLEAYRHLR
                     IGSRLLQTVLSAVHNDTRNRIVAVTLHVQVGSPALKLYRQFNFEEVQLVENYYTDLDE
                     CNAILLRRVVPQPHFEHHKKFK"
     gene            <35547..>35966
                     /locus_tag="LMJF_03_0140"
                     /db_xref="GeneID:12983166"
     mRNA            <35547..>35966
                     /locus_tag="LMJF_03_0140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721644.1"
                     /db_xref="GeneID:12983166"
     CDS             35547..35966
                     /locus_tag="LMJF_03_0140"
                     /note="previous protein_id=AAM68982.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721692.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12983166"
                     /db_xref="UniProtKB/TrEMBL:E9ACG1"
                     /translation="MPYYPSGEGRESYITGIRPGGRYGAVHDVEKRRDNLPDNVFHYI
                     KEAVQREERLRCNEEEERARIRLEMFAKKPGQHRGSGATLAAAASGGAEQSVAISQLE
                     CETLTRERRAALQELYQRERKEWEIQLGARGLATHRT"
     gene            <37224..>38159
                     /locus_tag="LMJF_03_0150"
                     /db_xref="GeneID:12983167"
     mRNA            <37224..>38159
                     /locus_tag="LMJF_03_0150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721645.1"
                     /db_xref="GeneID:12983167"
     CDS             37224..38159
                     /locus_tag="LMJF_03_0150"
                     /note="previous protein_id=AAM68983.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721693.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12983167"
                     /db_xref="UniProtKB/TrEMBL:E9ACG2"
                     /translation="MTAPASHYTFANLKKLGLCAPQVALSRQPRLRPHVGHLNGLVYP
                     LPYYAMWRGNHDKYTYNQATPARWGEGNTNTMYHQHYAHAKCPTDYGRGGREFQFLSV
                     KRGKLKRKPLPTVQYVDPNSKPQWVFKSWHNPLSAPSMWEREVQYPEHTPAHTGAKRP
                     LAVVAPKTSHKHLFLMHMEKVTVTVSPLLFGYGHTLQKAALDFYRRGLSARSPFPSDK
                     MFLYYSIDHITPKIEVTWLDGSVYVPPLIEGVKAQDLIQMVMEQAWLAADRMSAEGRV
                     LNPIAIDDYKWEQLIAFKQKRAKGAEAAKGGAKKK"
     gene            <39082..>41256
                     /gene="ABCF1"
                     /locus_tag="LMJF_03_0160"
                     /db_xref="GeneID:12983168"
     mRNA            <39082..>41256
                     /gene="ABCF1"
                     /locus_tag="LMJF_03_0160"
                     /product="putative ATP-binding cassette protein subfamily
                     F member 1"
                     /transcript_id="XM_003721646.1"
                     /db_xref="GeneID:12983168"
     CDS             39082..41256
                     /gene="ABCF1"
                     /locus_tag="LMJF_03_0160"
                     /note="previous protein_id=AAM68984.1"
                     /codon_start=1
                     /product="putative ATP-binding cassette protein subfamily
                     F member 1"
                     /protein_id="XP_003721694.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12983168"
                     /db_xref="GOA:E9ACG3"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9ACG3"
                     /translation="MDLVQLQRILSTHDERVVKVFVNHIPEVGLRKIDDCVLEYMLKM
                     LEGQTSSESYLPEEIIEETMKLYFREFDVFSDSEEKLNKSTAAICQQMLKEGITKKPS
                     EESSRLASAVNIGRQYEESLKRATMIKSVGKVTTANTNEDWTWETKRSAAKDMRKKRR
                     EDEKKAILAEEYEAFLRKRGISNTTAVTKIHHKGEGTNYSTDIRCEAIHIQLGKQVLL
                     DDTDLVLLTGHKYGLIGRNGAGKTTLLRALAERELEGVSPFMQILHVEQEIVAGAETP
                     LEVLLATDVERAQLLHEEQELLKQNDTEANTRLNEVYARLDAIDAHSAEARAATILHG
                     LSFTQDMMTSPTKQLSGGWRMRVALARALFVEPDVLLLDEPTNHLDLFAVLWLEQFLR
                     DWQKTLIVVSHSRTFLNNVCSEIIHLIGHHLHYYNGNYDQFEITRVEQERQQKKQHAA
                     QEKQRAHIQAFIDKFRYNANRAKMAQSRIKALERMEMVADVVTDPQFAFTFPDAEPVS
                     GSFIEMVDCEFGYKPGVSLFKDVNMGIDESSRIVLVGANGVGKSTFMNVCTGALEPRS
                     GTVVRNKKIRVAHFAQHNMESLTPQLSSLEFLRSKFPHMEDQQLRAHLGSMGLSGERA
                     LQPIYTLSGGQKSRLVLAWITFQKPHLLLLDEPTNHLDIDTVNALIEALLAYNGGLLV
                     ISHDEYFITSLCDDIFVCEDNTVKKFDGDFAEYRKHVVKMMK"
     gene            <42231..>42809
                     /locus_tag="LMJF_03_0170"
                     /db_xref="GeneID:12981544"
     mRNA            <42231..>42809
                     /locus_tag="LMJF_03_0170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721647.1"
                     /db_xref="GeneID:12981544"
     CDS             42231..42809
                     /locus_tag="LMJF_03_0170"
                     /note="previous protein_id=AAM68985.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721695.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981544"
                     /db_xref="UniProtKB/TrEMBL:E9ACG4"
                     /translation="MSSPYSPPTAAVTDNSQDDAFLEKDLALLMAALRLNNSDDWAGK
                     PQQETFRVYETVPPAVTPQPSSCSADVGDAARGSSPHNSDKSDASSDSLNALMADYVH
                     AVRALHAFDARTAADGIRESVTAEAGHTGGGVVDAEAEATTPCKAAADDGSCSAANTK
                     CADAAAPVDMAEPLAVLDPLPCLTIDAQGEES"
     gene            <43600..>45291
                     /locus_tag="LMJF_03_0180"
                     /db_xref="GeneID:12981463"
     mRNA            <43600..>45291
                     /locus_tag="LMJF_03_0180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721648.1"
                     /db_xref="GeneID:12981463"
     CDS             43600..45291
                     /locus_tag="LMJF_03_0180"
                     /note="previous protein_id=AAM68986.2"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721696.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981463"
                     /db_xref="InterPro:IPR028005"
                     /db_xref="UniProtKB/TrEMBL:E9ACG5"
                     /translation="MSSSKDALSLLNRVEAPAGMMQPHSQTRAFYCCDDEDKEGTDEL
                     LGELLFGADGRRGTDLSSTRCPPPAAPPASLDIAAPASAAATGSGAELPRLRYSRPPP
                     HLTQTTLDLGHAEPTMATRCLLCRMLYSPENDEDAALHRRFCRGGRLRRRDRGPYDAP
                     SSFTGACRSRRARTETAASPLASLSSPAAVAVHMLEELNGAGLGHSPSPLVANTTATV
                     RRGGPRRRESGARGVAKATYTATDTLNTAADATVSLCTCVLRPRSSSSSSPHLSSPLA
                     VFRISLNACGVADSKGGCTALRLLELLDFTPVVLRAAAERDVAPQTASSSVLCGNVPV
                     VPSVRDSAASTVHVVCVVDTVLRLLLCAVVGEPRSREQDPELCVERRADGATVCSTRR
                     NFTHGDVAGLWVLSPAELSAAQTAWEKSTAAPFASTRQALEVFFGTRAGGGAPSSAQS
                     HAAHVTEKAHERCQQAAGVALHALAQYLVYGSSLCPSRQLSYSQAALAAAERMGAGFM
                     EQCLAVASSCYLAGATPTPREDVGELQPLYIHGDSDDGGSDSDDANEDAKGVIGE"
     gene            <46204..>46836
                     /locus_tag="LMJF_03_0190"
                     /db_xref="GeneID:12981464"
     mRNA            <46204..>46836
                     /locus_tag="LMJF_03_0190"
                     /product="putative U2 splicing auxiliary factor"
                     /transcript_id="XM_003721649.1"
                     /db_xref="GeneID:12981464"
     CDS             46204..46836
                     /locus_tag="LMJF_03_0190"
                     /note="previous protein_id=AAM68987.1"
                     /codon_start=1
                     /product="putative U2 splicing auxiliary factor"
                     /protein_id="XP_003721697.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981464"
                     /db_xref="GOA:E9ACG6"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR009145"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:E9ACG6"
                     /translation="MTAHVDRCVFFSKMGACRHGDQCTKLHYRPDTSPTVLFPLMYPN
                     PHAIEHIKDREWNFELDKKYLKKHFEHFYKEVWRTFMEFGRIAELRVVSNLGDHLLGN
                     VYIRFEDPQVATRIVKELRGKKLNDIIVLPELSPVTNFAEACCKEDLENRCQRGEQCN
                     YLHIMKVSRRLLEKLEKEQSKYWKKKERRHEHSSSDRKRSRSRSPADTRW"
     gene            <48406..>50088
                     /locus_tag="LMJF_03_0200"
                     /db_xref="GeneID:12981465"
     mRNA            <48406..>50088
                     /locus_tag="LMJF_03_0200"
                     /product="putative delta-1-pyrroline-5-carboxylate
                     dehydrogenase"
                     /transcript_id="XM_003721650.1"
                     /db_xref="GeneID:12981465"
     CDS             48406..50088
                     /locus_tag="LMJF_03_0200"
                     /EC_number="1.2.1.88"
                     /note="previous protein_id=AAM68988.1"
                     /codon_start=1
                     /product="putative delta-1-pyrroline-5-carboxylate
                     dehydrogenase"
                     /protein_id="XP_003721698.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981465"
                     /db_xref="GOA:E9ACG7"
                     /db_xref="InterPro:IPR005931"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:E9ACG7"
                     /translation="MLRRTVSCAFAAFKCPPVLNEPMDNFEPGSVSAKGTLEACKEAR
                     GEVRECPIMIGGKPYTSSNIIKATMPSDHQVQIAKAYNATPELAKKAVEAAVEASKEW
                     SQVPFRDRAAIFYKAAHLLSTKYRHEMRAVTMLGQSKNPWQAEIDCVAEACDFIRWNI
                     HFAEELYAQQPRSVSNSGVWNTTDYRPLEGFVSAITPFNFTAIAANLAGTPALMGNTV
                     VWKPSPTAVLSNYLMYKIMEEAGLPAGVINFVPCEPAVMDSAVNADPRLAAVVFTGST
                     RVFTEINKNVFSRLETYHNFPRISGETGGKDFHLVHPSADVRHVAAGTVRGAFEFQGQ
                     KCSACSRLYAPQSCWKELKALLIKGQKQVKMGQPDDFQSFMCAVIDETSFNKNKKYIE
                     IAKADSSNYEIVAGGKCDKTRGYFVEPTIIETKDPRAQLMREEIFGPVLTVFVYDDSK
                     PGYWKEVCELVDSTTKYGLTGAVFSRERAPIREADKYLRYAAGNYYVNDKCTGAVVGQ
                     QPFGGSRLSGSNDKPGAGQFVTRFVSARSIKESFDVTPTISYPHQLPDVYTL"
     gene            <51986..>53125
                     /locus_tag="LMJF_03_0210"
                     /db_xref="GeneID:12981466"
     mRNA            <51986..>53125
                     /locus_tag="LMJF_03_0210"
                     /product="putative protein kinase"
                     /transcript_id="XM_003721651.1"
                     /db_xref="GeneID:12981466"
     CDS             51986..53125
                     /locus_tag="LMJF_03_0210"
                     /EC_number="2.7.11.1"
                     /note="previous protein_id=AAM68989.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_003721699.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981466"
                     /db_xref="GOA:E9ACG8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008266"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9ACG8"
                     /translation="MQESNTLIFDVPDAFQVESIIGQGAYGAVCKAVFCNDQIAVKKI
                     PHYSRSEDTARRVLREIEILQNLQFCEQVVGCRLFFRPKSEEKDVYVAMDYIPADLSS
                     VIKNGAITLDESVVRYITCQLLLALRALHRCKVLHRDVSTRNILIHYNSQVFLCDFGL
                     SRFFDPDEQLSFGVVTQWYRAPEIILDAAYSYASDVWSVGVILGELLLRRHLFPGKSN
                     DSANQLQLIFHLVGTPSKDVFDADRSFGRASQNARNYALAYIERRPCPSTLVNLLSTA
                     PALHHSAIAAVPPQVVQLAEQLLQFDPARRPSADEALRHPWFDQCRAFIDEVVQHQDE
                     EEIPVFTQTQNMNVEELVKRIEEVVPVFSEDLLVEDDGGGAADSA"
     gene            <54143..>55084
                     /locus_tag="LMJF_03_0220"
                     /db_xref="GeneID:12981467"
     mRNA            <54143..>55084
                     /locus_tag="LMJF_03_0220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721652.1"
                     /db_xref="GeneID:12981467"
     CDS             54143..55084
                     /locus_tag="LMJF_03_0220"
                     /note="previous protein_id=AAM68990.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721700.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981467"
                     /db_xref="UniProtKB/TrEMBL:E9ACG9"
                     /translation="MSSPAMLRTSSVLLDKSMFAAKRRVIVPIQPTPGYPAHFIKASF
                     TTDPLKEKQKARFSSGGDAMREVQDIPKRLEGQRSRAELTSRGDEDFAALIEFIQGAS
                     YDQLISGRRFRKIYEKLSENDDMFVWLCHTAMAVLNPGDMRSRLMHNHLKALAEAVAS
                     GEMTQRTAFRFFESAVRSPAYREIAARQLETGAATRLAGLAAAADVMREMGLTRRPMS
                     SYFELYQRIVERSEAMTPWGFPPLFQFEERLALEPRLKFFSRAGQQQLERRRRGSIFS
                     PHTILQGRRIFWIPPTWNRAGRFIGPHINLYPGLTPD"
     gene            <56015..>58129
                     /locus_tag="LMJF_03_0230"
                     /db_xref="GeneID:12981468"
     mRNA            <56015..>58129
                     /locus_tag="LMJF_03_0230"
                     /product="putative long chain fatty Acyl CoA synthetase"
                     /transcript_id="XM_003721653.1"
                     /db_xref="GeneID:12981468"
     CDS             56015..58129
                     /locus_tag="LMJF_03_0230"
                     /EC_number="6.2.1.3"
                     /note="previous protein_id=AAM68991.1"
                     /codon_start=1
                     /product="putative long chain fatty Acyl CoA synthetase"
                     /protein_id="XP_003721701.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981468"
                     /db_xref="GOA:E9ACH0"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="UniProtKB/TrEMBL:E9ACH0"
                     /translation="MGGAVSFCLQKLNKVSEVEYRPYKEYASYGEQSVPVKGSDDSGR
                     SMIYRMSNTSEEELKRLRDEWYAGGSCLSVLERLCKERGKRTCLAYRKLKTIEKNETT
                     TSDGRKKVLETYVFEPERRTMSYTLFWQNIVDFGRGLHEIGLTKGNTVSIYEETRWQW
                     LCTMYSCWSQGLLVSTVYANLGEDALQYALDEAQCNAIVCNGSKVKDVLAMFKVIEAP
                     KGTKVIYLDELPPSVTSEEYDLYAWSDVVARGKKSEASCRIPSGAESKDELALIMYTS
                     GTTGNPKGVMHTHGSLYCGCMTISQRINDLLGKMKEQEWYCSYLPLAHIMELAVTSVL
                     MMRGVIIGYGSPRTLLDTFAKPCGDLTTYRPLVFVAVPRVFDSMKRAVEEKLPPPGSL
                     KRKIFDKAYEARLKALKKGCDTPFFNKRVFANARKVMGGRVYAMLSGGGPLSESTQEF
                     INVVFGMVIQGWGMTESVACGGIQRTGNLEYNCVGQVLKTAEVQLLDTDEFKHTDQPE
                     PRGEVLLRGPFLFKGYYKQPEQTREALDNDGWLHTGDVASVTPSGTMRIVGRVKALAK
                     NANGEYLALEMLESIYGTNEITVPNGVCVLVHPHRTYIAIIAVTNEKLVKAFMKKHKI
                     ENGGFPAILDDAEFLRVVLQSLQKTARDANRCSFEVVQGVKLLNEEWTPENGVLTAAM
                     KLKRRVISENYADFINKLFEKQ"
     gene            <61003..>61467
                     /locus_tag="LMJF_03_0240"
                     /db_xref="GeneID:12981469"
     mRNA            <61003..>61467
                     /locus_tag="LMJF_03_0240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721654.1"
                     /db_xref="GeneID:12981469"
     CDS             61003..61467
                     /locus_tag="LMJF_03_0240"
                     /note="previous protein_id=AAM68992.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721702.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981469"
                     /db_xref="UniProtKB/TrEMBL:E9ACH1"
                     /translation="MLRRTARRAMGNSRFSGSKERDRIEQERRRRLLYDAAGNLQLGG
                     LLLMMYDDFKKPAAIGLGMVAFLYGYNRLVVRLSREEEAEGLQLDAKSEAVARQTGKL
                     KADRYLVKPNRQIDDPDFLNIPAFGGRGVSSSKLLSDDSVSGGALHSERKRS"
     gene            <62110..>62361
                     /locus_tag="LMJF_03_0250"
                     /db_xref="GeneID:12981470"
     mRNA            <62110..>62361
                     /locus_tag="LMJF_03_0250"
                     /product="putative ribosomal protein L38"
                     /transcript_id="XM_003721655.1"
                     /db_xref="GeneID:12981470"
     CDS             62110..62361
                     /locus_tag="LMJF_03_0250"
                     /note="previous protein_id=AAM68993.1"
                     /codon_start=1
                     /product="putative ribosomal protein L38"
                     /protein_id="XP_003721703.1"
                     /db_xref="GeneID:12981470"
                     /db_xref="GOA:Q4Q8X0"
                     /db_xref="InterPro:IPR002675"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8X0"
                     /translation="MPREIKTLKEFLAICSRKDARCVKVKHNPSATKFKVRCSRYLYT
                     LVVNDKKKADKIERSIHPSVKKIAVTARSHAKTNAGSKQ"
     gene            <63658..>64566
                     /locus_tag="LMJF_03_0260"
                     /db_xref="GeneID:12981471"
     mRNA            <63658..>64566
                     /locus_tag="LMJF_03_0260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721656.1"
                     /db_xref="GeneID:12981471"
     CDS             63658..64566
                     /locus_tag="LMJF_03_0260"
                     /note="previous protein_id=AAM68994.2"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721704.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981471"
                     /db_xref="UniProtKB/TrEMBL:E9ACH3"
                     /translation="MAAQPGRVCLSAELCQRCCGAVGHRITAAARGEVPLSASFTASQ
                     QPTVEDLFVRRFGTTTFDRRRGTSATDAPPLVSPSAGVDALFTERFPALTAQATVERM
                     HQVAASHDAAKTQSAMWDGLRRCFTFRGRLPSARINNSTGDTPSPAPPPARFSAQYPP
                     VANEASGLSASGHQSPPPAVQRYWHSYQLWASLQPHIQQEHQAILQLRAQAHAAKIAQ
                     QKSLRQHLHRTVYWTLFVVCPLLGLLFLWLAIDAAAYGAELELLPFVKYDEALRDFAE
                     AEGHHRQLIRGKRNNGVAKKKNIRID"
     gene            <66059..>73123
                     /locus_tag="LMJF_03_0270"
                     /db_xref="GeneID:12981472"
     mRNA            <66059..>73123
                     /locus_tag="LMJF_03_0270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721657.1"
                     /db_xref="GeneID:12981472"
     CDS             66059..73123
                     /locus_tag="LMJF_03_0270"
                     /note="previous protein_id=AAM68995.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721705.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981472"
                     /db_xref="GOA:E9ACH4"
                     /db_xref="InterPro:IPR000074"
                     /db_xref="InterPro:IPR000306"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017455"
                     /db_xref="UniProtKB/TrEMBL:E9ACH4"
                     /translation="MSTPVSGVVPQDRWQPQQRVKVCQYQDCGAPFGFFSTKVNCHRC
                     GIVLCSKCAATKTVIPRYYSNETVPVCQRCYQVVERYKERGSVTPGYVVHSTTISATP
                     ARSSPVPPLHTTPALRPHAPSPQPASVVSTATLVHPVEEDAVSTKPSVSEADLHALRS
                     IIETLQQALNDEQHNAALAATSAAEQLRTAKEENTALKSTAHLLQQRLDTATQQRAEL
                     EARVARLAADRDEARQQLAANAEELQQRLDTATQQRAELEARVARLAADRDEARQQLA
                     ANAEELQQRLDTATQQRAELEAQVARLAADGDEARQQLAANAEELQQRLDTATQQRAE
                     LEARVARLAADRDEARQQLAANAEELQQRLDTATQQRAELEAQLARLAADRDEARQQL
                     AANAEELQQRLDTATQQRAELEAQVARLAANAEELQQRLDTATQQRAELEARVARLAA
                     DRDEARQQLAANAEELQQRLDTATQQRAELEARVARLAADGDEARQQLAANAEELQQR
                     LDTATQQRAELEAQVARLAANAEELQQRLDTATQQRAELEARVARLAADRDEARQQLA
                     ANAEELQQRLDTATQQRAELEAQVARLAANAEELQQRLDTATQQRAELEARVARLAVD
                     RDEARQQLAANAEELQQRLDTATQQRAELEAQVARLAADRDEARQQLAANAEELQQRL
                     DTATQQRAELEAQLARLAADRDEARQQLAANAEELQQRLDTATQQRAELEAQVARLAA
                     DRDEARQQLAANAEELQQRLDTATQQRAELEAQLARLAADRDEARQQLAANAEELQQR
                     LDTATQQRAELEAQVARLAADRDEARQQLAANAEELQQRLDTATQQRAELEAQVARLA
                     ADRDEARQQLAANAEELQQRLDTATQQRAELEAQVARLAANAEELQQRLDTATQQRAE
                     LEARVARLAADRDEARQQLAANAEELQQRLDTATQQRAELEAQLARLAADRDEARQQL
                     AANAEELQQRLDTATQQRAELEAQLARLAADRDEARQQLAANAEELQQRLDTATQQRA
                     ELEAQVARLAADRDEARQQLAANAEELQQRLDTATQQRAELEARVARLAADRDEARQQ
                     LAANAEELQQRLDTATQQRAELEAQVARLAADGDEARQQLAANAEELQQRLDTATQQR
                     AELEARVARLAADRDEARQQLAANAEELQQRLDTATQQRAELEAQLARLAADRDEARQ
                     QLAANAEELQQRLDTATQQRAELEAQVARLAADGDEARQQLAANAEELQQRLDTATQQ
                     RAELEAQLARLAADRDEARQQLAANAEELQQRLDTATQQRAELEAQVARLAANAEELQ
                     QRLDTATQQRAELEARVARLAADRDEARQQLAANAEELQQRLDTATQQRAELEARVAR
                     LAADRDEARQQLAANAEELQQRLDTATQQRAELEAQVARLAANAEELQQRLDTATQQR
                     AELEARVARLAADRDEARQQLAANAEELQQRLDTATQQRAELEAQVARLAADRDEARQ
                     QLAANAEELQQRLDTATQQRAELEARVARLAADGDEARQQLAANAEELQQRLDTATQQ
                     RAELEAQLARLAADRDEARQQLAANAEELQQRLDTATQQRAELEARVARLAADGDEAR
                     QQLAANAEELQQRLDTATQQRAELEARVARLAADRDEARQQLAANAEELQQRLDTATQ
                     QRAELEAQLARLAADRDEARQQLAANAEELQQRLDTATQQRAELEAQLARLAADGDEA
                     RQQLAANAEELQQRLDTATQQRAELEVEMAVLLREREEARGETAVAGEQVQLYRETVE
                     EEECLKEERWCLESRVAQLREASAAAKQQRQEVAAKANEVQERLDSMARRCIAHEGDA
                     PQRADGRDDALRQLANLREEVKLSEKQKAMERVIPGVRERQMRLEAAEEQRADLEARL
                     VDEAGDLRSRPAASTNEVNLYRDLALQEHEAAQNRCTTLEAQVASLTSDRDNGRQQES
                     ADLSEAQRHLDNVQERDMAHHRCAALEEQNAAMASELQAVKAKLRQASVKASSLMTRL
                     SASSSGAGGVSARVRVGGSSAVPQAAPHRDAELIAEVGERLRERGEAMRLLAEGVELR
                     ERARPLERVLAEKLIGDRRTSDAEEVATEPTQVRRNAAHSRHLDSREAQLDERAARLR
                     EKEQQLLRVARELQTKSRALQVLYARALNRPQVTSLLLTADGDDTSYPDTPQQQQQGT
                     RTPLREPVYSLDSEVAHYGRTAGAAVSSGLASPLPREPPRARMVHRAVEATGTEEDTQ
                     VRLTAATEAYRDVLYEHILESNGLQGVDVLAQYLPHHTSGGGLKTPRLPGSGIISKTR
                     AMLRALEERLGASRGVGRGVDPAVQERSLEAFRRLEAALSALCGGSHA"
     gene            <74029..>76956
                     /locus_tag="LMJF_03_0280"
                     /db_xref="GeneID:12981473"
     mRNA            <74029..>76956
                     /locus_tag="LMJF_03_0280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721658.1"
                     /db_xref="GeneID:12981473"
     CDS             74029..76956
                     /locus_tag="LMJF_03_0280"
                     /note="previous protein_id=AAM68996.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721706.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981473"
                     /db_xref="UniProtKB/TrEMBL:E9ACH5"
                     /translation="MHAAAGGQNRGEDCGGHDGHPANDEAASVHSPLFANVCRALQHI
                     VTELQPQHRQHQVGSSSTAGEDGRASADDSTPAHLAFPVPRASASCTDVACSTSPDTA
                     EQQCERRRLLFLAEWAQRVAAAYAPIMPSAAQEAAALLLAVHPVSHDAVTQDAAAAVA
                     DAALETNAAASISGTKADLPPVRCASVPVERRLIYPDGYVNTHADRAASVSVTTHSDL
                     LLLPHTIMTAAAAVSHLSSPPPPITPRDRAPLCRVVGEPFDVPATRAEQRAVLAAQGG
                     CCARCGVVLPQPQLRFPEWCSARTRSICTRLTSSCCYLQCSCCGGGQTTTMSLRRGRF
                     WRACMCLSRCSSSAEDEEDGRSTAVTAVHVTPETTGGAGGGRGGVRHNARAPLDAPES
                     EDFGGTASECDGLLGGGTRSNRHSRTRAGCDHHRSDRTGDGGGGTPADASFLFCTYEG
                     HYLCLRCFHTPLTAAGLGAAMSTASAAAASAVGGTCIPEDYQTRYVAPEEWQAHASST
                     ASLSSPPAWFQPRRRGNGGGEGVDGSSARAALARASDQLHEWWLARHVAHPTPAAGTL
                     TLRGSRAASGLDHPPQQHTASPLHLCILPAHALHRWDFTRFPVSAVAAAVLQRRCYPG
                     SAHGRESCLSPGASGQERGRQRTTVGGGGGGGVRGKMSGDDSPILLPGEEQGARGHHN
                     ALAIPPPPALEHVPYLSGEAGAAAPAMGQLPELYDVSVINPSLYVRVPALASALRLRQ
                     RMSLLHAQAWWCPQYRHEVWGLRSGDELVGQALEGATALSVAQQPPGPSSTVKHALKS
                     SPTPAAVVESAVDSAEFYLLTQDVAPPPNSSWAVSSASRLHSVATPQTASLSALSSQA
                     HSNLSGRVDGTSSPHRHLSAVGVAAVPLTLPTGARFHARRRYLVERAEGWSLQDLHRL
                     TTPSSSTSATVATASSPPLLLTELQSMFDIMQAHLNNCSVCAAQCRGLMVKAPLGLPV
                     CRD"
     gene            77813..79145
                     /locus_tag="LMJF_03_0290"
                     /pseudo
                     /db_xref="GeneID:12981474"
     misc_feature    77813..79145
                     /locus_tag="LMJF_03_0290"
                     /pseudo
                     /db_xref="GeneID:12981474"
     gene            <82957..>89220
                     /locus_tag="LMJF_03_0310"
                     /db_xref="GeneID:12981475"
     mRNA            <82957..>89220
                     /locus_tag="LMJF_03_0310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721659.1"
                     /db_xref="GeneID:12981475"
     CDS             82957..89220
                     /locus_tag="LMJF_03_0310"
                     /note="previous protein_id=AAM68997.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721707.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981475"
                     /db_xref="UniProtKB/TrEMBL:E9ACH6"
                     /translation="MRLRPPTRAPPPPLPLSSKSGVLSREPEQCVLQSREEDAYPMQT
                     SADSNSPTRPLSAGVTTEGGGGGNTAAAAPTGANTSGTTRTAEHAVDERAPALVAAPA
                     SSAEALAKFLAMCLDRICRLEARQCVFDTALQTLFMQAYGRQPQQPSCGQAAVGAHRE
                     DGEVNGSDAHDRELSEQYLCSRHTTSCRTSPWSHVNRPPALGGSSNSHHSDDGYDRAA
                     AASELHSQQRCRRHRSLRYTQGSDVHRLHGADAPASSSLESTAPVDTSAAAATAAGAA
                     AKGNERDDAPTNHSTGSQHHRHQSPGAVAAAGVVPSPSPADLANTKWKEASSGAGAGV
                     GGGCAHAVPSATAAGNYRTTLTASAAVASGSTNEPPIISHFGSSSGGGGGGRQRQGSL
                     VTVVSPTHTSQAEEAEAHAIAASELISVGGSSAPASAVPMSGFTWAVPVTLLSSSENS
                     RCSTPVEFHMSARSLSEQQQQQQPPTQPSTEEWPSCISGHLAERADEITHDGPDAAPP
                     VHPQQQQQQRGSRRHLRSSLTHLAPLADHPQHPPARLHLQPTYRKGEEREGRESGSSS
                     RLAATALRSAGSTVTSSATHIGDELDALYHELSTPHPPASVPASSESATASGAQATGT
                     PPRKVQFPVGTDNATAINELFAQAVQNTMETTRMKENLTVLVRSVHEEREKRRRLQRR
                     EGSAVQRLFQRVLDMSSVMLRLQRTVRRIALEASSGRAADAAGWHHHHHHHHHHPSNN
                     HSHLRDRGADSSRSAGVGDQDEDGATCDGDVDDGESEWREHLCASFSTASVAISRSRR
                     SGSVSGSGHRQSISDRSGNVGYAALAAPFFSSGSLSAGCERVVPAVRSPWLSSLTTQC
                     SADVARGEAIPGRGGAVTTGTATSTPVVDGVGNTPTPPDPSGTVSFQRLAGATSVTAA
                     AAAASAGPLLVAGSAALPKIISSSSSLHSLITASAAITTNVNTTAATTTTTTTTTASR
                     AASATLVPQSMVSSLVSVPRQERPPSLLLSPPAMLNVGAAESKSSAVTSDSSVVPALS
                     ITDVHFGLALSRHASATEDELPAPAPDAAAAAGSGSAGPRAEGAGSSTTPDSDACNGG
                     RSGQRSERYGAHPDGAKVTEPQKAQQHLARPPQQQQRRQDVSGESSAPSPALSSSSSQ
                     CRQREHNMRRAVPVAIATTAVPMPISGGTQHSSTSVWHSPVPPPQQQTISSRKSPASA
                     FAGASSTAARGNSSGGSSVSARRLFDALNSEHRSGAVTGASTVVDVAAEVGAKGHGGS
                     SGTGAVNTTVTASAASPAASLASSGAALKLTGSAASLVCRTSNAPTATALAQLASAPV
                     TARPRPRQQRSEASVTKLSTMRREARRPWSDLIQSAGSATPRSKAAAADRRGNMKDDA
                     CGTDAAGSTSLQGCENLPTWRDAATSASPTHSSSDRSPSSHPQHSLLSSWLQSPPVRV
                     ATAAGGDDKTILSPVTPAGATAIATGGERRCRPSAGAPRSHSSSGSITSTPPRRLNAQ
                     PVPSPTSNAAVGARGASFSSPSSKFQRAQPVVTIAAAHQPQPLLQTTATSHQARKWTS
                     IPLMSSATVSGTLPHVPMMASVQSASSFLRITPILISPSMAHPASPVSPLAPASSPSA
                     GTGAGGSGATVGPLPTCIEQPVSPLSSTSRRDQCHRLHSSRALHFSTSSSGNNMNASL
                     AAPCTPPPTPPHGHPPNLAQQQSRDAAVQWQHAVVLSRSATALMQTTNTLPRVVASPP
                     SPSRLPRVAPLSASRRTKPLAPAAAAPASSQPARSGYEAKTLARAAMAPTGKTQRPSN
                     SAKVRGKAKQAPPSSPLAGCGSAAVARGAATHQQASCSSSLVGHHPCSNPQQLADDPG
                     RQQPQRLQTPCSAQERRSGRRARAGLPPPLSVETLSDASVSALRTSSVGTAGSMDVEK
                     GITKGDVGDGVSGALALHNHGGGSCATLVTLVAVAGAGQNRGSSAQLHPPELIAERCQ
                     EKSGRERGSPAAAAVSSLPATPTAVAAAGVTGVMRSSNRSSNASDANVDRAAGLEAGE
                     HVDNDDDDSFVQHAFRRLPLQQQQQQQHYSLAAASVGPASAMDNAASHDSSTSSSHTS
                     TPTMPSPSDMRSS"
     gene            <90197..>93295
                     /locus_tag="LMJF_03_0320"
                     /db_xref="GeneID:12981476"
     mRNA            <90197..>93295
                     /locus_tag="LMJF_03_0320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721660.1"
                     /db_xref="GeneID:12981476"
     CDS             90197..93295
                     /locus_tag="LMJF_03_0320"
                     /note="previous protein_id=AAM68998.2"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721708.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981476"
                     /db_xref="UniProtKB/TrEMBL:E9ACH7"
                     /translation="MSSGGGEASARPPPSSSHGTPAADTGGAAKATDGTQGSLSPVEL
                     EAIEQRFVEVLRALTAEPQLEPFRNEYEKLHRLLLSSHDGEQRLLRQARELRDELDTH
                     HQQITTAMQLSQEDEEAIRTLRGEIEAAWAKADTAHEQEQRSRELLHTLRQQVTELDA
                     MVEKTAGLSMGQEAYLRDLLTVKKDREEEAMLLHAALNRTEADHRQVCVQLAAAKQAH
                     EAAQRERDEQRQVYQHLLTSLEAEQRERAAKEASVRQYRDTTELCMRRLDERGVEVER
                     AIREEKKAAKEAEGTAQEIQAIARQLQERQERFGVEAARLAAAERENTILTRELPQRQ
                     AALHEQQDELKREEKQLHLLEKSARAQQAELAALVEKRATAAAAVQTRANSVDAALTE
                     LATEEKARAALEEAVAKEMQRKTNTMHTNTFKATASSKVEGQRVMEAGKSRRLHQQLE
                     LLRTENEKMRKEIYYAEQNHEKNTKEAQQALLNYHRTLDAIRTRRSEAKAVEEDIALH
                     QKKLKAQQALLSTVTADRQKTEKALRETEAELLLLRNRHASKQEELESVKTELIQQEA
                     DMCQLHGLSRQLNKDVANTEQRLRFLREDQQHAESRVEALRSEAQELRQVIAQYDLEA
                     QQQGTRLKYMTHERNAIATQLLLRSEELELIREKIRLADATRVSGTTKYQRAMKQLLE
                     SRDLLVEQRLRCRIALVRLRYLDRLHTKEVHQEKLLSQSRARVRALADELGTKHNVHC
                     WRSMESNAPEVLDALAKVQLLQAKLLRKHGELKEKTDLVEKEERAYQQLRQKLARMPG
                     PEAAEELALCAENMQQRKAQLLCMTDSLAEAEQEAEVLEVHVAQLQEELQDLKHRYYQ
                     EKTKHAALRQEEKLVARTWGAGGAGAARQAGSGTGSSVGDGDGAVVAAGASAPSAEQR
                     RTNTDDRSPSAGGPASADVEHRSASQPQQPHSHAGGSAIVSNSHNGVQAAASGTGRMS
                     AANSGRVGNGSVPPRNGRRRAPLAEAILDTLTAGPPQPNFPLQRPPHQRQFVGGGFSL
                     TR"
     gene            <94560..>96452
                     /locus_tag="LMJF_03_0330"
                     /db_xref="GeneID:12981477"
     mRNA            <94560..>96452
                     /locus_tag="LMJF_03_0330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721661.1"
                     /db_xref="GeneID:12981477"
     CDS             94560..96452
                     /locus_tag="LMJF_03_0330"
                     /note="previous protein_id=AAM68999.2"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721709.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981477"
                     /db_xref="UniProtKB/TrEMBL:E9ACH8"
                     /translation="MTKRPRRGIRRPSRAAGRLGSDTEEAENAALCQRHPEEHAGIFQ
                     SQHIKPFPVRAAIDIGTGGVVSLCVARVDATVGAIQKLMYQTQLPLHLEALPTSMSSP
                     SSPLSASSSSFTLSERTMEDITNKVHILQGAMRRNAFEGLSERAAVLSWPLCLARNAG
                     QLAERLTKEFKVDVRVLGADFDVEWPPSVARFLAGEGASTPETADDSRSTVDKGTRDS
                     VTRKGAENTLKSLLCAARAPTTSGLARHKRKVTAPPSSGSASSRGAMDARTQLDTLAF
                     LAHAAVSQCVAPQRLLVLHEDPQRGLRLLGLGTSAADDIADLLDDATTPEERQSLYAI
                     AHGPGPSLLEAGERTPSSGKQVFVAAHAQSRQQASLLPTLSSMRDCQGSADDGTSSDA
                     APAAASLMRLVEHPLPVDVASAHRYCITQIQRRPLESYGLHASSPNPLLADEFAALRG
                     LLVGMIQPTLPAWVRRKAQLGGVLCGTSHNGGLLNLAARVSQQTHVSLEHLEVHAQYH
                     FCGLTDVLLAESFPNPFLVLPSVALTAAVLRSLESPRITYLPEVSVAAALLVQPSLWL
                     HARATEVRARLARDPFYASTTAAQRGRMFGRPHRKDNPTAAPDATWVKEGRWNPISFS
                     ESMRGT"
     gene            <97232..>98365
                     /locus_tag="LMJF_03_0340"
                     /db_xref="GeneID:12981478"
     mRNA            <97232..>98365
                     /locus_tag="LMJF_03_0340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721662.1"
                     /db_xref="GeneID:12981478"
     CDS             97232..98365
                     /locus_tag="LMJF_03_0340"
                     /note="previous protein_id=AAM69000.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721710.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981478"
                     /db_xref="InterPro:IPR019153"
                     /db_xref="UniProtKB/TrEMBL:E9ACH9"
                     /translation="MVNLQRARTPIHRVGFARPPLHLAIPHPATTTPCAMSAESLVLA
                     LVLLALCGAVMLRWISQRHAHDSAVGDKALTHKGRLRLSQNASGSAAGRCGSDDGNDS
                     DQGGVDDDNGGAVGRRRRGAGGVLRRRRPQERGGNARRGGSDGDENSYDGDDAGGIPE
                     TDANGVKLTRLQRKKLAKEREREERRQAQEAALEAQRQRMDVNELRDAEAALREEELK
                     AAEEAALQQLRRDKKKAEDEEYAKWVSHIGVEERGELGDEERERQTRMQSFLLDRAAQ
                     VQARARRSAAGAKSSPSEEECIHVLILQTAARDLKVSVEELVSTIEQLSQVDKVHGVF
                     DDRGKYVFIAPEQFPLLAQFIRLRGRVSVQEFTRECNRVVMQS"
     gene            <99582..>104165
                     /locus_tag="LMJF_03_0350"
                     /db_xref="GeneID:12981479"
     mRNA            <99582..>104165
                     /locus_tag="LMJF_03_0350"
                     /product="putative protein kinase"
                     /transcript_id="XM_003721663.1"
                     /db_xref="GeneID:12981479"
     CDS             99582..104165
                     /locus_tag="LMJF_03_0350"
                     /EC_number="2.7.11.1"
                     /note="previous protein_id=AAM69001.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_003721711.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981479"
                     /db_xref="GOA:E9ACI0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9ACI0"
                     /translation="MRPGEAVAAFSMNQTGGSRAPPSPERDTLQPFLRSSPIYGGSAN
                     AASPKTGSLDVNLLSHSAAVKMLPADDEPVASEGSSHRQKQPQCRSGIDSDSTSSSRN
                     NAGNSMNSGSRSSSSSSSGGGRGATTARGPFLGMEESSGEANVPIGRPSRGDGQPQNA
                     RPKSEDPPAMTSLLSRRCLDDAVAVDTVEDDDCADNVDDDVDNARPGSPFLHRRNRLR
                     GPPIAAVMKPDAASCRAAGRRHSSNVDLLEAQEDPLMLSPHQRLLRPVSSDSIVFSIV
                     SSNSSGDERDGQGSEAARAWRHAGDGDDVSSLLPSTLALPGHASSNTLLRPCTVYDAD
                     DNGSGTGKDGVESGADSMHSSPVAVTLWGVDRDLRRKRIKKVSHYILGPLLGEGSYGV
                     VRDCINLNTDNADRRFSRCAIKIINGNYAKFDTPAAKPGKASSTSAAATEDGTDGGAR
                     AGTRGTLKRTSGMQYRREEDLKRQETFQREMRNLQRFHSTNIIRALDAFTRYSKEYVV
                     MPIAICSLRQLVQQMLRTRWREAVREWRRAQRRLRRKQRHQRGRFAPSVSRDETQTPP
                     QPSPGLPMVPSAVEELDMDAFASMTDGECDDDEDTDGISASQPHSSSDGDDGVAAERD
                     SEASMVDHEEESQRQHSDTSSITATRAGGRVTVAAAAVAERGPSAQSRLPPRVSFNGA
                     SSTATTTHSIDRYTDHSNGSPPSQSPQQRSLEHCPIFAGGHHHRGGAGSWGDDVSDGG
                     SASTTETNNGITVMSATPPALSTTELPMECDDLVGSGANGADGRPPATASPAPAPAAS
                     AQHIRPRMSLPVCSPTLLKGIFYQLMSGVAYLHQQHLAHNDIKASNVLLFEDGTVKLA
                     DLGSVSDTYNDQGSPLCASPELCKYFYGAATPPASFSQSAQHVGRDAAQSSDMWCCGL
                     LLYYLITGKPGPLPVQLQYFRALNSKQAHQHSRPFAPHGDGGQAGLPPVVTRYQLYRE
                     IAQQTMPVDLGDLPDMVAPDAGNGVLLPSSPMLTKGETPHGDSVNDAATPSYPPNGVR
                     HLLAGLLELDPLRRLTAEQALRHPWLRITFRSKTSETSSNNTVSQTTAPNSSGGQQDD
                     AQNQQQQRKAPSKQAMEKAIQRDVARRVMESRHVQHMLRLDRQRHLQFVADCCNMLNL
                     AIPPEIIKVHPEAPYHDDNGASVCSSPPPALQVYRPNSLAAAAAAVSGRNTRLGRPSV
                     GFNTPGPRGGPGGSEWSLTSRNSRNAAVTGVALRDGMRPRVMPPGCVDTDLFLPPSEE
                     DYYEQKSGKAEFDVRVLRRKPLLMAQLDEYFNNVVLVQCGYRTGPDPNYQAMRLRAVP
                     IEDKSGGGGSDGSQGGTQQPAVMILPGVSGSVYRRSPFLGLSSMPAAAAVAGYSSDDG
                     GTDGANSRGGSVDVWAAGPRHNPHTHVDDHREVVAAASSAGAVAGRGANMSRTSAAAG
                     RSLIGTSLHGATAPSRSTAVGGTGNRAPDAGSDPILYCGRGRRGGSGSGSASRRVAGR
                     GRRRGQRDASESPSEEEGNVAMRESSKCLCGLV"
     gene            <108057..>113039
                     /locus_tag="LMJF_03_0360"
                     /db_xref="GeneID:12981480"
     mRNA            <108057..>113039
                     /locus_tag="LMJF_03_0360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721664.1"
                     /db_xref="GeneID:12981480"
     CDS             108057..113039
                     /locus_tag="LMJF_03_0360"
                     /note="previous protein_id=AAM69002.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721712.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981480"
                     /db_xref="UniProtKB/TrEMBL:E9ACI1"
                     /translation="MLVHVSVVRNSTQESCGAAVGTDGSVGGSGCRNSGMAISGGGDA
                     LEDASVPYHLPALPSPPTIIEDENRHEDSNRPECCNERTGSSTEAAESRVGAVQSNKR
                     EGSPSPTTPTTLSPSVVRVRPRADTTSGVPSNHTLGEGCVTTPCAVRARSPTGAAASP
                     AAAHSFGVTPPSLFAAGSMPVSFRERTSSPPLNTFTAEAGERLGSIDSGTISAASNSR
                     RPELLCKQASYDAQQLTASSDSVPASGSQHTPAAAATPQGTEPHSIPVDATASLSCGM
                     HSCSLDELALGPDVATPTAVGSAAMPTSEAATAKQNFTLAAWTPLRVSEQAPRPNACG
                     SPLHGWSSSVSSASTPVSDSARFREEPRPASPVTMVPLLAATLPLASTAIAVTSAEPP
                     RSLGALPLSSASRPSPSPPPAVPSPSSSAPTLAFASPTHPRCPQAPPPPPSPSPPTPP
                     QQQQQQQQQQMPSPVRMTSLVHVSEGEEMCEDLGKDLLSSNGDLHTPLGGPEKGNAGF
                     STALCVSLLSGCCGGNGSLSPIVSLEAAGLTARPNTPILQPSPGPQSRSQLLESSFLT
                     AGTPSTQPIGRPLVPLPPILSTGAAASSSSPLSLLLPPSAVSGSFLSGSGHINSGGVA
                     GGGGGGTGAGGAGGFRSPLAFRYPFTSVLTPQAHHQQTHHNHHSTAVSPHPCLFHRHA
                     SVRPTTPLQLPPPQSPALQHGFSPPPSFHQQQQKQRPLDPSTPRTSMMSIASSSSLYS
                     GSLPPLLALGDPGPAPGSSSLPASSLTFMQGGGVAVATAMSPASAHHTASEPLAAARR
                     APRVHSPLLLPPSAAMPSFTSPSFGTVPWSSTSSPGGAGRTRQSSLVLLSSTPGFPST
                     PCLAPGQAASSLTSAPTTSAVVAHKEADRGDAWSANAAGSGAIALRDGPQSRDQQQQQ
                     QQQHHSHHRLHAVNHLSGRRVAAQPVVCPQAWRVLEVSGDSSCSVDNSRDRAAEWCSG
                     DGQQRLSIASPANSATARQPHECEVPRGVAEALRSPEMSREGDDSEATKHLWDNETND
                     ASNGDGDNLEEEVVASEDEREASLPMYRCRRGKNSVAVRDTTPAAPPARPPRAISLHS
                     RSGDSSHPLEHIEEAPEEALAVERGFSTSSILAPTPPRTPGRASSSSATATTVTHERH
                     FWVSSLASFSHGKQSAAAAAAPSCRAPPTAYTPTRSPFSVAPGCRWARGSGAAARLTD
                     RLSVSSASFASPMSPSYRKTSGRAVNSRSNSSLGGRCREAPMRRGARSQRASSVTIIG
                     VAEDESVPISVRGTTSPRPGSTAAGAARRRAASVSTRSAHVQATPTSPAAVSPLAELL
                     LSPLSRGTDSGAHYRLNASCNGDMPTPDMAAAAAAAVQRLHRKRPNPIPPLSTAPASS
                     PKASAATQLHAGAVEAERDASARAEASLQQQRRERDVIKAAVAAATTETEELSDPLPQ
                     RRSNESSRSLHRTPSSVARAVAVALRRPWLSEDSAGGGVPLHNPFPCIPSLLVSSTRP
                     SWTAAVDPATVADPGEPSAKPSQCIQEGEATEAGAAAVTQLRTSVVSTEVSVVDDAAA
                     DGTPEVLRQQRAEREQPPSPEEQQARPGGCFKYPSSSPNFGVALTAASTAVLAAPQSP
                     SAKAAVSATTPASRRRYNRVDSSPPPIPLATSLIGTAVTGVSWLSSRNEK"
     gene            <116648..>117580
                     /locus_tag="LMJF_03_0370"
                     /db_xref="GeneID:12981481"
     mRNA            <116648..>117580
                     /locus_tag="LMJF_03_0370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721665.1"
                     /db_xref="GeneID:12981481"
     CDS             116648..117580
                     /locus_tag="LMJF_03_0370"
                     /note="previous protein_id=AAM69003.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721713.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981481"
                     /db_xref="GOA:E9ACI2"
                     /db_xref="InterPro:IPR000791"
                     /db_xref="UniProtKB/TrEMBL:E9ACI2"
                     /translation="MPDKVGIFVEADVANPNEPATHASTTAAASTKTADKGTKMVRRR
                     CGRPRKVVVYYFDSDAENDEGVADAVENDSITSQGEELTSLRRCGPQNSPEHECCCSH
                     CGHRRAPAQKRISPENPRIGSPTPLGFFAFGMTTLLYNVHNANICRLNMATMGLILIF
                     GGLTQFVCGFFELINRNTLGCTISTTYGAFWGATAVLFLWPESSYVERGDNNYMGGFF
                     LLWFVFASSLFASSFRSPFTCMALLFLVPLNFLLQSIGFFLNSNTVAHVAGYLGIIIG
                     ALATYLGMAFTLRDVYGRSMLPILFQKRMRYVEW"
     gene            <120627..>121739
                     /locus_tag="LMJF_03_0380"
                     /db_xref="GeneID:12981482"
     mRNA            <120627..>121739
                     /locus_tag="LMJF_03_0380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721666.1"
                     /db_xref="GeneID:12981482"
     CDS             120627..121739
                     /locus_tag="LMJF_03_0380"
                     /note="previous protein_id=AAM69004.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721714.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981482"
                     /db_xref="GOA:E9ACI3"
                     /db_xref="InterPro:IPR000791"
                     /db_xref="UniProtKB/TrEMBL:E9ACI3"
                     /translation="MSTGHVEASGSPLQPLMKGPRPPSNDERPHGVFKSTDGIASNVN
                     DDLRARRSRASYDYLVGASDGRSLGNTSNNFVYHSNRKPTGGRSLEYLDGDQNRISNV
                     AQNLGDHHDDPHCFDSDSDSGECLLDHQIRLLEAKKSAASSRKCANPGPVGLLGFGLS
                     TILLNLHNTGNFPLSTVIVAMGICLGGGAQFIAGMLEWVRGNTFAYVAFTSYGTFWLS
                     LVCVWMLPNTAAGTSNLVAPASEYFVGVYLFLWGIFSFVMLLCTIRMNLAIFLVFLTV
                     TLLFLMLGCSSMANSAIGLRAAGYEGIICGSLALYLAFAEILNEMWDRTVLPVIPMTQ
                     ALGWFGTLKGYKATQLDKRNRSTRNASQQSERGVRR"
     gene            <125342..>126778
                     /locus_tag="LMJF_03_0390"
                     /db_xref="GeneID:12981483"
     mRNA            <125342..>126778
                     /locus_tag="LMJF_03_0390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721667.1"
                     /db_xref="GeneID:12981483"
     CDS             125342..126778
                     /locus_tag="LMJF_03_0390"
                     /note="previous protein_id=AAM69005.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721715.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981483"
                     /db_xref="GOA:E9ACI4"
                     /db_xref="InterPro:IPR000791"
                     /db_xref="UniProtKB/TrEMBL:E9ACI4"
                     /translation="MRSNLCTRRSRASYDYLVGASDGRSLGNTSNNFVYHSNRKPTGG
                     RSLEYLDGDQNRISNVAQNLGDHHDDPHCFDSDSDSGECLLDHQIRLLEAKKSAASSR
                     KCANPGPVGLLGFGLSTILLNLHNTGNFPLSTVIVAMGICLGGGAQALHCCRFPSLLS
                     SALSLFSVDTHTHTHTLPLMHLLLSCTLESTQIAPAPEISGLSSPILSLRVDPASRPA
                     DTRTCSCRKQRRHSCLHAAVHVRMRVCVSSPRGEGQAWRSTNEACINVVDVTTSLLGF
                     SLCAKPASSPTHPPHPLPHVKKRAMQRAEVARWCGARQGHCVRVIDGGRVSVEGEAVS
                     LALARRLMSLALLCRRYPPPHAEMSNTYGYTRPNAGMCVCVCARGHLGTYVCCGLLAS
                     SSSSLIFLSLSPRLSVSGAPPPSPSLYRPKTRVRCSRLDDIEPLPPDLGIPACIFVVG
                     LFPLACPPSVGIISAAAHPELSASLPLL"
     gene            <127150..>128061
                     /locus_tag="LMJF_03_0400"
                     /db_xref="GeneID:12981484"
     mRNA            <127150..>128061
                     /locus_tag="LMJF_03_0400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721668.1"
                     /db_xref="GeneID:12981484"
     CDS             127150..128061
                     /locus_tag="LMJF_03_0400"
                     /note="previous protein_id=AAM69006.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721716.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981484"
                     /db_xref="GOA:E9ACI5"
                     /db_xref="InterPro:IPR000791"
                     /db_xref="UniProtKB/TrEMBL:E9ACI5"
                     /translation="MSTISGLNGKPAHEPVTSAAQINTDLGAFHEKYSCGNVSQTALG
                     RQDPLALNTNGKSLRKNSLRLKRKRLCELQEWEYQAATAPRRCANPGPVGLLGFGLST
                     ILLNLHNTGNFPLSTVIVAMGICLGGGAQFIAGMLEWVRGNTFAYVAFTSYGTFWLSL
                     VCVWMLPNTAAGTSNLVAPASEYFVGVYLFLWGIFSFVMLLCTIRMNLAIFLVFLTVT
                     LLFLMLGCSSMANSAIGLRAAGYEGIICGSLALYLAFAEILNEMWDRTVLPVIPMTQA
                     LGWFGASPEKASDSAELAYHDQPPKVN"
     gene            <131769..>133820
                     /locus_tag="LMJF_03_0410"
                     /db_xref="GeneID:12981485"
     mRNA            <131769..>133820
                     /locus_tag="LMJF_03_0410"
                     /product="putative MFS transporter"
                     /transcript_id="XM_003721669.1"
                     /db_xref="GeneID:12981485"
     CDS             131769..133820
                     /locus_tag="LMJF_03_0410"
                     /note="previous protein_id=AAM69007.1"
                     /codon_start=1
                     /product="putative MFS transporter"
                     /protein_id="XP_003721717.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981485"
                     /db_xref="GOA:E9ACI6"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:E9ACI6"
                     /translation="MPLDSKEPHRRAAVDAAQQPSASVKPKTPSNTVLAFALREEENH
                     IDDAALVAAMDDENADPLLHPAQTRALLHIEQREENRLRGDPWRFAVAPIFCLLSISN
                     AMQWIAFSPIVDEVRTYFHMNATQVNFLATTYVIAYVVIVFLSCKLYEVTGIKIGVLI
                     AAAANALGALLKIIALYAWPNAALLYLAQVSNSFTEVLTIATPPLISNRWFPEKERMV
                     ANTVMSSALNFGCGIGVLVPTFFVGPDKQSKKHFGNFFWFHFVYAALVLALVVFLFPR
                     RPRYAASHVAARQQNREERRLRALDHVLHRRHSDEDEEESDNRPHPHAVQKRGVAKSK
                     NEPLVAGLTDACKEGSCDLAAVAAGNQCASSSGAAVEHGIDEIQDAESESEREEPEVQ
                     PVNVFSVLMDCFREFRSNWSFILLAISSAAELGLIWGVATVLPQMLAPYGISEAMAGW
                     IGFLNLVLGTVVCPFFMPLVDRYGRRYKLLLCALSVMVVLVMVLLTLLLHLGPAVHED
                     SKYYVTAVFVLWGGVAGICQNFMMPLMFEYVVELTFPMAESTSAPVLTWTACLTNFLL
                     TLIFGEVLTDTPTENKALRTFIGATVVSFIGCVTLFLTKPLTKRTDYEKHQAEALEQR
                     KMRLQSAAAVAVGMDGACLHHGVDGAAVGASAVPPPPPVTHRNSAHSHHDGDATEVKK
                     A"
     gene            <136729..>141879
                     /locus_tag="LMJF_03_0420"
                     /db_xref="GeneID:12981486"
     mRNA            <136729..>141879
                     /locus_tag="LMJF_03_0420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721670.1"
                     /db_xref="GeneID:12981486"
     CDS             136729..141879
                     /locus_tag="LMJF_03_0420"
                     /note="previous protein_id=AAM69008.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721718.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981486"
                     /db_xref="UniProtKB/TrEMBL:E9ACI7"
                     /translation="MPRLHAISQGLWHHIQQQQQQRPARPMQLAEPTIGDVAAQLSPM
                     TTPAITQVWMVGVQEGENGTVLVQESPRIVHTQTSHAQQPHPNSEESHVRSAARTMHR
                     SGRAALPPPRDALTNSEVVVCGDDAENSFHRRRERRPRSPSPSTSRTLEELFNEELIG
                     EEQRVALLSTHQRTITAGEEDLFSKASTRSHRCIAEAGQRVMTMTNASSQATPRQRTV
                     DEPLRVWLPRCVNALSTLTCEGSPPITRVAARGNRGQVRLRTAPPRRRASALLLATGD
                     GGADSAPPDYAGDGDDGFPVALWRRTPPRAGVTMADADGAPTSLLSSPRWCVTAYEPL
                     SLSLPATARCADGDGEGPVFQQAPISTTTLSHLSSTVDSSILGRSGAREDEDAVIDAV
                     IDAEDDEEAAAVGTCRDHRPPIAMASTHGSAPTATVVTRVYWGAAPPLRGMAPSALHH
                     GGATGMADDGDAGGDGAAFAGRRSSGQSIRSSVQGGGRALDQRAQHFSVAPITVSSSV
                     VATGRPGQHQHGGARGYDGVGAHPSRSSATAAVHRHEPFGELPSSLLPVMRRRPPAVP
                     APDACVPPQSMELRITLPWLLHTSTLPPVAAEALARCLGAHIRAHLRPEGAAQWTQDG
                     ACRPRLSGTCAPGPAAAHPQPGSSRGDDPPPCWVAAFAYTEGIQIYATNHAASLVHAK
                     ESTEGCESSRDCLASPRHDPCGLAPEAPLDRISWPAWVPDAQTSVRMLAALTSGAFQL
                     IEVIARALDQATAAGNSPAAAAALADMDTAEGGNTEARSVRRAAYNAGGQLHIGSGTS
                     RSSATLSRDPATVLHQFHVFSEAIFGDAANKRLCRHVRDRLPLHVQDLSELLSRPWCG
                     GAREDEDGDVATTTTAVAATGVWRARCPSMLDLVHHLARAWMTECFAGLANRLHAFLI
                     THDPGVVLDLICARANDRNDAVPHDNLCNSARLLKRMCAEERDENACAHQRAPVPARE
                     RHRDQRECHGCSAHSRAVLAAATAAASVLPPHALIYRGVAEFTHGPLQRWERWCLSPS
                     STPAAHSLATNATASAAAMQWSTHVNYATVHSLQWVLRHPLDAHAVADNVRQSASKLA
                     AVTDMLALLELLTLMPPLLDTTALLMYQAEAVLRGACACVMGNAGDRGGGGTAIMTSG
                     AHSHNAITGGIRATRSRAATQGFHEYYRVFLGLVCYGAMQLSDAEGMALLSRPRPQPT
                     GVEPSTAAPRHHDAASPLPELRSAQATVDGLWTEYILPLVVGYVSGSGTGAAPAARMD
                     ALTAADQCITYALMLLQLLRLEGRSVRHGGRGCAQTPAFPNGARQDVPNSGVSSSSRH
                     RRKRARSAAVGGPEPQSWGSLRSAGSCGEDARPRWWAPSPANADEHPPTARSPQPESV
                     SSSAFTADTATTTTTTTATTRWCANSGLDSINEIERVGETMTASRYMAAPAFAHAPRP
                     GHRDEQSVAHNAAGGMADGVVGVSPTEQTAPPPHCIPPLELLAEGDAGEAAAAAGTLQ
                     FPPCPAPPPDWQGVCRQLIRRWLQPTSDCHGRGCRASNFAEVAAQHPKADDSATVRAT
                     CFPGGRSQFLDVCEAGSGYTLHRRDVRRVGALLAGLAQRVAAVREEEQGAHAVSPHSD
                     SAGCCYDYLYGVLPPGLRARDAGLITVTSTSSSDDGEDSDTDSAGEGAETNDNLCNVN
                     ILRCVASTISTSTSTSTSSSGSSGHSTLGTTPSATLVSPLSSSLATSP"
     gene            <142923..>143258
                     /locus_tag="LMJF_03_0430"
                     /db_xref="GeneID:12981487"
     mRNA            <142923..>143258
                     /locus_tag="LMJF_03_0430"
                     /product="putative 60S acidic ribosomal protein P2"
                     /transcript_id="XM_003721671.1"
                     /db_xref="GeneID:12981487"
     CDS             142923..143258
                     /locus_tag="LMJF_03_0430"
                     /note="previous protein_id=AAM69009.1"
                     /codon_start=1
                     /product="putative 60S acidic ribosomal protein P2"
                     /protein_id="XP_003721719.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0430"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981487"
                     /db_xref="GOA:E9ACI8"
                     /db_xref="InterPro:IPR001813"
                     /db_xref="InterPro:IPR001859"
                     /db_xref="InterPro:IPR027534"
                     /db_xref="UniProtKB/TrEMBL:E9ACI8"
                     /translation="MSAETLACTYAALMLSDAGLPTSAENIAAAVKAAGVEMRPTLPI
                     IFARFLEKKSVETLMAAAAAQAPTAASAPSPAAGAASAAAAGGKVEDKKKDEPEEEGD
                     DDMGFGLFD"
     gene            <143874..>144209
                     /locus_tag="LMJF_03_0440"
                     /db_xref="GeneID:12981488"
     mRNA            <143874..>144209
                     /locus_tag="LMJF_03_0440"
                     /product="putative 60S acidic ribosomal protein P2"
                     /transcript_id="XM_003721672.1"
                     /db_xref="GeneID:12981488"
     CDS             143874..144209
                     /locus_tag="LMJF_03_0440"
                     /note="previous protein_id=AAM69010.1"
                     /codon_start=1
                     /product="putative 60S acidic ribosomal protein P2"
                     /protein_id="XP_003721720.1"
                     /db_xref="GeneID:12981488"
                     /db_xref="GOA:E9ACI8"
                     /db_xref="InterPro:IPR001813"
                     /db_xref="InterPro:IPR001859"
                     /db_xref="InterPro:IPR027534"
                     /db_xref="UniProtKB/TrEMBL:E9ACI8"
                     /translation="MSAETLACTYAALMLSDAGLPTSAENIAAAVKAAGVEMRPTLPI
                     IFARFLEKKSVETLMAAAAAQAPTAASAPSPAAGAASAAAAGGKVEDKKKDEPEEEGD
                     DDMGFGLFD"
     gene            <145022..>150133
                     /locus_tag="LMJF_03_0450"
                     /db_xref="GeneID:12981489"
     mRNA            <145022..>150133
                     /locus_tag="LMJF_03_0450"
                     /product="conserved TLD domain protein"
                     /transcript_id="XM_003721673.1"
                     /db_xref="GeneID:12981489"
     CDS             145022..150133
                     /locus_tag="LMJF_03_0450"
                     /note="previous protein_id=AAM69011.1"
                     /codon_start=1
                     /product="conserved TLD domain protein"
                     /protein_id="XP_003721721.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981489"
                     /db_xref="InterPro:IPR006571"
                     /db_xref="UniProtKB/TrEMBL:E9ACJ0"
                     /translation="MERLPTGAAGGDAAETAAVPPGITVGGRPPSRASTSTASPPPVA
                     TQLTDTQLLQLSLRNAVASAAAGKATVAANNYALVIKIIFRKCFLLEELVLLALAMGY
                     ETRKVAHTAPPHIAGDDGRKSSGPGGGAAGTGPHDCPLSAGAAHEQLVDPLVSVGTLL
                     PPGLDEDDYEGECTYSEQKEQREQQQRHQHVWTTPAARDGASIASTVSSARPTAHDST
                     PGYDTATARWLACLLAKVHPDALPIATLEKICKVPLTGSPNAAASSPARGGAAARRHV
                     TSTTSAASIGHWPSATGANDSPSMSTVAVLPLLPSLKSSPTASPPGAASPMPAGGRRD
                     MSTGSPNSNGDAAPSLGAAAPFSTSLSLLFATLLWDVACALWNEGFIEDAHHWLSVMD
                     VRRLWKLYEDLCRGGEAAADGCHEQPAAAAPSPSRLFAFREPPEESVKSGDRACALSW
                     PAVLAESCAADVSRSSAATESPSGGAGQTIHSSGAQQEHVVSSTAVPQPRQGILLSAL
                     AQVGGPLPMTDLTACFTGPAELEVGNADKDAVTAATQSRTEERSVGDDAAAMHAETRT
                     AALATFVRRLARRTSALRDLCGFMIACETAEDVFYVMYALNSALVTQQWKYGQQQERQ
                     RADDAAAAARGAAATTASTTATTTNGGLSELLIIANLLIELFITKRAQQLLLEEGGLD
                     EFASGIAAAPSPLAADGGGGSAEDASRRLSRQQQRRRTDRAIRRACDEVVCAFTNGRC
                     LTLYALESYGIPPPCDGDSSTVTVQLLAPELPFVLVSNLLSSTLNYSTRYLFSKVYHG
                     VMGCRGVDAAERHQEAGIGSPSPSSSAAAAAAAAASIPSHPNRTRRATDEEKERRRAW
                     TRLPDAAAAAAPQRTPPLHAHAAPTSASATITASVQSVAGELFGLMKKTAVNWRDLGN
                     RGHAGVAPQSCGGGNCNYDCRHHHQDVRPSFSMADAPGGDPLLGREGGDGYAERLAAA
                     RREHRAAAGDGGSKERVQLGEATPWSAGSPATVTSNNSSLADARSTTGAYPGRPDGDA
                     PSVSLPCRAGRSRGCALKTRGVGAAEMMLPSSSSIAVSLLAEENELTGLGDAVSDLYL
                     APAAPASQEEAPPSAPQPAATVVHTPAAHLQSRSPSEALSLRLLALLYRYPQLHTLEP
                     VTASHVDLVGKELNKALHILQTAMRDRFGDGWWLQWRSRREGETQRYYARALTDAQRG
                     GYPLSLPATALPSSPARAAGAAGAAVVPPRTIGMSAVQPDPSLLLVGARPWHASVAHE
                     QDKVNVWGLDARGCSGVPPPSAPPPSSRAHTVLSDLWCTRTLTIPTDEELRKPVQDLR
                     RHFTGTTTASAASRETATAATDTAPASAAAMHGDVQAAGMLLDVDWDIPPVYTPDVSL
                     DFSAFTTTSVETQESTRQLVESLQQREQARGDDGDGSDNDYSCDDAAGAPGVSVLSRA
                     CRRLLHNELPLLQQYSPWRVIYSTRMHGVSLSTLFSNCRREVERQGLSGYAVDSAVTT
                     TLSDSKPMLLVLELPASTTLQFSEDDAGVREAWADADTSSSTTRPEARWQADDGGRRH
                     RRRNKLFVGAFLSDLLRLESRRYYGSQDCFVFQLLVPGTVEGEATASGASAASAGPQL
                     RVHRATRSNTQYINCRATSIVIGGGEGGSSIYLDDTLCHGATSACATFASPPLSTWVS
                     TPCEAAGDGADGESDVHRRQKSLCVLNVEVIVMDA"
     gene            <155368..>158556
                     /locus_tag="LMJF_03_0460"
                     /db_xref="GeneID:12981490"
     mRNA            <155368..>158556
                     /locus_tag="LMJF_03_0460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721674.1"
                     /db_xref="GeneID:12981490"
     CDS             155368..158556
                     /locus_tag="LMJF_03_0460"
                     /note="previous protein_id=AAM69012.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721722.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981490"
                     /db_xref="UniProtKB/TrEMBL:E9ACJ1"
                     /translation="MLGRSAHETMRTSTLASWQPRGTDSALSLSPQQRPSPSLRSPPS
                     TPQQRDGGRHPYPHHHRHQYQQRANQQQQQQRTPRAGAVAPPPYSDRSDAASAGELVS
                     PLMRSPRVSSPLTSLLQHQQPHHRRYRSSLPAPPPLRSLTLSSDRVSLRLARAHAPHH
                     QQRTHYVDQSGRTATRHAPPLSIAALEEHNSASATARHGPRAHNRRRTRGRSNVRLHL
                     PAPVLSSNQTEDKAQPSTPVDQRIPAMVPPSYDMYNLDVPGAGMRAAAAAATHGAYAS
                     SSPTSQAHQLKTAQPQPQLLHTLKLVDGVWRVVVPPQQQPPTSGPQLQHCTAAHPHHG
                     NPACHSPSNHSCDWCGGLDNGEAASATEAASPIRCRGANSPTYRTPTTTPFTAAGTPC
                     GVSMSACGGEWRSPCLAAAKMWCHHQRYPLPCHARTTPASVAMRSSSVGLSDGVDMAL
                     SPVSTPARAPRTPRQQQQQQQPHLLHGRHGVHHHCDAHSLSVPSLASEEAYAMCGQCS
                     TPHEADLAAGTPSSAVPGAAASVARRGYQQALVTPTIVIARATPATARDVLTGTTVPA
                     SRWGFTNSAAASTSVGPTLQHDNARTTLSSIDSVSAATAAADGGRGRAVAVHDDDDDD
                     AALLHASSSAYLRYQRNADFLYAVDCADECETAAVPTARGDTALGNAFMLAAAQATAA
                     MDSSVTVSRSASSSSPAPSSVYYSPQQFRVGDLQQSAPATATTTPALRMRQPHNWALY
                     GQRVTHTVSQPSHAGGGSILHSCATVTPLRCSCRDAAGWAGPNVLTTPPSACCGAPGT
                     GEGWRSPMQWNPRQARDDLEMEAVKHVAQFALAQVAATAAAAPSTGLSSVSLSPSYAT
                     VSWNTVAQEAVVAVSPSHARNASPAEEARDDSVSQYTVALDGEEAAAEWLELLLHYRD
                     RENESGRIRRALVDAAATAQTPPEAGGSSNPSAAAAAVTAATTLSWWATSSLMREGFP
                     SRGNGIALQQQQQQGRQRHHAGTLPAVSSPSMTTATRAALAPPPAQLCTAMSAHRAAR
                     TISRCVRHNVWRMRENERQRVSASVAARVAAR"
     gene            <163288..>166305
                     /locus_tag="LMJF_03_0470"
                     /db_xref="GeneID:12981491"
     mRNA            <163288..>166305
                     /locus_tag="LMJF_03_0470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721675.1"
                     /db_xref="GeneID:12981491"
     CDS             163288..166305
                     /locus_tag="LMJF_03_0470"
                     /note="previous protein_id=AAM69013.2"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721723.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981491"
                     /db_xref="UniProtKB/TrEMBL:E9ACJ2"
                     /translation="MFLRFDCRFRGCGGCACRSTGACRTAQSITAAFSLFRTSMHRCS
                     SMAPLTQRCCGVSASSAIRSSSWEARTRSFVLFCIVLLLLACHAACAASSTGDEGIEH
                     GHASGKSGAAAHSIGGIAAQSTSKQTGGAASAPMRHTAGTTRAAGLLTCQELYAKRAS
                     SSSLPLSGDCVLPRISKELSGDRRDDLLQRASSAEAAARILTWHIGPRTPAHQAPLQS
                     TFPSYFMNVSTAAAATADESRLSSGTVGGVQGELLPDAATAWRVRSYNALCSDEGRAT
                     AGSLSSGRHRGTAGVRSGAHGSNVQAGKRGGDASSLPFMKCMRAVVQPIASVVAAVVD
                     VSGFGHYVRCSATEVIANVRVFAWRSGTAWAQVFMRRRVALRIPIGSWSGGAAVAAAA
                     AADEGDTKSGAGGGDGKAKSGMPAHVMLSRMAMSTHGSVSLLRVISFPPVVQLVPSTQ
                     SKPAAASFVCSLPAVHEASLLLEEDAMARRREARQAAVAAGVVVFPRGRRQRARTGPP
                     SSPPIPPLWIVSIMKDVVCLAARLLSGVSREDDAAAAAAAAWSRAASISADDGVSRSA
                     AVAAARGFRARVREELGPHQNFGESVLPIALQQMLGSRTMHTHAQLVENEVVVAGEEH
                     ETFYMQWEASLPAGKPMCLALVALPPSSPAVEAAAADILLQSSAAADHLPVSLEETCS
                     FDILWLQMLFMAWVVWQLERRVAQSTLVKHLVTGLSGVLLLLLLLLWYVIRRLQGTSF
                     QLAMLAMALLLGGSTAMTDGLLNVVKSIHYIIMSLSEPASGGGRGWAGAEGGGDADDD
                     SSTSAPSVFVVLGSGLLVLVCVGSGILLNWLVPPAVLRATTFWCVRALLWTLWGLCVL
                     RNTEATVVAALLWTLWQARSLARATPRFSSPARRGTSVEFSVNDPLEEVPHDARQARG
                     YVTPLAVSSWAATSGGSNTGYASLRTSGARLKRYEEEGAEYTRCALEKLAAHLRANPG
                     RYATRLLDPNGVQHWAGAASTETDEEAEEVAAA"
     gene            <167878..>170907
                     /locus_tag="LMJF_03_0480"
                     /db_xref="GeneID:12981492"
     mRNA            <167878..>170907
                     /locus_tag="LMJF_03_0480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721676.1"
                     /db_xref="GeneID:12981492"
     CDS             167878..170907
                     /locus_tag="LMJF_03_0480"
                     /note="previous protein_id=AAM69014.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721724.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981492"
                     /db_xref="GOA:E9ACJ3"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:E9ACJ3"
                     /translation="MMLRHMKGMWDQLVGLDEYLPGTPNPKRWHYHNPADDFPYDTMG
                     RRNLASAAEQHRGRTAAERLFRENDAVRRRQFPSCFEEACAYGNLQAVILMWAQGAVD
                     IPTRQAVYEGNNASSLMWAAFKGHLSIVRFLVDHDAPLGAVNALGHTALQWAITGGHT
                     DVVRYLLDHGADPSHRDRQGFDASFAAVQTSHLALLLMLTEDAAREGRLLQTSDHGLV
                     FYKPSSEQQAQAATRENPRTKRSYYLLNPQQRDVEGHTLMHWAAYRNSPATCQYLLDH
                     WGYDVNAQDNHGRTPLVWAAREGFSEIMELLLSRGADRHIADSDGWTALQHARVRNHP
                     EAVYVLESYPVSSLTAATAATTSDNALADREFSQLADSVKAALLEASAEATINTTSRG
                     RYVCVRDRRAAGTLRMIRTDTTFAMMAIAGPVYVALTFFLVKVLPPIASYLPFCMFFF
                     KNVLWSMLTPRPTQTSRSGPPPPLIKQVGMAMSIAESVRGTWRFRLRDPINLFIWLTF
                     LVVQVWAWNSLGLVSLFSLFGGDAAAAEERQAASAAAAALWGTSATSTADGTARQPLI
                     HYFGLSLIRLLTFRSSPLDQFQADTAAATPAFVAAEKAYMAQSNNLVRCVLMLLLLTS
                     VTCAVLCKLLAGRSMMRASEEGTLRTSPLWHILASRQYRWLHPRLFSQERHMQIPLRA
                     FYCRERDVVVRGYDSYSSLLDSPIGRSNHLLFVLSLTCFALFELLVVVWGTQQTRVLL
                     RCPERVPWYRDAFFAFQTTEAMAAAVAARGTMSVTTWNNTSLQAATPSMLAAATPVLS
                     FAWLNTAMEVWLHGLPCRQYRLLDEITMNYVKAAAASAAAAKHKPSILVSYVHRGVFL
                     FRYYLWPTRASMLGVWVLHYSAIAAVLIGCVAVRQWIGVWCGATRMELANPLAQGSDG
                     ELVSIFPKDAQQAQRVVPIDDDEERYYATVCPPKARTSTTGRAAAAAEGGGRCLYAEG
                     NGIVNVLAFLLGRNGKRWVGAMTVSSHNAPVKTPMLL"
     gene            <172565..>175633
                     /locus_tag="LMJF_03_0490"
                     /db_xref="GeneID:12981493"
     mRNA            <172565..>175633
                     /locus_tag="LMJF_03_0490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721677.1"
                     /db_xref="GeneID:12981493"
     CDS             172565..175633
                     /locus_tag="LMJF_03_0490"
                     /note="previous protein_id=AAM69015.2"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721725.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981493"
                     /db_xref="UniProtKB/TrEMBL:E9ACJ4"
                     /translation="MEVCGQKRVAATALNAVQVDAVAALHADSTIPRARKEDKESCSN
                     SHASAKCAQPPYTRRSGGGSSADGDDSAPDKRADGKDNGEEDEEDFVVDELDLYCSTP
                     ALLYQSPVADITWSDAAADLYRSSAKAAVSAAPPAGRRAVAALSSACAPSSSASSTVS
                     CKPCGRDTPVDESHHRDGDGPSGEPSVVSGEEGSEAGDRRVAGAPSHPQTAASAYLRG
                     ADDAGPTASFGGRDAAAPTVSSSRDNGASSGQSDGVAGQARASVEAKAKRSAKRDNYG
                     ANADADVCSPTPSPSRPASARVSSSSSTRRQGWSVNSDHGRGGGKHGAGDHGGSGGVA
                     SMSQGVAAKSTPTATVDAQALSTPLLRLSAAVTTATLPPVRQASEAEAGPYMPPLMDE
                     FDGELLQLIKAYYTRKQSTAAAATPLYPLPPPHAAASSSSTFPSTYCAGHALNRMQSG
                     CSSGSAGGSGGSRLAETAAVAEKRESGSGSDALHNLRRPLLSADDRHASSGLLRDPFA
                     APHAAGTAAVRDKASERGPQELRGRHPGDPPSSYVIGPSDDAARDSAAAAGLRPGEDV
                     LHRPPCRGMSRVCVHGDSTCVSFGAAAATVAAASFSQQQHPSTTAATLYNPMTLGEAG
                     RGQHRAAAANGAAILAEGAATLHHQTRSGTNISGGGGAGGALSGGITSGLSALSSLPS
                     YSSTSFVRAYVSDMSLSLQPAIIVSALTAAFNIIVVYFLQQHVLDTRDHLGLFLIGSY
                     MTFASYYMIYYFLERFSDSFRRIASQDKKFYIIGNLIKAGILISITPFACVHLVKIIV
                     FEEWESNILRNLGCIYAIPDFISMVIVRRMRWSTWVHHACVVLFNYFSIMNNYQHENV
                     CRCVVVYAAFSSFAYCVNVLLASRFLGVSVNVARVLSFVALVVYALCCAVNWAWQVYY
                     LRRLLISGHDHWTVYVYMLLISLVMWDDIVLNSWLLHHARNNAYVASQHLQQQQQRTR
                     QQQQQPSPASSRLTSARVSQRPSPLYRSQDTRAVYMAPPLPPTGLPPRAP"
     gene            <176969..>178687
                     /locus_tag="LMJF_03_0500"
                     /db_xref="GeneID:12981494"
     mRNA            <176969..>178687
                     /locus_tag="LMJF_03_0500"
                     /product="phosphate-Repressible Phosphate Permease-like
                     protein"
                     /transcript_id="XM_003721678.1"
                     /db_xref="GeneID:12981494"
     CDS             176969..178687
                     /locus_tag="LMJF_03_0500"
                     /note="previous protein_id=AAM69016.1"
                     /codon_start=1
                     /product="phosphate-Repressible Phosphate Permease-like
                     protein"
                     /protein_id="XP_003721726.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981494"
                     /db_xref="GOA:E9ACJ5"
                     /db_xref="InterPro:IPR001204"
                     /db_xref="UniProtKB/TrEMBL:E9ACJ5"
                     /translation="MIHPYLWIAVVGGFVGFLVACGNGANDLANAFGTSYGSRVLTML
                     QIVVIAAVCEFSGAVGLGSEVATTMSSGIAKLSTFEDDPYVLMYGFLCTLGATFIWLL
                     VATLANLPVSSHHAVAGGIIGFALVYGGGDAVVWAGRKQAFPYVSGFVPIVISWFVSP
                     LLAGLAAAVLYSMARFLLLERTFAVRLAPYLMPVVVLIVFFLEFIFIFLNAARNRLSW
                     SSGHAAWMAIAVAASVAVLSLGLVPVMKRRIESIRVSGEKCGAEEGCDAVEAMRMKMT
                     GARASSIRTFKTRRQAGEHLMAEKQRRKARKTPANLVKTEPIEEGSNEAEDARAAKKL
                     GLASRLVYGAVVRDESSDVDSPLDENVNGAQGSSDEVDVAHETAIDPKFNYLKYDESG
                     VRMFDPRAEYMFRMLQVVTAACTSLAHGSNDVSNAIGPYAAIYQVYRTGNVASAANVE
                     VWLLCLGGAGIVVGLATFGLPIMRLLGEKLAVLTPVRGCAAEVATALVVSLASSYGIP
                     VSSTHCITGAVLAISMVDIGFRRVCWALVLKMYVGWVFTLIVTAIISACFFAQGIAAP
                     VPRGSR"
     gene            <181357..>188820
                     /locus_tag="LMJF_03_0510"
                     /db_xref="GeneID:12981495"
     mRNA            <181357..>188820
                     /locus_tag="LMJF_03_0510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721679.1"
                     /db_xref="GeneID:12981495"
     CDS             181357..188820
                     /locus_tag="LMJF_03_0510"
                     /note="previous protein_id=AAM69017.2"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721727.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981495"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:E9ACJ6"
                     /translation="MDTRAAMSASSTKMDGAAVLVEKSATASKPSGAAGSSPSARCTP
                     SPCTGSPTSHDFQKSVLPPSESSTRGAAAVAHTAATDAAMPPSLAPSATPPSTFKSPA
                     ASPVFSPQMPDSNTNTSRAALGVSIAVEACGAAAQTLSAPAATPSSPALPPSAPSPPA
                     SAWLLPRDDVTYILSSLTWNVDLLRLLLPHAPCPLHLPGAEPLAEVPSPTAGELATST
                     ALAAAPASPTLLSSDMNEEEANAEAGQEGSTVKCAAKSIVDGAATVCGASSAGTLQSL
                     KADKRGDTSSVASKMHTSGASAQEAHHTRDSPAAVTDIVPNPRSLSPPPASSSSALTT
                     SVAVSGTSGAVSTVPLTWSQYLFRGAGGGVRTVVGSQRNGATSVLGDDAARARQQPQQ
                     QSSLVRGQAPPPAFVHGVGRGLPHSHSDGALVREPKTSAGTPAAAPNSAYVSSSIFHA
                     QYLPSLEEFQRQLEEHKHQQQLLLRQQQQQPPTLSATRLQQHLQQQQQQQQSQPHHYH
                     RRRAATNKTFFYSPTPSVLSFATTAATTTVSASATDEGCVGEQQRCQLSCSGATVTSP
                     RSPPLPLAEHRSHAAAASGTWSSSLPPSPPVSSSASQARRVLQQPQRLLGCSGLRLRP
                     CTSSTLSLDNLDSGGGGGGGSDNEEAGGGIGATAETPSVRYPTPHSSRPSPSQPQQQS
                     IMMLRAADQLRVSIVSSSAQRRSPLLLHTGDGRTSRDSRGSSRTTARDDDDENEEWAL
                     SRRGARGSRGVRPSSSLPASPTVSISSMSFSPVWSTTLSGRATPRTTLATGVGSSVAN
                     HNPHFNGSSFGGVGHASPYSAAKGRKNARRRRKPTCTRRRRIMRVYVPSITEGPKAAS
                     LYTAPTAEAQELLLQLQHRAAMSLLSGPTAKPLAGHSATATAVSPASSTPRTYAMAAG
                     VRVSALPAPTASATSPAIQPCGVAASPRPSTFAEAARAKSGNGSGTSAGVLTPGQVQR
                     QQRGFTDSSVPSSTAPRNPGEAEQTPHLLTLPQSLRSHETATDLLSASWSGVAAAPPS
                     AAAAAPTPRSFTSAGSSSDGGPGDLGDEVGEPGRAEASMSTAADTSAEAHNRPLSAPA
                     SAAGSVTPVELPQWVRERPLSALYYQPWGLELLARYEASRHEQQLMRARTLRRLGLGV
                     GSSTAVAGAAVSEVGVSGNKSSPAASMHSSSGTSPYTTSSPAEATAVPHVPVRSRPSL
                     GTSRGGCTSTATAAAAAAEAPPTSSSSTSRVSWAAALRQPQRANLTSGSSGGVGSNAA
                     SAAANMITATTTMNNSSTATTATAAVDLRQRQRPLQLPAVVPEWPPELSAAEEMDAWE
                     EAYYFGGVTTASSSSQQQEQQQHRQTRRSATKPRDRGASDTKKGHPEGKHGTLPTDLG
                     GRVGGSSGQVKGLSSNTLVTCSAAASAAVLKRQQWWLNEEIQPPTLYLSRQRRSSRRR
                     SRVAYPSDTFRSSTARRAGATSAAAELFGRHKDAHSTPTVDATAAAPTCVKALGEAVP
                     VSHTAADPPASSSLTFASSVSRSDVTLYSDGHPRKKAAQLFYPAPSLHGVGAPLPSPF
                     TKLDHRTIGQGAGTSGHAGVLLPVSAAVGTDAMQRGGDIADAQQKQQHVGVGNRAAED
                     EQVEMGASATQLEGSAVEQVVDSSGCDGGEEADAAKSGLQWHPPAWSSADNPHRSSSD
                     RMSGATDSTSTTLAATCASTPAATPPVDVTAPRPCADVDVIFFLQKFMRAVLIVFIAQ
                     VRLQQLQQHQERELQAYPLHDATCPAGAYLLDQHAQVQRMRAKDRDGSRAIRGDPAAA
                     GATAAAASDGGGLSKLERSALAFVRYYLADYRHMITAYVMRDDREVARRSAQAILSPP
                     QASASTRSMLPPSAVAAPGAMGRGTSSAPDPLFQQDVLARWLHATRVKTVYEEAVRVA
                     TQGFPGDADANPPATPVDDVESLRTAQVYISGKDAAWQPLLMELLQVSRVVQCYSDGP
                     VVAATGSAPSASATSPQRLLLASLEKFLAQPTLPLFRHAGSGASATPQALTTTPTSSA
                     APSTITATAASDSLASDLRMTTAPSLTPAQAAAAALMVEESDDFRAYLLSGYVREDAA
                     AAADGSSATASATFAAKPATTALRHSQSAPTLSARVVQQRQHSSASSAAVMPPSTAVH
                     AMSSHPQLQQPQSPSLLFDAGSLLQPLTWYPYAYMPGTANPYAQSADSNSTRITPAKA
                     ATASSMTLYVTMLPLSGRLLWRWVVPAEDTDNFNLSVFFQSSLFSFMQGGSLPMPSAT
                     PEWHAAAIGHGAVGYAPTPMAMLMAPSPSPHPSLTWPPALAARIDAQLRNDAFRAAWG
                     EVSSPCMCGTAAAAVRKGHRFGSELCGEMPEVTLVHCSAGMHRSCGILVAFLLWLLYQ
                     CRQVLRTEQTLGLGPLSCMSAPAPSLPAGDEAAHDAAVKALLLDDVDALAPAAASAAD
                     GGDEEQQKQPAQRTKNTAADADAPWLTSRLLHRTIHHVQQQRSIAVPIRTVQCLLQSF
                     ANELRLN"
     gene            <189457..>192012
                     /locus_tag="LMJF_03_0520"
                     /db_xref="GeneID:12981496"
     mRNA            <189457..>192012
                     /locus_tag="LMJF_03_0520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721680.1"
                     /db_xref="GeneID:12981496"
     CDS             189457..192012
                     /locus_tag="LMJF_03_0520"
                     /note="previous protein_id=AAM69018.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721728.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981496"
                     /db_xref="GOA:E9ACJ7"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:E9ACJ7"
                     /translation="MGDRDSCTQRDSRADRYGGDSDVTGCGGGGGGGSGGGGGGRYNR
                     ARYRREDADDDGYDPFRRPPRQQGGDDGSGNHDLYARRLRRPRTEGGDDGHGAPWQQQ
                     QLTPYMSQDVGVGTGFPYSEMMPMNAPQGFHGGAGGGDFGLPFMSGGAPGAMPFGFGG
                     GPSPNGNHHGGGVGMSSDQLLQFLLQQQQQQQLSSSPPPPRERAEERGDNMKNTGPNA
                     APSATRVLPSVEEFVPVVPKSLMNLVVGGGPPGSGDGDAAAAGSTSSQPQQTGNGQSK
                     ALILLEAPKIGPDADRRAREQRRAHVSGFPLGTTREELEDYFQLLLPEVRRLQTERQI
                     RELAERVGLIEEEGEAAVRHVPATANLASIDEVKSLSVSAGRAKSFSFIELRLADMID
                     ELVSQSAADPHRFLFNSSLDGQTYPLMIRRPRDADPLTGVDESKVVLVGFPPSMPEES
                     IKPVFESYGKLLKFELRNGYAYGEFEELRDATDFRADVHGVVLGNNMVVALPLFDWLK
                     ALLVREGIDVTIEDDDPVSGKYVMKQVRERLPETSALGGAGAQAGAAGGGAAGGDAGA
                     GGSSALVTVSEDPEAASLQIMRELLDMSFTLPDMLGRFAALYPHLRSLYANSQLTVYA
                     TPVLVLLNLFDEEELVYDSNYSQLLADIEEEVEKYGRVKQLVVPRREARPKLPEAPKP
                     GVDYDEDDEAAKAAAMAVYSEAKKNFGAELGRYMNRQTHPVWGGYGRVFVEYETVDEA
                     AEAQQRIAGKLFGERTVVTSFLFPELLTDTNEEAAEAGAQGEDEEGAGGDGASEEAKG
                     GEIDSDGEAVAEAGGEGDEAPSSSQPQKDAEVSGDAAAEVAARTPSVHTEDID"
     gene            <193995..>200246
                     /locus_tag="LMJF_03_0530"
                     /db_xref="GeneID:12981497"
     mRNA            <193995..>200246
                     /locus_tag="LMJF_03_0530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721681.1"
                     /db_xref="GeneID:12981497"
     CDS             193995..200246
                     /locus_tag="LMJF_03_0530"
                     /note="previous protein_id=AAM69019.2"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721729.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981497"
                     /db_xref="GOA:E9ACJ8"
                     /db_xref="InterPro:IPR001656"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:E9ACJ8"
                     /translation="MLESSLLSITGATAAAPDTIVDPGAALHFKALHQAEVSTRGRDR
                     PTHVQLEQIDRRRSKPSLSEAEFGVGMTERLLPELPRLPALHEVHYGDAVVRELDRST
                     YFALKQGNSTSATTLSMNAGASHPSTDSAAAPGNAAVVIINGEACVEMSLDEDLGEAS
                     FSAFDAEAGKAAPTASHATTPARTGAAAASVPASSTAEGQIKSAKGDSGREKCDAAAG
                     GALCIQEDIDASDAAEPGNSNGDDSDAEEDGLSLQLNFGAERPWFVPASGVVQLHPLS
                     PQDCALLLRFVLRLRQQSEVDLVPSLRRALIAAEQQTAETEAGGEGHAKRGGASVMSE
                     PPQASLSSEPATSSRGRRPHLTLADVVRYLDTAPPPVIAFTESLPANSASPCTSSSGP
                     DSTSPAFVFHMYLENISSQNALGHLAGLFGIPQRSFQTHTAASKMSCSTVMCAIAENR
                     VRREHLLLLNTLRHPGFVLRVSDIREVREDVHGSSGDSAGADASSPSSTSQRLFRELA
                     RWQPLYHTEVLLRRVCSAGSTASGSGLSTRQQLEHRLRAVQTVGAICFCANREASLAR
                     AATDVLHNFFRSALLNALQRRKAPVPLTRFLKRPNLATAQHAHHVSTDVTVRQVLKTF
                     IQCNGDWHATVVRTPYVWRRRWINALRGLVWNTMASQRIRKAGREVCLGDVVLKPEYR
                     DDVHRRGIMTVKAEHVMVVTTSAEAQAACMEDVFIPFLRGRYPEHLFADESTGHPIMT
                     RTNMLALLRAMHAPQLLLGFTDEARLLLDIRADVSPLLFRRLLVRPLGLEFAILEDKP
                     PMRALHFDAARLLTNDRWLAADGVKQQQQEQEQHPSSRTGLNDNNGNSGNAPRPTALQ
                     LACASHLIPPSVVLERTTLGARLASGILSEEFFSVPSADDYVVLGHAHRHLDGDLVQA
                     APHSDTAVVGDRVYSVYIRAVVEHNLAGLSSMLREYFALSGIETEADSSLQHKVHRMR
                     RELDPETELLTAPVYCSTCYNRDHDTQEQCAEYQYKRHRRGAQLDLAAAALQLEEDAH
                     RKGMEHERGAALPPVGMPGKRHGDLGRDEASVTDLTPSMPPAASTAATTPVPARTVCM
                     RWRLRRRHDEQRWGVRFTKSLHLVGIDDASLLREAAVWCSATSEACDAVSSASTTAVA
                     MPDEAEVCPWPSFWIAQSAPVDEQAPPSSSSALRILQFVRAALRGSVGTDTGTAPQQL
                     VALTELLAQSPLLRLPPAALTVALPPSTAAPAASLLKACKWRLAKVNAKPVATQRDVA
                     AALLTEAVKSREVWLTFEVPIGAAAENSRADVLTRAPPGASDSTGALTKRDDAGSTAS
                     RGVVPQSTAAMPPKRRHEAEVAMRRALSEVSPDTRRWVQDLPYRVTVVLKKHRRQVQA
                     HRSWGLQLDGTDMTLVNFAQLMLRFMADSDTHDKQGHGGGRCSVASIAPGEAFPRLIS
                     SSSSDKNDRHLHSVSKLLSDLDPGLMPVLNDMYRVMRIHNTPVRHKAEAARAMADFQA
                     SLDAALASAHVAEPSAPPRGGDHRGAHANMSASSEEFFLTLTLERKASSYRLCSSPAT
                     EHGLQPAAAELSGRSNAPVSANASSSAAALSPPGATAVVDAALLSGLATERCPVRPIT
                     EAQLSRSVVTVAINRLLLTSATMDKWGLRLQQGTRRLKAIQENQYFSFHVFAAKKSQG
                     ARIADTLRLIPASNAAMGAATRSNASTSATRRAHHLYYVERVNRTAVRSHAELRQALL
                     TAAQPAQQQQQLGRGPTPMPALPPESVTLGVRQLPLLRLSATVRRGGVGEESALGPVG
                     LQVDNHMQVVAVFAGSPMARALDEAAGPICSLRRLIRDRSDASGALDSTPEVGSEAAW
                     DVVRDPQLRESLARVAAATSVPSSSSAGGSAGGGTDETRTARMITTVAKKPVRRQWNY
                     GMDEDDGENSSGGNDTPDTRVAAVATGTSPGAPAAQVSAPSLLLVEEESAVRTSLRDL
                     AAVAAYIQQQLCKCTMVDGVHVLQASMLQEFALAQLAKLDQRHGPTSDGAPSSEDAVE
                     AAAMLAGVRTELAQLHKRVDAVHHEVRWEVVYAVASNRPLRTPADLAAAFAPGVAEET
                     IILQQLMED"
     gene            <201954..>203144
                     /locus_tag="LMJF_03_0540"
                     /db_xref="GeneID:12981498"
     mRNA            <201954..>203144
                     /locus_tag="LMJF_03_0540"
                     /product="putative 26S protease regulatory subunit"
                     /transcript_id="XM_003721682.1"
                     /db_xref="GeneID:12981498"
     CDS             201954..203144
                     /locus_tag="LMJF_03_0540"
                     /EC_number="3.6.4.8"
                     /note="previous protein_id=AAM69020.1"
                     /codon_start=1
                     /product="putative 26S protease regulatory subunit"
                     /protein_id="XP_003721730.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981498"
                     /db_xref="GOA:E9ACJ9"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005937"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9ACJ9"
                     /translation="MQSNAPFDPEREALRNEAIKKTVERNVTQARLKKVNDDVKLQQR
                     ELDKVEDQVNALLSIGHYVGEVLKRVDEERFIVKSISGARHLVGYRKSIKPEKLKFGA
                     RVALEITTFTIVKVLPREVDPQVYSMQYMSSDKDVSFQDIGGLQPQMRQMREVIELPL
                     TNPELFVRVGIAPPKGVLLYGPPGTGKTLLAKAIAANVDAAFLKIVASSIVDKYIGES
                     ARVIREMFAYAREHEPCIIFIDEVDAIGSKRIEGSSSDREIQRTLMELLNQMDGFDKL
                     GKVKVIMATNRPDTLDAALMRPGRLDRKIEIPLPNEAGRLDVLRIHSAKITKKGDIDF
                     ESVVKLSEGFNGADLRNVCTEAGMFAIRAGRDYVENSDFNKAVRKVADMKRLEGTAHQ
                     YSDQ"
     gene            <204879..>208829
                     /locus_tag="LMJF_03_0550"
                     /db_xref="GeneID:12981499"
     mRNA            <204879..>208829
                     /locus_tag="LMJF_03_0550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721683.1"
                     /db_xref="GeneID:12981499"
     CDS             204879..208829
                     /locus_tag="LMJF_03_0550"
                     /note="previous protein_id=AAM69021.2"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721731.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981499"
                     /db_xref="UniProtKB/TrEMBL:E9ACK0"
                     /translation="MHRLRRALRLTERAAVCALYLLLPFLLYYSTPPSASQRLPPARA
                     SITAALLAPFLCVRAVEYDLSLAFQANDHVDSVCVPGATAARTSVQAPPTSTRGSAMK
                     EAAVGPTVSTARAAAIDLSACPHYSLWSLLAGVNNFGETTRVDGGNVDAAAASRAGAR
                     GGVDSSTRPVDRHGRAAAAEAEARRRIPTATPAAAPSAASTAHVVPGDLTSTLSGSRN
                     ALTYYYQVLNTDNFFFMLQGCTIQITIDGDVPPSYAYNTFQRYADGYALNVSATGKDG
                     SISGGSGVRGTLASSAGTRTSGAEGDGDEAYPNITPRTAFFFWNQPRLHCTYNAPALM
                     SMMIDLANQHHHRRQPEEEEEEPRRAFLKDDAVLAEAGVQPADGEAAAGRPAASSTGP
                     LYPSCAASMPPPQNILPSGGRNTTLTVNYMQLGSSVVVKIFSFDVWYQLTGTPVLATH
                     SAARTTTTAAPASAAYSAVFSSDPITRSSSCSTGASTKNLAAGQSLKLPGDPEKVCTA
                     PALYTISLNPLLARASSWSLGSSTDWLQPSVMVTHDYPAARVIAVVAQCSGVPLSFAV
                     KVNFLNPGKYPGSGQHYATFITYLFFLACYALLLIVFLVMIVPCSKRRRRGQGRQRRG
                     GGAEGGESTSSSPGQARAADKTKRASAGSDQRSADKNRGGSVRGRRSGSAAAGGDGRD
                     GHRQDDDGGEEMHGTSAPNSTTAKYAAPESMSAAVKGMTKVPPSPSSSSPTSVAAVAA
                     RTRASAQRGAAESDQDNAEDEPLHREEGESSRQQRRGGAGPQQQQGQRVVERRDGVSE
                     GDDSQQETSSLYTAHSNAHHTSSSGIYDETDINCGSSDAASEAQARRGASGRRRAQSR
                     RRRGPSTLSLSTSGDDSDCSSSTTTTTTTTDSTSDDDDSRAARRRRRQKEQRRAKRGI
                     QKQKKQRSRPRRQASATSTSRCYAANNLNDDRRGSSTGTFAAPLRWRFRAVGMANAVG
                     HHVLDPVRLWWAESHILVMHAPIQWLVLVLLVLRCLLSVLLASKFFLLSGAVRRDSLM
                     GNSLPLVCVIFEVATDTLLIPIEMLVAMGWGLAFTAPLPTNQIVTVGFATLMMFIVLV
                     FSAACAKDGLSMSLTANRHARLINSNLCNTVAYTRAAFEMVCRVHNVLRMFFLSLWLS
                     KTVVPADAAAVQRQRRQSHRQLQGAQSECREGQGMAGPRDGSSDGAWCKSDHHRRTSS
                     ASSSSSSGQCDGSSLVTADTTTPSSAPIALRLPPRLGYPGVSLSAMDVYLRYRGMRVP
                     FAMLLVWAVLLLVFAFTVYQPEDYYMVIAFRELQSVYLLGFIILFLRTSSPLYC"
     gene            <210298..>212454
                     /locus_tag="LMJF_03_0560"
                     /db_xref="GeneID:12981500"
     mRNA            <210298..>212454
                     /locus_tag="LMJF_03_0560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721684.1"
                     /db_xref="GeneID:12981500"
     CDS             210298..212454
                     /locus_tag="LMJF_03_0560"
                     /note="previous protein_id=AAM69022.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721732.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981500"
                     /db_xref="UniProtKB/TrEMBL:E9ACK1"
                     /translation="MSSDFETLSCNLESSEPRRRHCRRSSSSIGCDSDTLDDLIADDD
                     AQLLRRLAVRNSAPGAGARRALSSDHASAHLGRRESALYGYRAYGVTGGVAATSPAAR
                     GGACGTMPLSTKGPITCCHQPATVAHTTVKSTDSLDNLGGAFTATVVTPRAPGGGGVS
                     WASATAAPTTTAAHASAFRDREAASLVERQVTCPPDTSSLTSVTSAATMTASATTGRT
                     HDSTNDDDSSEDNEGAEEGRAHLKGGHTVQHRRLAHDASEAAAASRTPQPTSRAPPHR
                     SARDFDGFYNTGLLLEDDDDDDDDAAESELSRRPARAVDSAAAPFPSTALNASLLYMQ
                     GPAGQRGSDAPISFRRAQAAPATPGPHTKGHGKRPASPTSAKKSTVTAARPLFIASRR
                     EAASEELCRLAVALPTMTTVHWLSLVITLLVPVNLLCLDVMALGWIRRRVDASYGGTS
                     ALPSSGLTTSPTSLRVVICGAAGVSTGVAEAPSSCGNDSGFTFNMGAPTFTSTSGGGG
                     GCGRSGSSSGGSTAGAGNPRRVDAKTSSFSSAHTVPALCSVILWLLAPNGLLCRLVIH
                     RLRRPTGEAVADDHEPEDESVVNLSPSLAATAAAPSTPSPLHRSAASSTDEYRHLRAE
                     WQVCCDVYERVRQLAPHLEVIELFIRYACLWVMLHAPPLPCATVASEWTDAWLLKAPA
                     PEEEKVMAQNSSHWRASSSVTASVSPRRASDAIAAA"
     gene            <215060..>216058
                     /locus_tag="LMJF_03_0570"
                     /db_xref="GeneID:12981501"
     mRNA            <215060..>216058
                     /locus_tag="LMJF_03_0570"
                     /product="putative quinone oxidoreductase"
                     /transcript_id="XM_003721685.1"
                     /db_xref="GeneID:12981501"
     CDS             215060..216058
                     /locus_tag="LMJF_03_0570"
                     /EC_number="1.6.5.5"
                     /note="previous protein_id=AAM69023.1"
                     /codon_start=1
                     /product="putative quinone oxidoreductase"
                     /protein_id="XP_003721733.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981501"
                     /db_xref="GOA:E9ACK2"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:E9ACK2"
                     /translation="MEVIATAHGGPEVLAVRPSSHTPDATQLEGGQVLVHNAYAGVNF
                     IDTYFLSGLYKKPAMPYIVGEEGAGAVVKVGAGVPETMLGKRVAYFGGAGCTGSYAAF
                     TVAPASALREVPDGVTDAEAAAVMCQGLTAHYLVDSSYPCGPGSTVVVHAAAGGTGLL
                     VCQMAKLRGARVIGVCGGAEKATLARSVGRADVVIDYVATPDWAPLVRAAAPQGVDAV
                     YDGVGQATFAGSLSVLRPRGYMITFGNASGAVPPVSPLELSRAGSVYLQRPTLGDFMR
                     TPEEVQRRTSEVFEWVASKQVQLTIGHEYPLHEAAQALADLQSRKTTGKLLLKCID"
     gene            <216520..>217056
                     /locus_tag="LMJF_03_0580"
                     /db_xref="GeneID:12981502"
     mRNA            <216520..>217056
                     /locus_tag="LMJF_03_0580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721686.1"
                     /db_xref="GeneID:12981502"
     CDS             216520..217056
                     /locus_tag="LMJF_03_0580"
                     /note="previous protein_id=AAM69024.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721734.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981502"
                     /db_xref="UniProtKB/TrEMBL:E9ACK3"
                     /translation="MKLLKFVNSDAPHTLADVQLRNQRLWFPCRHGNAAVAAKSWTLT
                     AASPASVSGGYWLLDDDSQPICEITDVLLALPETAANAAGSSGTFAPRGVTDKDVDGI
                     DFRSKMGRQMERERATYGATSKTATKSARTMMNAEEMTEKKNERMKREREAVAEAIED
                     NDASVMEPRKKERKHSKK"
     gene            <219029..>223108
                     /locus_tag="LMJF_03_0590"
                     /db_xref="GeneID:12981503"
     mRNA            <219029..>223108
                     /locus_tag="LMJF_03_0590"
                     /product="putative DNA repair helicase"
                     /transcript_id="XM_003721687.1"
                     /db_xref="GeneID:12981503"
     CDS             219029..223108
                     /locus_tag="LMJF_03_0590"
                     /note="previous protein_id=AAM69025.1"
                     /codon_start=1
                     /product="putative DNA repair helicase"
                     /protein_id="XP_003721735.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981503"
                     /db_xref="GOA:E9ACK4"
                     /db_xref="InterPro:IPR006555"
                     /db_xref="InterPro:IPR010614"
                     /db_xref="InterPro:IPR014013"
                     /db_xref="UniProtKB/TrEMBL:E9ACK4"
                     /translation="MLLNSILSYLFDPVEDAKDVDGTASGSGSSVVAEPPAAMATAST
                     HDSEKAALDYSPPSPTLDEVLRQRQLEEEMVQVRRERRARVRAQRRQIRQARKLMRLQ
                     QQLTNSGGEHDFLLTQDPLAWYAEQLSMKKARLRGDDLVDLHSASSLSSSSSSSSSSS
                     SAREDDDDAEAQLEAALSTLIPLRKPKVYFASRTHTQLQQLMEDLQRTAFARLPLRPR
                     HRKIEPLESAAGRTAGEGMGGVNDTDDPATSSKSLGSPTHACPVAAASRPTPSRQQQQ
                     PRRLTAVHVAGRPHLCLNAALRRKAGGNNDRLNYYCREAMHFERSKQGRQYRRQQQEH
                     PQYQPPHLTDRPAVRNIEDATGVQQELEDDKGCVYCVESHLRSLMTYLRDEQRRADAA
                     TDPVDAASGGASASGNGGPPSSVYTMDRLRRLGAELQACPYLATRLLLRGADVAFIPY
                     GYVLDEGQRAVLLGGAATNPATAAEAAAVFATPSRSTPAAEGGGALQNDVAPHSPPSL
                     GTVLYHRRQRVTATATFRRRRQQQQQRGGNVYGGDDDDEGEEEAIWSTMARSAPPSLC
                     GDIFVFDEAHNIADHCRSTSTVTVAPWHLLLARRLFETYLARYASRLLTRNKQRLREL
                     VHFLSKLSGFCERADSAAVLGEGGGGEGDIAPSLSAPSPPLMRLPQPSTTTPTTAART
                     LVLPFHTFLFDAGIDSVDVYAFLTFLVDSQLLMKLQGFVSYALDAELQQERESVSTAM
                     RTTMTVSGTDSSAGSTAGVKRQRGSGVGVGVSDAHNEAQRQRRLLASLDLPDNHKKTA
                     EGEAAPPHLSLAEHLSQQLQPAGVAMTAAAHAGAVAPADPVQLRALTAEALQCVERLL
                     CALYVSNTTSTRVLWTPSSLSPTSPARPAGCAVRQGALKVIQLEPGMYTFAPLVLEAR
                     AVVLAGGTMQPLAFTCGPLLPAQAMVGGDAGGDCGTASTIGRSAVEVAVEGIGGSDYV
                     HCIDASLQGGVAPAPGPSAFHLISEGHVVPSSSVQVWALGIGPSGLRMELSQQALGLR
                     SNAASTSNDTGSSRIGVSSIISPHAHRVLAEVGCTLLNLARVLPPAGAICFFTSYDVM
                     DAVVAVLESTGYYAQISDVKRIFKETRNGGGGGGGGGGGGRITAGGTDGGGGEAIAEL
                     LREYQEWISGEPASHGAAERAPGPSSTTASSPVSTAAASQQRQKPSRRGAFLFAVMGG
                     RLSEGINFADDLGRAVVVLGMPYANPTDVEMRMNLKHIVATRLRANADADRRGMRGTA
                     GSASTPSPASSSPFTCAEEWGLYMDSMMRTVNQCIGRCIRHAGDYATIILLDARYTER
                     PDARRRVSAWLQPSMRVAQTFGQCFSGVREFFAERQPKG"
     gene            <223718..>224935
                     /locus_tag="LMJF_03_0600"
                     /db_xref="GeneID:12981504"
     mRNA            <223718..>224935
                     /locus_tag="LMJF_03_0600"
                     /product="putative arginine N-methyltransferase"
                     /transcript_id="XM_003721688.1"
                     /db_xref="GeneID:12981504"
     CDS             223718..224935
                     /locus_tag="LMJF_03_0600"
                     /EC_number="2.1.1.-"
                     /note="previous protein_id=AAM69026.1"
                     /codon_start=1
                     /product="putative arginine N-methyltransferase"
                     /protein_id="XP_003721736.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981504"
                     /db_xref="GOA:E9ACK5"
                     /db_xref="InterPro:IPR025714"
                     /db_xref="InterPro:IPR025799"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9ACK5"
                     /translation="MPANRDMRTGAPTQRGESRSANASKVVLTESLLATDAEKNPTSK
                     SLYGDSAARISSNINMIHDHQRLRAYEVIFRNVRGKTLLHLGCGMGLYTMLAARGMAK
                     MVIGVDSSAIVDAARVVAEQNGLKNILFIRGRLCDVLHQLPGGMKFDYVLCEWMGPLL
                     LNERVLTDALYARAHLLTPSGALCPNRASLHVVAVSDYSFRLDTEDFWSNVYGFQMEP
                     MKELVRQEVEMCAIPGSNIVSAPCLAHTVHMDTLEGLTVEETATYEAQANQAAASRDN
                     EEENPVEHRWVPTAVAQRGYEAAFTLSITRNATVHYLTFYLDAAFTSKTNPGANFVLA
                     VRPGGENNWTEVSVGLREPLPVNVGEKIQGTLRIYTPADKGGKITVVEVTAKTEGQVA
                     AVETSGTYYYQSY"
     STS             226173..227175
                     /standard_name="stSG624215"
                     /db_xref="UniSTS:455777"
     gene            <226459..>227508
                     /locus_tag="LMJF_03_0610"
                     /db_xref="GeneID:12981505"
     mRNA            <226459..>227508
                     /locus_tag="LMJF_03_0610"
                     /product="kinase-like protein"
                     /transcript_id="XM_003721689.1"
                     /db_xref="GeneID:12981505"
     CDS             226459..227508
                     /locus_tag="LMJF_03_0610"
                     /note="previous protein_id=AAM69027.1"
                     /codon_start=1
                     /product="kinase-like protein"
                     /protein_id="XP_003721737.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981505"
                     /db_xref="GOA:E9ACK6"
                     /db_xref="InterPro:IPR005129"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9ACK6"
                     /translation="MMSRVPRPHIHQRISVEDIMKGNRRTLAKAITLAESSNPADSTR
                     LGNLLREIHQMATVRTVPRFALSGSPGSGKSSLLDTLGYYLCEKKNMHVGVLAVDPSS
                     TITHGSILGDKTRMEKLGTHLNSYIRPSPSGGHLGGVTSRAWEALEIFEAARFDVVFV
                     ETVGVGQSETQCKDLTDMMILLVPPASGDELQGIKKGVVEVADMVVVTKNDGRRKPLV
                     QQTMSAYARAVMYTEEKQGFEKPVIAVSAEEGTNVPELWEAMLKMWNARLESGQIAHL
                     RRAQSTKHFYNYFEMELLAKARRMTNLEMQNMAHRVWEHEMTPREAGDIMVLRTLREH
                     LAADAAVQHDAGKRA"
     gene            <228696..>230723
                     /locus_tag="LMJF_03_0620"
                     /db_xref="GeneID:12981506"
     mRNA            <228696..>230723
                     /locus_tag="LMJF_03_0620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721690.1"
                     /db_xref="GeneID:12981506"
     CDS             228696..230723
                     /locus_tag="LMJF_03_0620"
                     /note="previous protein_id=AAM69028.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721738.1"
                     /db_xref="GeneID:12981506"
                     /db_xref="UniProtKB/TrEMBL:Q6T444"
                     /translation="MYGVTRYLRYIAGVGGSGGMGGISSTGTSSSGGDLRGPAISYRN
                     SLQIADAFQPVQHRNQWPFDHVLIDVSFFANSLGYLTRDLVGHERDCETVKNVHRQLQ
                     TVILRRLQPRKSLAFLLDGSEPLWMLEHRRLFPGRRYDSRVYRSCASPMPYLLEEKLR
                     GTAMEQRTPPSEAVISGPATPGLAEGKISAYLLDLATRTLRPPTFPPLSDSTVTAKDT
                     VCLVGGPELAWLAVGMTPFRNITSVTLQQGELKSCSLQESMEWMRLAHLLKAAPEQVN
                     GDGGEALALQRRLAAVRTDLVLLDLLANGHPTTGLPQVLATPFADVLDAYVDMEKEQH
                     SAAAPSAPQNVGRLRSVLFDEEPVTGVHLEQPSLRLRLVSLQQLLVRIVRALSGAHVG
                     LPAGNRPTPHAATLLEMTLQTHGLLCGGGVPSQAWSPTPDPADASSGGSSTAALNGTV
                     LLDKFPRLSAEMLLQHVTYLLSNEAKQRTANAADGAGEGSDSIYLSPQRTRHFGLTGV
                     ETLLLSATQAEQVNQVLPLYVRGHTLPDEVASDITQTRNIHEAVRKTQRVLSRVLQQA
                     SQELASQSGSGTAAVDDAGHNGPHPALAHLPSHLFVRTAGARGPPPGWEYYGVHLGIK
                     AEAMNVRYNLNASDTATLHLIDSSGSSNSGGVTATAGSEVGAESTRSGMPG"
     gene            <232358..>233335
                     /locus_tag="LMJF_03_0630"
                     /db_xref="GeneID:12981507"
     mRNA            <232358..>233335
                     /locus_tag="LMJF_03_0630"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721691.1"
                     /db_xref="GeneID:12981507"
     CDS             232358..233335
                     /locus_tag="LMJF_03_0630"
                     /note="previous protein_id=AAM69029.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721739.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981507"
                     /db_xref="UniProtKB/TrEMBL:E9ACK8"
                     /translation="MSFRYTNHLVATLKHRLFLEAAHRQLVRQTFTGVCNGIEVTCTA
                     YGSVVGIRMLDRAVWEPHYQVAADNKSEAAAATPTAPAAASPSRPSSSSSSSSTASGK
                     TGIDLVKLSASIQAATWQAIQKVRAAKEETHSRSLRRNPQVLAEARLRDWYEQDANTL
                     HPRPFDGLKNLEATEWMQAVRFGVPQPARYRRPNAAPKDLGEGGDGAHTDQKPRETIT
                     VLRDEDCDPANIPIGSVHPLFAPGLLQLEVDPNVATNGGSRVDEFFVLSEQRKEMRRD
                     EEAFWERVELIRRSQLATIPKGGVKRGYADMADTVQDSIEEKVQLRFTQ"
     gene            <234134..>235975
                     /locus_tag="LMJF_03_0640"
                     /db_xref="GeneID:12981508"
     mRNA            <234134..>235975
                     /locus_tag="LMJF_03_0640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721692.1"
                     /db_xref="GeneID:12981508"
     CDS             234134..235975
                     /locus_tag="LMJF_03_0640"
                     /note="previous protein_id=AAM69030.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721740.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981508"
                     /db_xref="UniProtKB/TrEMBL:E9ACK9"
                     /translation="MLRRTLHCCTAVRHTSVPSFMQHPVEMAFYFPRFHPDTHVNAAG
                     IPELIDAVGLMTRHSRSSRAESTASASTSAAESAMSRALPPTRWTTTVSATAQPTTDA
                     SVVEAQKDNAKSLLLLERGIDILNSVGGVRNPTVANLLRPLYAARFEMLNGSEHLPRS
                     EYAKRMHVHKAILQQAAPLLYYDAWDKSDVHQLDTSCVLVGHFMKAFCALHPRPFHPV
                     AAPATSGGAGSSQASSTTTTASSSSSSNSNSNVTSSSSAQSTPKGAFNPAEWKMAVGD
                     DGEGAYLTLSIVQDRVEELLRLATAAYDKHGSTHPELRWLRPKLLVLKGLLTIPLTGH
                     LLHAQRCIEEAAHYVDALTKRTNLLLDGLKERTHEPELGLYMLLQAEIAARVFDWDVA
                     PGQVDGDVVNMFTDAAGYYADPPNTTLDGDAIMSERKLAEQRFEVEAYACCLRSYAAF
                     LLGASRPEATSTRDSPVFLAKQLFSLNPLLTVATSSSLIFSDVRNVSELPLDMCRRRT
                     GEALDRALKLNRMLYPDFRQNAPAAATLMTMACMYADTRDYLYATGLFESANKAVTYN
                     FGDTSLEHVFLQKLRYEFLAGVGSEQEAKTASHEVVHLLKRIDALPC"
     gene            <238440..>241121
                     /locus_tag="LMJF_03_0650"
                     /db_xref="GeneID:12981509"
     mRNA            <238440..>241121
                     /locus_tag="LMJF_03_0650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721693.1"
                     /db_xref="GeneID:12981509"
     CDS             238440..241121
                     /locus_tag="LMJF_03_0650"
                     /note="previous protein_id=AAM69031.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721741.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981509"
                     /db_xref="UniProtKB/TrEMBL:E9ACL0"
                     /translation="MATMAVMDASLPKTTTAMTNTCQGFAAPLPHPAAVSSPSPCQQP
                     STPIDTLARQLHQDPSPQPKQYWERRRHSSSSLAVSPSASSASSASHASHTDAYEVAV
                     VAETRRTDVGGSLLQQPTSLPSCTVKSYGTASDISDDGSRSSLSAVVAVHTVANTFDL
                     MTTQTVGYRTPSTRAEVQPGQLEHHAQHPQQRQGQVMSSYAVEFSAYDPHSFTLLDGN
                     AHMVGGVGQSEPAPLARDTSQEPLAPEGGANVGAGPAEGRRPASPAAGGNVGGNGPAP
                     VFLPRSAQSPTGPPPTFVELVMRRVGSTSLLQFLWVVLLVVMLLVGNAFQVIFLNFWI
                     HQFPTKLNPQIAPASSSSASSGSGTDSSSGRHAEALASSYTTFVISAVLFPAFFVVLL
                     ITYALWRRPNLRFTREWAGWRLLFGIGAMDALNSALAIYAAANTPEVLQALFVSLVPI
                     YSAIFTKWLLKDPRDYANPYVVVSFVLIATGVALASLFNQVVTHHHHTEDRSGSGHAG
                     VKELLVAVFSDGSSSSLSPVALDRRLWCFIFFLSVPPTVLMNVWQTMYMIRYTSNDQL
                     MAYLAEHADEAECGESSNDVAAGAPGQSTPLLDSARDSHGDAHHCPSPAAGEAVERVP
                     LQPSVVSVSRSLPHGWVHQQHIPHSEHLLHGEDASVKLVMLTSDTAIQAILAVVLMPM
                     DALPWFGGSHSIREVVQNLDEGIDCVLHCPRNMRYCILYSTGFVLVYIASAYLNRYSV
                     TLCSMVSQLSGPITALVLIAFPTLNMTDDASPWYVSVFAIFLLSCGTVLYVYWDEMTV
                     EEKAVGEMQLKWAMMQEQSPRHAPSLAEGQRYHEVDSGVNGSSLATSQSGVSQPQQQQ
                     HRHARSRRYCRRRQSGYAVVVDQDASDASASGQPHRY"
     gene            <242303..>244585
                     /locus_tag="LMJF_03_0660"
                     /db_xref="GeneID:12981510"
     mRNA            <242303..>244585
                     /locus_tag="LMJF_03_0660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721694.1"
                     /db_xref="GeneID:12981510"
     CDS             242303..244585
                     /locus_tag="LMJF_03_0660"
                     /note="previous protein_id=AAM69032.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721742.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981510"
                     /db_xref="UniProtKB/TrEMBL:E9ACL1"
                     /translation="MSPIHRKHMEVLGLGVKGTANDASNTQRPAGALSREEEQLPRES
                     SLTTGATAAAAAAAASGDVRHGPLPEEDDLSNATVVLAAAAETTATRPPIFGSGLRRF
                     SDALASLPLRHLLIRGSSFASPLRITSVCLEPCHTPGAEETAAATRMTAPAHDAGANV
                     VTLMRSLPSRTASVVMPSLRAFRERLCKMSLTQILWIILLVALVMVGNFMQIVMLNFW
                     LISFPSDGTPGNYTAFAVPGIFFAVLFVLLLGAYTAIRRPSLRFARHAHGWVILIGVG
                     FCDAFNSWLATYAASYTSEVLQALFSNLCPLYAVFLCKWILHDTRRYANVYIVSVFVL
                     TICGILAASLYGLIKDHNMGEGKWWILIFFLSMPFRVLMNVWQSLYMIVYTHDPNFVL
                     WLRMRLATAEEAAEPVSAAERGSNEVTPDTSDTFFRGGADVVAGPASPLDADCAKVAS
                     SIARYNDRTLMSGLEDEEDDKEELRNARPARHAKTKLANSVKPSSVDANDDDAVGDST
                     EAHEPVASDSSDGTASGGVAITPAASPDEPATSRVNEHGAVHDLSGVEDGEYLRPTAT
                     GAPPLPTRTMFTVRYNQGEDTVVKLVMLAGETVIQLCFTLCLLPADALPWWGNSETVS
                     ATLDNFAEGIRCVFTIRDNFLYCFLYTLGFVFTYVGCAYLNHYSAALCSIVTQLSSPV
                     TALMLVIVPSWNVQVDGDSPWYYNMFAIFFLCVAALIYVMWEEMTDAEKVQAEYELKM
                     KELRVRPSSHEAPHLVTMQG"
     gene            <245148..>246857
                     /locus_tag="LMJF_03_0670"
                     /db_xref="GeneID:12981511"
     mRNA            <245148..>246857
                     /locus_tag="LMJF_03_0670"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721695.1"
                     /db_xref="GeneID:12981511"
     CDS             245148..246857
                     /locus_tag="LMJF_03_0670"
                     /note="previous protein_id=AAM69033.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721743.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981511"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9ACL2"
                     /translation="MRGKGHKRLAARSFQQWQKLHYNALCDRQMPTPLHATLRLPVRR
                     VAHQPSSCPSAPASVDMQLTTNSSAVLQWWQREYDPFLLGCDASAHRTAGPTPPATTA
                     THVLASTRVSAHVGPPAPPLGYPDYIAIEATQHTEGVLRGETYAYHHAAAVGAVPAPP
                     PGAAYPSPVKWIQQPLLDGFVAQRLTAHIGVTTGSLLDTRRTAMALGRQLPPVELSPF
                     YAASALLDRWCLFGEAAAVVPSMPASSGATLDGTQQSQRPHDAAAHHLRIAELALGAG
                     LLSNYRAVWLNGAVLSHPGTARSVLVVGPRRSGKTTLALHCLSAAAMQASSSASGDGG
                     VRLTAAEHFFLAAGMPVRRMLDPASTRLTSPTIFACSLPHHITVGLGAVLGTLRPNPG
                     LAAAVELPSFLQCEAGLRACLRNTDGVLWDMSKTYRVRLEDIYRASSPDISTQWAPVV
                     VNTLAGVVLLDWNVEELASASPTPVRNAVREIPLHDGGVEELLKRAQDYMFHGHHLLR
                     TVYDAPQDAPARLADALADEWDTAQPRSLANGTAPALHCIEGSVNFDLATQLIMSLLS
                     ERA"
     gene            <257028..>257888
                     /locus_tag="LMJF_03_0680"
                     /db_xref="GeneID:12981512"
     mRNA            <257028..>257888
                     /locus_tag="LMJF_03_0680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721696.1"
                     /db_xref="GeneID:12981512"
     CDS             257028..257888
                     /locus_tag="LMJF_03_0680"
                     /note="previous protein_id=AAM69034.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721744.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981512"
                     /db_xref="GOA:E9ACL3"
                     /db_xref="InterPro:IPR003754"
                     /db_xref="UniProtKB/TrEMBL:E9ACL3"
                     /translation="MSSHQILITAPEVYSKRFAQALEARSLIPMAVPVIETIATPDTA
                     DMRALLEQDLNGIDYIAFCSRCAVDSLSAALDHRYGGGGESVSERAGSAPAVNEDRRA
                     TAVVKVLAKCALAAIGKDADYVFERLRIRTTICPDEPSPAGIAAKLAESGRAEGRTIA
                     VLAPCVEGFTEPDVVPRFVDQLKGMGMKVVRVDAYMTRPVSEEAVSAAVTALKNGSVR
                     GVAFTSAGEIAVLLRRSPQCLMNIDVACFGPYTAGFAAKHGVKVSCVAKDFRSFDGFA
                     ATIEQHYASR"
     gene            259299..259371
                     /locus_tag="LMJF_03_TRNALYS_01"
                     /db_xref="GeneID:12981513"
     tRNA            259299..259371
                     /locus_tag="LMJF_03_TRNALYS_01"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:12981513"
     gene            complement(<260161..>266796)
                     /locus_tag="LMJF_03_0690"
                     /db_xref="GeneID:12981543"
     mRNA            complement(<260161..>266796)
                     /locus_tag="LMJF_03_0690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721697.1"
                     /db_xref="GeneID:12981543"
     CDS             complement(260161..266796)
                     /locus_tag="LMJF_03_0690"
                     /note="previous protein_id=AAM69035.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721745.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981543"
                     /db_xref="GOA:E9ACL4"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9ACL4"
                     /translation="MSSHYRELNQLFVDANGQPDFDATVEISASLPIKQLFQERSLLC
                     PSSSNSEATAASNASPSTVKPVHETTALLRTCNAVLRWAAAEKAGQDQGGAAVAARAA
                     AVGQIDSLQSPDECRMAWKFLATFAGQPAALVCIDKALTEVAVDFHYAMARPRQFDMF
                     VHLSAMEKFFIDGDSLLMAALSSPHVDWDLMQPLHVLHNAQVLLRGLQSRGGHFHIVF
                     FRHTAWFWEPTPQKLFIREALRETLTAVAATNPDSRLVVDTFDSFHSEEFAAYVSKYE
                     PEFLLMSDGEQLGHETELMHLFHNHTEEELLRFEKEGGIGEEGTPASAASATPLTDDE
                     KLELKQRITEDQTMELKRPYRSLVDDESHGDTVAFYYHCFLTWATARRIKVAYSSRII
                     TRENAVVVFAVTVSSGNFARSLVLEPNSTKLAAALERAVPLPTLSDASLALTKDGQLS
                     RREQVVSAAVHAYLHAGDSTPPRTEQQRQLCQVMVTTAYCTALVSAELRAQRSVTSPV
                     VAAFLNEMAPYLLQAFQHCDCATGRGTEFDVYDGHLITIMAHLLRTTPAEQLLDEDGI
                     TDVNLSWQDVVGDESAIITGGALSALPDVILAEPKKAMKYPHLTHDLIDQLARAFRVE
                     GHVSNRPYPATLGNANELGGWIVSQPFDELNDVVDAYVERESQRNVTERERRKQLAME
                     AAFVTDAAQQAESMGIRGFTAGTLAVVCSDSDEDEAAAATDGAAGTSTGKVAKKVKQQ
                     HSGQKNKKARSREDIIREEANLRDANKTVQDWTQQVAELCKKTDQASRLTDVADSIGL
                     LTAAITRMTGTSFGRNFDPGEVLKDGSAVPLQLTMWRLLVDASGMREAELAFTITDDD
                     ADRSPAADKKRKKSAKDKRATNLYAFGLIADLVEENITNAKSGSHGSDDWGKLERLRK
                     VKKDFTVYDATSYLNWVYLTYVQLHFQCKLMTRVVRLQLMQWKNERERARQAQEAPNI
                     NVGVPLFLYCHHKVLACIRDNGVAISTDDLDAVRSALAHFDFPASYYEKVDGAIAKWQ
                     NSAVSVLPPSHRPRQKACFETPEMMQLMTMGHLLERPVIPTKDYRVVFNPDGWQRELL
                     DIVDNRGSAVVCAPTSAGKTFISYYCMYSALKTSNTKVVVYVAPNRALINQAVADVCA
                     RYGSKKYSFPGRNVYGVHGGADYHRYVDSCQVLVTLPEVLETLLLSPKYKEWAKRLDY
                     VILDEIHTMESSGNGDVWERVLALLPCPFVALSATLGETQQLCGWLNRVQQRLEAQQP
                     EAAKRDFTVHDIPSSGSIQRWNDIKKYMYLPPPGYHPQLKKLTAKYPNRYIHDLHPLS
                     ILTLEQLQSGFPPDITLVPSEVVQLYQKMCTLFTEHVFAKWSKVAIVQAMKAQLSMLL
                     PETYFQQEIYITQQRARQYEADVKNAFAYWVYLNKGCDADGLETLSEGEVVAFNTDMR
                     ELCETILQSFSQRLREDEAQLDKYATDAALKPEGRPVDTSAAEAEATASDTATAATTA
                     IAQPRKAFFPESKEFIADNIISVLRELNSRDMGPTIVFTFEGEDCDDLTKAIIARLED
                     AEAAYRQTEEFAQYKATMERKAAAAEAARRQRESTLKQKKLTTDDGGEVDRADRDVDN
                     NMNDDEDYVVPDVLPEFTFIGQYCTVDPIVVKEAVEECIKRGDTLCARAIQRGVGIHH
                     AGVKGKLRRMMEILFRGRHCGVICATETLALGVHSPCRSVVLAGDHVLLNTTQFRQMM
                     GRAGRRGLDYLGHLIFLSVSMKKITRLMTSSMTVIKGNVQVDPITQLRLLQLYDYARH
                     RDLKGAEEWSRRALGMAERLYVNPLFFAGRAAMENGNMESFTVEFAQMLLGFLHREGL
                     HFKDRPSSLGSLLVDAMYVFRNAQVGVEGFAFISMITRKVFAKARLARRFRYLAPSDD
                     AVVQEAKAELLAYLFSVNKVCGVPLELHRSALSDPAVIELWSGRRVAKQHRVVLAPLD
                     VCSPATKPFSYVSVFRMISAFYTYLASTLKEPADTRLPYMCAKTKKKHCIFGGTSDMP
                     LMAKLKETAEPYAARDPFVAISGCGDHFVHSEDLVTTLRRGLFCDRRMLPVLDLTDGC
                     RHDGAQVLINACITDFVRCKAQIDSVRSNFRFTLLEELNGLSQSESYAVLNQTERLLS
                     NISGLTRDDKYTPLQVLSALYPERERGENVAEEDLKFYAGTLGVMDFASQLHELRPHI
                     DKELAMVQWMARIAEMRRARK"
     gene            complement(<267582..>276056)
                     /locus_tag="LMJF_03_0700"
                     /db_xref="GeneID:12981514"
     mRNA            complement(<267582..>276056)
                     /locus_tag="LMJF_03_0700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721698.1"
                     /db_xref="GeneID:12981514"
     CDS             complement(267582..276056)
                     /locus_tag="LMJF_03_0700"
                     /note="previous protein_id=AAM69036.2"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721746.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981514"
                     /db_xref="UniProtKB/TrEMBL:E9ACL5"
                     /translation="MPTKEYIQLLQRLYVYLKRNSGRNVPHGISQITLIDDDDLTRWF
                     VQLLYKDENNADFYVSLELVFNEDVDSEDSVAGGAWGVSAGVGGAGSRHRRPSRHMEP
                     SASATTLAAADAAPQSAAATSSPHVHRHDTTATSSPAPPTQPSSSLTSSGAGDKVRAT
                     AERVGGREVAPRAVASSRDGSNGARTSDRSTQQQQQQQQSDDDANSVPTATTPQPYND
                     FQCRLVALGEARRPPLTSEGHMALPENADGAGVAVPQVNDPSQPLARPQTSAFASPPP
                     PTAATGGSRRRARMPLVFVVAPRLIASFIHHGALCSLELMSQDWELTPENMVLLLIAL
                     FETLNPFAGDGRVSVDDAERMEHLRETVAAWGVDGGGSSALAAAYSEEEHQLGMEYIR
                     RAHPHLFRRYVGPLSESASAARDGMPSLPVSSESRGGLSASANPNIAAAAATGGGMVQ
                     RNHRDMYFDSGSAVTATGSDSVRPSASPHSAQTATTTPSLMGFGTGHGRGSSGALAPH
                     VLRDVSHLNTAVYDALVATYAPPSEPSPVSPPPPLCPTLGQQQPRPTAATAKPVVMLL
                     DSPALLADAEGVRLFQSGVRGVQQAVVSTTAAGEDKYSAADSTTPDTPADRDRVGASP
                     KYSGSAFPSLPAPLQQRTPSTRTATPPPSSSASTSVFAPVMNAERVLRARPPALWHVA
                     YAPTHPHTAASCGKVQLLQQRVAELWIPFTLLPPPPSISGSSTAVSGIPATSSAEESQ
                     VTQVLRLAEAGVSCERGAADSAAAPLPLEVHLIGDAGDNVQEARVACVLRNVRVSATA
                     ARKFSSTVNPLLNASNGGSPSTTQRTSLRFSLQSSTAPSPAGDVHTCHLPRGLTLHCR
                     NMYLYGHLRVFGNLVLDSCVFVGSLTTEELASVQVSRSHLALMPDDRLLLRQPPYRRG
                     PSDRCRGAGRGAPRQRASSTASPGAADAARPPPPPPPPPPALFYAQRKECVLVLDSSR
                     VEMSEDTHVYRLMPNFHAAAAAAATRGWQRSTQEAETEKRSGEPSSASCDRDEDEGSD
                     EVASVRDNGEDSGDEGKAAAAAVAPSLAAMMAVLRSLILVSNQARLRLVRCTIHPGRN
                     TERTVFAEQNAIVDMAHCTVTAAISSAVSVQGCRAYLEHCFFEGSPTTTAAATSAVLS
                     AEAAAQEAVADGVGTESDHDTASDRSEIQQQPPPPIHVNDTTRCTGLNVELGGTLTAR
                     YCAARHLYFAFCVIAHSVAHFYRCHAEDVVNGFTVDASAATLDGCSADTNHVGAFVLR
                     KAKCILTDDSGGSFPRRCTLLGEAHETACRAVTEALRQQHQETRGGGVGPPAITETES
                     LWTSAAAVAERTARVALLARRHYAEQLPRSDTLSDAAPVTTTATHAPHRRSQTAIGMS
                     SPQQTLGFFGGRFSLEVRDAALKATGVMLMNAHDTSVYAYENSAVELEECVLWSTAEA
                     EEAASAAAATVAAALGSAESSAAAASAAALKLTGRRALTGADGTFDGQLRSGSPRQRS
                     CGVKVVHASLKARRCLMAGYSFGLAAIQSAQAELQECLVVNAINGYTIDHSQCRLRHC
                     GADTSHVGLFALNGSRVEAESTPHVVGVSSCGRTPPPLICGGVPAVFCGDVYGVEIQS
                     SEVECTGITVLRGRDSGFNAYNGSTLRLSKCLVDMSPTDAASYVFRRPSSGGAAGVAA
                     AVGEVHAKRHGSSTNKGDAAGMAGLWIHHLHLDVSDAVHAHSRNRLLAEQQGDTVPHR
                     DEGGEDGRGKAMRAAAPAATTTPTTATPPLAPSSAGRVAPAVRTSGVKVWSGSQCHAQ
                     DTEVRCVTFGFASLGPETLLDAHHCTAKHVVNGFTSDGGALQLTKCSASSNHVGVYVL
                     SHARCVVRRGSYTAKKYGIECRSGVLSLQGHVKIYGFSRIGMYLYDGAHCEADSDCVL
                     DIHALKHASPGSSADVTPAVVPAAGSGIRSPSLLQLSKTQQPQPPMSTASTTSLCSPE
                     DAVNVSDLLPACIALDEATAHLPQAVLGGGARCGVTCGDGATGFIGKCIVYDCSLVGV
                     NVFYGAHLTLANALLRCAQQYAVVVHVGGVCRIIQNAEGDETGDDDDGLAVDSTDEGV
                     DRGARGSGGLGSILRRHGPGAAASAAVRRLRRLASHIVAVPWRVAHQWAGRRDPDDGA
                     AAAESVAEDSSGCGAVLSGARARSLATGSMPGAPPTPRHPPSRVADKVQHLSSDTSSR
                     WRGETRSAVSPSSATAATASLVAIGGGGGAILVRDDDDEVGGRRTLPLTSALRRRLKW
                     LCWKTYLGAPLPFRLSTLTMPVATVGANGTGPEPGSTAAGVAECQSFSLSPSASGAAA
                     PTSGAPAITSVFPPVRPTICGSCVVRGTCTMERVVLRPTNHLPRLFAECSRADRARNS
                     GKEHDDEATTATATDDEDGAMDTARDSAGNVAALRPRRSPWPGQEVCNSPAQHRHTDS
                     NNSADDTTSTGEQGGDSAYASPLLTTAATIKTSLAAGHAVAAASARAADGWAALPSAC
                     VLHHLVRQPPGVHVCQQGVLNLTDCIVDASLSPQPYLGARHAGQIVSAVVACEGPYAK
                     LHCDYVRVVRGESGDEDGRTAIEGGDGGASSAPRPVTFPALTRSSALPALSPDAAPPL
                     LAAADVATVPLLLVSLVDGAQCTLHMVGASLDDWPYGAYSAESINHDGNVCSDPMTGA
                     EKEDAGNPLGFAGRGGAAAAQLSPARLISARNAGVMLRTTGDTLAEVTYASIAGIVAS
                     QRSQVWLAHCTVTGTVPIILGSGSYSSLTCCRVVGGARAGPAAAAIRVEDDGDLTLIR
                     SSVWTLSQGLAVECVDSGCVHAVDSEELTLGRVAGSADGHGDCEEAIDGAVRQP"
     gene            complement(<276897..>277658)
                     /locus_tag="LMJF_03_0710"
                     /db_xref="GeneID:12981515"
     mRNA            complement(<276897..>277658)
                     /locus_tag="LMJF_03_0710"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721699.1"
                     /db_xref="GeneID:12981515"
     CDS             complement(276897..277658)
                     /locus_tag="LMJF_03_0710"
                     /note="previous protein_id=AAM69037.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721747.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981515"
                     /db_xref="GOA:E9ACL6"
                     /db_xref="InterPro:IPR007214"
                     /db_xref="UniProtKB/TrEMBL:E9ACL6"
                     /translation="MERCRQHFISKQAPHLTERIQTFAESSATVELAAIRLGCDPAHI
                     AKSLSFLLKKPKSKAEAKAHQKMVREVRTQQQDGSGAAGGDRASASPASQPTATAPDD
                     TNIVVIVAAGDAKVSTKKYKEKFACQPKMLKHEEVEPYTGFPPGGVCPFGLHDDVRVY
                     LDVSLKRFPYVYPAAGTTNTGIKVTVDELEQYASNAVEWVDLCEGWQPEEAVAAATAE
                     KATADGSSTIGVVQDAGVAAKKVENEASKSAEATA"
     gene            complement(<278248..>280869)
                     /locus_tag="LMJF_03_0720"
                     /db_xref="GeneID:12981516"
     mRNA            complement(<278248..>280869)
                     /locus_tag="LMJF_03_0720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721700.1"
                     /db_xref="GeneID:12981516"
     CDS             complement(278248..280869)
                     /locus_tag="LMJF_03_0720"
                     /note="previous protein_id=AAM69038.2"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721748.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981516"
                     /db_xref="UniProtKB/TrEMBL:E9ACL7"
                     /translation="MMQCLHEVVRRWSPTPTTSAVADGAVDGDDSDACRVKRRRRAAC
                     KRAAESEGVMPSAACTFMANHRLLTAVLSVLKRMDLCVMEAEIKSSPQNTSAAAASVG
                     AAATATRCTDGKPPQQQPQQHPCDRLLLHKTPFPARLSRLLLQWLSREVSRMDATASL
                     QILHLLAQQRLLHMEAVLKTLVDSIVVHLERCGSAGAATPGSESTAQAFTLEEYSLLF
                     DTLARFQAQLLRLSYLRQFAAQEPHGVHPSAAEPRDGTSVVDAEGTEATDPCLVSATA
                     AVRRRALEQGNHPVANGRLFHHLAEALSLTLMNGQQGHLPASMAGAATNSIDAADTSA
                     RLLRMNATSFLFLTRALSKLQWWHDGLAAALAAPLTGYVRAHPESALVVVGLVGRREN
                     RSGDVALLEVLQDSLITLLLRRRAALKARTEMGRAPRQGRAAGMDSDAGVEVGTSGLV
                     SQWAQHRGDGATGESTHHTTRAGTNDGDDHEAVLAEWEEGGEADLRLFSSAASDAAPT
                     THRRSHGLFAAAVPTASSTPAVAASTPCGVTPAPPPEPPAANSAASLTFIDLHALPGT
                     VEALCRFHMRTVAVAPPPREAGAGAAGTSGEDVRVRLVRTMRELLGLMLDDTSRGITS
                     LDAVARTLAPAFLSRVLLTLLEATAQLPQAWGTIGLPDALLLRRGEYTNTATVDNPHH
                     PLVIELAYAWILQVMRHRRPPRPPSTSQTDERTAAAAVAYHRIAASAYWRRAVVVHEA
                     LVKGGLLCCTRPHAAYASDPAAALRGRYYMPDDILRAAPRVNAAVQLAKTRIEAKREW
                     EAAERPEVEEQEQHKAAASRYASAAIRVSAQRRRASAASSSSRSPQHQGRRATAEQPA
                     RTTDVFAGYTKAISRLL"
     gene            complement(<283112..>284317)
                     /locus_tag="LMJF_03_0730"
                     /db_xref="GeneID:12981517"
     mRNA            complement(<283112..>284317)
                     /locus_tag="LMJF_03_0730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721701.1"
                     /db_xref="GeneID:12981517"
     CDS             complement(283112..284317)
                     /locus_tag="LMJF_03_0730"
                     /note="previous protein_id=AAM69039.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721749.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981517"
                     /db_xref="UniProtKB/TrEMBL:E9ACL8"
                     /translation="MAAPASSATLPSVLQLTANTSAGGKRPSRAVTMPALKQAAKAAA
                     AAPSPSPSFHVFADLPDHLLCSPDNSVWVYAQHTLSFLTSEAAAQAKLGRKVQRMMRE
                     AQRQYDISCAFFHSMSSDEQMAEVLRVGSGGGALSLPPAMTAATGTPAKSDRKRLTGV
                     HRALRDAWPTWRGPNMSDAANSLTAREVGGAGESESSENRYSAGLRVNIVLDIVASRK
                     TLRTVPLRSRPYRLAEYLYQLVMQPSATQRATAAPALGDMASHVRSLIIGISDADTTL
                     VGCHIVCPYRHLTSPTPMMMRLRRAIEGAADQERARALAAAEAANTTVSGLDTQWQAS
                     SAAAAAEAAASDAAPSPLRSLVASHLAHYRRVDALFPAPYVRVPPQSLEQIDQNRLIL
                     CTPGKLLDG"
     gene            complement(<285202..>285456)
                     /locus_tag="LMJF_03_0740"
                     /db_xref="GeneID:12981518"
     mRNA            complement(<285202..>285456)
                     /locus_tag="LMJF_03_0740"
                     /product="putative cytochrome c oxidase copper chaperone"
                     /transcript_id="XM_003721702.1"
                     /db_xref="GeneID:12981518"
     CDS             complement(285202..285456)
                     /locus_tag="LMJF_03_0740"
                     /note="previous protein_id=AAZ09194.1"
                     /codon_start=1
                     /product="putative cytochrome c oxidase copper chaperone"
                     /protein_id="XP_003721750.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981518"
                     /db_xref="GOA:E9ACL9"
                     /db_xref="InterPro:IPR007745"
                     /db_xref="InterPro:IPR009069"
                     /db_xref="UniProtKB/TrEMBL:E9ACL9"
                     /translation="MGNSASSVGGAVPPQQQDQRQSSKTPSCKICCACPQERRTRDEC
                     TLLRNVDECETEIEAFYACLRREGFSAEEVNALKRNTKTM"
     gene            complement(<286149..>288416)
                     /locus_tag="LMJF_03_0750"
                     /db_xref="GeneID:12981519"
     mRNA            complement(<286149..>288416)
                     /locus_tag="LMJF_03_0750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721703.1"
                     /db_xref="GeneID:12981519"
     CDS             complement(286149..288416)
                     /locus_tag="LMJF_03_0750"
                     /note="previous protein_id=AAM69040.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721751.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981519"
                     /db_xref="GOA:E9ACM0"
                     /db_xref="InterPro:IPR001130"
                     /db_xref="UniProtKB/TrEMBL:E9ACM0"
                     /translation="MGFVDRGGGREAKGASLRRSKNNPGASIAKNKSAKKDYTTPATR
                     ATPTPPPACLPVLKALMAAASAGATAMEATAASTVTDFEKALAAVRDAAQTGGSPYID
                     AAVALLSRKLEEDREGIFRRAAEEGKLAAVVCWCGEAERQSLLLNTCVQHNKLYRGTL
                     EQQQRSSATGGGARHVHFNVDGAVVASVAAAVTTSSSSTKASILLYAVLGIHVNSIDR
                     VNMRLHDQWVKELEANVKHSDVVGVLTGLNLSREHGTHYAQERLFKECWRVAAEVRLP
                     LVLHLGAADAASLTETVNRAAKLLDELLAATSATADGAGAAPSAVVLHNGLRALHAST
                     AMQQLVRAHRPAAGRTAAAVPFYVLATADGLAVAKTEGSETEVTATTDSGPSVEALAA
                     LLPPRAGLGSNSDSATTTSSGGDAAVHLSQLLIGTGAPWGTPQNLPDPYLCTLPNEPG
                     NYAYVVQTLYDAMRAPPPPPTAAAAAAELTLADLSAIAAVNYLLAFFHECVWEQEQQQ
                     QQQRSGSDDETTADALQQQQRRWVESQQPVVVAGLADSDVKRDLEALLAEAAKERERM
                     EQERLREEAGLAQARSEELQQKRSRRERKKNVKANNRSNFTHFRNKDFAPRQSKQEKP
                     AHLREVVGIREGGSTDVDGRERTPSSSSAASDSGSAGGPNSLAAQVERLLKANAAHRD
                     PECRAQRQPAGRGKGRGQNALAGSRKVGRSADMKSSEQPQQQYGAGAGGKAENGSPSD
                     GSDDDDERYTRTRAL"
     gene            complement(<289277..>290227)
                     /locus_tag="LMJF_03_0760"
                     /db_xref="GeneID:12981520"
     mRNA            complement(<289277..>290227)
                     /locus_tag="LMJF_03_0760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721704.1"
                     /db_xref="GeneID:12981520"
     CDS             complement(289277..290227)
                     /locus_tag="LMJF_03_0760"
                     /note="previous protein_id=AAM69041.2"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721752.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981520"
                     /db_xref="UniProtKB/TrEMBL:E9ACM1"
                     /translation="MRQFAYRTMRTATASLAANTTLTPVRNCYDSSRVERGDAAAAAA
                     SSSSPSVPSRRSSAPPRHARPVGGRGPVKDRFPPVPTDLADPRRRLAVLVDGSNPNLI
                     PGGCTTVDQVYRTSALFTMVLPAVLQVGVPVLLRVFAHQLPAVWEPLLAGSSSATQGG
                     SASASHHTPTDGAGQSISLVPLPLQPSSSTSSSTADAVIVPQVQFEYFRVERFIPVAM
                     QMEADARHLYEFRHTNKVEGVCYVCHEVDRAMFISLMEEQRTGSVELEELLREIHGKG
                     RRAEAKEEKATAAAFFNQYVLDELGMAGELLADSRSKSGA"
     gene            complement(<291072..>292712)
                     /locus_tag="LMJF_03_0770"
                     /db_xref="GeneID:12981521"
     mRNA            complement(<291072..>292712)
                     /locus_tag="LMJF_03_0770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721705.1"
                     /db_xref="GeneID:12981521"
     CDS             complement(291072..292712)
                     /locus_tag="LMJF_03_0770"
                     /note="previous protein_id=AAM69042.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721753.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981521"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:E9ACM2"
                     /translation="MPSPSSSTPPPTVSFVDAVKQRYGSADDNTEEPLGAVFSQDKKW
                     QFVGVQQTRVKQSRHDRLTLVVLRNCGINVAMHEPSATTAAGGGPKELQETSMIRLEE
                     LDLSENTALSLAEVGKLMPYLPRLATLQLCSIPDLLPMAPPATTALSSSHLSKLVLNN
                     TGFRSLAQLSALVELPQLKELHLDSNKLTSLDVVVAPPPASAGTAEGMAASDSGAGAA
                     AGEVVFPHVTTLSLAHNELSDWRAIGVAIVQAFPALTQLYLTDNKLEDLVLPETLVAR
                     AAADEALTAELEDGGVLQPYRYLRPLTLLCLKDNATLCNTSTLDAVRIFCPQLATFRI
                     TYSTLLPTWNETNARMYVVAALPTITTLNRGTVRPKERLDSELLYIQRGLLQRQMDEE
                     SRDGADNVSGSATAAPLPCIAYPLLDVLKEKHKDVVLALQRDGDTATTTGAGYVMITV
                     TLYFVNGYAAAAATSSSSSPMTTQTSKLPSTLTVAKLKALVQKLFQVKPVNQRLSYRS
                     GDDGVLELQTPLDNELETLGYYGVSDGSIIYVEDASLR"
     gene            complement(<293546..>302884)
                     /locus_tag="LMJF_03_0780"
                     /db_xref="GeneID:12981522"
     mRNA            complement(<293546..>302884)
                     /locus_tag="LMJF_03_0780"
                     /product="putative serine/threonine-protein kinase"
                     /transcript_id="XM_003721706.1"
                     /db_xref="GeneID:12981522"
     CDS             complement(293546..302884)
                     /locus_tag="LMJF_03_0780"
                     /EC_number="2.7.11.1"
                     /note="previous protein_id=AAM69043.1"
                     /codon_start=1
                     /product="putative serine/threonine-protein kinase"
                     /protein_id="XP_003721754.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981522"
                     /db_xref="GOA:E9ACM3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9ACM3"
                     /translation="MLHWAKHFFGKASTSAAAATDASDGGTGEAVVRQEQPRRSRRGA
                     DVPPLKRWWISADAEDAPAGAARPSPPASLTLAEAGMDGDYGSPGILDLAASLNFGAS
                     APAAAAAAAEAPATEVVSARCADLTTTSTAHAHDNDDDDDAVDDFLRNVIAGKTDMLR
                     KRLAQEKLEAAAAAAAAAANPGHHNNNSPSCTSDGAASMGSSMHMQKSITTATTTTGA
                     ALAAGGASPQHYHARRSRYVSSAARSLQDYELIAFLGSGTFAEVTLARNKVTGEYFAV
                     KKISKQRVKEEGCVERTFTERQLLAKLHHTFLVRLYQAFQSQTHLYLVLDFAQGGDLY
                     SLNVQQLWLRSMKRNLVKMQYPYYQSTSRTFTPAPPPAAATSNAQQHQPRASPVSARA
                     DGAQRTAGPALPRLPSSATVTQPTEVVPDVQRQQPRGSSGTATSDRDAILASSAMVGS
                     VGPSTVSSASRPGNTVANTATGAALPLPSARDGRASGVADGAHEAAAAVAVEEEMKEE
                     DAKTTEFDGATDNHHSMAEAPQSAVLQRQRQSIRHAQPGAADCPSQHPRLETDLFYYT
                     TDAIDEFSTSRNVGSGGSRSSPTTPTISRTPEATESATTNAAAAAGDSAPAATRDGEV
                     ASSTASVASSGRERYRLLRRRTLPAVERDSGARGGLSVSSSSSSSTADDNSKGRRRRD
                     TADKDGRGSSADSARRLSWRPRGVACTGPATQAEAASQHPPSPAASTPSRQTAASSAS
                     GVSTATSNTALPLATRPSDLTTTDLATPKTQVPLPRSPVHFQCDERSSSSGHSNNGGG
                     GVDEALRDDESSSAVSVKSTPSLTATKWRPMPRRASASELTDIFAVAASSAAVTVSAT
                     SAAGGTSAADVKRYKTTKSAWPPATGAEQPQLASDNSHTATSATSAAATSLPRRQKGK
                     AKVVSDKDEGSGASPPLHAGSRHSHRRAPAKKATESHDASEAAADQRSLSTDITTDAA
                     KPLSATVTTMSFVGATAVQDAAATTAALRVDLAAPFHQVAMEGSASVLRTLPSTVFAP
                     DGAHRLPLRLIAFYAIEVALVLQYLHREGFLYRDLKPENILMCRDGHVMLTDFGVAKY
                     RKGAAIMPSGSGEGVQGEVASSPSSSAGACTYGRANSFTGTTQYMSPEMLRGQPHDSR
                     TDWWSYGCLLFEWANGRKAFNTQNQFALFRSIVEEDVKITAEDYRLTLLEVHTRVAQL
                     HYRAEEVRLAYEQRVARRMRRSFTPLSQSTRPQATPSALTAEVVYNPDNRSFDVQLRS
                     PAMSALSFAQSGSNGAGAAAEGAEEALTGNAVKSCIPHPKDSRQLPPPLLPPSNAAAT
                     HITPHRHAHRRLHSYSYASPHSTATVPKASVAVLLNDSFANQLGALGVSRTTSAEEDT
                     QGPSPQSTLNDSFAGVESNSVVSLCGAPTNLSMRLTTTEDGVIAALLSSASSTAVHLQ
                     HQQQQQERHRRHQRRRLRLSCLNLDEATRDRYIDNAVAQMAEAQALLRDLTMKLLDRR
                     MEHRLSGEAVLEHPFFTCPYIVSQLYYDVYQRRVLSTEMRRSVRAAFGSNNVPVDLVA
                     PVWDGTLQQPTTVASPLPPLVPASPTPFATTTTAAAAAAASVSHTHDSSLAIPLPSQT
                     RPEDWRKLFMERHIRAPYTPRLRTRDDLRYFPAAVTATGLSAAVEQHRRIKEVKEQQK
                     ELMIMRANKATATAANNSFGSATFPATLSCPNTQLPANGSGSGGGSVVLVPLDAEAAQ
                     QVQQLLVASASSLSLHNRDDASPLPELDPDGAAAVHTDGVRAALDVSHAAAAPVALTS
                     SGAAVAVSTPAASSQGLTEKIQRLQLPAVEVIGAVTADLGAASPSHKQLAEVTAQSSA
                     TGDARRSDLAEEAQLDTAATTAAVELPSRMWEPQLAGHCSAGTGSAKASPMDTALSVG
                     SGSVMTSAAAAEFRPNLLDRAATLPQSFVDAALAVAAAAAQKQQQRPADSGTAPKALI
                     AAPVETQCSRTGAVAAAETACASASTDVIRSTGAARSTFAATPPTSPEALPQQEPARV
                     DGAAPNSCVLPAFREMAYAADGRADGRRSGALPACGGVGAHSTADAEAVVEDAEKAHA
                     EVLVDEGEDHDGGGGYYEQDALAEDDAHAVDGGDDSTIVEETAAAVDMTSETDAITAA
                     AVNSTMEVSSFEDSHASVRLPTPTRRGTLVKSSVVVSSAGTSGWGSSAANPLSPGVGS
                     VDAEADSNNSVCRRGNVSITGPPPIVPMEVPPTANASPDLRSHSRRSLGSGSARPMHG
                     PLKEAPVYASPLLSHSGEMHCDLSAFTMSPVSSMTTMLLEDSQRSLSTSLGPSGAGGP
                     CGTSSAWATPSSADTQVPEREYQRRVYHHRHPLSYTDGSGNQAVPGVSPHMLPLPPSL
                     AHCDESQQQPPEKLLSAATSFENALLPATTSFSSTTNTTPLGTIMMIQSAELTGVGRS
                     LSAATTAAGTASDAAPSCTASPAALQALAAFRDGTTTVGGVEASSESPCGGELHSAGA
                     ARSGGPPIPAAFSAVEHRGARPSSATAAAVTGMASMNVNHGVADDDDNHDVGIANEAG
                     YERSGGEEHSSGDDDGSDTMTNSGSASEGQDEGDWKSDASESVDFARRPTPSAPASAR
                     GENVAGSERSAGAVSSLLDSSASSISTTTSTSVHALSVSSDASSTSLQGDNNRTAAMY
                     PTAIRPPMALLAGADRGGDGDPSGTISERPQRGDTVSLSPYDTPWSFDARIGSCSGGG
                     DHCRRGSDQCMLHRYAHLGCDAAHGGVGTSMPFTTTVTSVAVNPTMYATLSANTPLSV
                     GSSSSRFFSAAGGSSLSLDTIGGGADDAAGFWGPLTTTLSGVAYNIDDEASMSTFAAA
                     PMMPAEGSDSDSGAASTPLSGYGGRGQGGKDAIGATASSGAGSPSAAGRRRGVQAIWA
                     KQQRKRIARELQQQQQQRQQELDPSAAASLLCEAGAESGRRGISDSGRWWSYRSKHSS
                     NDATISSKGNLVDLTSNDGCAEPQHRRMHLGVPYDRSIGDDDKYNAAAAGRCGSPLQR
                     QSCSVKSGGEQGRSDGRGGKRDHQNSALKSSGNEGGADGRAGATGEGGSGGFDHFQNF
                     SFTSPQLLQHCLASSSSSSGGGGGDVDEGRRRPHYQRLRRGRLGGGDSDREP"
     gene            complement(<304661..>305968)
                     /locus_tag="LMJF_03_0790"
                     /db_xref="GeneID:12981523"
     mRNA            complement(<304661..>305968)
                     /locus_tag="LMJF_03_0790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721707.1"
                     /db_xref="GeneID:12981523"
     CDS             complement(304661..305968)
                     /locus_tag="LMJF_03_0790"
                     /note="previous protein_id=AAM69044.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721755.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981523"
                     /db_xref="UniProtKB/TrEMBL:E9ACM4"
                     /translation="MQVLSEATPMTNGEVYALLRRRRDERNAARHPPFGLQPVLADSH
                     QRAAVATGAAAATAVAPSAPASASAISRAASVMSHNSVGQHSGSKAAPAGAIESAASA
                     AAASTASILASPSSVHLVVLLTEVTMLNYIANHSSLLLESARPTPAGVRVRTCTPRDV
                     YGPTSVYNRVVGTEGRSDAAVGASATAAGSLLDAELVSSCYAKLASHRPGTRGHVRGV
                     EELLEHFEEVGRAQERLYAAGVRRAVQQLWRRRLWVPAEGLYPPPSPPFATTAPSLSN
                     GSALVKAEPVAEEDVDGTAEAVQRLSQDKAARQSGAGETNHDAEGAQPTNASHLVTPL
                     LLEPTPLWGPAARNGGGKGSVDGGAATASMAHSPLSYHVQLQLQQASRSLLSEAEVLQ
                     LVVGRPQRALDVYRLLDDVDDRLQYREEAVNAFVEAVTGVFAE"
     gene            complement(<306694..>313962)
                     /locus_tag="LMJF_03_0800"
                     /db_xref="GeneID:12981524"
     mRNA            complement(<306694..>313962)
                     /locus_tag="LMJF_03_0800"
                     /product="putative
                     6-phosphofructo-2-kinase/fructose-2,6-bipho sphatase"
                     /transcript_id="XM_003721708.1"
                     /db_xref="GeneID:12981524"
     CDS             complement(306694..313962)
                     /locus_tag="LMJF_03_0800"
                     /EC_number="3.1.3.-"
                     /note="previous protein_id=AAM69045.1"
                     /codon_start=1
                     /product="putative
                     6-phosphofructo-2-kinase/fructose-2,6-bipho sphatase"
                     /protein_id="XP_003721756.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981524"
                     /db_xref="GOA:E9ACM5"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR003094"
                     /db_xref="InterPro:IPR013079"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:E9ACM5"
                     /translation="MSIVRHQGPTCIPTQQPLRHVHMSKASASPTADDQEGVSQGDGD
                     DKHGCLPQPQQQQPHRRDVSFLMYDNQALQQHMQSRTGGALTVSPPSPRDVGLEPPVR
                     PRLSPFSTPTYSVTTRTLEDLQGWRRSAGGRGGGRTRGTLGAADGGSRSRGTGSLVSA
                     ASQLATHARCGSSGALEAAALPQNQPPRHRLGTHSRYGSVGLAPPTSPSTAKSSTQRL
                     PAETARDGNASMPVTVGFNEHLPAEAAQRAPVHVNASPITTTTSPITAGAGMERSTQR
                     VCRTQRSNPVGLTASAQAWHWGAAPVAAVAFQQQQQKGRGRQRRAVAASSEGTLGRRR
                     GGNVPAPLFSNVPTTAAMGAAVAAWAHKSALNPSMSVSSPTTKVPLRRTPPTSSTSGR
                     AAVFPSPHATPMSSGGDSLPGAESPAALESSPTQLLSGRGTLTTHTPTTELKRVLSHT
                     EAAPMSLTSKVSGEDAQAPSEATTVEAPFSTCAPAPSASVSAGAAAPATSYDAAPHLG
                     VPHTFATLDPTGTARFRPVTGGTAAEGAEAEDDIVAAAAAGQQHLLATDQRKHSDDSR
                     GDLPRVMSFASGEEGSIYSLVDSRQTSEHACALPASATDENVVEAAAAAGAATAGTAR
                     AFTGTEARTTLYRQGVDDAHIRKAPQSLNIGRATAFGGASSQSRAAGDDAASGIPFRS
                     EAAGAHVLGDRRRRVGRGGATGGAVASDSLEEEALLRHGLETGGNAGIGSVNRAAMLK
                     RSLTAPSCVTGMSSATASGGLLGSGTAAAETWPKQQHANNSGVLGVTAALGQRTTSVA
                     SNSFWSSSSVNMNAISNNSIAGIAGGVSAINVGAGGLGSLVNSSTLFSGSSFTTVAGA
                     STLRDPFAASVVMQQNRSALIAELKRRRHRLHKQLELLQKEATARNIFALVRASNASQ
                     LQYLLQEGLCNVNDRDYNGCTPLHVAAGEGNQAIVRVLLSFGADVVAVDNNGRTPLDC
                     AAANRHSGVARYLLTVIRSKHLIQDGGDGAVTGSGGDDGSPATVRSAKRAADEGSADM
                     STYPSSSTSPIDHSSTRRRNLDSAGGVLPLGNSPAISLTPCAGTATQIDTSAQYQSAS
                     SGSSLMQSPRLPPPLSRQPQQLRHPVSSSLVASTPSPSRPSNLNRYPAKVTASVATMD
                     AESWCDSDVPPHAVGWGIHSALAEAAAACSAPNQASAAADTTAASDPASRSLPQRLAS
                     QHGATAMANSAGDYSTLTTHERVASMSTPRWRHNSIPHGSSPQRPVFLSSLDSTAAAH
                     SRGLIAAESNAGAATTAPSSPPFSSRSHESTVPLPITLGINGPATSFGSGSASVGGHL
                     LERHVMSAPTYLAGAMEECGGEGTGQAVMQQPLSRTRSSASLITTAAATAAGAMAGWH
                     DSDEPLADTNAEGIFDAFLGRRGYCSTHRRRMQSESGSSPHGAFASASSDWLRSGSPP
                     ILSAGDDKQQRSRNDYNFNATGSFPGEVPSKLYPPPAPTAAAGAATTAAATPATSAAA
                     SGGGAQQRQILLRPPRRPDSRSPATEWGGATTTADAVACPMRILHPLQLLGVDSHEEL
                     SSYHARTATSVTSSTTAATAASGGGSPRLRHAASSSLCDMGQQSLEEHHHHYRLTAFG
                     ALGNQQQLKGKYSCDRHSTRPPLLQAPRAMSNPTKMEAAVAGPASPSGGGGDGGSSSN
                     SSAITKNGNSDVTPLFSVPAVAAPSSSRNTTAGPSETTKTLVAAPAAAPAAAPTAGSH
                     IAEEQPFLQEMHHEPVELAALHHSSYTTISDTVSVIVCMVGLPGRGKSFISKRLVRYM
                     NWKGVPCKVFNAGNYRRQLLGVEATAGADFFNPDNPQGAQLRERMAELACEDLVNFIA
                     SHSLAVGILDATNTTRKRRAWLSDYFQKEAQQYAVPYRLLFIESVCTDDTIVTENILR
                     SKCGNDDFRNLRDVNAVISEFRNRILQYEKVYETLEPEERMPYIKIVNVKRHVILHRV
                     PNGLGSRIAFFLLNLHPIAFPIYVALPGETVGDSKHVYGGDERLTAQGEAYALALKHF
                     IQDRYVPHMVVLHATNYCVLSTLAPLMEGATQEEDASALQVSSSANQRSAPAGQQCAA
                     KATLAPADAVATTGGEPSTPNASSEAPQDLQQHDEGVAEEQSMHEDDSDQVDADEEDV
                     GDEVLCAVPGLDNINFGRFSGHTAAWVKEKYPRLSALLYDVDDDDVVGDARAGAAAAG
                     QQHQSRKGSGEADATTSSAPVRSDTAAEWFSAPLPPRVHYATHEEAVSHLQRTLSGAD
                     PRLSYCTQLPNGESCRQVNVRLEPALMAVMRTQSPVFVVAPAVPAQGILSFFMDVIPE
                     QSPTIRIPKGCVIEIGVKDGITVHPLLANALPERMTRSPLTVLPEIQNAIREVAAASS
                     MEMCAARTCAEVSASTQAGGCTVVGDGGAAALLSAVAAGGEAGGSVKGDACPVSASAS
                     "
     gene            complement(<315211..>318447)
                     /locus_tag="LMJF_03_0810"
                     /db_xref="GeneID:12981525"
     mRNA            complement(<315211..>318447)
                     /locus_tag="LMJF_03_0810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721709.1"
                     /db_xref="GeneID:12981525"
     CDS             complement(315211..318447)
                     /locus_tag="LMJF_03_0810"
                     /note="previous protein_id=AAM69046.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721757.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981525"
                     /db_xref="UniProtKB/TrEMBL:E9ACM6"
                     /translation="MWHPSAGAAAAGYRDPTTLLAESVSSTVTGSDESDDDYRTLHDF
                     RKAALGKQAATSRALTGSRHTGSDTERVQRQRELQEHRFFRKRGALDYRHSVVFSPAG
                     CEPTEGRGSGGSPASPAVEAVPSAHSRRRRQGTASKSSFAADEPNEDCVPEELRAWYV
                     ASNSAVRVARQAKVRQSSTRAASAESRDSRVGDETPAPADALTDRPATPGLADDRSDG
                     EDGVFGDVVVRPSIRSGGAGTTSVNILQSRAAPRMGGGAHPPDGGRVGAAAGAQAAAS
                     LSSGPGATPESIRKGSTTAAAVTDDTNVESHAWGGRPPLRAHRYVEQPNGLLINHARH
                     ADLLAEYAVEAELHYAKEREDARRARRWARVLYGRSSGARRDGGQRQDGTTAVPASAN
                     ASGTAMARSGCYWLYDAATYRRHFLSTLRFLQRVHVFLGALAAGVSLLTLLAITVPFP
                     APYIGSDGVVVADAGSGASAVLLLALFANASATPADTAAAAAAAHVLPVLEQGYPAFA
                     LFITLFQVYHASLLLCLCLLLVITGYAPAPWSVAEGYWMTQRWRWLQQEGQDAEHASK
                     RGGEAGKRPRPDGGGECRTDTIASSDGTAFASASAGAGFGGSRRPSNMVHRDAMSSSS
                     VLGDGSRSALFATRTLHHSPDDRLSMSMGGGGGGGVGVGGGGGWANRGAYGSDELDYS
                     ATNVLCGSRGATHGRQRLDSLRYNVNLGASTGPSGLGATYAAYGATLSSLAGTGDWGT
                     LGEAQYTLPPATMLMSPRGPGGGASRYHPLHRNSEGGNVAGSAVTDAPGRHRQQQYWL
                     QGGFALHGDHPAVAQRGGGAAVNRALRAPPLQLHFPASTLEGSLSANNVLTRMFDRVE
                     RRAMQGLCNALHALPRVFCVLGARRGDDTIKSSGARGARGGAARAADAWPRYVENDAT
                     AAGRELASSLSPQVHHTNPVLPAFLHLHVVLQPRLWCVVVALVLTVVEIALVDERTVE
                     LLWLAQPAWWWSAAAVPSQRTTSSGDVVLPHAWTVANFTPTSARMSGGGGGGVRFAAA
                     ASDMAFLPGGALPDDAEDTSGYLWCVLMAVYATRTALFWVAFLLNTFF"
     gene            complement(<319236..>328046)
                     /locus_tag="LMJF_03_0820"
                     /db_xref="GeneID:12981526"
     mRNA            complement(<319236..>328046)
                     /locus_tag="LMJF_03_0820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721710.1"
                     /db_xref="GeneID:12981526"
     CDS             complement(319236..328046)
                     /locus_tag="LMJF_03_0820"
                     /note="previous protein_id=AAM69047.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721758.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981526"
                     /db_xref="UniProtKB/TrEMBL:E9ACM7"
                     /translation="MDARAMASIADSAEETTSTVVDAPAPAPWPLSPLPPPLVSPVDE
                     KPQLQQGSQEAPVAEQPDASLPLPLPASPVTRRRKRPLTAATAAIARGRSPRGSAAAH
                     PAAAPLSALLAPTTRHPPQRSRTATAAASRTTPSPPKSAPPPTPPPPSSSPPSLGKDS
                     VPPPRGKTVPSAGGRCTSAARASSSQQQKRPPRPGAARRLATAATRASSSAASPYQSL
                     VDAVLDEQFTTRSSSQQQQTAAAAAATGVAVGGGDPTVVAVVPSERRARGGGVAVQQQ
                     RQRQTPRRAQRLAVTGRTEDDSDDSEDGSEAAASALAPLHQQALRLQPLPPVAPAAAL
                     MEEVSLAGGDDGELAETLADIVAVAPTQARAATQSAAQSALAVERARLLHNSPCTMDE
                     RDAAGRMRSLDAEARERLWRPTTEPRVVARAFGHAGAGVAENHRHASAVSSRAPNRMR
                     SAAALPAAVVEFLKAEADAEAAVKGTAATATGAAERQRRAASPKRSRDIAGARAGASS
                     ASPPTTALSTSPPLASLPPVLSPAAESAAVLRDLKDVQRRLHAHGHLRGTAAAAAGAM
                     PLEVKAHSPAAAPSNSTRGPESCSPCDISVAASSVSSTATSSSSSSSAAMKRSERHGS
                     ARRNRMVGLRRASAEYWATASLTEIVDALEERCTAAPAREHRKHKRQRGQAGFDPASY
                     ARRLLDTAARSCTSSTVSDDDDDGAYTDGGDAGYNPTGPRRRSAEEGIRGNKRCETTE
                     DSHDRRSRSAPPASCGPSPAALKREALLRSGPTWATAAAELGLTPTEVQDLLRYSLSS
                     PDAAATWLAVSSCHARDATRVVEVAADTVPENGVGRRRAGREKTCSSSSSSVAGGSPS
                     DVHPRRPHRLSSASLDVATQTALVQRIIAAMPAVPAELQEELSRQRRLLERVCRDVSC
                     MSAPAHAAVRARLASPTVSSAAARQPSPLEFSTGASGGGAQTSPSAAAETHNMQVQHE
                     EDQQLLFASLPRPAAQALKAVGSLRGAAADPSRPLPPFHAVEARPTLYPAPQDPASTT
                     GSGAAAPREPYEAALRELAERETRHYVSELDRLRTMYDRQLQEERRQRQQERRHYAEL
                     LQSQQHKMLRHHRETVHLLQRECRLQQQQQESLVQKLAASQAAAAQRQQAQHEQTTKH
                     MLAGAVDVMKSYATAEGLGKGGQAEMAAPAGVAVTSRAMQKRRRQRPRVHFDSAASGG
                     SKSKRVVGSPTSPLAAAHSPDDNDTSGAGKMRESARAEGVSAAATVASVAVNTPPRSS
                     MCPRVVDVASKMSPLDADMPTAEHVSPPQPASSAAHLGLSSVSSLSVSPSRSTLPSPP
                     HPSTDSDGGRAPSARSTMRPSPPAAASTAVGRRGEQHPTATVTLSVAPSASTLVPTPA
                     AATPAGAAVASAGPPINTPAMLRAVYGGNAGPPPRQPRTQGRMTLPLHVRLPPEDDTP
                     TRQRLDVTAVEAELSDVRAAAAARDAGLAEGTRLYGAVPRRPRLPHASSSSDTGEAAV
                     ERLNQAAPRRALSASPSSAAATRQARTPDGEKAVGRRSAEWRRSGSGRGRGGPTRRGR
                     VGKGPGSSAGRRGRRTSPHATVGGGSGGVAHRSRRLLLHHFDTEVVSELSSEAGTAPS
                     HACPLHGAWGTPAPNAAASSTAYPSSVAPHGDVMDGRGVVPEPAQYRGMWSEAMRVDD
                     QGTHGGTGPHQEAADAAGVTAGKPSVGRLHVVLSQPAGGEVAAVTCATRIAGAAASPV
                     PCIPQAVDAELRAALYHRAGVVRELRYTALPGSSPVQADGSTGDTDGRAVFNAVGSLP
                     PCDSAFFGAPAEVLINATDSRAGEDDGDGALPSNLDVAPVPLVMLSDYARAWARYAAA
                     EREVESHAQALAAEDTGVLEAVSIAQERRRRSRGEEDDDAVSAIVVATPHPASTAAAV
                     RYREQELGYGDPALRRGSLHVSPRMAAEAQALTEARRRLSAIRACFIAPPSLGAASAL
                     GSASMGRVTEPDAAARDAALVRELVDATVLSVLEVQARGAHEDPVQQVMAAMEHEILR
                     LMLVGCREARVEIASGAAKEENAHPQRTKSQQRRLDAELARALAEAALEDVVHAALER
                     SCHDKKVRQAVTTSSDATATSTTTTTTTAAPALPVDAPSAVEVDPREHVSIPRTSSTA
                     WLQDDPATSEAAPQQQATPQPKDVGDAEREANAITATATVVLRPPRDDQHDATSPAAP
                     RAAEPTPQEVRVVVDLSPVVHHMITSRIPAAAVPAYDWQQQQYCPPPYPPIQQEQLPS
                     RWMALEDRRDVIVEAESPLVVTETRAELPAPTVADAEVAGEHTSVAVPATDGDGLPSL
                     AVPAPPLPAVVPPPATASDDPSCAHVEDMATPADGTTSHDALQLTLIRLLQSTLLDQE
                     RLQRASLADREEEQRRAHELLREVSKVAAEQRTSKAPAAAVAPPSPSVAAIPMAESQL
                     ALSPRPVVNAVTDGARREDVGATETATSRFSAPPPSQPPPTATPVTSASRCTTPPRPL
                     VRDPVMGFVLEWVRQFGALQQQSSMRGAATATSSASLVEGLNAAARTAARHDAAPPAQ
                     PAGHRSLPGRFMRYAASSLSTRNLGSSTTTASSSLLSPSLPSSLHTQSSSSSSLLEDE
                     TWGRARITGGWHSGEQRVRVPHRISSGAPLEAARAHQCAPIRKARPVLDTQRDDTSAC
                     TATTRYTTGRSSAAFAFADELREGRAVPSGSSGLLPPRASAEVQAAMAAALRAHQQAN
                     RAEAWTAAPEDGSRLGATDISQGSAVGNSSYAISLPARSAPTTSVIGTPPPTAAAAGV
                     PPSSPAKLRAPPPTWSATTREPADARDDGNGGAKDAVDDAGKPIPSGRTRDKVAGTVA
                     VVGPRDAWKQRATQPRPRSPLRTTEWTCVSLTSTSTSSHSNDRGGSGGESNHVHAAQG
                     NGFAPPAISEAAPASSALPFMSAQARSATAPARRNGVLQAPLRPRRSLCQ"
     gene            complement(<329559..>330770)
                     /locus_tag="LMJF_03_0830"
                     /db_xref="GeneID:12981527"
     mRNA            complement(<329559..>330770)
                     /locus_tag="LMJF_03_0830"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721711.1"
                     /db_xref="GeneID:12981527"
     CDS             complement(329559..330770)
                     /locus_tag="LMJF_03_0830"
                     /note="previous protein_id=AAM69048.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721759.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981527"
                     /db_xref="UniProtKB/TrEMBL:E9ACM8"
                     /translation="MWQRIRLLQTLVSQKGAATAAAGAASSSPTAAAAAATTAAPPSP
                     APSVAADNERSFLRNLIPMRVYSSGPPSIYLRHAFLNQDRLIRRFLGALEAVPLPSLP
                     RLLLAEGFQRMLEGDVPQRELRELFEDAEVECRKMLLHMDVSKSGHRRYHDSHADPRD
                     QEMWHAVRHDPLRRLLAHELRAACSHYARLMGVSSSPYVPAAVIVRTIIASDVRTDNF
                     LVKMTLAFERHPRNVETGEPVGEAMPPVVEELMKELLLLERDAFGCFRFDPRGDNHHL
                     VHSLKLADITKTPRSFSVMRDPLMKRYGNYCVECEEVHKGRWNQYKVHCGPEDHRIDP
                     ALPLFESVVATDPITGGALNMLVHYDEPICLRHKHSLREEKGNFGHTEVFELAMDVTN
                     RTFWERYFLDR"
     gene            complement(<331871..>334795)
                     /locus_tag="LMJF_03_0840"
                     /db_xref="GeneID:12981528"
     mRNA            complement(<331871..>334795)
                     /locus_tag="LMJF_03_0840"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721712.1"
                     /db_xref="GeneID:12981528"
     CDS             complement(331871..334795)
                     /locus_tag="LMJF_03_0840"
                     /note="previous protein_id=AAM69049.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721760.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981528"
                     /db_xref="UniProtKB/TrEMBL:E9ACM9"
                     /translation="MTDTAAPRQVACQGCSTQTTTAFQCPLCQAEAAVDRGFFCTQEC
                     FAKNWLKHRNTLHKSGVVREMKRPPAGAAAAAPAGATEKGRKARGGKRSRAGDEAASG
                     TGTDTSADKEAAPAGTLAPWPPLPNAAVCKKNNWAQVTPELPLDVPRAVVRPVMTEAA
                     NGSAEQPLQCCLWSAMLAAAQYVALSVQRNAAPSAMQALVVAGDVHSAHAFAWAARCV
                     GLAGMLQLAVSEQPTESSVAAATRNSSSSNTASTAAATAASPSRYFTSHRRIVIATSA
                     VVRASALARTSSSTAASGAASLWLTGAPSHSLLVTLPDVVDAEDLQGVQTRAVFFTGP
                     AGPTSDDAAKDDGDDGVVSYTYTSLEVLCEDRQPLCWKPIARSAPGSSTPSSNTAGSG
                     GAAAAAAAAAASCLDDEVCTCFANGDMAAALQRLVRCYQHQPGHLESKLYYTLCCNWG
                     AASLVHAHHRLAYVARFLCDRSVRFEAPKNATLAAAALRAIAAVCRLLPRMADVEAEA
                     AAAAANASSQESASDAANKSKKRRLHTNEVAAAAPYAPSLASTTRPTPAVASGVSAPS
                     AQEVARYANYYTHLPNLQLQATVCHLYPIASPAVLDTFAMAWGLYRYLPGPSSLDGAN
                     HARSAAVHRVRQRFTTKLDSANGVFYIILMHLMYDAVGPYSLPVDEVNRRLQWDLTLA
                     HDAGSLEAYLRCCGLLVADDGLLLPTSSKQRVRKMKKGDRAASPPAVLSSRLKGSRET
                     TQSRTEQLRCFAVKSMPGIAGAAAAASSGNYGVIELPWKTFPITGERQRQVARLHQAA
                     VEELLMAMPRVPRPMYIGDVGNLIGKWMHFNSRFDGILGVNLQAFLEQHPEAFKVLDN
                     IVTRRTAGKTEQVRIRFDGDDEHDNDDSDDDTNRARKACDRQLLTGQSRSKSGGKGTV
                     ELPARARKKRAIKEFNKERFNRNYKSIDPSARVPGYIKRGPRRIKGRGKKANKRGVKR
                     GA"
     gene            complement(<335655..>342803)
                     /locus_tag="LMJF_03_0850"
                     /db_xref="GeneID:12981529"
     mRNA            complement(<335655..>342803)
                     /locus_tag="LMJF_03_0850"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721713.1"
                     /db_xref="GeneID:12981529"
     CDS             complement(335655..342803)
                     /locus_tag="LMJF_03_0850"
                     /note="previous protein_id=AAM69050.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721761.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981529"
                     /db_xref="UniProtKB/TrEMBL:E9ACN0"
                     /translation="MNSPPSSKAPGADSPRSFRAGSEAGTARKPLRLRSPPPTASRPP
                     PAVISASASLSPPLPLHRSSSLANRPALPGARRLMDYSLPPPDAAHGIAELVAPHELQ
                     LYNTEVRSCGHPQRLYVKVPVSPSSSMVTERDKQGRGAPVPCTEGTEAATPRHHPASS
                     VAHALSPPLAPVSSSSTAADATPPARDTACRAPPPPLASPAVSVSPYAAESARASVGS
                     EPLQLVVTDGVRTPASSASTSLTPAATAETSAMKRHHEDDDDMRDPYQTQLQQQQGRE
                     GREIGPQPSPPLVELHQLAMGASTFIPTTLSALSSSRHRSVSGNTEERAIIVVVPADD
                     ATHSVPMPAAPASGDEKKLLVQLTEDTTHRGTSTHTSPAEVHQLQEGVSLAVMPSWAS
                     HEAAAVAEEEAMLPVHLFTTTVREEVSASSTRSVSHVQSSTERSGIHFSSATAATLPS
                     ARVERWVETEPAVPAPWQFAEHAAYTTPHSQPGPTRGSYPSSASAAPASTAPCSTGRE
                     ELVGAHLNDEAGGSGNGDNREGSSDVRSLSGSEAEAWLLDASGQPSATAEAEQQAQLY
                     VLQPTGAETSEVPLSSVGSDEDHPAVVPVDASRSPVAPSLPPEPSAVQHRDNVNDATA
                     TAAVAELVQQQQQQHARREDIVVADTRITARDGIDEVVEGSWEDGVGHIATVLAASPA
                     VVTADARAASSLTSLSSSSRPSVRMDKGTAERAVTAAAAAHFPVEMLGNEAEKAPLAL
                     AAPESPAARGGRAGDDDVDAAMPRTGASEDVVAAAAADVVANATRTRQPIDEGEDFSA
                     ANDLENAPQNQLVDAATDGEEVVVEDVREKPHRALVSRAAGGTVPATCVVARSSPSDR
                     VLVSPPTQRTVPPAVPAAVIDGGYGAHAALRARDAPPSAAHTTSMWRWPPQPSLCDRI
                     QCDHHHHLSGGEQEQSRSVASLFQRHPVARDLLADVDVMNDEEDNAWEKCSAEQPRIP
                     VRFEGRDNPLVPQHASSSAAAPPPSPPAADVVEALVLAHRRLIADAPLHELMELEREG
                     RRTVMLDMLQDREAVLQEKAFDFSMLSLLPARPWAVAAAAATGSRTGTGTETSSSVAS
                     DGAAAPRRAWVPPLPPSPLTPAASPFTSRSAAASVLATVTAPPPTSREEVERLLRMRG
                     LSGSLSLGIVSAALFADELLRREVIEGAEASARTIFLRLCRCGADALNPYSVVVQETL
                     ARQRLMATERLEGQQVRSLENSPAADTLELLSIGRELALCRMAEDSKRREVIEKAEQL
                     GRQRLRELHVRGLAARLRQRELLQASMDVALRDAIDDVVFDETQAREELRVEAIRAMT
                     VLLESASGTVVRDAARQRQRQLQQQRDDATPQRSHEKVRLSAAGVKNGSSAAPGHEGA
                     RPAAASEISAPAGEDVEDGSDWELVEEVDDLSVGDDVMVFDAAEKPMTSATANTFPAL
                     AADGTPDFFEWNPTSNSASSLSTQPKARKCRPSSSQQQPPQQQHTSTSSPSPHVTSMT
                     ALTVNTTADTTSAISTTTASSGQAVGGDSGGSAPQVKQQGVATNESGNTTSDGRRSPT
                     TVLPSEEEQQLVQGRERVNLAEVSVLLHALRCAEAAARDRHKASRQTEVTVEKGSAAP
                     AWPQDQDNSAAVSAGNLDGDAAQSSNTLSRPPLSQQQYQVISVGDVVDAPHQPRATSH
                     SRHASTTRGPSFINRHTIPCSLADSPRCGYAALMRKYTPQRESQSSSPLLAATAVSAS
                     SPSTSSSSSSRPYADGDVYAYDPQRTRHSRPARRAAFETNPDRRAPWEHSCEGISGEE
                     APVGLCNDSGTGAPASVYEPTLQTSAREVSPAQRRRALSTLEPSHVPSASTVPLVLEV
                     IAEMRSTRSSPAADVTVSPMSSGARLSQSPTRARPPQAYAAPTAAWAKYVQEQQLVQC
                     VRDRGAATVDGGGQRALHTSSATPIKNGGAATHVNLDQSGCSRRRWGHAADHTVQHVS
                     APQAPLLITRLPLECGPGVWTSSPRYAHGGVHVVATTTPPRTRPAPATLADAFSQAAR
                     TGDVVHLPATVAELLRAPQHTHLPCPAPAASAGPMKGPSCQLAEDRHAPRQHLTPYNY
                     VDVFYKYRDRSPRGSAPAVPSSADALVQLPSTPSAAFISARCTAVRDREMQHDLRQLR
                     QAPSPSHARRAPPSPPARAGRGGSSTRVASSRRGSSTSSGSALIATAAATWGEDEVLT
                     DASAESEDCYFDDDDAFALRTAAAVSRAGRHRAVAQRRQQQQQPSHGALRAPAWSPAS
                     PSVPPPRQQRRQSASDAASGHHGGDGGRVRPAGYRVPPAPSPCSRVSSRTPPSLSSPA
                     SPSTAVVPSVVASSWRNTPAPPVPASLWCPSRHGMLHSGRSSGGGNTTRSSGDHITRQ
                     DRRAPSSAAAPARVVSIA"
     gene            complement(<343742..>348133)
                     /locus_tag="LMJF_03_0860"
                     /db_xref="GeneID:12981530"
     mRNA            complement(<343742..>348133)
                     /locus_tag="LMJF_03_0860"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721714.1"
                     /db_xref="GeneID:12981530"
     CDS             complement(343742..348133)
                     /locus_tag="LMJF_03_0860"
                     /note="previous protein_id=AAM69051.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721762.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981530"
                     /db_xref="UniProtKB/TrEMBL:E9ACN1"
                     /translation="MATAAALSPWTLSSASTSPAAVADTLHEGPHARFIAETTAMLWG
                     DDYPSWMVQQWVRLGDVEDDEEDGGTNEAAVAVGSGDSSATGVDNVETADGTALGRED
                     EIEGMHGKSFVEPQLSGQGAPLPLQPPSRHSEAERVEVAASAVVSSSSAPVPVPSPSW
                     TFMMQQTLEALQLHLPLHHDHPPPQLQLASTGETPVMTLAKHLVQDAPLLWLRYLLVP
                     MYTQWTQQRAAAPPAAGAAATTTTAPIPSSSSSPSATTVLERDGAVTMHELLGALGTA
                     SVREALRKEQSWSDDLVQLVAAAAAAPPSDASATLKALNGRQAAIRDQQRQHTGEMLY
                     FTGALAKAAQSFMVLGQGGYAILASLIIRLLGRARAAWAEWAIPLTEAGVQRAAQVVC
                     RGGGHETRADCNSSSSSVTAEDNAEEEAPAEKRIRVEPPPRRSAPRSDFPRIAAVESF
                     AALRAAVSSAAQRQAHLVWRCWYILYGYYGADLYTNEVLARSLEEEDLEKAGVRRMAA
                     AQQAHWRRLRLAADVKQHALSETHWLWCSTLLASVETTLMAALSEKHVDEHAPVGTCA
                     SAFTTAATDVPPACATELLYRRLLEGTARAFTAELRDTLRVYGEAALALRSGGLHSST
                     FTVPSALQTVAHNVVALQDAFSQCLAASLGYAPAAAMSPHQRKSALCTQIGVYLWQLY
                     PTLLRVQVPEEASWMSTTGTEQAGDTLGASDSAEVAAGSFTAQFHRHWRRRGRHLSAV
                     MTDAFRCMEQALTHGRRSATSPSLLPLSSSTAASITATAPVSKACDGSGGASDDVHGR
                     NDADDGATTARFLAALVHSPAGEFAASSSSASNDAWTAALCDIAADFYAVYDQSCFFL
                     LRPERQRLFTLSVRRLYHLLMSPPDGSSAGSSPSQAAASGSATKTTPPLPQQSLVCLL
                     RRDTRLWMLLTHGVLLQLERRGRVAREDEALLASYLLPLMTLLGSRQHDGEVERGSAD
                     SSLPYIATEASPVWADIAVAEDILLLLASGLASLPWNLEEVYVTVQRHTALCLRHCMR
                     HQGRLSANGAATVTEMAAWFGAAELASTSAAPSSPTTAVASPWGFSGVAEVGSPAARS
                     DRGASALANVAAHIDAQCRRDDPLLAYCGGEVASASASADARNPTLTAPPCLSEDAVD
                     ARFAAALARHGRLASASLASAPCGLLMVVGAYRSCGRALHGLRAALEEQYRMAREDEV
                     GEFVGRTVTFCTSGDITAFRGLVTTVHSCVFGYACQPRGLLRLWLGYLQHLFDCVVPR
                     SASSSSEDPLCTEGEDTLVLMPSSWQRRHHITTLFGARVYRTGWRALQHDGEPASQTR
                     LREVLGECLANLMLLPYSHPRGDADRSENEAAMWTVAAEHNGAAAATQAILQRTLPHT
                     VLEILCELLRIPVEGNRDSVSYREKVAAVDAAGKVIEKSFLGLAGLLAFLRRLELLVV
                     PGSLQDRRLVHLLRCVYEAADAAALGI"
     gene            complement(<349088..>353260)
                     /locus_tag="LMJF_03_0870"
                     /db_xref="GeneID:12981531"
     mRNA            complement(<349088..>353260)
                     /locus_tag="LMJF_03_0870"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721715.1"
                     /db_xref="GeneID:12981531"
     CDS             complement(349088..353260)
                     /locus_tag="LMJF_03_0870"
                     /note="previous protein_id=AAM69052.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721763.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981531"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR016117"
                     /db_xref="UniProtKB/TrEMBL:E9ACN2"
                     /translation="MSAHAEFAERLQAFFTTELRRQGVTDEEGWAEKLNTYCSYVPAT
                     SADDRSSGAGDRQRASPSTVLVIDMTNLEVGDKPVVALCESLLKMAGLSWRGRYADVS
                     EWQVLWRRCGLTDRVVRHLELLLLGCQRLTLLDVSANALSTEGQASLLHAAAEVPCDV
                     VIAEDARATHSGSRTRETSVPSSSLCTPFPREFAERQCHSQASRHRRRSGGDGNAAEG
                     STRIASHGAIEQQRSSGARRQSTSPPGQAATPRLLRQLSPPFSGASASASPSLRSYAS
                     GSAEALQKRREELFGRSNTAAPATAAVPPTAATASARDVPTPRRSVDVRKGVSTGSTT
                     TSDSVVEFEAVLSTATDSPAAAERPHPQRRPAEEGTRTGGSHSPFAAAAARRGQPSAH
                     RTGGAHTASTSVKADAASREPFVDRNDQIDLTANLSPVLDSVLDLSALMTRDGALREA
                     RMFGGALTVWDVLEAYESAAEQQLHGSVSHGGETSVDAATSAKLPSALLGGATYNAIT
                     VLNLSRNHLTALCALPGTLLRLDVSENNLTELSGLQGCKMLTVLNARRNRLRAISGLE
                     KNLSVAHLFLGHNGITAVEGVAHLVLLETLDLTYNELRTWASLRMLSLCSALRHLLLR
                     GNPIMESGKPGFMAVLRNLCPTLLVVDEHRMANSCLADRALAQRNWGRQPNMINNTQP
                     YARTETLRGGSGAGASSSLLSHAAKAGSSASVDGSAMSSVAFTSSRRRGGSQPAPFAA
                     GDEDVADERSMNLLHMLTRGVTAPTGYGDSVRSQQAAQQLAQTQREKEAQAQAARKRR
                     VTANGRLLRGAVVKQLAEESRKYLEDTIVRRMATAQQQHLQGSHSALPDAGGGSSDAA
                     GVAASNLMTRHGSVERNAYGGMAHPERMENPMADVMGYTAASPEKRQRASTECGVQDK
                     TDAELLRRYKPRAARLRRDPSAKPSQSLTAEASAGPPSQQQQQQQQALQRRTASAGRA
                     PSPAASEGGVLYGPAVVTRGQSARRTHRDGDDAALAALYAGDARGRPSGEAARGASGS
                     YAALHVADQRQPRAPEDAEIECSPISKDPQARVVASLNTTASILQDNAQPYRMNDPPH
                     SAHLRTPPTSIRGHPSPTAQARRHPTPQGYREPAEVDVTAIYPRSRSQRSPSPGVGGD
                     TQKEQRQRYQRLPSRRNASASKPSSRSRSTSAAAVASSATRGSSVGGRGAESGAAAPS
                     VASSAGARSPSLRPVHIDDAQRARVRGWVQQLHDDTDALHDALQTLVDLLEAQRQKRM
                     PVPESSRELPPTYLQERRRCVQIIEGSGMLQDTYVPMDVVVYYGFSRAELEGQTDRSM
                     QVVARRGGGTEADERAWAHEVAERSDVLRQVHLMGDAKTCLRYVVLLVGDGREKLLQQ
                     YVDQLKESLRSV"
     gene            complement(<354240..>360041)
                     /locus_tag="LMJF_03_0880"
                     /db_xref="GeneID:12981532"
     mRNA            complement(<354240..>360041)
                     /locus_tag="LMJF_03_0880"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721716.1"
                     /db_xref="GeneID:12981532"
     CDS             complement(354240..360041)
                     /locus_tag="LMJF_03_0880"
                     /note="previous protein_id=AAM69053.2"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721764.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981532"
                     /db_xref="UniProtKB/TrEMBL:E9ACN3"
                     /translation="MLAASAKKTTRRQVVSAADDGVPAVTAKKPKKQRATRQQAAAPP
                     AASAPVERAVHLSDAVQEWATLRRRCRWQRRHLVAAGASSSSANVAASERSMTAGNAA
                     GVSRGGNTASTGGGGGALPAEISVAERTQLLSALANEPNAYPQLYAMFYPRGHANVDG
                     ALRTSLASPTAVGETRWHIEGTPALVRSEAVAMELFTLLHVHHQVVGHSDDVAELNEA
                     AWSAYLSALQARLEADMGQPARQQCTSLALVLRTLMDVHRGQMDRPTTIALSQRLNRE
                     QQVQSREEIALRRRVLEALTRLMAPTHALVRQLEEAARSETGKLSSPSSVESTYGDAT
                     TLLLMAAVGAVAVEAASALSHSKPVAASVGVSPINAVLVDEWTTWRDNARGRLASHLQ
                     ALEASVHKSGLDVVAAVFVDILRCMRWIEELGVVLLPAMGSAMEKTCQRILLQACRCA
                     ETVEGADLFEYICTPAVTAELRRLSPERTSYAQIITDVCTVAAAYLRQRPQRVPQLVE
                     HLEKEHRDVLAKAGAPRAPPARPPLHSPLTELLYAMLCAGFPPESLLTSSLCVSLPPR
                     DVIDVVRAVNRFSALCATTPLPVRTRAVLVDQVAGMLAQCNKDSYRVVVSSTDELGEG
                     DAAAQEEARVIAVAAAGKGSRHKGAAASTFNLMQRMAAGAAGAAVLPGASVVLSATAM
                     LSPQSQAAAAARMRRVRNSSKRSQRRTSSDATDGDAMATVASAILTPALYQRQVNHLL
                     FVGLEALVECLLRGDAAAVEMLTQALLPLLQREGREAALADALEVVWEGFRSRLTEMG
                     CDDVRDLTSGSLRSPALAAATAGRSGRSPALPVALSEDVEKALALLPALFLPRLTESA
                     VKLLGSGLEGAGSGGGAGTSKATGSLSRSTVGCHHHSPTAATVPMSVEELTEVALRLS
                     TAAILCGMPADTVAQLTALHSTLNKSHGKAAGAGAGDGGQGDAAGAVAWAFAVVERLE
                     RLLSQLSRQSQGLTRHPHSAHARNSGLAVYQLLTIYIASTAAVANSMTQSSRSSAASA
                     STTRQRYRHYLLTVVHLLYRLRTEYTVVVEPAALRMFRLDVFDPALTAVMCTSSRGAV
                     ATPALPMPLTTLTEVMVVTCVADSVQHVSPALVRGVVAAVEQHLKVRATALQMPEEGP
                     RAESTANTADVADTATGVLATQLLCAAATLCLRADDALTSMLLQLLDLMSPLLATSQA
                     MTVLQRLHATGAPLPAPPVRRLIERLVVALRQDLHAATESGGGAATATRRATTVAQRI
                     TILHILSAVQRTAEAAVDDGDAATLLQLLRTVPYGPLLQSFLKPQELAQRRYTVGECG
                     ALVEVVAHLTAGEAGAAKGSSSQRGLTGGIDGAATEAKAVASDEARQPQQSPPREAKA
                     EPIASATARWTASEAEAARLLPRTLAVYALQAVQLPYNVHDIPLLLRGYAALSGESQL
                     QQQVLRGFVSRTMRAAPTLTPDEIVLCVEAYCAGGVYHQQLYGVLLGRVADMGRKFSL
                     ELSVRLLRCGTQAGNASVRTVCVTAVQPIFSAQVRGLLQNDPHMLVSVASTALAILHC
                     LRDCFPHDDIGAAVLANVARYHHDASLPVVKAALELAERRGSTDYDVVHILARHCTER
                     VLPACSPAELANVSHLLIACGLRTAAVMEATYRRLSESVHTMQAHSLSRLAQGLLRAS
                     VEVDTAVMEKVCKRIVELAEESAMEASGDFAAAAPLTMWQVCVLLQLLRSVAGRVMTT
                     VMTTVDALLTYVQRMVLQERRDGEPLHGDQPPSYQPPQLLAGMTLREVEAVLRCCIDL
                     SSMPKRFQRLTYSLADYTAYVMAQDASSLAASGGGSEGRLPNSTADRLLNGTLSSTSS
                     ASTRSIGAASLSATPAWQTDLILLVDLSSLFIRLGEAAHPVVQQLFERQYDRRGILLQ
                     RALLVKTTKQSLEAAGRDVHPALYKLVVDGELL"
     gene            complement(<360959..>363175)
                     /locus_tag="LMJF_03_0890"
                     /db_xref="GeneID:12981533"
     mRNA            complement(<360959..>363175)
                     /locus_tag="LMJF_03_0890"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721717.1"
                     /db_xref="GeneID:12981533"
     CDS             complement(360959..363175)
                     /locus_tag="LMJF_03_0890"
                     /note="previous protein_id=AAM69054.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721765.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981533"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:E9ACN4"
                     /translation="MLADIVKYARWLWDAVLLPYVITSISSLASDGWESFIHLKESVI
                     VLFFFLCGWSHRTFPLSRSAVEAQRSAATAAESTRASARMTQWRYGCVSEGEDNDADS
                     EADVKGARQVSVSVAAASVTEGATASGQCAGEGTSRRDGINDGLPLIQRRLLFGKKGE
                     VEGWMSAVRSRLLVPPHHPLCTSRSLHQLVSIVVGPIQQPTVSTMPTRHPEPQWPPHF
                     LRTSSSGGGTGGSSLLGDPSTDDNSSSNSSAAPHTLRHRTNAAAAARYRQASSVVYKR
                     VSSRNLDFSSSCVAPHLIASITAHHVLSYPATRQKVLVIDLDETLCHVSTTTANMAGP
                     PTFSEVIPTASGAELFHVWERPYARLFLSTAAKLFNLVLFTSASKPYADTILQRIDPD
                     RLLKYRYYRQDCRLVPRGLLRKMCAAAGMRGLPLGSGGAEGRSSVACGSSDCDRSGGG
                     GSGSVAGGGVYGSSSSARPLGRLSSAASIGGRHSGSTTNTDDDVNGSGRGGKGSTRAW
                     GNTLSSEAKVSLLGSGGSAAGDHAMTASVLAGTAADRGGVDTGLPAVEKAAMNEHAKV
                     LVKDLRLLKVPPELLVMIDNSEECTLVNPENALVIPPYIPALSKMAPPARETTRRRGS
                     RGHDEQGSGGGAVEVQPQNSLKISDDDAGGPLEGRTATDASSNVDDSGAGRVQAADDD
                     DITGGSSDDSSAADDIAANDGTEDDEDEVLLALLSLLECLLVVPDVRSILRHGRLY"
     gene            complement(<365406..>366530)
                     /locus_tag="LMJF_03_0900"
                     /db_xref="GeneID:12981534"
     mRNA            complement(<365406..>366530)
                     /locus_tag="LMJF_03_0900"
                     /product="putative peter pan protein"
                     /transcript_id="XM_003721718.1"
                     /db_xref="GeneID:12981534"
     CDS             complement(365406..366530)
                     /locus_tag="LMJF_03_0900"
                     /note="previous protein_id=AAM69055.1"
                     /codon_start=1
                     /product="putative peter pan protein"
                     /protein_id="XP_003721766.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981534"
                     /db_xref="InterPro:IPR007109"
                     /db_xref="UniProtKB/TrEMBL:E9ACN5"
                     /translation="MGKAAKGRTAMPGKLDTTEADKRTPKSIIIYRGEVGIHVRSLMH
                     EWRNVFLPWSSKKLHGKNKSLKDFLAVAATFSASHLQLFTAPSQGTSLRIMRFFNGPT
                     LSFRVLSFTLHKEIVAKQRRPVAVDRAAWEVAPIVVLNNFTHPDLAHRAEVPLLTATF
                     KALFPSLNVQTIQSSEIQRICLFHYDHVEHVVEVRHYYINARTVGVTKTVKKLLENRR
                     PTKLGTLESIDEVLDREDAWSDTDGEGEEVPLVQPFRQHREQCRVKLQEIGPRMTLQL
                     SKVENGFAGGEVIYHRTEKKTLREVQVNASKVRARKTEKAKRRALQDENVQRKRQKRE
                     DKLERKHQRREAAAEAQQANPFEVAHGDGDGDGYAAGDEE"
     gene            complement(<367694..>368374)
                     /locus_tag="LMJF_03_0910"
                     /db_xref="GeneID:12981535"
     mRNA            complement(<367694..>368374)
                     /locus_tag="LMJF_03_0910"
                     /product="putative inorganic pyrophosphatase"
                     /transcript_id="XM_003721719.1"
                     /db_xref="GeneID:12981535"
     CDS             complement(367694..368374)
                     /locus_tag="LMJF_03_0910"
                     /EC_number="3.6.1.1"
                     /note="previous protein_id=AAM69056.2"
                     /codon_start=1
                     /product="putative inorganic pyrophosphatase"
                     /protein_id="XP_003721767.1"
                     /db_xref="GeneID:12981535"
                     /db_xref="GOA:E9ACN6"
                     /db_xref="InterPro:IPR008162"
                     /db_xref="UniProtKB/TrEMBL:E9ACN6"
                     /translation="MFYKVGATDTIVSAWHGLPLYAGASADPLVLTCVTEIPKGTRAK
                     LELSKEEPYNPIKQDIFKSKEGHPLRYFSYGDMPFNYGFLPRTWEDPVHIDPNTKCSG
                     DGDPVDVVHIGTPHRVGTYGPVRILGVLGLIDEGETDWKIIVESVSATAGEGYGTLSK
                     VPQELQATIIDWFENYKVPDGKKRNEFAFNKAIKDAETALSIVAQCASQYNALMEGKC
                     ANPGYWLR"
     gene            complement(<369181..>369837)
                     /locus_tag="LMJF_03_0920"
                     /db_xref="GeneID:12981536"
     mRNA            complement(<369181..>369837)
                     /locus_tag="LMJF_03_0920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721720.1"
                     /db_xref="GeneID:12981536"
     CDS             complement(369181..369837)
                     /locus_tag="LMJF_03_0920"
                     /note="previous protein_id=AAM69057.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721768.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981536"
                     /db_xref="GOA:E9ACN7"
                     /db_xref="InterPro:IPR007305"
                     /db_xref="InterPro:IPR011691"
                     /db_xref="UniProtKB/TrEMBL:E9ACN7"
                     /translation="MTMVDSGRQRNPGVLQDDGEKTLHQYWSQFKYKALSLVSDEPPP
                     DTALLTEMPPEQGYMEGLSEMTDLTYTQRITGFFMMMGMGILFILLGMAMWFRPKKFS
                     FFMTCGNIFCMCSTMFLAGCAQQLRSMFEANRFEAACLYVISIVMTLLSALWLQSKLL
                     CVLFALAQLACILWYALSYIPYARQTLKIALSYASMIFGPVVSVIAKGVSSCIGVILG
                     "
     gene            complement(<370901..>372994)
                     /locus_tag="LMJF_03_0930"
                     /db_xref="GeneID:12981537"
     mRNA            complement(<370901..>372994)
                     /locus_tag="LMJF_03_0930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721721.1"
                     /db_xref="GeneID:12981537"
     CDS             complement(370901..372994)
                     /locus_tag="LMJF_03_0930"
                     /note="previous protein_id=AAM69058.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721769.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981537"
                     /db_xref="GOA:E9ACN8"
                     /db_xref="InterPro:IPR011059"
                     /db_xref="InterPro:IPR013108"
                     /db_xref="UniProtKB/TrEMBL:E9ACN8"
                     /translation="MTSVLAVVNARRVWRGASVLQPAVSSSYPPEVDALLVEGGRISF
                     IGSTAEVQQRYGALVAAQPVDAAAAAPQPVEGGRPRTVSHRVIDCEHRHAVYPGFIDS
                     HVHFLDGGRMLLAPQLGFATSRTQFTAIVRDFVEHRYNREEGGWVYGVGWSEAVLGCS
                     PTREWLDEVSTKIHLVMYSKDIHSAVMNTAALRSCHIIPGAEDGEPLITSVEGGVIEL
                     NENGQPSGVLRDNAIQLAKRYAPAADTPANQRRALEAATEHLLSLGFTSVFSMMSTTY
                     MDNVSEINFLAQMEREGAMRLRVRYGVPLSDVERLMDKFYRVMATDAAQSGRSDDFTL
                     PYRFTMTPPAAGGGYLLLGAVKLFADGSLSSRTAAMNRPYGYNVTTEGDIDSDLDDAA
                     ISALLKERSGKQCQCGLLTMSRLELQCAIRVAHSHDLQCVVHAIGDRAVATVNRALCA
                     SADWLRERGAEAGVVAAVARFRADPRSRVEHCQHMSSMTKEVKRMAQYGIIASMQPCH
                     LLFDGDYVDTLLGQRRKDTSYMWGTLLAAKIRVDLGSDWPVAPADVNDGLRGAVTRVP
                     DVMTALAAEEAQYRSQQQAQPSADNTAACAATALRRYHDTWNPAECISMDAALRTYTY
                     EGAHGMFMENYLGTLEVGKYADITVWTADWLDDAEMEQMAGVEGANARWWPRHREPHV
                     AYTIVGGVVEYDRSH"
     gene            complement(<373620..>374606)
                     /locus_tag="LMJF_03_0940"
                     /db_xref="GeneID:12981538"
     mRNA            complement(<373620..>374606)
                     /locus_tag="LMJF_03_0940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721722.1"
                     /db_xref="GeneID:12981538"
     CDS             complement(373620..374606)
                     /locus_tag="LMJF_03_0940"
                     /note="previous protein_id=AAM69059.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721770.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981538"
                     /db_xref="UniProtKB/TrEMBL:E9ACN9"
                     /translation="MFKGLLCPVLGRRAARRLATVANSARRGGRQRSRETVLESTRLL
                     EKLQKRQGPGRTRTAQQRARRSGLTNPLNSTESWTAAQADALAQEEANWRAADPLRKW
                     KDEAEELRRRQQGAEDGAHSVTGSAQPTSSSHYDAVNADTGNSAVQERFDALVHRALL
                     RYGLPLPVEVAMNNNVISAASFASGTRRSAQRSYSDAKAASDKGADDSSAVYYDEVAL
                     KLHEFMTVLRKEEPHFSLRDGCDGVPLSLMVKNCCYLRAFGGKVNYMRFVRRLRTDEL
                     RSGGNHQGGGVQGGHEANAAVVSLGKYMMRELPSQDGLRKGPQPWRYTYRMI"
     gene            complement(<376092..>377999)
                     /locus_tag="LMJF_03_0950"
                     /db_xref="GeneID:12981539"
     mRNA            complement(<376092..>377999)
                     /locus_tag="LMJF_03_0950"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721723.1"
                     /db_xref="GeneID:12981539"
     CDS             complement(376092..377999)
                     /locus_tag="LMJF_03_0950"
                     /EC_number="1.-.-.-"
                     /note="previous protein_id=AAM69060.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721771.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981539"
                     /db_xref="GOA:E9ACP0"
                     /db_xref="InterPro:IPR002355"
                     /db_xref="InterPro:IPR008972"
                     /db_xref="InterPro:IPR011706"
                     /db_xref="InterPro:IPR011707"
                     /db_xref="UniProtKB/TrEMBL:E9ACP0"
                     /translation="MRAPLALLLLTIVVCLHTAAGNAADAAPSPVILPRGRSDTKVTL
                     YLRTGRVSIPLEWIDGKGVFFEYTGRFYEVGNSGPMLPGPTLKVNPGGRIVLTLVNDL
                     GKEGMVNMTSGMNTLHGPNITNVHFHGMHSDPKMDNPFKVALPGETLVYKINVPRDHE
                     PGLHWYHAHSHGAVYYHVMGGMFGAIDVGEGDFTKTPRHPFHGWDSQILMVHLYRLNR
                     SERCDGMPMSSLDAAMGSLLPFDPRIVDREGNEYEMPAELFLVNGQHRPTVRVKRGHP
                     MLLRIGFAAGSCYINMSLPKQCAFHMTAIDGAQLRRTVEVVEGWLYFTTATRRSLVVV
                     CDAEGTYPVSHTGDPSDAIFYLKSRGRRQKGGRAVAFPVTMPKFSPGYLQLKGQNTFY
                     REISFSQRDLPITEPYYVLGQGPNCQSLQNSSTCHYEFFQGEIGRRIEGYHGFTVPLQ
                     AVVTARVYGDPTDKRPHPLHFHVNHFQFLSFEPRPGGNHENETMAMYGVHSGEFRDTI
                     PILDGVTTIRWKAATYVGEVVYHCHALQHEDRGMMMSYLVYSPRSKEGKAVQQYEQSQ
                     TGAFLSAWPHRSHAYSLLFVFLLASAAAAAWGYFRHRGACCSPAAQSAFDARSYAGTP
                     GEHIPLLERRA"
     gene            complement(<378657..>378971)
                     /locus_tag="LMJF_03_0960"
                     /db_xref="GeneID:12981540"
     mRNA            complement(<378657..>378971)
                     /locus_tag="LMJF_03_0960"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721724.1"
                     /db_xref="GeneID:12981540"
     CDS             complement(378657..378971)
                     /locus_tag="LMJF_03_0960"
                     /note="previous protein_id=AAM69061.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721772.1"
                     /db_xref="GeneID:12981540"
                     /db_xref="UniProtKB/TrEMBL:Q1X7K5"
                     /translation="MVYTRWKCDRIPVLQLKLFTQEYNMMAVVGLLSMVFLFKHASYC
                     SEETERKNGWWAGYPYWRDPIARRNEIRYKQLINSNDVDITDPKWTGCSKEQLERLRA
                     IV"
     gene            complement(<379513..>380577)
                     /locus_tag="LMJF_03_0970"
                     /db_xref="GeneID:12981541"
     mRNA            complement(<379513..>380577)
                     /locus_tag="LMJF_03_0970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721725.1"
                     /db_xref="GeneID:12981541"
     CDS             complement(379513..380577)
                     /locus_tag="LMJF_03_0970"
                     /note="previous protein_id=AAM69062.2"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721773.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981541"
                     /db_xref="InterPro:IPR003409"
                     /db_xref="UniProtKB/TrEMBL:E9ACP2"
                     /translation="MGFRRFLFRARWHLAQSDVTFNRYPRRTTMPSDGEGKVQQVNID
                     EIDAVTGFKKAELYVWNAYAAAFLAEGGEPETDVEAWIDDFCQRSEESGAVFDRNFVK
                     SVCTLGIYAGPRDEFQQRSGCGKATYASGDTYEGEFFEGKKHGRGQYIFVSKGRSEAD
                     RVVSKEVELLTSAGKDAKAMVTEIATKLQLGRHVVEGIMQYGQRPCYHGDYVRGKRTG
                     RGVMKNKDGTLYQGEFLENKRHGQGVYYYLNGDVYSGNWKAGAKDGYGTYHFAEGSEY
                     RGEWVRGNFVQGQWILQGGSYYEGKFDKKNRPLDDAASLHYPSIQMAQTGAFRRGIWA
                     PTSALQVCSEVPVDGMAWAD"
     gene            complement(<381260..>382558)
                     /locus_tag="LMJF_03_0980"
                     /db_xref="GeneID:12981542"
     mRNA            complement(<381260..>382558)
                     /locus_tag="LMJF_03_0980"
                     /product="putative elongation initiation factor 2 alpha
                     subunit"
                     /transcript_id="XM_003721726.1"
                     /db_xref="GeneID:12981542"
     CDS             complement(381260..382558)
                     /locus_tag="LMJF_03_0980"
                     /note="previous protein_id=AAM69063.2"
                     /codon_start=1
                     /product="putative elongation initiation factor 2 alpha
                     subunit"
                     /protein_id="XP_003721774.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.03.0980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.03.0980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981542"
                     /db_xref="GOA:E9ACP3"
                     /db_xref="InterPro:IPR003029"
                     /db_xref="InterPro:IPR011488"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR022967"
                     /db_xref="InterPro:IPR024054"
                     /db_xref="InterPro:IPR024055"
                     /db_xref="UniProtKB/TrEMBL:E9ACP3"
                     /translation="MWVSLCRPLERIIFCNNESMASYCVTDSPETVDYKTKCCCRTTD
                     NVYYAVPKEYFRLNQSLARRKLLLAEPFPVPVDCRTLDHLLVLLEKATILSAQVVEGE
                     TKGSNNERPEWMRDLNKRQQKFVCGCLGITSWDGKDIPFYVETMPKINDVVWVKITQV
                     NDTSAVVQLLEYGKREGIIPYTEVTRRRVRSMGKLIKVGRTEPAQVIRIDKDKGYIDL
                     SKKLVTPNEAKACEAHFRQGNEVRSIVCHVAELCDIPAMDAMEMIAYPLYQREPGKHA
                     WTWLYELNQTEDVERILGPLKLEKAISDCLMLTLKNAMRLKVLTLFAEVEITCFACDG
                     VEAIRDVLILGRSYGEGSDPQIHLSVNIIGPPKYGIRARTDMKEEGIQRMKEAIEAMT
                     AEIKKRGGQLKVVSPPQPHGDADEGKKGFDGEDDDDEDAD"
CONTIG      join(FR796399.1:1..384502)
//
DBGET integrated database retrieval system