GenomeNet

Database: RefSeq
Entry: NC_005229
LinkDB: NC_005229
Original site: NC_005229 
LOCUS       NC_005229             119895 bp    DNA     circular CON 17-AUG-2015
DEFINITION  Synechocystis sp. PCC 6803 plasmid pSYSM DNA, complete genome.
ACCESSION   NC_005229
VERSION     NC_005229.1  GI:38505535
DBLINK      BioProject: PRJNA224116
            Assembly: GCF_000009725.1
KEYWORDS    RefSeq.
SOURCE      Synechocystis sp. PCC 6803
  ORGANISM  Synechocystis sp. PCC 6803
            Bacteria; Cyanobacteria; Oscillatoriophycideae; Chroococcales;
            Synechocystis.
REFERENCE   1
  AUTHORS   Kaneko,T., Nakamura,Y., Sasamoto,S., Watanabe,A., Kohara,M.,
            Matsumoto,M., Shimpo,S., Yamada,M. and Tabata,S.
  TITLE     Structural analysis of four large plasmids harboring in a
            unicellular cyanobacterium, Synechocystis sp. PCC 6803
  JOURNAL   DNA Res. 10 (5), 221-228 (2003)
   PUBMED   14686584
REFERENCE   2  (bases 1 to 119895)
  AUTHORS   Sato,S. and Kaneko,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-NOV-2001) Contact:Shusei Sato Kazusa DNA Research
            Institute, Department of Plant Genome Research; 2-6-7
            Kazusa-kamatari, Kisarazu, Chiba 292-0812, Japan URL
            :http://www.kazusa.or.jp/rhizobase/
COMMENT     REFSEQ INFORMATION: The reference sequence was derived from
            AP004310.
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider                    :: NCBI
            Annotation Date                        :: 08/17/2015 19:20:20
            Annotation Pipeline                    :: NCBI Prokaryotic Genome
                                                      Annotation Pipeline
            Annotation Method                      :: Best-placed reference
                                                      protein set; GeneMarkS+
            Annotation Software revision           :: 3.0
            Features Annotated                     :: Gene; CDS; rRNA; tRNA;
                                                      ncRNA; repeat_region
            Genes                                  :: 3,673
            CDS                                       3,602
            Pseudo Genes                           :: 23
            CRISPR Arrays                          :: 3
            rRNAs                                  :: 2, 2, 2 (5S, 16S, 23S)
            complete rRNAs                         :: 2, 2, 2 (5S, 16S, 23S)
            tRNAs                                  :: 41
            ncRNA                                  :: 1
            Frameshifted Genes                     :: 13
            Frameshifted Genes On Monomer Runs     :: 3
            Frameshifted Genes Not On Monomer Runs :: 2
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..119895
                     /organism="Synechocystis sp. PCC 6803"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:1148"
                     /plasmid="pSYSM"
     gene            complement(join(118399..119895,1..27))
                     /locus_tag="SGL_RS00005"
                     /old_locus_tag="sll5132"
     CDS             complement(join(118399..119895,1..27))
                     /locus_tag="SGL_RS00005"
                     /old_locus_tag="sll5132"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153668.1"
                     /note="sll5132; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153668.1"
                     /db_xref="GI:499467028"
                     /translation="MQEIQGKTRTVQELLGNAKYGIDYYQREYQWQTKNISELIDDLT
                     NRFLEDYQPGDGETEFAKYGYYFLGSILISVNDTKKFIVDGQQRLTSLSLLLIFLNNL
                     QKKTSSKTINIESLILSENIFGKSFNLDVPERNACMEALFIDEPFDATQQPDSIVNLV
                     ERYNDIEELFPEEIRHEALPFFIFWLQTKVLLVEIEATSDNDAYLIFETMNDRGLSLS
                     PTEMLKGYLLANVTNLNQRALADNTIKKWLLEFKQIAKEADADFFKTWFRAQYAQDIR
                     DRKKDAKPKDFDLIGTEYHRWIRNNAESVGLKTSNSFFKWINNDLNFYARIYKQLLDA
                     SKGLTEGWERVRYNADHGFTLQFQLLMAPLQSSDTEEIIKQKVALVAWFIDSWLNRRL
                     WHFKSNSYSNMSYGIFQITKKIRGLDVETLRTTLIQRFEEVISAEKLDFSNHLYLHKQ
                     NSKTLHRQLARMMDWLERECGMNGNYQQYIVRSGKNAYEIEPEVLNDSYKEKKSPLK"
     gene            complement(574..921)
                     /locus_tag="SGL_RS00010"
                     /old_locus_tag="sll5002"
     CDS             complement(574..921)
                     /locus_tag="SGL_RS00010"
                     /old_locus_tag="sll5002"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153539.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153539.1"
                     /db_xref="GI:499466899"
                     /translation="MPDIQTWEYKTIRFDFLGRGITQEFNLLDVDGTRVKGWSMNNTA
                     IKTLPQMMLALGQEGWELVSHVVNQDNQANNVTLHYMTFKRPGELLVETEDPALTGSA
                     NIRQIRDKFFVIP"
     gene            complement(1136..1540)
                     /locus_tag="SGL_RS00015"
                     /old_locus_tag="sll5003"
     CDS             complement(1136..1540)
                     /locus_tag="SGL_RS00015"
                     /old_locus_tag="sll5003"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153540.1"
                     /note="sll5003; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153540.1"
                     /db_xref="GI:499466900"
                     /translation="MIELTNPFKLLIDEDLSPSIAQVISQKLGIEAVAVRDRGLINAE
                     DQAVFEYAYKNDYIVVTANIRDFEQIARATEIHPGIIFICDGELIRAEQIEVVTLAAI
                     ALAEEMATGRDMINRVLYVEIDRSLRFETMPN"
     gene            2528..13921
                     /locus_tag="SGL_RS00020"
                     /old_locus_tag="slr5005"
     CDS             2528..13921
                     /locus_tag="SGL_RS00020"
                     /old_locus_tag="slr5005"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153542.1"
                     /note="slr5005; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153542.1"
                     /db_xref="GI:499466902"
                     /translation="MANPYASYAAPVVDAAGTKHLVWEDNGRLYHAHYDSRAGAWVDK
                     NTVSNAQGGSDIKLLAGNIIPVDQSGKLYAPGLVAAWIQGIGNAAEIYVSVGRYTDDG
                     RLEWSDAVQVSKDAVANTSFDLGIGQDGLIQVVTQKVLKIADPRKSDYQNNPGQLAED
                     IKSPQQGDKDLYYSTLLIELERKTGSLFLVPNPEVNASGTTDIPDDADALNFNPDFYV
                     AKTNRTGSLSQILLNAPPSNSPSLQQSGFQSAGLLSASSPTPGNGFLSNTDSDSQNDI
                     SLPATGGPAWGFDITIGTTQHTTEGTTFPLPVLEEANKFASLFGVELGINLSGAIKTK
                     VSRDSDDVYSVDADLALSVDLVKEQTRWKAFGRNQKLDPRIDDPVNGGLMPDPNNPAY
                     NASIDTNQGFSGIQFSLNFSGSQSSNANGELQSLENFYGLKVAFPKRVTFNIPSIPGL
                     EGALARLQALIQFSLAIGYQGIGSDPGPNAEAPFTLKPDTKPNLYDGLSGAGGGGAGF
                     FQAITWLTAYNNYKKGTPGLGAGGKIFAGVNTAFSLLAASDILAASGPLIFPGEFDDF
                     NTTQRGLLIEILATGGLSGSILAGLLGAEGTISTGFDFEFLSGPQPFIFKIPYELSIE
                     ARAAVLTFSWDISGDIVDTTDSSAQTTSIGLLSDDASHNDQNSEMVRLKLAYSPYQGS
                     TAIHENGRFSTVSPTTRIAQPQLLTAFPSTASQNNYVIGSVSVEEGGSGYLGGESGNF
                     LVVPSIGNALLMAYVEKGVIQQIVVESPGIGYDRNNPPTLDFSQYGGGGSGAKAKVNL
                     IDREVLDLTNDGRPFVDSVVFFAGPSAQAETALIWIADGADSTKPISDSANQLTTRVQ
                     VSELAGTNWSIPTALPLQGSEGMNYDPVIAKFISRDNRSSLLAVWAHARADGIGSHSV
                     DDLTNTLDSILETDIYYSVRIGNGTWSNPEKLITLEGTDNRLDIGRLNDGRLHLAWVN
                     AEANATEGGIQRIYSAFFDPTEETWSTPVAIDPTKDIDTPNRSEISSLKVGQLEGEPA
                     MYWSNTAETPYVVSVLNDSPELYFRLESSAINQSEINYGNLGNSIVSNLSFYDGNMTF
                     GQEGALSQDPDPAVRFNGQGAFVIGIPDKQTVTPTSFSVETWVKLTDTAAGKGIVTRG
                     QPITIPATLPTATLTYKVTQGQDTDGKWFYLITPDSVDLGNSGQDIFPNTLRVTNFRA
                     NEQLDIPFNPIESFALRAEPDDFLGLDFIGTDDVYIIRNTPQDVVIGDGTLIVRRFDP
                     GTDKNREERIELSAGQKIQIGGQIYTITAGETFTVSLKAGDNISIFDANPPGTISQSL
                     APNFNFTPDESGSLSGIQVNSNQILSSGTGFSNRPFVNEAESFTLTAELEFEQIEDWY
                     LVTGNNGSIVFNSGAGEISSESLDQGQWHHVVATHNSTTKESILYINGQEVAKTIGER
                     FAPSDNPILVGYNLNGFLDEVAIYNKPLTVADPNAVEFDSTGKYVVAFNPNAPAGEIT
                     SHFNARDVDPDSAEEATYYSVWNGERWGTPEQFAAEYKLTPTQASLSRTPAVDMVGSN
                     GLQPDGVLDQHLQVTLALPNEFLFGRTITGIEIKDAQGNTWSINNNIESPLGSNLVGA
                     MLAGQRVNDLKNGAFEHTVMGVKEVLDLYFDDPNVQSDKTYSVTFTMKDGGTIPPLDN
                     LAPSPNIQGSSSKSSIVKAEILEKEVTSLAEVDSGVIIDIDTVGAGQSLAAGKIRNGE
                     IGFAIGHPYQIDEDLNKRGLVWVLPAGTNKKLNELTGIPLKNDDVPAEGALIIGKNGD
                     KIGYAMAVGDIDGDGIDDLIIGAPDADDKKGKIYVISGKYLGSGHTINLASLPDNAVV
                     TIEGTRLSNAGFSLAAGDVNGNQFDDIVIGAPNALNSEGKAVGAVHLIYGSADFFSGN
                     KTIVLGTNNLLFEGKRGTAKSKFELFPNPANQWHSQVGYSVAIVRPGATGNPNAHSFN
                     ADLVADILIGAPGYHQTVQFDRQGFPQGISAEQLGRYRSVLNHVPNFGTDSVAPERDL
                     NTGRAYLIFGGDNLTVNGPLNDENLSGKGVIFDGSPLEDGDMRLGEVVTSAGDMNGDG
                     YIDISMAAPEAAGRSGLVFIFGGRGGSDSIRLKDKYSVMTESDVLIAGGDVFNYAGQS
                     LGGVGDVNNDKIDDLLVGVPQAGGAKGQNYVIFGVENFEIGKGNFPTTISLKQGIPDD
                     SFVFNGGIAQGLAGYAVAKGFDLNGDTVGDMLLSAPFANQVYVGFGHPWLKKEGSVRL
                     DNLANDNGIIINRYEGSEPKYSFDGRRVTNLGDINGDGYADTGVAGNGDSILIQFGGP
                     TWDLIDAGFGVGQLSVFLRKDVITDINFESIEGVGDINNDGFDDFIIYNSRSKTKEVH
                     DFTIVYGGDYLNSLGSATIDVVVAPGEEIRQRERLANPGFVLSNSATDLKLYHSSLGL
                     GESIYAPGVGFNGKQSRLTLEENGELIFYLHGTPQKIGGQANAGIVKMEIGVLDGKDR
                     LLFKDKSDKIVTYSEEHYNQTEEQITYLRVGDDFVMLSNRFNYAVPGRNDIKIFGYDF
                     DQSVNVVQQHYPSSVWGSVLPSLLAGESITAPDGQRSFMVMPLNYNLKAEDGQRVVAG
                     IVDKEFNVISSLISTRRVPMITSDLEFRSARDAYLILGNDTVVTPSSGGDFTHTKGSL
                     LFVYNGFYYDGNALRNILGGASRTGRDYEIEWTSETQGQDLLFHLDSNIKNINLAQKG
                     TAFDGSQGTLQYKNFHGSKLEEKLFEFLPVGDLNGDGYGDIVAFDSEFTYIYLGNASG
                     KISTLPSSNYSGDEGMVFSSRWAVGSGIGDINGDGYDDLLSQSKDGIFIVFGGPILSS
                     AQRISISNFLTIDSQFSQSPSTYEAGDVNGDGFADFIVRDSHVVAGSTRGALRLVYGN
                     ATGKNFQSTQIQTYLPVYYPLPVTRAGDVNGDGYDDIIFSDPSYLDNNAGRVYILFGG
                     SHLTNKATITPEEINSLEGKDGFVIDGLASSDSYSRAGESVSGGGDMNGDGFKDFIIG
                     APGTDGTVGLTYGLFGGDFTKSVNQAGTLANDILEGTGTGDVIIGLAGDDTLMGNGGR
                     DVLYGGAGDDTIIIADTYFQRIDGGSGFNNLKLEGYRGQDWDLTPLSPGLRLQNISAI
                     DMTNYGSNTLTLNKTTVMKMTGTQNNLVILGDANDEIILDAEFRKVDSFNLFGTLFDR
                     YQAGTANVLVAPNIKTEVKFTANRINQTIGLSNATPVTNSRLLSAASPNRITTIIPAS
                     NGQPTQFFVVANPTREDAGVFTFTVNRSGDLSKSVTALYQTVNDTAIAGRDYTAILGT
                     LVFAPGEISKVIEVPLLDNNEYGGNNRSFGLAIQAIDDIFGERYGSNFLQLSTDNGNQ
                     IRNLDSGSLAPEVVKQLGAALPFGAMGFSVTAPEGSASVTMPFQGITELNSYFRFNQI
                     SGQYEEFLYNGESGVEFLDTTNDGRADTLKIHLLDQGRGDGDGLGNGVITGLNVPAIV
                     NPGLVQVNPGVFLAPTNGDGVLQLRLITNQQESNQIGWVMVDDANGSIDGLLPDAPGY
                     LEAALARKQVVFENAYSASGQAFDRASAQQSFTELNALIQTESQFFGSLQSLELGGGG
                     YYIFYNESSSQTVFSVNTPVTVETESRGYHQISFDGLTMEIASKALVVPGNLDDLVVG
                     QISIGRAGAYENQILLYQVDSLSGGIDTDGDRQINLRPGDTGYVEAALKRAQNPATGA
                     SFNAPEGFFSTGQETVNLRGGSMYGMAIIPNATIGEVLSLNPNNNPELGPVALFSFDG
                     ANPAGISQMSRLGSNLFGFEDMVGGGDADYNDVILEFSHQF"
     gene            complement(14340..14639)
                     /locus_tag="SGL_RS00025"
     CDS             complement(14340..14639)
                     /locus_tag="SGL_RS00025"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153626.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041428257.1"
                     /db_xref="GI:752788401"
                     /translation="MDYEGEGLPEQPEPWSTGGLGDRDEWELAPPAGEACYRQPELEG
                     LLHSLYSARSVLVTSGEGMGKTYLVRQVWERLLSDGVTCQYFEPATPKTLLMAMA"
     repeat_region   14347..14534
     repeat_region   14579..15675
     gene            complement(14579..15133)
                     /locus_tag="SGL_RS00030"
                     /old_locus_tag="sll5006"
     CDS             complement(14579..15133)
                     /locus_tag="SGL_RS00030"
                     /old_locus_tag="sll5006"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153543.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153543.1"
                     /db_xref="GI:499466903"
                     /translation="MSIAGKSKGDVVQQLEKSYGVARTTVFNRLKYLGYSLDKVDDLF
                     SLSNEQMAELDKLHRWISDGGKMADYPKPGQLTMVTDERELEQYGEVINFDALEGDEE
                     LGHAELIRAAQNQAAGILIAQNLLTAEILKNPQHLPADLQAQVEQSKVAIAPKPQNPL
                     VIASQWITKAKAYQSNQNHGPLAA"
     gene            complement(15233..15481)
                     /locus_tag="SGL_RS00035"
                     /old_locus_tag="ssl5007"
     CDS             complement(15233..15481)
                     /locus_tag="SGL_RS00035"
                     /old_locus_tag="ssl5007"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153628.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153544.1"
                     /db_xref="GI:499466904"
                     /translation="MDFNPNEWPTHKQGEVVRQLILDALDSPKTKEELSSLCNKSVRQ
                     ITRHLHRLSSENKILSTGKGQFVRRIAAGFLLLYVGQI"
     gene            15996..16235
                     /locus_tag="SGL_RS00040"
                     /old_locus_tag="ssr5009"
     CDS             15996..16235
                     /locus_tag="SGL_RS00040"
                     /old_locus_tag="ssr5009"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153546.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153546.1"
                     /db_xref="GI:499466906"
                     /translation="MTTVTDADLKELKDLITTGFTKLEVNQARIEEKLNGIDKRLELV
                     ETRINTQTNWFVGAFAALVGGLLALLGKFILFPNA"
     gene            16603..17166
                     /locus_tag="SGL_RS00045"
                     /old_locus_tag="slr5010"
     CDS             16603..17166
                     /locus_tag="SGL_RS00045"
                     /old_locus_tag="slr5010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153902.1"
                     /note="slr5010; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153547.1"
                     /db_xref="GI:499466907"
                     /translation="MKINRQGQAKVLTEQELHDLFTIGLLTPRDRLLFGICLYTGCRI
                     GEACSLAWADVTTDAMTFRIEKTKTKSSRTVAITPALQVLFDEYRQQQCFRFSSSYVF
                     RGKRVGSHLHPSMAHKILKAATDRIEVRGVSTHSFRRTALTMMCRKGINLRVIQKISG
                     HKNLNVLSHYLEVSEQEKEQALSTISF"
     gene            17218..17439
                     /locus_tag="SGL_RS00050"
                     /old_locus_tag="ssr5011"
     CDS             17218..17439
                     /locus_tag="SGL_RS00050"
                     /old_locus_tag="ssr5011"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153548.1"
                     /note="ssr5011; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153548.1"
                     /db_xref="GI:499466908"
                     /translation="MKKQVKVKPNAKQSKVVYGDDGSLIIHVKSPPVDGKANQELIKL
                     LAKEFNVSQQSIKIKSGAGSRQKIVEINE"
     gene            17880..18800
                     /locus_tag="SGL_RS00055"
                     /old_locus_tag="slr5012"
     CDS             17880..18800
                     /locus_tag="SGL_RS00055"
                     /old_locus_tag="slr5012"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153549.1"
                     /note="slr5012; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153549.1"
                     /db_xref="GI:499466909"
                     /translation="MKVQLGLDIPKHQNQLKPIFARHETFHPRFGWLKKGFDRARDNS
                     RIFLAEDAPVLLGVGKNMVRSIRYWCEAFKLLDNDQPTLFGETLLGNQGWDPYLEDPA
                     SLWLLHWKLLEPPCLASAWWFTFNQFNRLEFTDRDLFDALVDYGDRLSGNIAESSLKK
                     DVSCLLRMYAKQPNIKKFVASEESLDCPFVDLGLINPAGGNHRYLFRLGYKPTLVPAV
                     ILYSVLHYAQRVNETARTIPLARLLYDEGSPGMVFKLTESSLCGAIEAISRTHNQLGL
                     EDAAGKLQFWFDSDPMALANQVLETYYADI"
     gene            18822..20513
                     /locus_tag="SGL_RS00060"
                     /old_locus_tag="slr5013"
     CDS             18822..20513
                     /locus_tag="SGL_RS00060"
                     /old_locus_tag="slr5013"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153550.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153550.1"
                     /db_xref="GI:499466910"
                     /translation="MTTLSQYFQIHRRYYRSVNLERDLGKASTVEGYVLTERSTATLE
                     RILPAFSKPHTHRAWTLTGVYGTGKSAFIHFLASLCTPQNTEVHRVAVTIAERFLEPT
                     SPILEAISALPAEGLMVAFATGQQEPLTWTLARALSQGAETFFPKNQRADKLLRQLTD
                     WKVEAETGDCQVTPKAILRAIKELVVIANRPLLIIVDELGKNLEYAAQNQGITDLYLL
                     QQLAELSLSGENQVYFIGLLHQSFGGYGDRLSVTEQNEWNKIQGRFEDIPFTESPNQM
                     TRLIAQVIDRENAKPILEEVQKTSNQWHQTLSSLISDLETTPELLTHIYPLHPLTAFA
                     LPLLCTRYAQNDRSLFTFLTSDEPHSFKHFLETTVIDLSLPTLKLYHLYDYFVETVTG
                     LASRLNLQRWVEIQSLIEDARDQSPQTLQVLKTVGILNLVTTTGNLKATSALVTWALC
                     DQADGEQSNYWQAEIERLMQKGLITHRRQLDELRIWQGSDFNVELAIAEQVEKNRSHL
                     ANLLQEVAPLKPLVAQRHYNQTGNLRYFEQRYGDGTEKWENLTCSDLSFEKFISA"
     gene            complement(20523..21479)
                     /locus_tag="SGL_RS00065"
                     /old_locus_tag="sll5014"
     CDS             complement(20523..21479)
                     /locus_tag="SGL_RS00065"
                     /old_locus_tag="sll5014"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153551.1"
                     /note="sll5014; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153551.1"
                     /db_xref="GI:499466911"
                     /translation="MSQIFQCPYCKALAIWKKGNYIHRRTCENSECRKKLNRDTAKKY
                     DQLRQKKKIQELKFQGFNIVTCQICNEEFEMIHHSHLKTHGLTVAEYRNRFPNALICN
                     SRNHKKRSQAALERSKYKSYSGKNIDNDFLEFLTGSLLGDGSLEKGKKKLNARYAEGG
                     ANKEYINWKFNFLKDYFYCTFQECLSSPHVKSGKQYQGWWIRTGVHPILTDLHCIWYL
                     EKKLLPRKFVEKYLTEFAFCIWFYDDGCSSSGLSLYPMSFSEDDVNFLSLIILQKFNL
                     KNSVLKTKQGHFFIRISQKAKSELKAILDKFSIPGMAYKRNL"
     gene            complement(21479..21760)
                     /locus_tag="SGL_RS00070"
                     /old_locus_tag="ssl5015"
     CDS             complement(21479..21760)
                     /locus_tag="SGL_RS00070"
                     /old_locus_tag="ssl5015"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153552.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153552.1"
                     /db_xref="GI:499466912"
                     /translation="MSDFPKDWAMYEPDGDFAVSEMMREVKAALKNMPLPEVRTLLKA
                     KIELVGISHGEIYDSEVRNKIESYLTSWACEVHELNDTWNTLSRSYWSL"
     gene            22086..23219
                     /locus_tag="SGL_RS00075"
                     /old_locus_tag="slr5016"
     CDS             22086..23219
                     /locus_tag="SGL_RS00075"
                     /old_locus_tag="slr5016"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153553.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041428268.1"
                     /db_xref="GI:752788412"
                     /translation="MSSQSLPESEQVNVSILAQLFNKTTNSYKYLFFLSLLDILKRRK
                     FDVLPPISFAELVVEILANAWFPHTYFKLSFGTQDKITEKLDSLNLIISEPILKFNDP
                     DKQLLRKTIANQTYDDLITYLVKYVPFRLIRPFYSHETRGLKDVEVNQVILDLTNNNH
                     KSRNALYHFDADLVKDCQGIILSPDWVNYIEENFKIVKGWASWAWLEYMQSRNPTTPN
                     IVNKLFTPQQRGSLSSQTKFWKSALNYQLFNCIYSKQKLNSDYLSLDHYLPWSFVAHD
                     QLWNLVPVIPEVNSSKSNNLPADQYFYDFVNLHHLALVTNHKHLPRQSWNKVIDPYVA
                     DLNLSENDLLDLDRLLKAYESTVKPLITLAAKQGFSENWVYPK"
     gene            23255..23572
                     /locus_tag="SGL_RS00080"
                     /old_locus_tag="slr5017"
     CDS             23255..23572
                     /locus_tag="SGL_RS00080"
                     /old_locus_tag="slr5017"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153554.1"
                     /note="slr5017; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase subunit beta"
                     /protein_id="WP_011153554.1"
                     /db_xref="GI:499466914"
                     /translation="MLSVTHLKIPQQTLAELCQQWHISELALFGSALTEDFHEDSDID
                     LLVSFAPDARQGLLTLAKIKHQFEEIFHRKVDLVVKAAIEEGDNWIRRQEILNSAVTI
                     YES"
     gene            23562..23903
                     /locus_tag="SGL_RS00085"
                     /old_locus_tag="slr5018"
     CDS             23562..23903
                     /locus_tag="SGL_RS00085"
                     /old_locus_tag="slr5018"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153555.1"
                     /note="slr5018; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153555.1"
                     /db_xref="GI:499466915"
                     /translation="MNRDNAYLLDILNAIQRIQIFSNGLTKDELSANEEKQSAILYQI
                     IVIGEATKRLSAEIRSINPHIPWKDIAGMRDILAHQYDRINLNTLWDVVQKDVPELEA
                     LIAPLVSNAKQ"
     gene            23890..24099
                     /locus_tag="SGL_RS00090"
                     /old_locus_tag="ssr5019"
     CDS             23890..24099
                     /locus_tag="SGL_RS00090"
                     /old_locus_tag="ssr5019"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153556.1"
                     /note="ssr5019; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153556.1"
                     /db_xref="GI:499466916"
                     /translation="MQSNKQIHLDYHATTPVDPRVTEKVVEFMTTQFGNASSVDHSID
                     DRARGAVDQAKQSVVYQRFNRRPTS"
     gene            24181..24462
                     /locus_tag="SGL_RS00095"
                     /old_locus_tag="ssr5020"
     CDS             24181..24462
                     /locus_tag="SGL_RS00095"
                     /old_locus_tag="ssr5020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153557.1"
                     /note="ssr5020; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153557.1"
                     /db_xref="GI:499466917"
                     /translation="MIRNFKDKEAQKIFERQRSRKLPGDIQQVALRKLRMLNRAETLQ
                     DLKVPPANRLEALKGDRQGQYSIRINAQWRICFQWENGEALDVEIIDYH"
     gene            24473..24787
                     /locus_tag="SGL_RS00100"
                     /old_locus_tag="slr5021"
     CDS             24473..24787
                     /locus_tag="SGL_RS00100"
                     /old_locus_tag="slr5021"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153558.1"
                     /note="slr5021; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="WP_011153558.1"
                     /db_xref="GI:499466918"
                     /translation="MNPDKLKPIHPGEVLLEEFLQPMNLSQNKLALAIRVPARRINEI
                     VQGKRRITADTALRLALYFNMSPRFWLGLQMDYDLDLAEDEIGEKLQQEVTTFNLDNV
                     AV"
     gene            24798..25955
                     /locus_tag="SGL_RS00105"
                     /old_locus_tag="slr5022"
     CDS             24798..25955
                     /locus_tag="SGL_RS00105"
                     /old_locus_tag="slr5022"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153559.1"
                     /note="slr5022; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase"
                     /protein_id="WP_011153559.1"
                     /db_xref="GI:499466919"
                     /translation="MIYLDYHATTPVDPRVAEKVMAFMTTQFGNVSSVDHAVGDRARR
                     AVDQAKQQIADLIHCRPQEIIFTSGATESINLAIQGTVLALEKQQQTPRLAISAVEHK
                     AVLDTCRHLEKQGRIELIVLPVDAQANLNLNQIEEVCHQGLDLLCIMAANNEVGTIYP
                     IEKIAAIAKRHAVPFFCDASQAVGKIPINFQDWDITLLALSGHKLYAPQGIGALIRKT
                     HHPLEPLIWGGGQQQGLRPGTLNLPGIVGLGEACHLRQLEMNEDETAIARKRDYLQAR
                     LQKAIPEILVNGNQSRRLAGNLHIAIPDIPNSAIIARIREQIAISTGSACSSGTIAPS
                     HVLRAMNLTSNFIDGALRIGIGKFTTNAEIEQAADILIKTITIVKSCLKSS"
     gene            25994..27175
                     /locus_tag="SGL_RS00110"
                     /old_locus_tag="slr5023"
     CDS             25994..27175
                     /locus_tag="SGL_RS00110"
                     /old_locus_tag="slr5023"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153560.1"
                     /note="slr5023; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome segregation protein SMC"
                     /protein_id="WP_011153560.1"
                     /db_xref="GI:499466920"
                     /translation="MKIVSIKIKNYRVFEDIKITNIPSFCVIIGANGTGKSTLFDVFG
                     FLRDALKNNIRQALQIRGGFKEVVTRGKESEDIEIELKFRMEILATERLVTYILIIGQ
                     EGKKPVIKREILRYKRGEYGSPFHFLDFHNGQGYAIRNEESFESDEELEREEQKLESA
                     DILAIKGLGQFQRFKAANAIRSLIENWHVSDFHISDARGSKAALYAEHLSPTGDNIPI
                     VAQYIYQEHPEIFAEILQRMKQRVPGISNVEAKEIEGGSLILKFQDQAFEDSFVDLYV
                     SDGTIKMFAYLILLFDPKPHPLLCVEEPENQLYPTLLRELAEEFASYAHRGGQVFVST
                     HSPDFLNAVPLDSIFWLIKIQGVTKVEKAADHEVLRNLIAAGDLPGYLWNQGWFEGVA
                     P"
     gene            27175..27735
                     /locus_tag="SGL_RS00115"
                     /old_locus_tag="slr5024"
     CDS             27175..27735
                     /locus_tag="SGL_RS00115"
                     /old_locus_tag="slr5024"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153561.1"
                     /note="slr5024; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153561.1"
                     /db_xref="GI:499466921"
                     /translation="MSYDLIFLLEEPSLKNVLEMLLPKIIPNSLTYQLITHQGKQDLA
                     KSIPRKIKAFQFSRTTKFIIVHDQDSHDCIQLKTELLTICQNAGQSDILIRIVCRELE
                     SWFLGDLAAVEKAYGLKPQSLSRKQTQQKFRNPDQLNNAKQELIKLVKEYYEATHSKA
                     IAPHLSLTDNKSHSFQVFIEGIQNFI"
     gene            complement(27859..28053)
                     /locus_tag="SGL_RS00120"
                     /old_locus_tag="ssl5025"
     CDS             complement(27859..28053)
                     /locus_tag="SGL_RS00120"
                     /old_locus_tag="ssl5025"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153562.1"
                     /note="ssl5025; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153562.1"
                     /db_xref="GI:499466922"
                     /translation="MLQNLDRITFDLQIMGGKACIRGMRVPVSLILNLLANGKTSEEI
                     IDDYPYLESEDIQQAMLYAA"
     gene            complement(28096..30168)
                     /locus_tag="SGL_RS00125"
                     /old_locus_tag="sll5026"
     CDS             complement(28096..30168)
                     /locus_tag="SGL_RS00125"
                     /old_locus_tag="sll5026"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153563.1"
                     /note="sll5026; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153563.1"
                     /db_xref="GI:499466923"
                     /translation="MADTHNFIDIKDALNALILGKRLPDALYIHYSIISHLSPILRRY
                     ESLARQIFDENYQSKLNQNLQFTLIKFNLNEPKISYLDYPNFDLDAHPALRQSTQVNL
                     ELNNCQVRHYGDNPPILHRKETFVCADYPLYQTFAELTQAEEKLGLLADPRQIGYRQQ
                     WEKRLQQFRVRIENHKLIEIQEFAHQSPKIDRHKAAIIRRQMSRPVRSLLDANLLTEG
                     MTFFDYGCGHGEDLKFVAEKGFEVHGWDPFYEPEGDRHPADIVNLGYVINVIENPAER
                     REALFQAWELAQKILVVSAQVLIADGGAGHIAYGDGVITSRNTFQKYYGQEELKLYID
                     QVLGIDAIPVALGIYFVFRDEAQAQAFRASRFRSRATTPRIRLSVKRFEDYQDLLQPL
                     MNFLTERGRLPKKGELATEADICAEFKTLTRAFQVIEQATNGEDWKKITEQRKQDIQI
                     YLALSHFAKRPRFSQLDDILQTDIKVLFGTYKEACLLSDRMLFSLGNLANLANIAQQS
                     PIGICSKKALLVHISALEALDPLLRLYEGCASRTVGRLENVTLVRFYLHEPKIAYIFC
                     SDFDTNPHPRWQTMMQISLQDLRVRYKEYDPDYAPVVHCKERLVMTDYPLCKKFAKLS
                     QQEEDWGLLENWSEIQLWPGWQRTLREMGVEFRGHRLVWRSDADPYAQKLLKARIRTQ
                     QRQRQNLS"
     gene            complement(30677..30988)
                     /locus_tag="SGL_RS00130"
                     /old_locus_tag="sll5028"
     CDS             complement(30677..30988)
                     /locus_tag="SGL_RS00130"
                     /old_locus_tag="sll5028"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153565.1"
                     /note="sll5028; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153565.1"
                     /db_xref="GI:499466925"
                     /translation="MGSSIESVAVDSDLLPFDPGMVALIQLMESRRSPLDNLRDLEDA
                     VSYGWLLTTTQIEKLLGVKPRGEQFDRQGFLFTRQGKAGREAQWSITKITRGLRSVEI
                     E"
     gene            31397..32062
                     /locus_tag="SGL_RS00135"
                     /old_locus_tag="slr5029"
     CDS             31397..32062
                     /locus_tag="SGL_RS00135"
                     /old_locus_tag="slr5029"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153566.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_011153566.1"
                     /db_xref="GI:499466926"
                     /translation="MTKTREAKKTVQCVDTYSELYKDIFPEVRSYESFKYIIVGMLSD
                     IKRKSLPAIASSLGLKNEQGLLHFMTDSPWELKELKKRRLNIILEVLEGREIIVIIDE
                     TGDPKKGKTTDYVKRQYIGNLGKIESGIVSVNAYGYCDGVTFPLESKVFKPKERLKEG
                     DKYKTKTELAVEIIKELEESGFKIKRVVSDSLYGESHSNFISAVEELKIEYAVGIRSN
                     HGV"
     gene            complement(32015..32836)
                     /locus_tag="SGL_RS00140"
                     /old_locus_tag="sll5030"
     CDS             complement(32015..32836)
                     /locus_tag="SGL_RS00140"
                     /old_locus_tag="sll5030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153567.1"
                     /note="sll5030; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153567.1"
                     /db_xref="GI:499466927"
                     /translation="MKTSLDCIPCLLHQSLDAARLVSQNPSVHEQIIRDALSWAGEMD
                     LNQSPPAMAQQIHRRLREITGVTDPYRKTKDWQNRVAMELLPTLRAKVEAAKDPLLMA
                     ARLAIAGNVIDMGVDGSLTEADVREALEQALKGPFFAEEDRLREVIAQAKSILYLADN
                     AGEIALDRLLVEQLSPERVTLVVRGSPVLNDATLIDAQTVGLDKIVEVVDFCFNFPIS
                     YCAFFTINYFSDIPIFLFSIPSYVFKPPPLICPYFSFLWKLDPMIAPDSHCIFYF"
     gene            complement(33000..33350)
                     /locus_tag="SGL_RS00145"
                     /old_locus_tag="sll5032"
     CDS             complement(33000..33350)
                     /locus_tag="SGL_RS00145"
                     /old_locus_tag="sll5032"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153569.1"
                     /note="sll5032; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153569.1"
                     /db_xref="GI:499466929"
                     /translation="MNSENLAALKPYLSFFHPITMWALLALAIYTLYLGIQVRRTRLA
                     EGEPKKELIKGRFAIRHHQIGSMFLALIVMGAIGGITVTYINSGKIFIGPHLFAGLGI
                     VGLVSTSAALVPFM"
     gene            complement(33422..33961)
                     /locus_tag="SGL_RS00150"
                     /old_locus_tag="sll5033"
     CDS             complement(33422..33961)
                     /locus_tag="SGL_RS00150"
                     /old_locus_tag="sll5033"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153570.1"
                     /note="sll5033; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153570.1"
                     /db_xref="GI:499466930"
                     /translation="MKSILSFIKSVFILGILVGVLIINLAVSPAQAVIRQLEEAPGPT
                     VYQSEISKSRQILKDQQGGSWQAIAFERTIPDHEDSIYLRLVDFPGTANIDHSKPLII
                     TNMMSETLSAVNVSEDMFMDKTKMSPDAGEYDLQPILMQLESAIPLRLILPTLDQQKI
                     VLNVSPAVVEEWQSLTTQK"
     gene            complement(34001..34624)
                     /locus_tag="SGL_RS00155"
                     /old_locus_tag="sll5034"
     CDS             complement(34001..34624)
                     /locus_tag="SGL_RS00155"
                     /old_locus_tag="sll5034"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153571.1"
                     /note="sll5034; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153571.1"
                     /db_xref="GI:499466931"
                     /translation="MQTLPQRILSLMLIIGISLLLLGGNAAIATAAPIIPNANELAQA
                     VQEIESLDAMRTGLASSLEGRTEAPTKQTMKEVCRPVGMRAMQLSKENGWQVQQIANK
                     YRNPDHKPNNLHDQIALAKFNQEPELVGFWDRETLNKQTGTRYYRRIEVESTCLACHG
                     LKNSRPQFIKDGYPQDLAYDFNVGDLRGMYAVFIPDDIQKAMQDAIK"
     gene            complement(35079..36365)
                     /locus_tag="SGL_RS00160"
                     /old_locus_tag="sll5036"
     CDS             complement(35079..36365)
                     /locus_tag="SGL_RS00160"
                     /old_locus_tag="sll5036"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153573.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfide-quinone reductase"
                     /protein_id="WP_011153573.1"
                     /db_xref="GI:499466933"
                     /translation="MAQIVVIGAGLGGLPAAYELRHYLGKAHQVILISEFPQFTFVPG
                     LVQVGLGHIPLDHMQLNVPMLAKRHGFKWVQGKVQKIDPLQKRIYTHETLNYDYLIIA
                     SGAELANDLVPGLGIYTHSICTPSHVLEARTAWETFCQQPGDLVVGAAPGTGCFGPAY
                     EYVLLAEADLRRRGIRDQVKITYITPEPYIGHLGIANMAHSQTLTEALMNKRGIATLT
                     NAQIVNISSDHIFLADGQSFGFAYSMILPAFRGAKFVKASGLGNERGFLPVLPTMRHR
                     DYPEIYGVGVSVHLGQINDTQVSIGTPKSGQMTEAMAMVAAHNIAVELGSIAKPLQVP
                     TLEALCFAEYGDTGIAYIAAPVLPDRLTGKRRYSYAIKGIWVNWAKAAFEKYFLAKMR
                     LGVGLPWFEKLGLRLLFGLSMSRPAMAEDIVQPVNV"
     gene            36483..36866
                     /locus_tag="SGL_RS00165"
                     /old_locus_tag="slr5037"
     CDS             36483..36866
                     /locus_tag="SGL_RS00165"
                     /old_locus_tag="slr5037"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153574.1"
                     /note="slr5037; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153574.1"
                     /db_xref="GI:499466934"
                     /translation="MYYFSKKLLVGFDEAIGLVKDSLAKEGMGIMTEMNLQKAFQQKL
                     HQDFRRYQVLGACHPKVAYEMLQIDDQAGVMFPCNVVVQEHDDGSVEVSAVDPLAMFL
                     MIHSAQAKEIALYASAMMQRVIDHL"
     gene            36906..38144
                     /locus_tag="SGL_RS00170"
                     /old_locus_tag="slr5038"
     CDS             36906..38144
                     /locus_tag="SGL_RS00170"
                     /old_locus_tag="slr5038"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153575.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromate transporter"
                     /protein_id="WP_011153575.1"
                     /db_xref="GI:499466935"
                     /translation="MKEIHSLENSQAPKIPNLGEMTWLFLKLGTIGFGGGIAMIALME
                     EEFVKRRNCLETEEFLHGVALGQILGSFPVNTALFIGYRLHGFLGGLIGSMTFLAPSL
                     IMVLVLSWLYFSFNQIPSLQGILAGLAPVVIGIILTAAWSMGQKAIASSVALGIAIGA
                     CVGSLTHINPVIILFTGGMIGLLLKLTPKKIKLKKLADTNQSALVLPVAMQALPHHWA
                     VLAETPVIPGAVSLLTLGWTFLKVGFVFFGGGFVLIPVLKQLLIDNLHWLTQQEFIDG
                     VAISQLTPGPIAVISTFAGFRVGGIMGAMIATFGLFLPSIVLMFVLSKYYQKVRHLQP
                     VKHFLSGVNPAVVGMIVSAAVNLAPGVFLGSESTKIIINLCLLGMTLLVIGKLKWHPA
                     ISLGIGAMTGIAVSFLPGVS"
     gene            complement(38437..38730)
                     /locus_tag="SGL_RS00175"
                     /old_locus_tag="ssl5039"
     CDS             complement(38437..38730)
                     /locus_tag="SGL_RS00175"
                     /old_locus_tag="ssl5039"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153576.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153576.1"
                     /db_xref="GI:499466936"
                     /translation="MDQNEWVIFAELRRSDFELIVSILSDHFPRLEWGSQGDDWLWIY
                     RRDYKLEIDSFSSIELEVKGPRKAYGLAQKVLRPLPPSVFIQVFERPKLDLTR"
     gene            38994..39641
                     /locus_tag="SGL_RS00180"
                     /old_locus_tag="slr5040"
     CDS             38994..39641
                     /locus_tag="SGL_RS00180"
                     /old_locus_tag="slr5040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153577.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_011153577.1"
                     /db_xref="GI:499466937"
                     /translation="MLRTGCAWRLLPHDFPKWRTVYGYFQQWHEDGTWKKLNRIFREK
                     VRLKAGRNTHPSAGCLDSQSLKKAGTGQETGYDGGKKVNGRKRTILVDTMGLLLDVVV
                     HGAHRSDHQGLILLGTWFAPLWQCLQVIWTDSTFGGKDFIFWVEHTFGWTLNVVSKKQ
                     GQKGFEVLPRRWVVERTFAWFGRYRRLSKDYEYLPTTSETMLYVAMVHLILQRLA"
     gene            complement(<39666..40187)
                     /locus_tag="SGL_RS00185"
                     /old_locus_tag="sll5041"
                     /pseudo
     CDS             complement(<39666..40187)
                     /locus_tag="SGL_RS00185"
                     /old_locus_tag="sll5041"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019498360.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            complement(40411..41316)
                     /locus_tag="SGL_RS00190"
                     /old_locus_tag="sll5042"
     CDS             complement(40411..41316)
                     /locus_tag="SGL_RS00190"
                     /old_locus_tag="sll5042"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153579.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfotransferase"
                     /protein_id="WP_041428258.1"
                     /db_xref="GI:752788402"
                     /translation="MTDCSPTTDHPKGPDFIIIGGMKCATSTLHEQLALQPGIFMTSL
                     KEPNFFSNDEEFAKGMDYYQSLFAGAQPQDLCGESSTHYTKLPTYPDTVKRLAEAFPQ
                     TKFIYVMRHPIDRLVSQYIHEWTQRVVNTDINTAIDQFPEMIEYSLYSKQLQPYFEQF
                     GRERVLPVFFERMLAHSQAELERVCNFIGYQGTPIWQELNPQNVSSDRIRISGWRDFL
                     VEAPGLKQLRRWLIPKSLRTWIRSLWSMKKRPQLSNERLAYLKKIFDQDLQVLGSWLG
                     IPLDCTTFKTTVKSQNSAWFKRDQI"
     gene            complement(41411..42397)
                     /locus_tag="SGL_RS00195"
                     /old_locus_tag="sll5043"
     CDS             complement(41411..42397)
                     /locus_tag="SGL_RS00195"
                     /old_locus_tag="sll5043"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153580.1"
                     /note="sll5043; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153580.1"
                     /db_xref="GI:499466940"
                     /translation="MAIIASNNSWDLYQLAVVILNYRTPQLVVDCLASLVSQIDPQTQ
                     QVIVVDNASGDDSVEEIEKAIANNNWQDWVRLLPSDVNGGFSAGNNLGIQAIRAENYL
                     LLNSDTIVRPGAIQTLLVALEQYPEAGLFSPRLEWPDGTPQISCFRDHSPLSEMIDGA
                     RTSVITKLLQPFDVPIPVTEQSFEPQWTSFACVLIRRSVVEQIGLMDDGYFMYYDDID
                     YCRRARQAAWKIRYIPQASVVHLRGGSGSVKSDVASRKRPRPYLYASRSRYFAKFYGP
                     LGLALANLGWLGGWGIAALREILGQKEPHTCDRQWQDIWFQWRQPLKPYRPE"
     gene            complement(42442..43161)
                     /locus_tag="SGL_RS00200"
                     /old_locus_tag="sll5044"
     CDS             complement(42442..43161)
                     /locus_tag="SGL_RS00200"
                     /old_locus_tag="sll5044"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153581.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
                     /protein_id="WP_041428259.1"
                     /db_xref="GI:752788403"
                     /translation="MSSAFFNYFDGTYIINLAERGDRRREMIQEFQRFKILGLPKNAA
                     FFTAVKPSDQGNFPSLGARGCFLSHLGVLKVAKAQNLEQVLLLEDDATFTKDLVQNQT
                     QLLQELQTTSWDFVYFGHNVSANTNSLLHLYDEPIIQAHFLAIHSRIFDQLIDFLETL
                     LERPGGHPDGGPMHVDGAYSTFRQQNPQIKTLVASIPLGFQRASCSSIAPRQWFDRWP
                     AATNIVNLARKAKNIYQKVAV"
     gene            complement(43343..44293)
                     /locus_tag="SGL_RS00205"
                     /old_locus_tag="sll5046"
     CDS             complement(43343..44293)
                     /locus_tag="SGL_RS00205"
                     /old_locus_tag="sll5046"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153583.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153583.1"
                     /db_xref="GI:499466943"
                     /translation="MNTSFLESPTFLIGAERSGTTLLRLMLSHHSQIAWCNEFEYVID
                     QVSDNAQFPKVSDYQDWLKTHRIFQATGFEVSPNLTYGELVQSFLQQKQAQEQKPVVG
                     ATVHRHFDRLLAIWPNARFIHIVRDPRDVARSCIGMGWAGNVWTGSQRWLEAEQDWEA
                     LKQTLPVNNYVEISYENLIREPQTVLTQLANFLGVAYDPAMLQYNQDTTYDQPDSSFL
                     NQWRRKLGDREIQLVESRVGDLLLQRGYEASGLPTIQLTSSQIKSLKLQDWWARANFR
                     LQRYGAVLFTLNYITSRLPLRAWRDRIQLKINQIDLEYIK"
     gene            complement(44338..45855)
                     /locus_tag="SGL_RS00210"
                     /old_locus_tag="sll5047"
     CDS             complement(44338..45855)
                     /locus_tag="SGL_RS00210"
                     /old_locus_tag="sll5047"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153584.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153584.1"
                     /db_xref="GI:499466944"
                     /translation="MTPQAQLVLLLWLPVILYFFRRYPPRTAVMVSFLGGLLFLPQRT
                     GFALPLIPDYQGMVATCYGIVVGLCIHDLERLKKFRIEWLDIPMMLWCISPFMSSVTN
                     GLGAYDGVNESITQTVVWGLPYMLGKLYFNRLIYLKQLAEGIIKAGLIYVPICLWEGR
                     MSPNLHLIVYGYYAHPSGISQAIRYGGYRPNGFMQHGLMVGMWMMTVALITIWLWQSK
                     TFTKIWNYEIKSLIPVLVFTVIWCRSTGAYGYFFYGLIILFTAKFLKSNLPLLILIFG
                     LGWFLYMNVTGQFHGDKILAFLSEYTNPDRIQSLGFRWINEEILAEKARERFWFGWAG
                     WKRNRVYEENWIGEIVDVSVTDSLWIIAFGIQGAFGLLNLTLALLLPPAVFATFRYPA
                     KLWLHPKVAPAAALATCLVLFKLDSVINNMYNPIFPLISGGLAGLCLQPPESLKPQSR
                     SPAVKQVKKQKQKSSEQGKLKTKPGRSKSGSGKRSKVRRKVVHRAGTKSDSDPSS"
     gene            complement(45852..46940)
                     /locus_tag="SGL_RS00215"
                     /old_locus_tag="sll5048"
     CDS             complement(45852..46940)
                     /locus_tag="SGL_RS00215"
                     /old_locus_tag="sll5048"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153585.1"
                     /note="sll5048; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 1"
                     /protein_id="WP_011153585.1"
                     /db_xref="GI:499466945"
                     /translation="MKITFVLPYAGLAGGIRVVAIYADRLQKRGHEVFIISQPLPKPG
                     IKQRISQWLRGKKTPAQPSASHFDGLNVPHKVLETCRAVGDRDLPDGDVVIATWWGTA
                     EWVAKLSPSKGQKVYFVQHHEIHPYFPVERVKATYRLPLYKIVIAEWLKKVMAEEYGD
                     SQVSLVPNSVDLELFSASPRGRQTVPTVGFMYSTKAWKGTDLAIQGWQLAQEKLPNLK
                     GIAFGSEPVSSNLPLPEAIAYHHKVAQEKLKEIYASCDAWLFTSRLEGFGLPILEAMA
                     CRTPVIGTPTGAAPELIEQGGGILVPPEDPAEIAAAIVKICTQPLEQWQTLSDKAYQT
                     ASCYSWDDATTLFEQALEEATMATANDP"
     gene            complement(46945..48288)
                     /locus_tag="SGL_RS00220"
                     /old_locus_tag="sll5049"
     CDS             complement(46945..48288)
                     /locus_tag="SGL_RS00220"
                     /old_locus_tag="sll5049"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153586.1"
                     /note="sll5049; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153586.1"
                     /db_xref="GI:499466946"
                     /translation="MASLNKLAIRGTIWTFVGYGSSQVLRLAGNLVLTRLLVPEMFGL
                     MALVNTFIIGLNLFSDIGIGPSIIQNKRGDEPSFLNTAWTIQVIRGVGLWLCCCLIAL
                     PVSRFYGDRQLIWLLPLVGFSTIIAGFNSTALFTLNRKIDLGKLTRFEFIVQSIGLVV
                     MIVWAWFNPTIWALVMGNFVLSLVKMIWSHYLVAEPRNRFTWDPTALQEIARFGRWIF
                     VSTAMTFLATQADRLILGKIFSLTLLGVYTIAFTLAELPRQVLSRVNGKVMFPVISQQ
                     IDLPRAELRSKILKKRWLLLGALAIAIAVMISFGDWLILFLYDERYRAGAWMLPILAA
                     GLWLPTLALTIDPVLYALGKPQLVAIGNFAKFAYMLIFIPLGFHSFGVLGAVIVVAAN
                     DLPYYLAVAYGVWQEKLSGFRQDLLSTLLLLGVASLLITIRWSLGLGLPIEALWS"
     gene            complement(48291..49505)
                     /locus_tag="SGL_RS00225"
                     /old_locus_tag="sll5050"
     CDS             complement(48291..49505)
                     /locus_tag="SGL_RS00225"
                     /old_locus_tag="sll5050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153587.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase"
                     /protein_id="WP_041428272.1"
                     /db_xref="GI:752788416"
                     /translation="MKVAYLINQYPKISHSFIRREILALEELGVVVERISVRPIAQTD
                     LADEADRQECQRTRALLGAGLIPLLGSGLFLAISRLPPWLKTLGLTIQVGRRSHRGLL
                     RHFAYFLEACLLWRWLKAAGITHIHAHFGTNSTTVAMLCASLGDISYSFTVHGPEEFD
                     RPEAIAIPEKISRARFVVAISSYGKSQLYRWCSLADWPKIQVVHCALAADYLQQEITP
                     VPEVPQLVCVGRLCEQKGQLLLVQAVRQLRDNGIAVKLVLVGDGELRSPIEELIEQYQ
                     LEENITITGWASSAMVQQHLLASRAMVLPSFAEGLPVVIMEAFALGRPVISTYVAGIP
                     ELVKPGVSGWLVPPGSIPDLVEAMQSVLTMSCEQLTAMAAMGQQAVQMDHDVHKEAEK
                     LAQHFHTYASAP"
     gene            49707..50099
                     /locus_tag="SGL_RS00230"
                     /old_locus_tag="slr5051"
     CDS             49707..50099
                     /locus_tag="SGL_RS00230"
                     /old_locus_tag="slr5051"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153588.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153588.1"
                     /db_xref="GI:499466948"
                     /translation="MPTVETDLAQILERIDGKLDRIEKDISDIKVSQAEVKGEIRTLD
                     ERLSGQIKATDEKLSGQIKTTDEKLSGQIKTLDERLSGEISTLDEKVTGIGKRLENQE
                     FTSRGILTALIIALIAGAAKFFGIFPNP"
     gene            complement(50111..52333)
                     /locus_tag="SGL_RS00235"
                     /old_locus_tag="sll5052"
     CDS             complement(50111..52333)
                     /locus_tag="SGL_RS00235"
                     /old_locus_tag="sll5052"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153589.1"
                     /note="sll5052; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153589.1"
                     /db_xref="GI:499466949"
                     /translation="MAHDEAEEFLATEEAEIEAVSPPATSKNLVRVYLNLVLRKWFII
                     VAFAGAGLVVTSYLSTQDPSTYVGRFEILIEPVTSAEKLTDASVLTRSNDLPSQELLN
                     LDYPTQLKILKSTVLLSKIAAEVHNILPQIPEAAMLQNLQKNLIVKRVQEGNSRFDYT
                     KILEVIYEGNDAVLVETVLKVTAEQYLQYSLQERENSLQAGVSFIDEQIPILETQIRA
                     LQGQQRTLQQRYNIISPNQQATNLNEAYQANQLDIQKIDEELEELRSLKSNLESTLGL
                     SPSEALVVLDLSQNPERQNLLQQLQEVETMIAAESSRFTNENPIMQDLFQKRNNLQTL
                     LETRTKEILKSSSLKGDNNPNIFMFQNTSRITMLDQLIVTQNEIAKRLTRRQVLVANQ
                     ERLRINLDQFPTIAAQYDEVARQLDLKKGLLDTLANQRETLRVEAAQQDVPWKIISAP
                     AIPRGPDGLPISFPPDPKKKMIAGMGSGLVLGLLLAIAWERSRNIFYSNSDLKFGLGY
                     SVWGELPLLDSGIAHDKDALEDEVLPTEANEAIVAMGEDRGQQIYTNFYFQYQEQGIR
                     SMAMTAIDNESGQASVTMQFARAAVNAGQTVLVIDTNLQHPDIHHHGNNTDELEQGLV
                     NVLNSDTDPQQLLNLVHYEDGLAIIPVGTMNAGHPIRLQRWLSRLDPALQTLTHKYDL
                     VIYNAPLLTVPDTPFLLNRTDGVCLIVRLKYTSQSQTHQALTTVEKFQIPVLGVIATI
                     "
     gene            52552..52992
                     /locus_tag="SGL_RS00240"
                     /old_locus_tag="slr5053"
     CDS             52552..52992
                     /locus_tag="SGL_RS00240"
                     /old_locus_tag="slr5053"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153590.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153590.1"
                     /db_xref="GI:499466950"
                     /translation="MVAIAKLSASQPGRVKTLSEHPFPYPQQVTLPSWQLKNSKTAIV
                     AGKSPGQRYILQKGDITATITACLNPNAPSTLTEQQFISNKYRHNLHFFAWLAGQKDL
                     TDSSCLWTLISAPIAPDATPDEITQTFQQLETAWVEWYQWWQLH"
     gene            53037..54026
                     /locus_tag="SGL_RS00245"
                     /old_locus_tag="slr5054"
     CDS             53037..54026
                     /locus_tag="SGL_RS00245"
                     /old_locus_tag="slr5054"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153591.1"
                     /note="slr5054; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
                     /protein_id="WP_011153591.1"
                     /db_xref="GI:499466951"
                     /translation="MEDLGIVVIGRNEGDRLKDCLRSVVEAGLVIYVDSGSTDNSIEF
                     AESLDVVVVRLDLAQPFTAARARNAGLAKLLELQRSTKYVQFVDGDCEVITNWLATAY
                     QFLEENRAIAVVCGRRRERYPEQSIYNQLCDLEWDTPVGQTKACGGDAMVRVTAFQTV
                     GGFNEGLIAGEEPELCVRLRQQQWQIWRLDTEMTWHDANMLHWHQWWKRHVRAGFAFA
                     EGAWLHGQPPEKHWVKESRSIWFWALIIPVVSLGSSCPTFGLSLVLLLGYPLIIYKTA
                     RYFQQQGLSAQLAWLYATSCLLAKFPQFIGQLRFHWLRLTKQTATIVEYKARS"
     gene            54119..54910
                     /locus_tag="SGL_RS00250"
                     /old_locus_tag="slr5055"
     CDS             54119..54910
                     /locus_tag="SGL_RS00250"
                     /old_locus_tag="slr5055"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153592.1"
                     /note="slr5055; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153592.1"
                     /db_xref="GI:499466952"
                     /translation="MNSITLLNTTIHNYSMVELLEDLNKRGGFVVTPNVDHMVKLQED
                     AELQEVYQVADYRVCDSKIIEYILKLLGTPIKEKISGSDLFPAFYEYNKDNTDTKIFL
                     LGAKEGVADRARQKINEKVGREMIVDSYSPSFGFEQNPEECAYILERIKQSGATVLAV
                     GLGAPKQEKWIAKYRHQLPNIKIFLAIGATIDFEAGEKARSPQWMSKVGLEWLHRLAS
                     EPQRLWKRYLVESLPFFALVLQYKLQTLLSEPAYPQLSTADSRTV"
     gene            55058..56281
                     /locus_tag="SGL_RS00255"
                     /old_locus_tag="slr5056"
     CDS             55058..56281
                     /locus_tag="SGL_RS00255"
                     /old_locus_tag="slr5056"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153593.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
                     /protein_id="WP_041428260.1"
                     /db_xref="GI:752788404"
                     /translation="MLITVFISAIAVVVLVPSAILLLECGAACLAPSERTQAVPGNQA
                     RTPAGLRVAVLVPAHNEAQVIAETLQSIQPQLTPADTLLVVADNCTDTTAIIAEREGA
                     TVIERIDQEKRGKGYALDYGVQYLAQHREPDIVILMDADCYVHPNCIEQLTTMAAQRQ
                     RPIQSCYVMATPAEPSIKDRLSAFAFLVKNWVRPLGLSQLGAPCLLTGTGMAFPWTIL
                     KNAPLASDNIVEDMQLGLDLAIAGYAPLFCPMALVTGLLPKAQDTAIQQRTRWEHGHL
                     KTFISQAPRLLKAAIGQVRLDLLALVGELSIPPISFLVLLWLTYAFVSLLASLASDSY
                     LPLLLATIAGAMLGMAILLAWMKAAQEILPFTTLLMTPLYLLWKIPLYFNFFRKPQTN
                     WNKTKRDTAIGKRDT"
     gene            complement(56854..57807)
                     /locus_tag="SGL_RS00260"
                     /old_locus_tag="sll5057"
     CDS             complement(56854..57807)
                     /locus_tag="SGL_RS00260"
                     /old_locus_tag="sll5057"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153594.1"
                     /note="sll5057; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153594.1"
                     /db_xref="GI:499466954"
                     /translation="MASTIQLIEVPQSFCQQEVAFIQSQLAEWFEAEAQVGRLVFDFA
                     KTRVLDSAAIVYLRQLSQQAKDKGVELLGWSLRPQLKQVLTLAGIDQYFTFTETTNQV
                     FGDNVDVAFDQQVHPSVISKGKRLLDIVGALVGLTITSVLFIPLAIAIKLDSPGPVLF
                     SQTRCGYKGQQFKIWKFRSMVTNAEALKHQVENEIDGAFFKNTNDPRITKVGKFLRKT
                     SLDEFAQFWNVLIGEMSLVGTRPPTLDEVAQYNSHQSNRLEVKPGLTGEWQVNGRSTV
                     LNFDQVVEMDLNYQKRWSLGYDIKLILKTIQVVFSKRSGAC"
     gene            57972..60323
                     /locus_tag="SGL_RS00265"
                     /old_locus_tag="slr5058"
     CDS             57972..60323
                     /locus_tag="SGL_RS00265"
                     /old_locus_tag="slr5058"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153595.1"
                     /note="slr5058; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153595.1"
                     /db_xref="GI:499466955"
                     /translation="MAKRSLKASPDGQAQAKQAMLCRGWTQEYLAIEAGLSTRNSVWK
                     FLTGRPVDRNIFMEICFQLDLDWQDIADLPTFPLEKVKATEPVDRPVTDESLKTTTIP
                     DVPDLAIIKTKFKVLVDTWCSRLPSYVDSNQSLLLTEVYVDVQVFPFAPDQQWLAQQN
                     SLTGLRANTFSNQRLAPTSKREQSVSALESVLQHNHVMVLGKPGTGKTLFLKYLALQC
                     YGQSAGFDLLPIFVSLRSFVEFIEAYENADLFSYLEHILRQAALSEAEVDYLFEQHKL
                     LLLLNAFDEVSVEKADFVYQKIYQFTEKYHQNKIIISCRSASQNYYFQGFTHLELAGF
                     SSPQIQQFTQRWFSATLQDSEQGEQKAAQFLETLSRQDNQAIQELAHTPILLALLCSV
                     FLARSEFPNKRSRLYQEALAILLTRWDQTRGIKRDQIYENLTLLDKLKLLSTIAAIAF
                     EQGQYLIEQEELLQIILDFLSTLPNADDDLDALWLNSETLLKEMEIQQGIIVQMAKGV
                     YAFSHLTFQEYLTARKIVVDSTSEFPTLSLQELADHVMMPQWREVILLTVEMLPDPVK
                     LLRLIQSQIDGLLRNDVGLQQFLQHVATKAESLDVPYLSAAVRAFYLGLFCGRELNLA
                     SALDPKIVGDLAPDMALDLALLRVLHLGERLIEQPTLEKLLELGFGLDLENRFTLTAP
                     LLGSLHRLKQRLPASSQDLDTQLTWWQQEGHGWCEAWRQMLIEQRGFGQPWQLTGSQQ
                     EKLEDYYQGNLFLLECLEQVTTRYRKAIAAQLLLPHDQGEKVS"
     gene            complement(60291..61199)
                     /locus_tag="SGL_RS00270"
                     /old_locus_tag="sll5059"
     CDS             complement(60291..61199)
                     /locus_tag="SGL_RS00270"
                     /old_locus_tag="sll5059"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153596.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_011153596.1"
                     /db_xref="GI:499466956"
                     /translation="MTETSPTVDEQRSPLILVTDDDNSLRSLLVMALRADGYVIEEAV
                     NGQECLAKYQRLQPDLVILDAMMPEMDGFTCCQQLRQFPQSLNIPILMITFLDDRESI
                     EQAFTAGATDYITKPIHWSVLKQRVRYLLSASQSLKQGAIQQQQLDRQLIWQEDWSEL
                     LAQLAAVKSLTTDLVSGLEPLREGLGIDRFVVYGADLTPQLESVAANSPSALNYSLLD
                     LGLNQLLPSGEILAIADIPQSSLSPASKTKLKDLQTTALLLIPIGSSSKPLGWLGLYR
                     QFTGEWDSFVQGRCQDLANLFALVMG"
     gene            complement(61202..64831)
                     /locus_tag="SGL_RS00275"
                     /old_locus_tag="sll5060"
     CDS             complement(61202..64831)
                     /locus_tag="SGL_RS00275"
                     /old_locus_tag="sll5060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153597.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="two-component hybrid sensor and regulator"
                     /protein_id="WP_011153597.1"
                     /db_xref="GI:499466957"
                     /translation="MINSGTLITKIEELQSTLAKMDIALGTVDEAIVWTDGTGQIQWC
                     NTAFDHLMGKLHILILGKNLVELLPLHRNSQPLEVSHHPFTIIVATQQKFTDHYEFNQ
                     NGKWLHLEIMTSPLMNAQGAVLVIRDISDRHLQEQTLQQLNENLEKRVLERTQAVSLI
                     NNKLEQELRERKKTEIALKATTSRLEALIQNLQAGVLVENENGKIVLVNQVFCDLFGI
                     DVPPEKLIGFDCRQSAQFAKILFEDPEAFIIGIDNILQNRQIVTNEELRLKDGRTFAR
                     DYVPIEVGNHHDGRLWLYRNITPQKQAEVSLRKQYQRTLLLKEITEEIRQSLDPVKIF
                     QVAVSRLGQTLQVSRCIVHLYSDMPQPHLTCVAEYLIPGMTSMLDLNLLIADNPHLLR
                     ALNQDDAVQVDNLKMVPTAVPLQDFYNQLQVYSLLIIRTSYQDKTNGLLILHQCDRSR
                     SWNTEEVELVKAVADQVGIALAQAKLLEQEREIRQQLIEQNKALMTATKAAEDANRAK
                     SDFLATMSHEIRTPMNAVIGMTGLLLDTHLNTQQQQFTETIRSSGEALLSLINDILDF
                     SKIESGQFKLEIHPFEIQQCVEECLDLVAPQAFAKKLDLVYQIEPQVPMAILGDLTRV
                     RQVLVNILANAVKFTTSGSIQVRVSATVANQQQNKYTIQFSIKDTGIGISPDQQSALF
                     KSFSQVNTSIARKYGGTGLGLAICKRLTEMMGGQIWVESYGEIAGNPPVDWAKTSKNN
                     PLESTGATFYFTITAQSTTIVRRPNDLSCQLSLAGKRLLIVDDNQLSCEGLKQLVTAW
                     GLQAQATTSGWEAFSWLRQGECFDLAIIDLQMEEVDGLQLAEALRTLPTGESLPLVIL
                     TPSPTSLAELSARTDISIAACLSSPIKKSLVYEVLCEVFKADETDNSLFNGDWRSGIT
                     EAVKRTCSPQEREARIKTLSPLRILLVEDNNINQRVALLMLEKLGYRPDIAGNGLEAL
                     QVLHQASYDVILMDVEMPEMDGLSATKAIRQDFPADEQPWIIAVTAYAMQGDRETCLA
                     AGMNDYITKPIRENDLLDALQRIDFSVLSLTKNKPAPLSEPVVNVGLVNPVPEVLKAD
                     QLEENLVLDLSILTGIREMAGPDGATFLQVIIGDYLHTTPSLLEKLKTAIAAQEIDTV
                     RATAHSLGSSSANLGAVEFAKQCKQLENLARSGMLSGVDGQYIQLEKEYEKVSQALAL
                     QLNPN"
     gene            complement(64868..65245)
                     /locus_tag="SGL_RS00280"
                     /old_locus_tag="sll5061"
     CDS             complement(64868..65245)
                     /locus_tag="SGL_RS00280"
                     /old_locus_tag="sll5061"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153598.1"
                     /note="sll5061; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_011153598.1"
                     /db_xref="GI:499466958"
                     /translation="MITLTSPGDSTELPLIATDHLGIVIRINTAFEETYGWSAADLVG
                     QPLTLILPSYFQDSHHLGFARFNTTSISTILNHPLQLKVVTKDQQEVDSEHFIIVEKQ
                     GEQWIFAATLRPLITEENEERTI"
     gene            complement(65331..65786)
                     /locus_tag="SGL_RS00285"
                     /old_locus_tag="sll5062"
     CDS             complement(65331..65786)
                     /locus_tag="SGL_RS00285"
                     /old_locus_tag="sll5062"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153599.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153599.1"
                     /db_xref="GI:499466959"
                     /translation="MGSFGLLFSDEPTCLHTIQEYGLRFDIEEAFLDDQSNGWNLQKS
                     EIRFVCALSRLFFLLALATLYATAQGVEVFATGKHRWVAPHWFRGNSYFRIGWDWLKT
                     SLEQGWTLIRHVRFTHALDPQPAMASRKLHHQRIYSIEFKINIYCYPVD"
     gene            complement(65758..66411)
                     /locus_tag="SGL_RS00290"
                     /old_locus_tag="sll5063"
     CDS             complement(65758..66411)
                     /locus_tag="SGL_RS00290"
                     /old_locus_tag="sll5063"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153600.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153600.1"
                     /db_xref="GI:499466960"
                     /translation="MIALLQRGEVSLTLWLPYIPCRGVQAQSKQRRLSRWLHNSRLNV
                     HRLYKSLIQAALADWQEEILYLSLDTSLFWDEYCLVRLAVVYRGRALPVVWRVLKHRS
                     ASIAFRQYWEMLYQAANRLSQGVKVVLLADRGFIHTDAMTAVTTHLGWHYRIRLKRNT
                     WIWRAGHGWCQFKDIHLQRGEAFCWHNVRLHKGDYYGPVHVAFGCNNVNGEFWAIVQ"
     gene            complement(67163..67378)
                     /locus_tag="SGL_RS00295"
                     /old_locus_tag="ssl5065"
     CDS             complement(67163..67378)
                     /locus_tag="SGL_RS00295"
                     /old_locus_tag="ssl5065"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153602.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153602.1"
                     /db_xref="GI:499466962"
                     /translation="MGRLSKVFDTAKAESVPEPEITKARSNEFVNLNFKVTPEMRRKL
                     KQYAAKHDLSLKEVFEAALDFYIEHHP"
     gene            complement(67362..67976)
                     /locus_tag="SGL_RS00300"
                     /old_locus_tag="sll5066"
     CDS             complement(67362..67976)
                     /locus_tag="SGL_RS00300"
                     /old_locus_tag="sll5066"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153603.1"
                     /note="sll5066; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153603.1"
                     /db_xref="GI:499466963"
                     /translation="MKIIAVTGYKGGVGKTITSIHIARYLADKGKVLLIDSDPNRSVE
                     KWAARGEKQPLFKVKNEKSAPAHIAGNDFLVLDTPARPDSNELKEISQEAHLTILPCV
                     PDAISLDPMLQMFHDLFPGAVYRVLITIAPPYPSKSADELRSVLAENQIEVFKGFIRR
                     SASVVKAIDMGVTTAEMKGRDHYPWQDYKTIGKEIMEVINGTAQ"
     gene            complement(68050..68574)
                     /locus_tag="SGL_RS00305"
                     /old_locus_tag="sll5067"
     CDS             complement(68050..68574)
                     /locus_tag="SGL_RS00305"
                     /old_locus_tag="sll5067"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153604.1"
                     /note="sll5067; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153604.1"
                     /db_xref="GI:499466964"
                     /translation="MLKTAYIVCGSPGAGKTFYGKELAKLKQAIFLDIDTATERLVRL
                     ALQLSGQDPNDRDSLYFKSNFRNPIYEQLFDIAQDNLLWNDVVITGPFTKEIKDPDWA
                     NKLSTRLGVPVQVHYVFCPPSIRQARIRDRNNPRDLAKLASWEDYLLYYEAELPPACE
                     HILVDNTLNKEIKK"
     repeat_region   68882..69002
     gene            complement(68904..69332)
                     /locus_tag="SGL_RS00310"
     CDS             complement(68904..69332)
                     /locus_tag="SGL_RS00310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153852.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041428261.1"
                     /db_xref="GI:752788405"
                     /translation="MEPLNTSTYLPDVGDSPWPQNKPEEKYKQLSLLKSTPTVTPSFS
                     ITGPRVKIKLRWPLPEVRPRRSRGQGSGYIRLHYCEKQTRSGKKSYEQYYYHYELEVK
                     GKRVKRSAYIPKDKLDVVEEWDRKKVDVVLILQYLGKATD"
     repeat_region   69043..69395
     gene            complement(69335..70810)
                     /locus_tag="SGL_RS00315"
                     /old_locus_tag="sll5069"
     CDS             complement(69335..70810)
                     /locus_tag="SGL_RS00315"
                     /old_locus_tag="sll5069"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153606.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153606.1"
                     /db_xref="GI:499466966"
                     /translation="MTQFYKLTTETIHEVIAADLPKSAHKLWLWVCELDPFGDRQVQI
                     TWERAKEVLGIGKTTFYRALNQLVDAGLLFSHRIVGFCVSSKNGTQDPNLEIESQNCN
                     PQFQKWDSSLYTDLQTFPYSPDSQSEEKEKIPDRSINTNGRSGIKPKIPEKLATAEIS
                     QNSSAIATSQGEEKYSAAGRTKKRTKKNQSFDWLPDGPWSIEGKLDPNFRDWLARNWQ
                     KRYGGDFHDKQADVLAHFRKDPANLPIRWEQYQKEFIHRVENTQMRLANGCQIPEDQQ
                     QNLITHQRAVTAVLPPEINPVAVVATQSPVLVPGVEEVTRGLEGVEPVADLSSNKNLE
                     EAELAPTETCSLVTDCESSPWESESPTEEPEAVANLSPSKNSETESTPTDNCPEYTIL
                     PDGTRLKVFKRQPEPEPVAPEQAQAFRQMMQGLFKSFGGKREVCPKPQSELERLNQWL
                     YDPALREEAIHYARRARSVPSASPNYKYCSETDQIIHCEEF"
     repeat_region   69417..69664
     gene            71474..71818
                     /locus_tag="SGL_RS00320"
                     /old_locus_tag="slr5071"
     CDS             71474..71818
                     /locus_tag="SGL_RS00320"
                     /old_locus_tag="slr5071"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153608.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153608.1"
                     /db_xref="GI:499466968"
                     /translation="MDDRDLVKIFKVKLSEQGIRQTEVCQEAGKPQSHLSKLLCGGKS
                     PNLQTLLDFINATDRLYPGFADQYWLAVAGRPTIRTLVDSMDSTELAVLLKVVGDRVA
                     EAKLKAPMMEVA"
     gene            71951..72238
                     /locus_tag="SGL_RS00325"
     CDS             71951..72238
                     /locus_tag="SGL_RS00325"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041428263.1"
                     /db_xref="GI:752788407"
                     /translation="MFFLLLPLFHLEGLGFVFPPQVAAQAKLGATSSQGHGLRIGAWI
                     AVAIAINLFRAGGLAGNAPVFPVDCEGAGEGEAIANLLGVNDQAFPTSKAT"
     gene            72425..73159
                     /locus_tag="SGL_RS00330"
                     /old_locus_tag="slr5073"
     CDS             72425..73159
                     /locus_tag="SGL_RS00330"
                     /old_locus_tag="slr5073"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153610.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153610.1"
                     /db_xref="GI:499466970"
                     /translation="MIVERCYFPLPKYFFCDGPSYVITSSSFGGSLLTPETLPELLQN
                     GDEKVINQLLEEGICLPLFFPGDCALDGAIFIVGDLTPIEEQEWIGRIQSKLKIPCGK
                     LLVVCGGGSPEDFEGVIAGNGINDYTDYFCVLDVPKGDYLVEVLAYVSSMSVDFYFEE
                     NEPLTEWFYRTRPGEILPQWLETFQSKGYIGELSDQLLTYIVHLTPLIDEPSLLTLIS
                     EIGWCGEFEFRRPEICPRGIPRSYYA"
     gene            73270..73485
                     /locus_tag="SGL_RS00335"
                     /old_locus_tag="ssr5074"
     CDS             73270..73485
                     /locus_tag="SGL_RS00335"
                     /old_locus_tag="ssr5074"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153611.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153611.1"
                     /db_xref="GI:499466971"
                     /translation="MFKFIGIVLIGGLAGYALGVAAGIFIVNNFSTNVQDKPLELAMT
                     SIFFFGPMGALIGLIIAVVYQLLRRYL"
     repeat_region   73513..73641
     gene            complement(73728..74147)
                     /locus_tag="SGL_RS00340"
                     /old_locus_tag="sll5075"
     CDS             complement(73728..74147)
                     /locus_tag="SGL_RS00340"
                     /old_locus_tag="sll5075"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153612.1"
                     /note="sll5075; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153612.1"
                     /db_xref="GI:499466972"
                     /translation="MKEDFGFTHIALFAKNIDLSISFYNRYANMSIVHERLDKDTGKR
                     VVWLSDKIRPFVLVLVQDENPTPILGPFAHLGIGCKDKSEVDYLCEQARQEGILAKDA
                     TDSGYPVGYWAFINDPDGHTLEVSYGQEIGLTIDKPA"
     gene            complement(74510..75055)
                     /locus_tag="SGL_RS00345"
                     /old_locus_tag="sll5076"
     CDS             complement(74510..75055)
                     /locus_tag="SGL_RS00345"
                     /old_locus_tag="sll5076"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153613.1"
                     /note="sll5076; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deaminase reductase"
                     /protein_id="WP_011153613.1"
                     /db_xref="GI:499466973"
                     /translation="MKATVYIATSVDGFIARNNGGIDWLPSAGDTDSSEDYGYQEFID
                     SVDALVMGRNTYELALSFDSWPYGEKPVFVLSSRKVDIPEDITKIVESMSVPPREVVC
                     RLSKRGFQHLYIDGGKTIQGFLSEGLIQQLIITKVPILIGEGIPLFSALPHDVRLHHL
                     ETRQFENGLVQSKYKVIEDIA"
     gene            75147..75929
                     /locus_tag="SGL_RS00350"
                     /old_locus_tag="slr5077"
     CDS             75147..75929
                     /locus_tag="SGL_RS00350"
                     /old_locus_tag="slr5077"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010872295.1"
                     /note="slr5077; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153614.1"
                     /db_xref="GI:499466974"
                     /translation="MFDNLCKFLAESFSEDYAAWLLGRPIKLTKLSPTELSLEPIRAD
                     SLILEQSEDLVLHLEFQTEPDPTMGFRMLDYRVRVYRRFPQKTMHQFVIYLKRSNNDL
                     VYQDSFQLGETVHRYQAIRLWEQPSETFLQSPGLLPLAVLTQTSDPTLKLREVATALE
                     QIEDNRVKANLMAATSVFGGILLSPEIIKTILRSEIMKESAVYQEILEEGEQRGILKG
                     KLEGKLETIPLLKKLGLTIAEIAKELDIDVELVNRFVANQNN"
     gene            76050..76988
                     /locus_tag="SGL_RS00355"
                     /old_locus_tag="slr5078"
     CDS             76050..76988
                     /locus_tag="SGL_RS00355"
                     /old_locus_tag="slr5078"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153615.1"
                     /note="slr5078; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153615.1"
                     /db_xref="GI:499466975"
                     /translation="MKFSFPWHWGKSHKLKPVTHPIRHLRPIQSGDSRQKKIQPMVTD
                     LYHWLLVLSWPKFLATIGIFYFSLNVFFALIFSLTGDSIANAKPGSFLDLFFFSIQTL
                     STVGYGAMYPKTVAAQIVVSVEIFVGLISLAILTGLMFSRFAKPTSRVLFSEVAVVCP
                     FEEIPTLMFRAANQRNNRILEAQIRVSLVQDEQTKEGHKMRRFYDLNLLRSHTPVFGL
                     SWLIMHPIDSNSPLYGFSEVSNQQQRLELWISFTGLDESFSQTIHSRYAYEGADIRWQ
                     YRFVDIFHQTPEGKWFINMDNFHQIEPYHPKSPENS"
     gene            complement(77192..77941)
                     /locus_tag="SGL_RS00360"
                     /old_locus_tag="sll5079"
     CDS             complement(77192..77941)
                     /locus_tag="SGL_RS00360"
                     /old_locus_tag="sll5079"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153616.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_041428273.1"
                     /db_xref="GI:752788417"
                     /translation="MKKLDGKVAVVTGASKGIGAEIAKHLAGEGAAVVVNYASSKEGA
                     DRVVDEIVSTGGKAIAVQANVAKKAEIQQLFAETKQAFGKLDILVNNAGIYEFSPLEG
                     ITEEHFYKQFDLNVLGLLLTSQQAVKSFGEEGGSIINISSIVSTLTPANSLVYNATKA
                     AVDAITKSLAKELGSRNIRVNSINPGMVETEGARTAGITESEGRRQVEAITPLGRIGQ
                     PHDIAPAVVFLASSDSAWITGETLYITGGLY"
     gene            complement(78057..78881)
                     /locus_tag="SGL_RS00365"
                     /old_locus_tag="sll5080"
     CDS             complement(78057..78881)
                     /locus_tag="SGL_RS00365"
                     /old_locus_tag="sll5080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153617.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chloroperoxidase"
                     /protein_id="WP_011153617.1"
                     /db_xref="GI:499466977"
                     /translation="MSTITTKDGTEIYYKDWGSGQPITFSHGWPLSADAWESQMFFLA
                     SHGYRCIAHDRRGHGRSSQPWNGNDMDTYADDLAELFEALDLKDVVMIGHSTGGGEVA
                     RFIGRHGTQRVSKAVLMGAVPPLMLKTEANPGGLPIEVFDGFRAAFLADRSQFFLDIA
                     SGPFFGFNRPGAKVSQGLIYSWWMQGMMAGHKNAYDCIKAFSETDFTEDLKKFDVPTL
                     IIHGDDDQIVPIGASALLSAKLVKNSILKIYPGGSHSLGDTSKEQLNADLLEFVES"
     repeat_region   79303..79431
     gene            complement(79505..80293)
                     /locus_tag="SGL_RS00370"
                     /old_locus_tag="sll5081"
     CDS             complement(79505..80293)
                     /locus_tag="SGL_RS00370"
                     /old_locus_tag="sll5081"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153618.1"
                     /note="sll5081; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153618.1"
                     /db_xref="GI:499466978"
                     /translation="MNEKFFKLGKNCLRLVTSEIESASFLGGKPLVSSSINWPRKNDK
                     PLGFIAQLDLSEINNEQAIEWLPNSGRLLFFYDFYEWPWGFAPEDRGGWAILYENGSE
                     ELHFQELPSDLHKEHIASSIKYVVSEKFMSYPDGQRINFEEGELSEIDKEQYYDFIDE
                     YYRNKTLHQIGGYPRPIQNDDMEKECQLISSGINYAYPEDYNSEEAKQLREQVNDWRL
                     VFQFDSDDDIDVMWGDMGMLYFWVKESESKNCNFSNSWMILQCC"
     gene            80783..81613
                     /locus_tag="SGL_RS00375"
                     /old_locus_tag="slr5082"
     CDS             80783..81613
                     /locus_tag="SGL_RS00375"
                     /old_locus_tag="slr5082"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153661.1"
                     /note="slr5082; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153619.1"
                     /db_xref="GI:499466979"
                     /translation="MFDNLCKFLAESFSEDYAAWLLGRPIKLTKLSPTELSLEPIRAD
                     SLILEQSEDLVLHLEFQTEPDPTMGFRMLDYRVRVYRRFPQKTMHQFVIYLKRSNNDL
                     VYQDSFQVGETVHRYQAIRLWEQPSETFLQSPGLLPLAVLTQTSDPTLKLREVATALE
                     QIEDNRVKANLMAATSVFGGILLAPELIKTILRSEIMKESAVYQEILEEGKIAGKLEG
                     RLEGKLEGKLEGKLEGRLEAKLETIPLLKKLGLTIAEIAKELDIDVELVNRFVANQNN
                     "
     repeat_region   81467..81612
     gene            complement(81723..81941)
                     /locus_tag="SGL_RS00380"
     CDS             complement(81723..81941)
                     /locus_tag="SGL_RS00380"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_048908398.1"
                     /db_xref="GI:890838998"
                     /translation="MLNTKGTTLNLACGELYSGCPLCAAWNLSVKAIAKSYCWLPMGG
                     KVRPAKARLSVGFKFDGTVDYHRALRML"
     gene            complement(82309..84186)
                     /locus_tag="SGL_RS00385"
                     /old_locus_tag="sll5083"
     CDS             complement(82309..84186)
                     /locus_tag="SGL_RS00385"
                     /old_locus_tag="sll5083"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153620.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153620.1"
                     /db_xref="GI:499466980"
                     /translation="MIFPFDININLSDSGITGIQNKTITINGGVTTFLGPNGSGKTQL
                     LRGLKLSLRSYANGKKIRYISAGRLGPMEAYRSDYDGQRGRQIRFDQATFGDKSSTTR
                     RHKNETILGDFGTLSERPDILIKVQERLRKLFKRDLMLDWDGGNLKVFFSRVDQETSS
                     NYSSAREASGLLHLVAILAALYDDEVGCLLIDEPEVSLHPQLQSFVMDEILKVAGPNN
                     EAGKKLVFISTHSTEFIEVNSVEQLSTIVFCKDILEEAVQIDPSIGEFRSRKLQALLT
                     RLGQEHKLALFCHSPLLVEGPSDEIICSAINRKLNINLEAAGSQVLPVTGKGQFPVVI
                     KLLRLIGKSPALLADADALTDNLDIIGVFTSLDKANIFANELGHRDAPALAGTIYNDF
                     CKLVADQWSNIQAQAELHYYWINRDIDKDELIAKRRSAFCWMFSNDETSILNIDNGAN
                     WVSIKHRLSTLLDLLEKLGCFILKKGTVEGYYQHVSNLTNDEKPNAASYEVNGLMEAN
                     IEAVTTAYDDILSALKYCSQAKDINEAEAIRDLLLAVITPALASIKKETSDAELRLHS
                     NNLFGAKSSLFKLSKEQDGNDIYLLVELASNILEVEGFPLRIKKGSNPIDMVNKALKL
                     K"
     gene            complement(84439..85155)
                     /locus_tag="SGL_RS00390"
                     /old_locus_tag="sll5084"
     CDS             complement(84439..85155)
                     /locus_tag="SGL_RS00390"
                     /old_locus_tag="sll5084"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153621.1"
                     /note="sll5084; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153621.1"
                     /db_xref="GI:499466981"
                     /translation="MSLSGAILYVPLFLSMLFLLAIYGITFCFIFCINYSFDVYNCQI
                     LFSNSMDKNIWLILSLCTTMITACSQKQMQEMASNTMVTQNRTPDKTWRVKPGSVHDG
                     DTFRAVADVTNEEIKVRLACIDAPELEQAGGVEARDYLRSMLTDNREIILMGAGKDQY
                     GRSVVEVFAITDTPGLEVGVNGEMVLAGMAHYYERYKRSCPENAEQYEFLEQEAISSK
                     AGVWANGDAERPWNWRGRNK"
     gene            85149..85469
                     /locus_tag="SGL_RS00395"
                     /old_locus_tag="slr5085"
     CDS             85149..85469
                     /locus_tag="SGL_RS00395"
                     /old_locus_tag="slr5085"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153622.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153622.1"
                     /db_xref="GI:499466982"
                     /translation="MTLPAIMKYKILSSLALVTLGITALAPGAFANPTVGRETRTGDI
                     YVSGLGSYQSIKGEYSSLPRSTNKNANECGVIKLSGSSASLPINGRSYSVGPNSVHCP
                     LPQN"
     gene            complement(85552..86997)
                     /locus_tag="SGL_RS00400"
                     /old_locus_tag="sll5086"
     CDS             complement(85552..86997)
                     /locus_tag="SGL_RS00400"
                     /old_locus_tag="sll5086"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153623.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_041428264.1"
                     /db_xref="GI:752788408"
                     /translation="MKPKFMTTSPNQTLYQTVADQIHGLISEGTFQPGDRLPSVRKLH
                     QQWSVSISTVLEAYRLLEDRGLIEARPQSGYFVKTILNFLPDEPSPSTPQSADNPVDT
                     SLAFRVNNSMLKPGIIGLGAAIAGSNLLPIATLNRLMGQVIRAKPEVTHRYSSPQGCE
                     ELRHEVARRLIDTGCSITPDQIVITNGTTEALYLSLKAVTKPGDTVVIESPTYHLLLE
                     TLEALHLRILELPTHPQHGISLIHLEDALKNDQISACVLIANFSNPLGSCMSDSKKKQ
                     LIGLINHYNVPLIEDDIYGDLNFTGNRPKSIKSFDTQGLVLYCSSISKTLSPGLRIGW
                     AVPGRYQTKVEQLKMTTNYMTAVAPQLTIAAFLANGGYDRHLRKLRRTYQAQMMDMTQ
                     AICNYFPKMTRVSRPKGGYILWIEMPEIVDTLQLYEDALRHNIAIAPGSMFSSSGGYR
                     NCFRLNFGLPFTEEIQQAMIVLGQLLHEQTK"
     gene            87601..88020
                     /locus_tag="SGL_RS00405"
                     /old_locus_tag="slr5087"
     CDS             87601..88020
                     /locus_tag="SGL_RS00405"
                     /old_locus_tag="slr5087"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153624.1"
                     /note="slr5087; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153624.1"
                     /db_xref="GI:499466984"
                     /translation="MPVPAEYQRASDNFYEYLVDTRNIAGLWSTHVAYTMTQGVFQVF
                     RRRLSTENAIAFANVLPVCLRALFVTDWNIHESKKPFGDYAEMIQEVKLLREEHNFSP
                     DTAIRDVAIALRKHINEKAFQKVLSTFPKEAADFWNV"
     gene            88114..88830
                     /locus_tag="SGL_RS00410"
                     /old_locus_tag="slr5088"
     CDS             88114..88830
                     /locus_tag="SGL_RS00410"
                     /old_locus_tag="slr5088"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153625.1"
                     /note="slr5088; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="WP_011153625.1"
                     /db_xref="GI:499466985"
                     /translation="MKLMVIGASKGLGKAFVEGLCSDGDMVIGVSRSQPQDLRLPESI
                     LLDWIEADLEKPLQAIQILKKYTPNELDVLIYNLGIWEKTAFSEEYSFLDDEDKSLID
                     MVNVNITSAILVLKHLIPRLLKSSQPRLILTGSTSGLRQSGRPEVTFGASKFALSGIA
                     DALRESFRSEGLGVTCLQLGYLNTEDSLQVPVAEAAQRGNGELIPLHDVINLVKAIIN
                     MSKASYVRELVLPAIQDERF"
     gene            complement(88902..89669)
                     /locus_tag="SGL_RS00415"
                     /old_locus_tag="sll5089"
     CDS             complement(88902..89669)
                     /locus_tag="SGL_RS00415"
                     /old_locus_tag="sll5089"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153626.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153626.1"
                     /db_xref="GI:499466986"
                     /translation="MAQPAVEACYRQPELEGLLHSLYSARSVLVTSGEGMGKTYLVRQ
                     VWERLLSDGVTCQYFEPATPKTLLMAIASLLPDIDISTSPAGRILPFISRPLEQRFSH
                     RSATHSLLASLTLAVVSYGLWFLAPVIPLVIIHAINIGYFAGWFLDCFTKSGVEMFYP
                     LGVRCVCPGNRNLRISTGSAAEYWLMVFVVAIAKRDKQRLEIAKVSYPFGEGDSERYL
                     AQLSSYDRQKAATFREWSRLRNQVVQVKLLVLGTGED"
     repeat_region   89458..89645
     repeat_region   89699..90795
     gene            complement(89699..90253)
                     /locus_tag="SGL_RS00420"
                     /old_locus_tag="sll5090"
     CDS             complement(89699..90253)
                     /locus_tag="SGL_RS00420"
                     /old_locus_tag="sll5090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153882.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153627.1"
                     /db_xref="GI:499466987"
                     /translation="MSIAGKSKGDVVQQLEKSYGVARTTVFNRLKYLGYSLDKVDDLF
                     SLSNEQMAELDNLHRWISDGGKMADYPKPGQLTMITDEGELEQYGEVINFDALEGDEE
                     LGHAELIRAAQNQAAGILIAQNLLTAEILKNPQHLPADLQAQVEQSKVAIAPKPQNPL
                     VIASQWITKAKAYQSNQNHGQLAA"
     gene            complement(90353..90601)
                     /locus_tag="SGL_RS00425"
                     /old_locus_tag="ssl5091"
     CDS             complement(90353..90601)
                     /locus_tag="SGL_RS00425"
                     /old_locus_tag="ssl5091"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153628.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153628.1"
                     /db_xref="GI:499466988"
                     /translation="MDFNPNEWPTHKQGEVVRQLILDALDSPKTKEELSSLCNKSVRQ
                     ITRHLQRLSSENKILSTGKGQFVRRIAAGFLLLYVGQI"
     gene            90973..91218
                     /locus_tag="SGL_RS00430"
                     /old_locus_tag="ssr5092"
     CDS             90973..91218
                     /locus_tag="SGL_RS00430"
                     /old_locus_tag="ssr5092"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153629.1"
                     /note="ssr5092; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153629.1"
                     /db_xref="GI:499466989"
                     /translation="MINQAIQLAQLFGNLLTMADYSMACALLSPERQRQYPPMEPNDV
                     VWLYVSLEGEDFVEAVSVIIEDREGKLAIRWLEWGRP"
     gene            91316..92692
                     /locus_tag="SGL_RS00435"
                     /old_locus_tag="slr5093"
     CDS             91316..92692
                     /locus_tag="SGL_RS00435"
                     /old_locus_tag="slr5093"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153630.1"
                     /note="slr5093; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amine oxidase"
                     /protein_id="WP_011153630.1"
                     /db_xref="GI:499466990"
                     /translation="MIRRRSFFKLSQLMFVSYLLSTSCGKNNTPVTANDAPSILIIGA
                     GLAGLAAAQSLMKQGYTVRVLEARDRLGGRTWTSNYWDDAPLDMGASWIQGTEGNPIT
                     ELAEKIATPLVMTSYDNAITYEVGGQPFTAKEDRIIEQLEKKWQGAIATAQNGDGDQS
                     LQAVIENVFDLENQPLETKQIIDWYMNSTIEHEYAGSLKDTSIYWFDGDGGFGGDDAI
                     FVEGYQAIVNYLAKDISIELNQIVESIDYSEEIPKIITNQGAYTADQVIITLPLGVLK
                     SGQVKFIPELPSPKRKAIKALGMGILNKCYLRFPKVFWPKKVDWIEQVPTERGLWSEW
                     VNIFRVNQLPILLGFNAADEGKEIETWTDEEIIKSAMKTLRHLFGDDIPDPTDYQITR
                     WQSDSFSRGSYSFNALGSHPDMRDHLAKSLNDQIFFAGEATERDYFATAHGAYLSGLR
                     VAEEINNL"
     gene            complement(92805..93236)
                     /locus_tag="SGL_RS00440"
                     /old_locus_tag="sll5094"
     CDS             complement(92805..93236)
                     /locus_tag="SGL_RS00440"
                     /old_locus_tag="sll5094"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153631.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid stabilization protein"
                     /protein_id="WP_011153631.1"
                     /db_xref="GI:499466991"
                     /translation="MKGWLLDTNVISELRKKNCHPAVKAWADRQSPTSFYLSTITMAE
                     IRFGIEKAEDEAFRQELNQWLDQVLRPWFGDRLLGVDEDVILQWRWLVEKGRKQNYTF
                     SQPDLFIAAIAVVHDLCVVTRNVGDFEKSGVPVFNPFLFAQ"
     gene            complement(93233..93520)
                     /locus_tag="SGL_RS00445"
                     /old_locus_tag="ssl5095"
     CDS             complement(93233..93520)
                     /locus_tag="SGL_RS00445"
                     /old_locus_tag="ssl5095"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153632.1"
                     /note="ssl5095; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153632.1"
                     /db_xref="GI:499466992"
                     /translation="MTNSATQGLDALQTWKLEDAKARFSELVRLAQGENPQLVTVRGK
                     DAVVVLAADQFAKLLPLMAQPNIHEFLSQSPLNRLDFEHSSVQSPVRELEL"
     gene            complement(93656..93865)
                     /locus_tag="SGL_RS00450"
                     /old_locus_tag="ssl5096"
     CDS             complement(93656..93865)
                     /locus_tag="SGL_RS00450"
                     /old_locus_tag="ssl5096"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153633.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153633.1"
                     /db_xref="GI:499466993"
                     /translation="MMTNFIDLAFPIKGTVLNADHNYFLYSAIAKRLNESRVKTSRGG
                     RWYAKTVSNIINREHEFLSKNGGFL"
     gene            complement(93862..94866)
                     /locus_tag="SGL_RS00455"
                     /old_locus_tag="sll5097"
     CDS             complement(93862..94866)
                     /locus_tag="SGL_RS00455"
                     /old_locus_tag="sll5097"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153634.1"
                     /note="sll5097; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_011153634.1"
                     /db_xref="GI:499466994"
                     /translation="MTAQNVLSPRQLERLLAIDEYIRSPIRYTAKVIAEKLSVAERTI
                     RLDFAFLRDRFNAPIQFNQSKGYYYSDNTWRLPTIPLTQGELFALTLGAKALEAYSGT
                     AYEAELKSSIKQLATRLPEKVWVNLEKLVDEKINFRPGAELLNLDPDIYQILHEAWKS
                     SRQLWIRYYTAGRNEESERIVDPYYLDIYRGSNPYLVAFCHNRQAFREFRLDRIREYR
                     ILDEYFEPNPNFDWKKYSKNAFQIEKGNCLHEVVIDFTCKVAPYIREWKWHHSQVIDE
                     HHDGSLTLHLEVGGLQEVKRWVLGYGKDALVKSPPELVKLLQEETEVIARQNETGDFE
                     "
     gene            complement(94925..95137)
                     /locus_tag="SGL_RS00460"
                     /old_locus_tag="ssl5098"
     CDS             complement(94925..95137)
                     /locus_tag="SGL_RS00460"
                     /old_locus_tag="ssl5098"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153635.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153635.1"
                     /db_xref="GI:499466995"
                     /translation="MKSRRLSIRVPDPLLSQLQSYLDHQGLTVTEGVLAPIASYVGDN
                     DKLPLVERVSRIEKRLAALENNIFIR"
     gene            complement(95697..95903)
                     /locus_tag="SGL_RS00465"
                     /old_locus_tag="ssl5100"
     CDS             complement(95697..95903)
                     /locus_tag="SGL_RS00465"
                     /old_locus_tag="ssl5100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153637.1"
                     /note="ssl5100; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153637.1"
                     /db_xref="GI:499466997"
                     /translation="MQSFNRRSPLDKHRELEEAATHNWILSTTEIKKLLGVKPKGETF
                     TRGCWIFRRSGKIGNQSAWIVEKI"
     gene            96124..96561
                     /locus_tag="SGL_RS00470"
                     /old_locus_tag="slr5101"
     CDS             96124..96561
                     /locus_tag="SGL_RS00470"
                     /old_locus_tag="slr5101"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153638.1"
                     /note="slr5101; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153638.1"
                     /db_xref="GI:499466998"
                     /translation="MRRRRPTRRRVSSRIVTQSIADQIANSQQQVFMRQDFEDLGNYE
                     QVGRSLRSLIQQNQLIRIGQGLYAKAQISPLSGKPVPRLGIKELAKEALQRLEVETFP
                     SSYEKQYNDGKTTQVPTGRVIGVKGRVQRRIGYNGKYVKFEHV"
     gene            96554..97156
                     /locus_tag="SGL_RS00475"
                     /old_locus_tag="slr5102"
     CDS             96554..97156
                     /locus_tag="SGL_RS00475"
                     /old_locus_tag="slr5102"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153639.1"
                     /note="slr5102; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153639.1"
                     /db_xref="GI:499466999"
                     /translation="MSSTLAITEIIQAIAAEFVVDECFIEKDWYAMRIIGVLSQIQDP
                     TFQLVFSGGTSLSKGFGLIQRFSEDLDFKVKIINNHPPSKNRQQKQRKAFRDKILENL
                     EQYQTDWQVDLNALQKGNESKFFKVPIRYQPLFQVSNSLRPHVQLEVTFESPALEPEL
                     KDLQSFVGKALKQQPEAINFPCVNPIETAADKLSALVWRI"
     gene            97277..97492
                     /locus_tag="SGL_RS00480"
     CDS             97277..97492
                     /locus_tag="SGL_RS00480"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014995488.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041428265.1"
                     /db_xref="GI:752788409"
                     /translation="MSNDKHRGDKETAITEPLEAIDFLVQIFEIDGEYSKEYKQFVEG
                     MSYAEDSQRLGFSHALQVLINLRLLFE"
     gene            complement(97790..98212)
                     /locus_tag="SGL_RS00485"
                     /old_locus_tag="sll5104"
     CDS             complement(97790..98212)
                     /locus_tag="SGL_RS00485"
                     /old_locus_tag="sll5104"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153856.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arsenate reductase ArsI2"
                     /protein_id="WP_011153856.1"
                     /db_xref="GI:499467216"
                     /translation="MIVIYHNPDCGTSRNVLQLIEAAGYLPQVIEYVKEGWTKPQLLG
                     LFAAADLTPRSALRTTKSPAAELNLLEETVTDAQILDAMVEYPILVNRPIVCTPKGVR
                     LCRPSEVVLDLLDHWPSGPFAKEDGELIIDERGNRVYT"
     gene            98614..99219
                     /locus_tag="SGL_RS00490"
                     /old_locus_tag="slr5105"
     CDS             98614..99219
                     /locus_tag="SGL_RS00490"
                     /old_locus_tag="slr5105"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153642.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning protein ParA"
                     /protein_id="WP_011153642.1"
                     /db_xref="GI:499467002"
                     /translation="MIITVASFKGGVGKTTTAVHLSAYLALQGETLLIDGDPNRSATG
                     WGKRGSLPFKVVDERQAAKYAPKYQNIVIDTQARPEDEDLEALADGCDLLVIPSTPDA
                     LALDALILTIETLQKLGNNRFRILLTIIPPYPSKDGDEARQLLTTAGLPLFKRGIKRY
                     SAFQKASLNGVVVSEVSDSKAGIAWSDYKATGKEIVEEILI"
     gene            99216..99449
                     /locus_tag="SGL_RS00495"
                     /old_locus_tag="ssr5106"
     CDS             99216..99449
                     /locus_tag="SGL_RS00495"
                     /old_locus_tag="ssr5106"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153643.1"
                     /note="ssr5106; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153643.1"
                     /db_xref="GI:499467003"
                     /translation="MSKFKGILDSHKQTAPAESQRKTKTRGKRSDPDYEQVSAYIRKE
                     TYRNVKIALLQEEEKRDFSDLVETLLSEWLNNQ"
     gene            complement(99565..99981)
                     /locus_tag="SGL_RS00500"
                     /old_locus_tag="sll5107"
     CDS             complement(99565..99981)
                     /locus_tag="SGL_RS00500"
                     /old_locus_tag="sll5107"
                     /EC_number="3.5.4.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153853.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytidine deaminase"
                     /protein_id="WP_011153644.1"
                     /db_xref="GI:499467004"
                     /translation="MVDICWEQLHRSAIEVRQNAYAPYSHFLVGAAGLVDDGRIVVGC
                     NIENASYGLTLCAECGLVSHLIATGGGRLLAVVCVDSQDNYLAPCGRCRQVLLEHGGK
                     ELQVMTPTGPLPMAELLPWSFGPQDLRRVGGLNTNP"
     repeat_region   100342..100462
     gene            complement(100364..100795)
                     /locus_tag="SGL_RS00505"
     CDS             complement(100364..100795)
                     /locus_tag="SGL_RS00505"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153852.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041428266.1"
                     /db_xref="GI:752788410"
                     /translation="MESLNTSTYLPDVGDSPWPQNKPEEKYKQLSLLKSTPTVTPSSS
                     ITGPRVKIKLRWPLPEVRPRRSRGQGSGYIRLHYCEKQTRSGKKSYEQYYYHYELWEN
                     GIRQHKGSKYIPKDKLDVVEEWDRKKVDVVLILQYLGKATD"
     repeat_region   100506..101106
     gene            complement(100798..102288)
                     /locus_tag="SGL_RS00510"
                     /old_locus_tag="sll5109"
     CDS             complement(100798..102288)
                     /locus_tag="SGL_RS00510"
                     /old_locus_tag="sll5109"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153646.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153646.1"
                     /db_xref="GI:499467006"
                     /translation="MTQFYKLTSQTIDQLIAADLPKSAHKLWLWICRLDPFGNRQVQI
                     TWERAKEVLGIGKTTFYRALNQLVDAGLLFSHRIVGFCVSSKNGTQDPNLEIESQNCN
                     PQFQKWDSSLYTDLQTFPYSSDDQSEGKEKIPDRSINTNGQGNGIKPKIPEKPATAEI
                     SQNSSVIATSQGEEKYSAAGRTKKRTKKNQSFDWLPDGPWSIEGKLDPNFRDWLAKNW
                     QKRYGGDFHDKQADVLAHFRKDPANLPIRWEQYQKEFIHRVENTQMRLANGCQIPEDQ
                     QQNLITHQRAVTTVLPPEINPVAVVATQSPVLLPGVEEVTRGLEGVEPVADLSASKNL
                     EEAELATTETCSLVTECEPSPWESESPTEELEAVTRGLESVEPVANLSPNKNLEGAEL
                     AATDNCPEYTTLPDGTRLKVFKRQPEPEPVAPEQAQAFRQMMQGLFKGFGSKREVCPK
                     PQSELERLNQWLYDPALREEAINYARRSPNYKYCSETDQIIHCEEF"
     gene            102741..103151
                     /locus_tag="SGL_RS00515"
                     /old_locus_tag="slr5110"
     CDS             102741..103151
                     /locus_tag="SGL_RS00515"
                     /old_locus_tag="slr5110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153647.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153647.1"
                     /db_xref="GI:499467007"
                     /translation="MLLREQPFNPHIKVYSRLSLLGKKMDFSEIFNQKLKHWRISGRA
                     LAVASGRSETNISQIRNGVVSPSISDFQELIRICDDLKPGFASDYYSSLSPVAFSPEQ
                     FITHLDSSQLASLMSAIGQRIKDYGRDAQFLKAS"
     gene            complement(103187..103417)
                     /locus_tag="SGL_RS00520"
     CDS             complement(103187..103417)
                     /locus_tag="SGL_RS00520"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153609.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041428267.1"
                     /db_xref="GI:752788411"
                     /translation="MYFLHLTEAREKILKRGCHSTDTQQIGDRLTLTGSLTIHGDDRS
                     LTRQATGTEDIDCGSYGDPSSNAESRKGLNHL"
     gene            103631..104083
                     /locus_tag="SGL_RS00525"
                     /old_locus_tag="slr5111"
     CDS             103631..104083
                     /locus_tag="SGL_RS00525"
                     /old_locus_tag="slr5111"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153648.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153648.1"
                     /db_xref="GI:499467008"
                     /translation="MQINYYTAKPMNNPLLMLKDKTGSMKIKLLISLLILTPITALSS
                     VVFAQSMHSEQSKKAEQNSEAAFDYAGYYYVETYCQARSYNKPHFDSVKNATSSYNDR
                     FKVYMNRNGVTNTNAIATASQQMFFRNGQVITNAIKETCASVMVGTGR"
     gene            104141..105274
                     /locus_tag="SGL_RS00530"
                     /old_locus_tag="slr5112"
     CDS             104141..105274
                     /locus_tag="SGL_RS00530"
                     /old_locus_tag="slr5112"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153649.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153649.1"
                     /db_xref="GI:499467009"
                     /translation="MIVQVTSGFLVVGLIALFVFYRNQNYSYIELAENLINSYSAQQS
                     TDDINNLEQLILDHEIIIKKLSAIRNCPFLPYEAAQDYKQKIELSLQQINEKKENLIL
                     LNELNQNFNEAQKLAGEAINLAKNPPHSIEVWQNIIDKWQQAIIRLNKISVTGLDEKF
                     LLEINNNRNFYEKNLSIANQSLENERTGKSLFATGQKLLNEAHQLSNDNLLTNKQNAF
                     KKRIEGIKKLSDIPPGTTFSKTAEGKIKQHGEIVNVELKKREEKTDKKQPVELDKKPE
                     VQLTNGNKIKNPIEDYFRTVINGDREEKYWCNSFVEQSFFSPTDYKILGDNSISNDQK
                     GAIYKIRVNASNAAGQPIIGTYRFYFENKNDKWCIFAFEKVKY"
     gene            complement(105753..106043)
                     /locus_tag="SGL_RS00535"
                     /old_locus_tag="ssl5113"
     CDS             complement(105753..106043)
                     /locus_tag="SGL_RS00535"
                     /old_locus_tag="ssl5113"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153650.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153650.1"
                     /db_xref="GI:499467010"
                     /translation="MSTVTESDLKELKDLIVELKLGQAEMKGQLAGIDNRLIRLETKM
                     ETKLDTLEPSIQKIPDLAEKVGELKNWKQIGLTLGGAIIGGIITYLARNANP"
     gene            complement(106087..106371)
                     /locus_tag="SGL_RS00540"
                     /old_locus_tag="ssl5114"
     CDS             complement(106087..106371)
                     /locus_tag="SGL_RS00540"
                     /old_locus_tag="ssl5114"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153651.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153651.1"
                     /db_xref="GI:499467011"
                     /translation="MATVTDTDLKELKDLVIEVKVSQARMEAQLAGIDKRLDVIKTRV
                     GGLTNWIVGILFALVGGLLGLLGKAIRKENDPVNGDRRQSVTLKVERESR"
     gene            106537..106950
                     /locus_tag="SGL_RS00545"
                     /old_locus_tag="slr5115"
     CDS             106537..106950
                     /locus_tag="SGL_RS00545"
                     /old_locus_tag="slr5115"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153652.1"
                     /note="slr5115; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide chain release factor I"
                     /protein_id="WP_011153652.1"
                     /db_xref="GI:499467012"
                     /translation="MLQITKSLSIALTEIEMTALRSQGAGGQNVNKVASAIHLRFDIG
                     ASSLPDVYKERLLNLNDQRITKDGIVVIKAQSHRTQEQNREEALKRLQGLISSVITLP
                     KPRRPTKPTRSSQRKRLDAKTKRSAVKALRKSIDE"
     gene            107105..107527
                     /locus_tag="SGL_RS00550"
                     /old_locus_tag="slr5116"
     CDS             107105..107527
                     /locus_tag="SGL_RS00550"
                     /old_locus_tag="slr5116"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153653.1"
                     /note="slr5116; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153653.1"
                     /db_xref="GI:499467013"
                     /translation="MNNRIVIDTSVFVGALIGSQGPSRELIRRCLLSEYQPLMGNALF
                     AEYEAVVGRKEIISQCLLSRTEVISLLEALMSVCEWINIYYLWRPNLRDEGDNHLIEL
                     AISGNAHYIATNNVKDFQGTELIFPHLSILKPEHLLRG"
     gene            107531..107746
                     /locus_tag="SGL_RS00555"
                     /old_locus_tag="ssr5117"
     CDS             107531..107746
                     /locus_tag="SGL_RS00555"
                     /old_locus_tag="ssr5117"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153654.1"
                     /note="ssr5117; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CopG family transcriptional regulator"
                     /protein_id="WP_011153654.1"
                     /db_xref="GI:499467014"
                     /translation="MGTLTIRMPDDKHSRLKQLAESRGISVNKLVEELSTIALTEFDA
                     YNRFRLMAARGSVTEGLKLLDKLDGLD"
     gene            107767..108585
                     /locus_tag="SGL_RS00560"
                     /old_locus_tag="slr5118"
     CDS             107767..108585
                     /locus_tag="SGL_RS00560"
                     /old_locus_tag="slr5118"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153655.1"
                     /note="slr5118; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153655.1"
                     /db_xref="GI:499467015"
                     /translation="MFDNLCKFLAESFSEDYAAWLLGRPIKLTKLSPTELSLEPIRAD
                     SLILEQSEDLVLHLEFQTEPDPTMGFRMLDYRVRVYRRFPQKTMHQFVIHLKRSNNDL
                     VYQDSFQVGETLHRYQAIRLWEQPSEIFLQSPGLLPLAVLTQTSDPTLKLREVATALE
                     QIEDNRVKANLMAATSVFGGILLAPELIKTILRSEIMKESAVYQEILEEGKIAGKLEG
                     RLEGKLEGKLEGRLEAKLETIPLLKKLGLTIVEIAKELDIDVELVNKFVANQNN"
     repeat_region   108439..108559
     gene            108733..109503
                     /locus_tag="SGL_RS00565"
                     /old_locus_tag="slr5119"
     CDS             108733..109503
                     /locus_tag="SGL_RS00565"
                     /old_locus_tag="slr5119"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153836.1"
                     /note="slr5119; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153656.1"
                     /db_xref="GI:499467016"
                     /translation="MFDNLCKFLAESFSEDYAAWLLGRPIKLTKLSPTELSLEPIRAD
                     SLILEQSEDLVLHLEFQTEPDPTMGFRMLDYRVRVYRRFPQKTMHQFVIYLKRSNNDL
                     VYQDSFQLRETLHRYQVIRLWEQSSETFLQSSGLLPLAVLTQTSDPTLKLREVATALE
                     QIEDNRVKANLMAATSVFGGILLAPELIKTILRSEIMKESAVYQEILREGEQRGLLKG
                     KLETIPLLKKLGLTIAEIAKELDIDVELVNRFVANQNN"
     repeat_region   109393..109502
     gene            110068..110283
                     /locus_tag="SGL_RS00570"
                     /old_locus_tag="ssr5121"
     CDS             110068..110283
                     /locus_tag="SGL_RS00570"
                     /old_locus_tag="ssr5121"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153658.1"
                     /note="ssr5121; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153658.1"
                     /db_xref="GI:499467018"
                     /translation="MLKFIGIALLAALVGYAFGVMAGIFIVNNFSTNVQDKPLELAMT
                     SIFFFGPVGALIGLIIAVVYQLLHRYL"
     repeat_region   110374..110488
     gene            complement(110524..111786)
                     /locus_tag="SGL_RS00575"
                     /old_locus_tag="sll5122"
     CDS             complement(110524..111786)
                     /locus_tag="SGL_RS00575"
                     /old_locus_tag="sll5122"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153659.1"
                     /note="sll5122; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153659.1"
                     /db_xref="GI:499467019"
                     /translation="MNSIALVDCNNFYVSCERVFQPLLNGKPVVVLSNNDGCVVARSS
                     EAKALGIKMGVPLFKIRDLVERHNIQVFSSNYCLYGDLSHRIMTSLQLFSPVVEIYSI
                     DEAFLELTPNQSNTNYGEEIRRCLKQWVGIPVSIGIAPTKVLAKVATDVAKQSGAGTF
                     CLDKAEAADTILATMPIADIWGIGRRLEKWFTTRGVSTALQFKQANPELIRKKMGVVG
                     QRLLLELQGISCLPLELIPNPKQETCVSRSFAQAVTTLDELQTAIAFFVSRAAEKLRR
                     QQQTPAVMIIFARTSFFIEQPISISQTIALPTPTHYTPELLKLAQTSLKQIFRPHHPY
                     KKAGVIMTGLQSERIVQGDLFEQPRDTERQQRLMLTVDQLNQKFGRETLGFGIFGQQQ
                     DWRMKSDLRSPRFTTAWDDLPEVKAGFY"
     gene            complement(111783..112217)
                     /locus_tag="SGL_RS00580"
                     /old_locus_tag="sll5123"
     CDS             complement(111783..112217)
                     /locus_tag="SGL_RS00580"
                     /old_locus_tag="sll5123"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153660.1"
                     /note="sll5123; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153660.1"
                     /db_xref="GI:499467020"
                     /translation="MPANVLPEIYRPSRRTVYELPLYACPVSAGFPSPAEDYLEGKLD
                     LNQYLIKHPAATFFVRVTGDSMIGAGIHAGDILIVDRSLEPRDGKVVIAVVNGELLVK
                     RLRMEKQKIYLASENSDYPPLVITDLMDFEVWGVVTNVIHPL"
     gene            112352..113182
                     /locus_tag="SGL_RS00585"
                     /old_locus_tag="slr5124"
     CDS             112352..113182
                     /locus_tag="SGL_RS00585"
                     /old_locus_tag="slr5124"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153661.1"
                     /note="slr5124; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153661.1"
                     /db_xref="GI:499467021"
                     /translation="MFDNLCKFLAESFSEDYAAWLLGRPIKLTKLSPTELSLEPIRAD
                     SLILEQSEDLVLHLEFQTEPDPTMGFRMLDYRVRVYRRFPQKTMHQFVIYLKRSSNDL
                     VYQDSFQVGETLHRYQAIRLWEQPSEAFLQSPGLLPLAVLTQTSDPTLKLREVATALE
                     QIEDNRVKANLMAATSVFGGILLAPELIKTILRSEIMKESAVYQEILEEGKIAGKLEG
                     RLEGKLEGKLEGKLEGRLEAKLETIPLLKKLGLTITEIAKELDIDVELVNRFVANQNN
                     "
     gene            complement(113239..113463)
                     /locus_tag="SGL_RS00590"
                     /old_locus_tag="ssl5125"
     CDS             complement(113239..113463)
                     /locus_tag="SGL_RS00590"
                     /old_locus_tag="ssl5125"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153662.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153662.1"
                     /db_xref="GI:499467022"
                     /translation="MGKAVAFGIVARFGCTKSSIATSIVRPVRFALPAPKKMIIQLLV
                     CGVYLFGRFAPFLKERSGTPPSLDYSKAKM"
     gene            113953..114423
                     /locus_tag="SGL_RS00595"
                     /old_locus_tag="slr5126"
     CDS             113953..114423
                     /locus_tag="SGL_RS00595"
                     /old_locus_tag="slr5126"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153663.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153663.1"
                     /db_xref="GI:499467023"
                     /translation="MKKLLLLLTTILLIPLNATPSNAGAYSEECRNRMRSFQDLIEDK
                     FKTSLYANRNNLTGNPPLEGARDWIDVQLGDLSDPRNHENGNKVMESPVFLKNAAKQI
                     MDSCYPVIGRISFSLAGSDYRRSYSYIPGKGVEEDKCLPEITLGEEPWGFQNCL"
     gene            114514..115284
                     /locus_tag="SGL_RS00600"
                     /old_locus_tag="slr5127"
     CDS             114514..115284
                     /locus_tag="SGL_RS00600"
                     /old_locus_tag="slr5127"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153664.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153664.1"
                     /db_xref="GI:499467024"
                     /translation="MRKISINRLLAIKVAGSFAAATICGFAGYAIFLYFRPINAIGPF
                     SEEKTAFIRSEDGNITIANVHIKDGSFIESIGGVEKVQGRLAKGKDGSFSINNDGTVS
                     YNCLSSDESKAVCGSVRFQKSLGKFQFDRKIPFQMEETIYHPRGIGANAKQNATIMFK
                     SEDQSFWVKSEKVGTYNFLTPTSFEITWKTPAILWNGAGYSDEYIIRTANCTFHAEPI
                     QSVICEGTSKIDIASYTAIWTLIDSDDVPSMKSDETLD"
     gene            complement(115503..116540)
                     /locus_tag="SGL_RS00605"
                     /old_locus_tag="sll5128"
     CDS             complement(115503..116540)
                     /locus_tag="SGL_RS00605"
                     /old_locus_tag="sll5128"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153665.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153665.1"
                     /db_xref="GI:499467025"
                     /translation="MTTQSLTAEFAIEQLKILCQDGDVSDAFPHFEKSSDDEDEGVNE
                     NDINNFVGILAKSNWESEEEFFKFYKFVGYELFTTASDPELSDPSGDKTLIRTSPHDI
                     QFSPYTLTSIGGYFDLYARAREFLKQDQQNGQYAYEEVEIPPQCDAESEDITVIDLIP
                     GATAYIYDHGSYLSGLSPLFDKLQVQFWCDLIYFLGAGYVESSYSYDDTFPKRDIALC
                     LDNGVVLEHLFYGTEETNNDTYIYSQDCIDHLCTNQSTTSQILKTIALAATRNYEKLA
                     AELEEEEIWNGSEDSFEKFREYIMEDLDWDTEEILEAVRSHPNCTDEILEIIAQYESE
                     NSDDDGEEDDL"
     gene            complement(116636..116830)
                     /locus_tag="SGL_RS00610"
                     /old_locus_tag="ssl5129"
     CDS             complement(116636..116830)
                     /locus_tag="SGL_RS00610"
                     /old_locus_tag="ssl5129"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153666.1"
                     /note="ssl5129; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153666.1"
                     /db_xref="GI:499467026"
                     /translation="MTGLWLHMMERALRPAPRKDYLVLLDHTKNDTIQGFPTRKRLWT
                     LEGVENFDGDRQLNGLKQRS"
     gene            complement(116886..117293)
                     /locus_tag="SGL_RS00615"
                     /old_locus_tag="sll5130"
     CDS             complement(116886..117293)
                     /locus_tag="SGL_RS00615"
                     /old_locus_tag="sll5130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015396719.1"
                     /note="sll5130; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153667.1"
                     /db_xref="GI:499467027"
                     /translation="MRFNDSEIEHIWANHFEEHTDEFSHEYEFRDYRNRLGGLVLLPK
                     SVNASLQDKPYSHKVNVYSTQNLLAGSLHPQTYENKPKVKQMQERTGLDLKPIYQEDG
                     KSQFTKVSFEERFALYRGIAEQMWSVESLKELV"
     gene            complement(117345..118361)
                     /locus_tag="SGL_RS00620"
                     /old_locus_tag="sll5131"
     CDS             complement(117345..118361)
                     /locus_tag="SGL_RS00620"
                     /old_locus_tag="sll5131"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010872778.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_010872287.1"
                     /db_xref="GI:499174700"
                     /translation="MISNFGHIVKTYLSNFPKDDYPVLDTFKFVSIWLGLVLDQSQTS
                     MRSMFKRLNLRGETVDISTFSKASKKRDVGVFREIIFSLKKELSKRKEIKQGELEIFP
                     LDSTIVSITSKLMWNLGFHQVKVFSGINLSTGIPGGIVIHFGQGHDNKYGNETIEETP
                     ENGVAVMDRGFCDLQRIKRLQKENNKYHVLRIKNNIKLEKLANDNYMVGTGKNKIESR
                     VVIFTHDNSEFRLVTNLPIESKEIEGVSDEKIAEIYKKRWQIELLWKFLKMHLKLNRL
                     IAKNENAIGIQIYTCIIAYLILKLLVIPKEAGTTMLDKLRYLQAFMCEKISYVHWLRE
                     LALR"
CONTIG      join(AP004310.1:1..119895)
//
DBGET integrated database retrieval system