GenomeNet

Database: RefSeq
Entry: NC_005229
LinkDB: NC_005229
Original site: NC_005229 
LOCUS       NC_005229             119895 bp    DNA     circular CON 15-MAY-2014
DEFINITION  Synechocystis sp. PCC 6803 plasmid pSYSM, complete sequence.
ACCESSION   NC_005229
VERSION     NC_005229.1  GI:38505535
DBLINK      Project: 57659
            BioProject: PRJNA57659
KEYWORDS    RefSeq.
SOURCE      Synechocystis sp. PCC 6803 (Synechocystis PCC6803)
  ORGANISM  Synechocystis sp. PCC 6803
            Bacteria; Cyanobacteria; Oscillatoriophycideae; Chroococcales;
            Synechocystis.
REFERENCE   1
  AUTHORS   Kaneko,T., Nakamura,Y., Sasamoto,S., Watanabe,A., Kohara,M.,
            Matsumoto,M., Shimpo,S., Yamada,M. and Tabata,S.
  TITLE     Structural analysis of four large plasmids harboring in a
            unicellular cyanobacterium, Synechocystis sp. PCC 6803
  JOURNAL   DNA Res. 10 (5), 221-228 (2003)
   PUBMED   14686584
REFERENCE   2  (bases 1 to 119895)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (25-NOV-2003) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 119895)
  AUTHORS   Kaneko,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-NOV-2001) Kazusa DNA Research Institute, The First
            Laboratory for Plant Gene Research; 2-6-7 Kazusa-kamatari,
            Kisarazu, Chiba 292-0818, Japan
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AP004310.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..119895
                     /organism="Synechocystis sp. PCC 6803"
                     /mol_type="genomic DNA"
                     /strain="PCC 6803"
                     /db_xref="taxon:1148"
                     /plasmid="pSYSM"
                     /synonym="Synechocystis PCC6803"
     gene            complement(join(118399..119895,1..27))
                     /locus_tag="sll5132"
                     /db_xref="GeneID:2655959"
     CDS             complement(join(118399..119895,1..27))
                     /locus_tag="sll5132"
                     /note="sll5132; ORF_ID:sll5132;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942156.1"
                     /db_xref="GI:38505667"
                     /db_xref="GeneID:2655959"
                     /translation="MQEIQGKTRTVQELLGNAKYGIDYYQREYQWQTKNISELIDDLT
                     NRFLEDYQPGDGETEFAKYGYYFLGSILISVNDTKKFIVDGQQRLTSLSLLLIFLNNL
                     QKKTSSKTINIESLILSENIFGKSFNLDVPERNACMEALFIDEPFDATQQPDSIVNLV
                     ERYNDIEELFPEEIRHEALPFFIFWLQTKVLLVEIEATSDNDAYLIFETMNDRGLSLS
                     PTEMLKGYLLANVTNLNQRALADNTIKKWLLEFKQIAKEADADFFKTWFRAQYAQDIR
                     DRKKDAKPKDFDLIGTEYHRWIRNNAESVGLKTSNSFFKWINNDLNFYARIYKQLLDA
                     SKGLTEGWERVRYNADHGFTLQFQLLMAPLQSSDTEEIIKQKVALVAWFIDSWLNRRL
                     WHFKSNSYSNMSYGIFQITKKIRGLDVETLRTTLIQRFEEVISAEKLDFSNHLYLHKQ
                     NSKTLHRQLARMMDWLERECGMNGNYQQYIVRSGKNAYEIEPEVLNDSYKEKKSPLK"
     misc_feature    complement(119239..119892)
                     /locus_tag="sll5132"
                     /note="Protein of unknown function DUF262; Region: DUF262;
                     pfam03235"
                     /db_xref="CDD:251819"
     gene            complement(195..374)
                     /locus_tag="ssl5001"
                     /db_xref="GeneID:2655889"
     CDS             complement(195..374)
                     /locus_tag="ssl5001"
                     /note="ORF_ID:ssl5001"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942157.1"
                     /db_xref="GI:38505536"
                     /db_xref="GeneID:2655889"
                     /translation="MNTVTAVRDKCLRYFPTEKTGIWVEYKTDANLRDTENIFLNNEI
                     CRYFLREVKPHVNNA"
     gene            complement(574..921)
                     /locus_tag="sll5002"
                     /db_xref="GeneID:2655869"
     CDS             complement(574..921)
                     /locus_tag="sll5002"
                     /note="ORF_ID:sll5002"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942158.1"
                     /db_xref="GI:38505537"
                     /db_xref="GeneID:2655869"
                     /translation="MPDIQTWEYKTIRFDFLGRGITQEFNLLDVDGTRVKGWSMNNTA
                     IKTLPQMMLALGQEGWELVSHVVNQDNQANNVTLHYMTFKRPGELLVETEDPALTGSA
                     NIRQIRDKFFVIP"
     misc_feature    complement(664..906)
                     /locus_tag="sll5002"
                     /note="Domain of unknown function (DUF4177); Region:
                     DUF4177; pfam13783"
                     /db_xref="CDD:258067"
     gene            complement(1136..1540)
                     /locus_tag="sll5003"
                     /db_xref="GeneID:2655929"
     CDS             complement(1136..1540)
                     /locus_tag="sll5003"
                     /note="sll5003; ORF_ID:sll5003;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942159.1"
                     /db_xref="GI:38505538"
                     /db_xref="GeneID:2655929"
                     /translation="MIELTNPFKLLIDEDLSPSIAQVISQKLGIEAVAVRDRGLINAE
                     DQAVFEYAYKNDYIVVTANIRDFEQIARATEIHPGIIFICDGELIRAEQIEVVTLAAI
                     ALAEEMATGRDMINRVLYVEIDRSLRFETMPN"
     misc_feature    complement(1220..1516)
                     /locus_tag="sll5003"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4634"
                     /db_xref="CDD:226981"
     gene            complement(1515..1826)
                     /locus_tag="sll5004"
                     /db_xref="GeneID:2655930"
     CDS             complement(1515..1826)
                     /locus_tag="sll5004"
                     /note="sll5004; ORF_ID:sll5004;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942160.1"
                     /db_xref="GI:38505539"
                     /db_xref="GeneID:2655930"
                     /translation="MNMLGRHSGRNRDKSPSNVELSPQENAQFQRWAEGLVQNPAIMG
                     GETVFPDSRLTVLRVASLVERGESPSVILEDYPYLKPIDLKFAPIYCQCQTCDRAYQP
                     L"
     misc_feature    complement(1554..1721)
                     /locus_tag="sll5004"
                     /note="Protein of unknown function (DUF433); Region:
                     DUF433; pfam04255"
                     /db_xref="CDD:252484"
     gene            2528..13921
                     /locus_tag="slr5005"
                     /db_xref="GeneID:2655948"
     CDS             2528..13921
                     /locus_tag="slr5005"
                     /note="slr5005; ORF_ID:slr5005;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942161.1"
                     /db_xref="GI:38505540"
                     /db_xref="GeneID:2655948"
                     /translation="MANPYASYAAPVVDAAGTKHLVWEDNGRLYHAHYDSRAGAWVDK
                     NTVSNAQGGSDIKLLAGNIIPVDQSGKLYAPGLVAAWIQGIGNAAEIYVSVGRYTDDG
                     RLEWSDAVQVSKDAVANTSFDLGIGQDGLIQVVTQKVLKIADPRKSDYQNNPGQLAED
                     IKSPQQGDKDLYYSTLLIELERKTGSLFLVPNPEVNASGTTDIPDDADALNFNPDFYV
                     AKTNRTGSLSQILLNAPPSNSPSLQQSGFQSAGLLSASSPTPGNGFLSNTDSDSQNDI
                     SLPATGGPAWGFDITIGTTQHTTEGTTFPLPVLEEANKFASLFGVELGINLSGAIKTK
                     VSRDSDDVYSVDADLALSVDLVKEQTRWKAFGRNQKLDPRIDDPVNGGLMPDPNNPAY
                     NASIDTNQGFSGIQFSLNFSGSQSSNANGELQSLENFYGLKVAFPKRVTFNIPSIPGL
                     EGALARLQALIQFSLAIGYQGIGSDPGPNAEAPFTLKPDTKPNLYDGLSGAGGGGAGF
                     FQAITWLTAYNNYKKGTPGLGAGGKIFAGVNTAFSLLAASDILAASGPLIFPGEFDDF
                     NTTQRGLLIEILATGGLSGSILAGLLGAEGTISTGFDFEFLSGPQPFIFKIPYELSIE
                     ARAAVLTFSWDISGDIVDTTDSSAQTTSIGLLSDDASHNDQNSEMVRLKLAYSPYQGS
                     TAIHENGRFSTVSPTTRIAQPQLLTAFPSTASQNNYVIGSVSVEEGGSGYLGGESGNF
                     LVVPSIGNALLMAYVEKGVIQQIVVESPGIGYDRNNPPTLDFSQYGGGGSGAKAKVNL
                     IDREVLDLTNDGRPFVDSVVFFAGPSAQAETALIWIADGADSTKPISDSANQLTTRVQ
                     VSELAGTNWSIPTALPLQGSEGMNYDPVIAKFISRDNRSSLLAVWAHARADGIGSHSV
                     DDLTNTLDSILETDIYYSVRIGNGTWSNPEKLITLEGTDNRLDIGRLNDGRLHLAWVN
                     AEANATEGGIQRIYSAFFDPTEETWSTPVAIDPTKDIDTPNRSEISSLKVGQLEGEPA
                     MYWSNTAETPYVVSVLNDSPELYFRLESSAINQSEINYGNLGNSIVSNLSFYDGNMTF
                     GQEGALSQDPDPAVRFNGQGAFVIGIPDKQTVTPTSFSVETWVKLTDTAAGKGIVTRG
                     QPITIPATLPTATLTYKVTQGQDTDGKWFYLITPDSVDLGNSGQDIFPNTLRVTNFRA
                     NEQLDIPFNPIESFALRAEPDDFLGLDFIGTDDVYIIRNTPQDVVIGDGTLIVRRFDP
                     GTDKNREERIELSAGQKIQIGGQIYTITAGETFTVSLKAGDNISIFDANPPGTISQSL
                     APNFNFTPDESGSLSGIQVNSNQILSSGTGFSNRPFVNEAESFTLTAELEFEQIEDWY
                     LVTGNNGSIVFNSGAGEISSESLDQGQWHHVVATHNSTTKESILYINGQEVAKTIGER
                     FAPSDNPILVGYNLNGFLDEVAIYNKPLTVADPNAVEFDSTGKYVVAFNPNAPAGEIT
                     SHFNARDVDPDSAEEATYYSVWNGERWGTPEQFAAEYKLTPTQASLSRTPAVDMVGSN
                     GLQPDGVLDQHLQVTLALPNEFLFGRTITGIEIKDAQGNTWSINNNIESPLGSNLVGA
                     MLAGQRVNDLKNGAFEHTVMGVKEVLDLYFDDPNVQSDKTYSVTFTMKDGGTIPPLDN
                     LAPSPNIQGSSSKSSIVKAEILEKEVTSLAEVDSGVIIDIDTVGAGQSLAAGKIRNGE
                     IGFAIGHPYQIDEDLNKRGLVWVLPAGTNKKLNELTGIPLKNDDVPAEGALIIGKNGD
                     KIGYAMAVGDIDGDGIDDLIIGAPDADDKKGKIYVISGKYLGSGHTINLASLPDNAVV
                     TIEGTRLSNAGFSLAAGDVNGNQFDDIVIGAPNALNSEGKAVGAVHLIYGSADFFSGN
                     KTIVLGTNNLLFEGKRGTAKSKFELFPNPANQWHSQVGYSVAIVRPGATGNPNAHSFN
                     ADLVADILIGAPGYHQTVQFDRQGFPQGISAEQLGRYRSVLNHVPNFGTDSVAPERDL
                     NTGRAYLIFGGDNLTVNGPLNDENLSGKGVIFDGSPLEDGDMRLGEVVTSAGDMNGDG
                     YIDISMAAPEAAGRSGLVFIFGGRGGSDSIRLKDKYSVMTESDVLIAGGDVFNYAGQS
                     LGGVGDVNNDKIDDLLVGVPQAGGAKGQNYVIFGVENFEIGKGNFPTTISLKQGIPDD
                     SFVFNGGIAQGLAGYAVAKGFDLNGDTVGDMLLSAPFANQVYVGFGHPWLKKEGSVRL
                     DNLANDNGIIINRYEGSEPKYSFDGRRVTNLGDINGDGYADTGVAGNGDSILIQFGGP
                     TWDLIDAGFGVGQLSVFLRKDVITDINFESIEGVGDINNDGFDDFIIYNSRSKTKEVH
                     DFTIVYGGDYLNSLGSATIDVVVAPGEEIRQRERLANPGFVLSNSATDLKLYHSSLGL
                     GESIYAPGVGFNGKQSRLTLEENGELIFYLHGTPQKIGGQANAGIVKMEIGVLDGKDR
                     LLFKDKSDKIVTYSEEHYNQTEEQITYLRVGDDFVMLSNRFNYAVPGRNDIKIFGYDF
                     DQSVNVVQQHYPSSVWGSVLPSLLAGESITAPDGQRSFMVMPLNYNLKAEDGQRVVAG
                     IVDKEFNVISSLISTRRVPMITSDLEFRSARDAYLILGNDTVVTPSSGGDFTHTKGSL
                     LFVYNGFYYDGNALRNILGGASRTGRDYEIEWTSETQGQDLLFHLDSNIKNINLAQKG
                     TAFDGSQGTLQYKNFHGSKLEEKLFEFLPVGDLNGDGYGDIVAFDSEFTYIYLGNASG
                     KISTLPSSNYSGDEGMVFSSRWAVGSGIGDINGDGYDDLLSQSKDGIFIVFGGPILSS
                     AQRISISNFLTIDSQFSQSPSTYEAGDVNGDGFADFIVRDSHVVAGSTRGALRLVYGN
                     ATGKNFQSTQIQTYLPVYYPLPVTRAGDVNGDGYDDIIFSDPSYLDNNAGRVYILFGG
                     SHLTNKATITPEEINSLEGKDGFVIDGLASSDSYSRAGESVSGGGDMNGDGFKDFIIG
                     APGTDGTVGLTYGLFGGDFTKSVNQAGTLANDILEGTGTGDVIIGLAGDDTLMGNGGR
                     DVLYGGAGDDTIIIADTYFQRIDGGSGFNNLKLEGYRGQDWDLTPLSPGLRLQNISAI
                     DMTNYGSNTLTLNKTTVMKMTGTQNNLVILGDANDEIILDAEFRKVDSFNLFGTLFDR
                     YQAGTANVLVAPNIKTEVKFTANRINQTIGLSNATPVTNSRLLSAASPNRITTIIPAS
                     NGQPTQFFVVANPTREDAGVFTFTVNRSGDLSKSVTALYQTVNDTAIAGRDYTAILGT
                     LVFAPGEISKVIEVPLLDNNEYGGNNRSFGLAIQAIDDIFGERYGSNFLQLSTDNGNQ
                     IRNLDSGSLAPEVVKQLGAALPFGAMGFSVTAPEGSASVTMPFQGITELNSYFRFNQI
                     SGQYEEFLYNGESGVEFLDTTNDGRADTLKIHLLDQGRGDGDGLGNGVITGLNVPAIV
                     NPGLVQVNPGVFLAPTNGDGVLQLRLITNQQESNQIGWVMVDDANGSIDGLLPDAPGY
                     LEAALARKQVVFENAYSASGQAFDRASAQQSFTELNALIQTESQFFGSLQSLELGGGG
                     YYIFYNESSSQTVFSVNTPVTVETESRGYHQISFDGLTMEIASKALVVPGNLDDLVVG
                     QISIGRAGAYENQILLYQVDSLSGGIDTDGDRQINLRPGDTGYVEAALKRAQNPATGA
                     SFNAPEGFFSTGQETVNLRGGSMYGMAIIPNATIGEVLSLNPNNNPELGPVALFSFDG
                     ANPAGISQMSRLGSNLFGFEDMVGGGDADYNDVILEFSHQF"
     misc_feature    <6656..6931
                     /locus_tag="slr5005"
                     /note="Concanavalin A-like lectin/glucanases superfamily;
                     Region: Laminin_G_3; pfam13385"
                     /db_xref="CDD:257711"
     misc_feature    8075..8212
                     /locus_tag="slr5005"
                     /note="Integrin alpha (beta-propellor repeats); Region:
                     Int_alpha; smart00191"
                     /db_xref="CDD:214549"
     misc_feature    8903..>9025
                     /locus_tag="slr5005"
                     /note="Integrin alpha (beta-propellor repeats); Region:
                     Int_alpha; smart00191"
                     /db_xref="CDD:214549"
     misc_feature    9128..9244
                     /locus_tag="slr5005"
                     /note="Integrin alpha (beta-propellor repeats); Region:
                     Int_alpha; smart00191"
                     /db_xref="CDD:214549"
     misc_feature    10757..10957
                     /locus_tag="slr5005"
                     /note="Repeat domain in Vibrio, Colwellia, Bradyrhizobium
                     and Shewanella; Region: VCBS; pfam13517"
                     /db_xref="CDD:257837"
     misc_feature    10925..11125
                     /locus_tag="slr5005"
                     /note="Repeat domain in Vibrio, Colwellia, Bradyrhizobium
                     and Shewanella; Region: VCBS; pfam13517"
                     /db_xref="CDD:257837"
     misc_feature    11090..11302
                     /locus_tag="slr5005"
                     /note="Repeat domain in Vibrio, Colwellia, Bradyrhizobium
                     and Shewanella; Region: VCBS; pfam13517"
                     /db_xref="CDD:257837"
     misc_feature    11456..>11557
                     /locus_tag="slr5005"
                     /note="Integrin alpha (beta-propellor repeats); Region:
                     Int_alpha; smart00191"
                     /db_xref="CDD:214549"
     misc_feature    12239..12478
                     /locus_tag="slr5005"
                     /note="Calx-beta domain; Region: Calx-beta; cl02522"
                     /db_xref="CDD:261323"
     misc_feature    13670..13897
                     /locus_tag="slr5005"
                     /note="Domain of unknown function (DUF4114); Region:
                     DUF4114; pfam13448"
                     /db_xref="CDD:257773"
     gene            complement(14579..15133)
                     /locus_tag="sll5006"
                     /db_xref="GeneID:2655992"
     CDS             complement(14579..15133)
                     /locus_tag="sll5006"
                     /note="ORF_ID:sll5006"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942162.1"
                     /db_xref="GI:38505541"
                     /db_xref="GeneID:2655992"
                     /translation="MSIAGKSKGDVVQQLEKSYGVARTTVFNRLKYLGYSLDKVDDLF
                     SLSNEQMAELDKLHRWISDGGKMADYPKPGQLTMVTDERELEQYGEVINFDALEGDEE
                     LGHAELIRAAQNQAAGILIAQNLLTAEILKNPQHLPADLQAQVEQSKVAIAPKPQNPL
                     VIASQWITKAKAYQSNQNHGPLAA"
     gene            complement(15233..15481)
                     /locus_tag="ssl5007"
                     /db_xref="GeneID:2655890"
     CDS             complement(15233..15481)
                     /locus_tag="ssl5007"
                     /note="ORF_ID:ssl5007"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942163.1"
                     /db_xref="GI:38505542"
                     /db_xref="GeneID:2655890"
                     /translation="MDFNPNEWPTHKQGEVVRQLILDALDSPKTKEELSSLCNKSVRQ
                     ITRHLHRLSSENKILSTGKGQFVRRIAAGFLLLYVGQI"
     gene            complement(15639..15812)
                     /locus_tag="ssl5008"
                     /db_xref="GeneID:2655891"
     CDS             complement(15639..15812)
                     /locus_tag="ssl5008"
                     /note="ORF_ID:ssl5008"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942164.1"
                     /db_xref="GI:38505543"
                     /db_xref="GeneID:2655891"
                     /translation="MDVRPWHQKHQKVNLHIGQDLVEIASLETPSKNYWGQFIWTKFP
                     IFIGKYRYILDPT"
     gene            15996..16235
                     /locus_tag="ssr5009"
                     /db_xref="GeneID:2655914"
     CDS             15996..16235
                     /locus_tag="ssr5009"
                     /note="ORF_ID:ssr5009"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942165.1"
                     /db_xref="GI:38505544"
                     /db_xref="GeneID:2655914"
                     /translation="MTTVTDADLKELKDLITTGFTKLEVNQARIEEKLNGIDKRLELV
                     ETRINTQTNWFVGAFAALVGGLLALLGKFILFPNA"
     gene            16603..17166
                     /locus_tag="slr5010"
                     /db_xref="GeneID:2655949"
     CDS             16603..17166
                     /locus_tag="slr5010"
                     /note="slr5010; ORF_ID:slr5010;
                     integrase/recombinase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942166.1"
                     /db_xref="GI:38505545"
                     /db_xref="GeneID:2655949"
                     /translation="MKINRQGQAKVLTEQELHDLFTIGLLTPRDRLLFGICLYTGCRI
                     GEACSLAWADVTTDAMTFRIEKTKTKSSRTVAITPALQVLFDEYRQQQCFRFSSSYVF
                     RGKRVGSHLHPSMAHKILKAATDRIEVRGVSTHSFRRTALTMMCRKGINLRVIQKISG
                     HKNLNVLSHYLEVSEQEKEQALSTISF"
     misc_feature    <16630..17115
                     /locus_tag="slr5010"
                     /note="Integrase [DNA replication, recombination, and
                     repair]; Region: XerC; COG0582"
                     /db_xref="CDD:223655"
     misc_feature    16681..17115
                     /locus_tag="slr5010"
                     /note="DNA breaking-rejoining enzymes,
                     intergrase/recombinases, C-terminal catalytic domain. The
                     tyrosine recombinase/integrase family share the same
                     catalytic domain containing six conserved active site
                     residues. The best-studied members of this diverse
                     family...; Region: INT_REC_C; cd01182"
                     /db_xref="CDD:238587"
     misc_feature    order(16729..16734,16804..16806,17002..17007,17110..17112)
                     /locus_tag="slr5010"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238587"
     misc_feature    order(16729..16731,16804..16806,17005..17007,17014..17016,
                     17083..17085,17110..17112)
                     /locus_tag="slr5010"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238587"
     misc_feature    order(16729..16731,17005..17007,17014..17016,17083..17085,
                     17110..17112)
                     /locus_tag="slr5010"
                     /note="active site"
                     /db_xref="CDD:238587"
     misc_feature    order(16729..16731,17014..17016,17110..17112)
                     /locus_tag="slr5010"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238587"
     gene            17218..17439
                     /locus_tag="ssr5011"
                     /db_xref="GeneID:2655915"
     CDS             17218..17439
                     /locus_tag="ssr5011"
                     /note="ssr5011; ORF_ID:ssr5011;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942167.1"
                     /db_xref="GI:38505546"
                     /db_xref="GeneID:2655915"
                     /translation="MKKQVKVKPNAKQSKVVYGDDGSLIIHVKSPPVDGKANQELIKL
                     LAKEFNVSQQSIKIKSGAGSRQKIVEINE"
     misc_feature    17230..17430
                     /locus_tag="ssr5011"
                     /note="Uncharacterized ACR, YggU family COG1872; Region:
                     DUF167; pfam02594"
                     /db_xref="CDD:251402"
     gene            17880..18800
                     /locus_tag="slr5012"
                     /db_xref="GeneID:2655940"
     CDS             17880..18800
                     /locus_tag="slr5012"
                     /note="slr5012; ORF_ID:slr5012;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942168.1"
                     /db_xref="GI:38505547"
                     /db_xref="GeneID:2655940"
                     /translation="MKVQLGLDIPKHQNQLKPIFARHETFHPRFGWLKKGFDRARDNS
                     RIFLAEDAPVLLGVGKNMVRSIRYWCEAFKLLDNDQPTLFGETLLGNQGWDPYLEDPA
                     SLWLLHWKLLEPPCLASAWWFTFNQFNRLEFTDRDLFDALVDYGDRLSGNIAESSLKK
                     DVSCLLRMYAKQPNIKKFVASEESLDCPFVDLGLINPAGGNHRYLFRLGYKPTLVPAV
                     ILYSVLHYAQRVNETARTIPLARLLYDEGSPGMVFKLTESSLCGAIEAISRTHNQLGL
                     EDAAGKLQFWFDSDPMALANQVLETYYADI"
     misc_feature    17937..18788
                     /locus_tag="slr5012"
                     /note="Protein of unknown function (DUF4007); Region:
                     DUF4007; pfam13182"
                     /db_xref="CDD:257550"
     gene            18822..20513
                     /locus_tag="slr5013"
                     /db_xref="GeneID:2655941"
     CDS             18822..20513
                     /locus_tag="slr5013"
                     /note="ORF_ID:slr5013"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942169.1"
                     /db_xref="GI:38505548"
                     /db_xref="GeneID:2655941"
                     /translation="MTTLSQYFQIHRRYYRSVNLERDLGKASTVEGYVLTERSTATLE
                     RILPAFSKPHTHRAWTLTGVYGTGKSAFIHFLASLCTPQNTEVHRVAVTIAERFLEPT
                     SPILEAISALPAEGLMVAFATGQQEPLTWTLARALSQGAETFFPKNQRADKLLRQLTD
                     WKVEAETGDCQVTPKAILRAIKELVVIANRPLLIIVDELGKNLEYAAQNQGITDLYLL
                     QQLAELSLSGENQVYFIGLLHQSFGGYGDRLSVTEQNEWNKIQGRFEDIPFTESPNQM
                     TRLIAQVIDRENAKPILEEVQKTSNQWHQTLSSLISDLETTPELLTHIYPLHPLTAFA
                     LPLLCTRYAQNDRSLFTFLTSDEPHSFKHFLETTVIDLSLPTLKLYHLYDYFVETVTG
                     LASRLNLQRWVEIQSLIEDARDQSPQTLQVLKTVGILNLVTTTGNLKATSALVTWALC
                     DQADGEQSNYWQAEIERLMQKGLITHRRQLDELRIWQGSDFNVELAIAEQVEKNRSHL
                     ANLLQEVAPLKPLVAQRHYNQTGNLRYFEQRYGDGTEKWENLTCSDLSFEKFISA"
     gene            complement(20523..21479)
                     /locus_tag="sll5014"
                     /db_xref="GeneID:2655993"
     CDS             complement(20523..21479)
                     /locus_tag="sll5014"
                     /note="sll5014; ORF_ID:sll5014;
                     similar to maturase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942170.1"
                     /db_xref="GI:38505549"
                     /db_xref="GeneID:2655993"
                     /translation="MSQIFQCPYCKALAIWKKGNYIHRRTCENSECRKKLNRDTAKKY
                     DQLRQKKKIQELKFQGFNIVTCQICNEEFEMIHHSHLKTHGLTVAEYRNRFPNALICN
                     SRNHKKRSQAALERSKYKSYSGKNIDNDFLEFLTGSLLGDGSLEKGKKKLNARYAEGG
                     ANKEYINWKFNFLKDYFYCTFQECLSSPHVKSGKQYQGWWIRTGVHPILTDLHCIWYL
                     EKKLLPRKFVEKYLTEFAFCIWFYDDGCSSSGLSLYPMSFSEDDVNFLSLIILQKFNL
                     KNSVLKTKQGHFFIRISQKAKSELKAILDKFSIPGMAYKRNL"
     misc_feature    complement(20586..21089)
                     /locus_tag="sll5014"
                     /note="LAGLIDADG DNA endonuclease family; Region:
                     LAGLIDADG_2; pfam03161"
                     /db_xref="CDD:251767"
     gene            complement(21479..21760)
                     /locus_tag="ssl5015"
                     /db_xref="GeneID:2655892"
     CDS             complement(21479..21760)
                     /locus_tag="ssl5015"
                     /note="ORF_ID:ssl5015"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942171.1"
                     /db_xref="GI:38505550"
                     /db_xref="GeneID:2655892"
                     /translation="MSDFPKDWAMYEPDGDFAVSEMMREVKAALKNMPLPEVRTLLKA
                     KIELVGISHGEIYDSEVRNKIESYLTSWACEVHELNDTWNTLSRSYWSL"
     gene            21843..23219
                     /locus_tag="slr5016"
                     /db_xref="GeneID:2655942"
     CDS             21843..23219
                     /locus_tag="slr5016"
                     /note="ORF_ID:slr5016"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942172.1"
                     /db_xref="GI:38505551"
                     /db_xref="GeneID:2655942"
                     /translation="MGKAGQALKQTLDLHNISQSRLAIALGVDRPIVFRWFHEKTDPT
                     GETIHQITTALQNLDPDAASSFVNFYLGNFTQNGSSGISSQSLPESEQVNVSILAQLF
                     NKTTNSYKYLFFLSLLDILKRRKFDVLPPISFAELVVEILANAWFPHTYFKLSFGTQD
                     KITEKLDSLNLIISEPILKFNDPDKQLLRKTIANQTYDDLITYLVKYVPFRLIRPFYS
                     HETRGLKDVEVNQVILDLTNNNHKSRNALYHFDADLVKDCQGIILSPDWVNYIEENFK
                     IVKGWASWAWLEYMQSRNPTTPNIVNKLFTPQQRGSLSSQTKFWKSALNYQLFNCIYS
                     KQKLNSDYLSLDHYLPWSFVAHDQLWNLVPVIPEVNSSKSNNLPADQYFYDFVNLHHL
                     ALVTNHKHLPRQSWNKVIDPYVADLNLSENDLLDLDRLLKAYESTVKPLITLAAKQGF
                     SENWVYPK"
     misc_feature    21855..22025
                     /locus_tag="slr5016"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(21867..21869,21879..21881,21954..21956)
                     /locus_tag="slr5016"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(21876..21878,21951..21953)
                     /locus_tag="slr5016"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(21897..21902,21933..21935,21942..21944,21954..21959)
                     /locus_tag="slr5016"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     misc_feature    22833..22976
                     /locus_tag="slr5016"
                     /note="HNH endonuclease; Region: HNH_4; pfam13395"
                     /db_xref="CDD:257720"
     gene            23255..23572
                     /locus_tag="slr5017"
                     /db_xref="GeneID:2655939"
     CDS             23255..23572
                     /locus_tag="slr5017"
                     /note="slr5017; ORF_ID:slr5017;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942173.1"
                     /db_xref="GI:38505552"
                     /db_xref="GeneID:2655939"
                     /translation="MLSVTHLKIPQQTLAELCQQWHISELALFGSALTEDFHEDSDID
                     LLVSFAPDARQGLLTLAKIKHQFEEIFHRKVDLVVKAAIEEGDNWIRRQEILNSAVTI
                     YES"
     misc_feature    23288..23536
                     /locus_tag="slr5017"
                     /note="Nucleotidyltransferase (NT) domain of
                     Staphylococcus aureus kanamycin nucleotidyltransferase,
                     and similar proteins; Region: NT_KNTase_like; cd05403"
                     /db_xref="CDD:143393"
     misc_feature    order(23339..23347,23354..23356,23375..23380,23384..23386,
                     23474..23476,23480..23482)
                     /locus_tag="slr5017"
                     /note="active site"
                     /db_xref="CDD:143393"
     misc_feature    order(23339..23347,23354..23356,23375..23380,23384..23386)
                     /locus_tag="slr5017"
                     /note="NTP binding site [chemical binding]; other site"
                     /db_xref="CDD:143393"
     misc_feature    order(23378..23380,23384..23386,23480..23482)
                     /locus_tag="slr5017"
                     /note="metal binding triad [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143393"
     misc_feature    order(23474..23476,23480..23482)
                     /locus_tag="slr5017"
                     /note="antibiotic binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:143393"
     gene            23562..23903
                     /locus_tag="slr5018"
                     /db_xref="GeneID:2655937"
     CDS             23562..23903
                     /locus_tag="slr5018"
                     /note="slr5018; ORF_ID:slr5018;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942174.1"
                     /db_xref="GI:38505553"
                     /db_xref="GeneID:2655937"
                     /translation="MNRDNAYLLDILNAIQRIQIFSNGLTKDELSANEEKQSAILYQI
                     IVIGEATKRLSAEIRSINPHIPWKDIAGMRDILAHQYDRINLNTLWDVVQKDVPELEA
                     LIAPLVSNAKQ"
     misc_feature    23562..23882
                     /locus_tag="slr5018"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG2361"
                     /db_xref="CDD:225236"
     gene            23890..24099
                     /locus_tag="ssr5019"
                     /db_xref="GeneID:2655916"
     CDS             23890..24099
                     /locus_tag="ssr5019"
                     /note="ssr5019; ORF_ID:ssr5019;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942175.1"
                     /db_xref="GI:38505554"
                     /db_xref="GeneID:2655916"
                     /translation="MQSNKQIHLDYHATTPVDPRVTEKVVEFMTTQFGNASSVDHSID
                     DRARGAVDQAKQSVVYQRFNRRPTS"
     misc_feature    23908..>24063
                     /locus_tag="ssr5019"
                     /note="Aspartate aminotransferase (AAT) superfamily (fold
                     type I) of pyridoxal phosphate (PLP)-dependent enzymes.
                     PLP combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine intermediate, which
                     depending on the reaction, is the...; Region: AAT_I;
                     cl18945"
                     /db_xref="CDD:267298"
     gene            24181..24462
                     /locus_tag="ssr5020"
                     /db_xref="GeneID:2655917"
     CDS             24181..24462
                     /locus_tag="ssr5020"
                     /note="ssr5020; ORF_ID:ssr5020;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942176.1"
                     /db_xref="GI:38505555"
                     /db_xref="GeneID:2655917"
                     /translation="MIRNFKDKEAQKIFERQRSRKLPGDIQQVALRKLRMLNRAETLQ
                     DLKVPPANRLEALKGDRQGQYSIRINAQWRICFQWENGEALDVEIIDYH"
     misc_feature    24181..24459
                     /locus_tag="ssr5020"
                     /note="Plasmid maintenance system killer protein [General
                     function prediction only]; Region: HigB; COG3549"
                     /db_xref="CDD:226079"
     gene            24473..24787
                     /locus_tag="slr5021"
                     /db_xref="GeneID:2655938"
     CDS             24473..24787
                     /locus_tag="slr5021"
                     /note="slr5021; ORF_ID:slr5021;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942177.1"
                     /db_xref="GI:38505556"
                     /db_xref="GeneID:2655938"
                     /translation="MNPDKLKPIHPGEVLLEEFLQPMNLSQNKLALAIRVPARRINEI
                     VQGKRRITADTALRLALYFNMSPRFWLGLQMDYDLDLAEDEIGEKLQQEVTTFNLDNV
                     AV"
     misc_feature    24539..24682
                     /locus_tag="slr5021"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(24551..24556,24587..24589,24596..24598,24608..24613)
                     /locus_tag="slr5021"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     misc_feature    24605..24607
                     /locus_tag="slr5021"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     gene            24798..25955
                     /locus_tag="slr5022"
                     /db_xref="GeneID:2655927"
     CDS             24798..25955
                     /locus_tag="slr5022"
                     /note="slr5022; ORF_ID:slr5022;
                     probable aminotransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942178.1"
                     /db_xref="GI:38505557"
                     /db_xref="GeneID:2655927"
                     /translation="MIYLDYHATTPVDPRVAEKVMAFMTTQFGNVSSVDHAVGDRARR
                     AVDQAKQQIADLIHCRPQEIIFTSGATESINLAIQGTVLALEKQQQTPRLAISAVEHK
                     AVLDTCRHLEKQGRIELIVLPVDAQANLNLNQIEEVCHQGLDLLCIMAANNEVGTIYP
                     IEKIAAIAKRHAVPFFCDASQAVGKIPINFQDWDITLLALSGHKLYAPQGIGALIRKT
                     HHPLEPLIWGGGQQQGLRPGTLNLPGIVGLGEACHLRQLEMNEDETAIARKRDYLQAR
                     LQKAIPEILVNGNQSRRLAGNLHIAIPDIPNSAIIARIREQIAISTGSACSSGTIAPS
                     HVLRAMNLTSNFIDGALRIGIGKFTTNAEIEQAADILIKTITIVKSCLKSS"
     misc_feature    24798..25922
                     /locus_tag="slr5022"
                     /note="Cysteine sulfinate desulfinase/cysteine desulfurase
                     and related enzymes [Amino acid transport and metabolism];
                     Region: NifS; COG1104"
                     /db_xref="CDD:224029"
     misc_feature    order(25005..25010,25017..25019,25245..25247,25329..25331,
                     25338..25340,25398..25400,25407..25409)
                     /locus_tag="slr5022"
                     /note="pyridoxal 5'-phosphate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:99742"
     misc_feature    25407..25409
                     /locus_tag="slr5022"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99742"
     gene            25994..27175
                     /locus_tag="slr5023"
                     /db_xref="GeneID:2655928"
     CDS             25994..27175
                     /locus_tag="slr5023"
                     /note="slr5023; ORF_ID:slr5023;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942179.1"
                     /db_xref="GI:38505558"
                     /db_xref="GeneID:2655928"
                     /translation="MKIVSIKIKNYRVFEDIKITNIPSFCVIIGANGTGKSTLFDVFG
                     FLRDALKNNIRQALQIRGGFKEVVTRGKESEDIEIELKFRMEILATERLVTYILIIGQ
                     EGKKPVIKREILRYKRGEYGSPFHFLDFHNGQGYAIRNEESFESDEELEREEQKLESA
                     DILAIKGLGQFQRFKAANAIRSLIENWHVSDFHISDARGSKAALYAEHLSPTGDNIPI
                     VAQYIYQEHPEIFAEILQRMKQRVPGISNVEAKEIEGGSLILKFQDQAFEDSFVDLYV
                     SDGTIKMFAYLILLFDPKPHPLLCVEEPENQLYPTLLRELAEEFASYAHRGGQVFVST
                     HSPDFLNAVPLDSIFWLIKIQGVTKVEKAADHEVLRNLIAAGDLPGYLWNQGWFEGVA
                     P"
     misc_feature    25994..27148
                     /locus_tag="slr5023"
                     /note="Predicted ATPase [General function prediction
                     only]; Region: COG4637"
                     /db_xref="CDD:226984"
     misc_feature    26006..>26311
                     /locus_tag="slr5023"
                     /note="AAA domain; Region: AAA_23; pfam13476"
                     /db_xref="CDD:257800"
     misc_feature    26081..26104
                     /locus_tag="slr5023"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(26090..26095,26099..26107,26261..26263,26378..26380)
                     /locus_tag="slr5023"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    26252..26263
                     /locus_tag="slr5023"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(26285..26299,26309..26323)
                     /locus_tag="slr5023"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    26366..26380
                     /locus_tag="slr5023"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    <26720..27016
                     /locus_tag="slr5023"
                     /note="AAA domain; Region: AAA_21; pfam13304"
                     /db_xref="CDD:257641"
     gene            27175..27735
                     /locus_tag="slr5024"
                     /db_xref="GeneID:2655925"
     CDS             27175..27735
                     /locus_tag="slr5024"
                     /note="slr5024; ORF_ID:slr5024;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942180.1"
                     /db_xref="GI:38505559"
                     /db_xref="GeneID:2655925"
                     /translation="MSYDLIFLLEEPSLKNVLEMLLPKIIPNSLTYQLITHQGKQDLA
                     KSIPRKIKAFQFSRTTKFIIVHDQDSHDCIQLKTELLTICQNAGQSDILIRIVCRELE
                     SWFLGDLAAVEKAYGLKPQSLSRKQTQQKFRNPDQLNNAKQELIKLVKEYYEATHSKA
                     IAPHLSLTDNKSHSFQVFIEGIQNFI"
     misc_feature    27196..27726
                     /locus_tag="slr5024"
                     /note="Domain of unknown function (DUF4276); Region:
                     DUF4276; pfam14103"
                     /db_xref="CDD:258322"
     gene            complement(27859..28053)
                     /locus_tag="ssl5025"
                     /db_xref="GeneID:2655893"
     CDS             complement(27859..28053)
                     /locus_tag="ssl5025"
                     /note="ssl5025; ORF_ID:ssl5025;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942181.1"
                     /db_xref="GI:38505560"
                     /db_xref="GeneID:2655893"
                     /translation="MLQNLDRITFDLQIMGGKACIRGMRVPVSLILNLLANGKTSEEI
                     IDDYPYLESEDIQQAMLYAA"
     misc_feature    complement(27865..28032)
                     /locus_tag="ssl5025"
                     /note="Protein of unknown function (DUF433); Region:
                     DUF433; pfam04255"
                     /db_xref="CDD:252484"
     gene            complement(28096..30168)
                     /locus_tag="sll5026"
                     /db_xref="GeneID:2655924"
     CDS             complement(28096..30168)
                     /locus_tag="sll5026"
                     /note="sll5026; ORF_ID:sll5026;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942182.1"
                     /db_xref="GI:38505561"
                     /db_xref="GeneID:2655924"
                     /translation="MADTHNFIDIKDALNALILGKRLPDALYIHYSIISHLSPILRRY
                     ESLARQIFDENYQSKLNQNLQFTLIKFNLNEPKISYLDYPNFDLDAHPALRQSTQVNL
                     ELNNCQVRHYGDNPPILHRKETFVCADYPLYQTFAELTQAEEKLGLLADPRQIGYRQQ
                     WEKRLQQFRVRIENHKLIEIQEFAHQSPKIDRHKAAIIRRQMSRPVRSLLDANLLTEG
                     MTFFDYGCGHGEDLKFVAEKGFEVHGWDPFYEPEGDRHPADIVNLGYVINVIENPAER
                     REALFQAWELAQKILVVSAQVLIADGGAGHIAYGDGVITSRNTFQKYYGQEELKLYID
                     QVLGIDAIPVALGIYFVFRDEAQAQAFRASRFRSRATTPRIRLSVKRFEDYQDLLQPL
                     MNFLTERGRLPKKGELATEADICAEFKTLTRAFQVIEQATNGEDWKKITEQRKQDIQI
                     YLALSHFAKRPRFSQLDDILQTDIKVLFGTYKEACLLSDRMLFSLGNLANLANIAQQS
                     PIGICSKKALLVHISALEALDPLLRLYEGCASRTVGRLENVTLVRFYLHEPKIAYIFC
                     SDFDTNPHPRWQTMMQISLQDLRVRYKEYDPDYAPVVHCKERLVMTDYPLCKKFAKLS
                     QQEEDWGLLENWSEIQLWPGWQRTLREMGVEFRGHRLVWRSDADPYAQKLLKARIRTQ
                     QRQRQNLS"
     misc_feature    complement(29635..>30114)
                     /locus_tag="sll5026"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cl17173"
                     /db_xref="CDD:266528"
     misc_feature    complement(28177..29601)
                     /locus_tag="sll5026"
                     /note="DNA phosphorothioation-associated putative
                     methyltransferase; Region: dnd_rel_methyl; TIGR04096"
                     /db_xref="CDD:188611"
     gene            complement(30281..30574)
                     /locus_tag="ssl5027"
                     /db_xref="GeneID:2655894"
     CDS             complement(30281..30574)
                     /locus_tag="ssl5027"
                     /note="ssl5027; ORF_ID:ssl5027;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942183.1"
                     /db_xref="GI:38505562"
                     /db_xref="GeneID:2655894"
                     /translation="MKNNRYSPDWPQLALQKKQSVNWVCERCGVQCLKPGEGKGLSTG
                     DRYRLRMAVHHCDYDPSNNYPSNLMALCSPCHLYYHRRQRGNVTPGQLTLKFC"
     misc_feature    complement(<30326..>30508)
                     /locus_tag="ssl5027"
                     /note="HNH nucleases; HNH endonuclease signature which is
                     found in viral, prokaryotic, and eukaryotic proteins. The
                     alignment includes members of the large group of homing
                     endonucleases, yeast intron 1 protein, MutS, as well as
                     bacterial colicins, pyocins, and...; Region: HNHc;
                     cl00083"
                     /db_xref="CDD:260180"
     gene            complement(30677..30988)
                     /locus_tag="sll5028"
                     /db_xref="GeneID:2655996"
     CDS             complement(30677..30988)
                     /locus_tag="sll5028"
                     /note="sll5028; ORF_ID:sll5028;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942184.1"
                     /db_xref="GI:38505563"
                     /db_xref="GeneID:2655996"
                     /translation="MGSSIESVAVDSDLLPFDPGMVALIQLMESRRSPLDNLRDLEDA
                     VSYGWLLTTTQIEKLLGVKPRGEQFDRQGFLFTRQGKAGREAQWSITKITRGLRSVEI
                     E"
     gene            31397..32062
                     /locus_tag="slr5029"
                     /db_xref="GeneID:2655926"
     CDS             31397..32062
                     /locus_tag="slr5029"
                     /note="ORF_ID:slr5029"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="NP_942185.1"
                     /db_xref="GI:38505564"
                     /db_xref="GeneID:2655926"
                     /translation="MTKTREAKKTVQCVDTYSELYKDIFPEVRSYESFKYIIVGMLSD
                     IKRKSLPAIASSLGLKNEQGLLHFMTDSPWELKELKKRRLNIILEVLEGREIIVIIDE
                     TGDPKKGKTTDYVKRQYIGNLGKIESGIVSVNAYGYCDGVTFPLESKVFKPKERLKEG
                     DKYKTKTELAVEIIKELEESGFKIKRVVSDSLYGESHSNFISAVEELKIEYAVGIRSN
                     HGV"
     misc_feature    31400..>32059
                     /locus_tag="slr5029"
                     /note="FOG: Transposase [DNA replication, recombination,
                     and repair]; Region: COG5659"
                     /db_xref="CDD:227946"
     gene            complement(32015..32836)
                     /locus_tag="sll5030"
                     /db_xref="GeneID:2655997"
     CDS             complement(32015..32836)
                     /locus_tag="sll5030"
                     /note="sll5030; ORF_ID:sll5030;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942186.1"
                     /db_xref="GI:38505565"
                     /db_xref="GeneID:2655997"
                     /translation="MKTSLDCIPCLLHQSLDAARLVSQNPSVHEQIIRDALSWAGEMD
                     LNQSPPAMAQQIHRRLREITGVTDPYRKTKDWQNRVAMELLPTLRAKVEAAKDPLLMA
                     ARLAIAGNVIDMGVDGSLTEADVREALEQALKGPFFAEEDRLREVIAQAKSILYLADN
                     AGEIALDRLLVEQLSPERVTLVVRGSPVLNDATLIDAQTVGLDKIVEVVDFCFNFPIS
                     YCAFFTINYFSDIPIFLFSIPSYVFKPPPLICPYFSFLWKLDPMIAPDSHCIFYF"
     misc_feature    complement(<32207..32836)
                     /locus_tag="sll5030"
                     /note="Protein of unknown function DUF89; Region: DUF89;
                     cl15397"
                     /db_xref="CDD:265686"
     gene            complement(32865..32978)
                     /locus_tag="ssl5031"
                     /db_xref="GeneID:2655895"
     CDS             complement(32865..32978)
                     /locus_tag="ssl5031"
                     /note="ssl5031; ORF_ID:ssl5031;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942187.1"
                     /db_xref="GI:38505566"
                     /db_xref="GeneID:2655895"
                     /translation="MHVSLNVVLLGLFGWQALTGIQIVQDILSKMGSTPTP"
     misc_feature    complement(32898..>32978)
                     /locus_tag="ssl5031"
                     /note="Protein of unknown function (DUF4079); Region:
                     DUF4079; pfam13301"
                     /db_xref="CDD:257638"
     gene            complement(33000..33350)
                     /locus_tag="sll5032"
                     /db_xref="GeneID:2655866"
     CDS             complement(33000..33350)
                     /locus_tag="sll5032"
                     /note="sll5032; ORF_ID:sll5032;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942188.1"
                     /db_xref="GI:38505567"
                     /db_xref="GeneID:2655866"
                     /translation="MNSENLAALKPYLSFFHPITMWALLALAIYTLYLGIQVRRTRLA
                     EGEPKKELIKGRFAIRHHQIGSMFLALIVMGAIGGITVTYINSGKIFIGPHLFAGLGI
                     VGLVSTSAALVPFM"
     misc_feature    complement(<33003..33317)
                     /locus_tag="sll5032"
                     /note="Protein of unknown function (DUF4079); Region:
                     DUF4079; pfam13301"
                     /db_xref="CDD:257638"
     gene            complement(33422..33961)
                     /locus_tag="sll5033"
                     /db_xref="GeneID:2655988"
     CDS             complement(33422..33961)
                     /locus_tag="sll5033"
                     /note="sll5033; ORF_ID:sll5033;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942189.1"
                     /db_xref="GI:38505568"
                     /db_xref="GeneID:2655988"
                     /translation="MKSILSFIKSVFILGILVGVLIINLAVSPAQAVIRQLEEAPGPT
                     VYQSEISKSRQILKDQQGGSWQAIAFERTIPDHEDSIYLRLVDFPGTANIDHSKPLII
                     TNMMSETLSAVNVSEDMFMDKTKMSPDAGEYDLQPILMQLESAIPLRLILPTLDQQKI
                     VLNVSPAVVEEWQSLTTQK"
     misc_feature    complement(33437..33868)
                     /locus_tag="sll5033"
                     /note="Protein of unknown function (DUF3122); Region:
                     DUF3122; pfam11320"
                     /db_xref="CDD:151761"
     gene            complement(34001..34624)
                     /locus_tag="sll5034"
                     /db_xref="GeneID:2655989"
     CDS             complement(34001..34624)
                     /locus_tag="sll5034"
                     /note="sll5034; ORF_ID:sll5034;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942190.1"
                     /db_xref="GI:38505569"
                     /db_xref="GeneID:2655989"
                     /translation="MQTLPQRILSLMLIIGISLLLLGGNAAIATAAPIIPNANELAQA
                     VQEIESLDAMRTGLASSLEGRTEAPTKQTMKEVCRPVGMRAMQLSKENGWQVQQIANK
                     YRNPDHKPNNLHDQIALAKFNQEPELVGFWDRETLNKQTGTRYYRRIEVESTCLACHG
                     LKNSRPQFIKDGYPQDLAYDFNVGDLRGMYAVFIPDDIQKAMQDAIK"
     misc_feature    complement(34040..34504)
                     /locus_tag="sll5034"
                     /note="Protein of unknown function (DUF3365); Region:
                     DUF3365; pfam11845"
                     /db_xref="CDD:256666"
     gene            complement(34736..35074)
                     /locus_tag="sll5035"
                     /db_xref="GeneID:2655986"
     CDS             complement(34736..35074)
                     /locus_tag="sll5035"
                     /note="ORF_ID:sll5035"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription regulator ArsR"
                     /protein_id="NP_942191.1"
                     /db_xref="GI:38505570"
                     /db_xref="GeneID:2655986"
                     /translation="MQISVNKTLNPPNFERLSELFKLMGDQSRLHILWCICEEECSVG
                     TICDMTGLSQANVSKHLQILRMGGIVGCRKQGNSRIYFLANPKYLNLCAQSLIELSNL
                     STDVLSSCED"
     misc_feature    complement(34781..35014)
                     /locus_tag="sll5035"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(34784..34792,34796..34804,34808..34813,
                     34871..34873,34961..34963,34970..34975,34982..34987,
                     34994..34996,35003..35005,35009..35014))
                     /locus_tag="sll5035"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(34832..34840,34853..34861,34877..34882,
                     34886..34891,34898..34903,34907..34918,34943..34951,
                     34988..34996,35006..35011))
                     /locus_tag="sll5035"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(34811..34813,34940..34942,34949..34951))
                     /locus_tag="sll5035"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     gene            complement(35079..36365)
                     /locus_tag="sll5036"
                     /db_xref="GeneID:2655987"
     CDS             complement(35079..36365)
                     /locus_tag="sll5036"
                     /note="ORF_ID:sll5036"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfide-quinone reductase"
                     /protein_id="NP_942192.1"
                     /db_xref="GI:38505571"
                     /db_xref="GeneID:2655987"
                     /translation="MAQIVVIGAGLGGLPAAYELRHYLGKAHQVILISEFPQFTFVPG
                     LVQVGLGHIPLDHMQLNVPMLAKRHGFKWVQGKVQKIDPLQKRIYTHETLNYDYLIIA
                     SGAELANDLVPGLGIYTHSICTPSHVLEARTAWETFCQQPGDLVVGAAPGTGCFGPAY
                     EYVLLAEADLRRRGIRDQVKITYITPEPYIGHLGIANMAHSQTLTEALMNKRGIATLT
                     NAQIVNISSDHIFLADGQSFGFAYSMILPAFRGAKFVKASGLGNERGFLPVLPTMRHR
                     DYPEIYGVGVSVHLGQINDTQVSIGTPKSGQMTEAMAMVAAHNIAVELGSIAKPLQVP
                     TLEALCFAEYGDTGIAYIAAPVLPDRLTGKRRYSYAIKGIWVNWAKAAFEKYFLAKMR
                     LGVGLPWFEKLGLRLLFGLSMSRPAMAEDIVQPVNV"
     misc_feature    complement(35127..36356)
                     /locus_tag="sll5036"
                     /note="Uncharacterized NAD(FAD)-dependent dehydrogenases
                     [General function prediction only]; Region: HcaD; COG0446"
                     /db_xref="CDD:223523"
     gene            36483..36866
                     /locus_tag="slr5037"
                     /db_xref="GeneID:2655933"
     CDS             36483..36866
                     /locus_tag="slr5037"
                     /note="slr5037; ORF_ID:slr5037;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942193.1"
                     /db_xref="GI:38505572"
                     /db_xref="GeneID:2655933"
                     /translation="MYYFSKKLLVGFDEAIGLVKDSLAKEGMGIMTEMNLQKAFQQKL
                     HQDFRRYQVLGACHPKVAYEMLQIDDQAGVMFPCNVVVQEHDDGSVEVSAVDPLAMFL
                     MIHSAQAKEIALYASAMMQRVIDHL"
     misc_feature    36579..36773
                     /locus_tag="slr5037"
                     /note="Domain of unknown function DUF302; Region: DUF302;
                     pfam03625"
                     /db_xref="CDD:252066"
     gene            36906..38144
                     /locus_tag="slr5038"
                     /db_xref="GeneID:2655934"
     CDS             36906..38144
                     /locus_tag="slr5038"
                     /note="ORF_ID:slr5038"
                     /codon_start=1
                     /transl_table=11
                     /product="chromate transporter"
                     /protein_id="NP_942194.1"
                     /db_xref="GI:38505573"
                     /db_xref="GeneID:2655934"
                     /translation="MKEIHSLENSQAPKIPNLGEMTWLFLKLGTIGFGGGIAMIALME
                     EEFVKRRNCLETEEFLHGVALGQILGSFPVNTALFIGYRLHGFLGGLIGSMTFLAPSL
                     IMVLVLSWLYFSFNQIPSLQGILAGLAPVVIGIILTAAWSMGQKAIASSVALGIAIGA
                     CVGSLTHINPVIILFTGGMIGLLLKLTPKKIKLKKLADTNQSALVLPVAMQALPHHWA
                     VLAETPVIPGAVSLLTLGWTFLKVGFVFFGGGFVLIPVLKQLLIDNLHWLTQQEFIDG
                     VAISQLTPGPIAVISTFAGFRVGGIMGAMIATFGLFLPSIVLMFVLSKYYQKVRHLQP
                     VKHFLSGVNPAVVGMIVSAAVNLAPGVFLGSESTKIIINLCLLGMTLLVIGKLKWHPA
                     ISLGIGAMTGIAVSFLPGVS"
     misc_feature    36954..37454
                     /locus_tag="slr5038"
                     /note="Chromate transporter; Region: Chromate_transp;
                     pfam02417"
                     /db_xref="CDD:251281"
     misc_feature    37596..38117
                     /locus_tag="slr5038"
                     /note="Chromate transporter; Region: Chromate_transp;
                     pfam02417"
                     /db_xref="CDD:251281"
     gene            complement(38437..38730)
                     /locus_tag="ssl5039"
                     /db_xref="GeneID:2655896"
     CDS             complement(38437..38730)
                     /locus_tag="ssl5039"
                     /note="ORF_ID:ssl5039"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942195.1"
                     /db_xref="GI:38505574"
                     /db_xref="GeneID:2655896"
                     /translation="MDQNEWVIFAELRRSDFELIVSILSDHFPRLEWGSQGDDWLWIY
                     RRDYKLEIDSFSSIELEVKGPRKAYGLAQKVLRPLPPSVFIQVFERPKLDLTR"
     gene            38994..39641
                     /locus_tag="slr5040"
                     /db_xref="GeneID:2655935"
     CDS             38994..39641
                     /locus_tag="slr5040"
                     /note="ORF_ID:slr5040"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="NP_942196.1"
                     /db_xref="GI:38505575"
                     /db_xref="GeneID:2655935"
                     /translation="MLRTGCAWRLLPHDFPKWRTVYGYFQQWHEDGTWKKLNRIFREK
                     VRLKAGRNTHPSAGCLDSQSLKKAGTGQETGYDGGKKVNGRKRTILVDTMGLLLDVVV
                     HGAHRSDHQGLILLGTWFAPLWQCLQVIWTDSTFGGKDFIFWVEHTFGWTLNVVSKKQ
                     GQKGFEVLPRRWVVERTFAWFGRYRRLSKDYEYLPTTSETMLYVAMVHLILQRLA"
     misc_feature    <38994..39239
                     /locus_tag="slr5040"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3293"
                     /db_xref="CDD:225830"
     misc_feature    <38994..39110
                     /locus_tag="slr5040"
                     /note="Putative transposase of IS4/5 family (DUF4096);
                     Region: DUF4096; pfam13340"
                     /db_xref="CDD:257670"
     misc_feature    39156..39620
                     /locus_tag="slr5040"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     misc_feature    <39465..39614
                     /locus_tag="slr5040"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1_2;
                     pfam13586"
                     /db_xref="CDD:257902"
     gene            complement(39660..40208)
                     /locus_tag="sll5041"
                     /db_xref="GeneID:2655984"
     CDS             complement(39660..40208)
                     /locus_tag="sll5041"
                     /note="ORF_ID:sll5041"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="NP_942197.1"
                     /db_xref="GI:38505576"
                     /db_xref="GeneID:2655984"
                     /translation="MDTLLDELLEEYQTPEEILGESGLLKQLTKRLIERALAGELSHH
                     LKNQAEEEKRNSRNGYSKKTVQSEQGEMELAIPRDRQGKFEPVLVPKNERRIAGLDEK
                     ILALYARGMSTRDISPQLEELYGAKVSASMISEVTDAVLEEVKAWQARPLEEIYPIVY
                     LDALYVNIKVSGRISKRAVYIS"
     misc_feature    complement(<39666..40187)
                     /locus_tag="sll5041"
                     /note="Transposase, Mutator family; Region:
                     Transposase_mut; cl19537"
                     /db_xref="CDD:267890"
     misc_feature    complement(<39666..40148)
                     /locus_tag="sll5041"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3328"
                     /db_xref="CDD:225865"
     gene            complement(40411..41253)
                     /locus_tag="sll5042"
                     /db_xref="GeneID:2655985"
     CDS             complement(40411..41253)
                     /locus_tag="sll5042"
                     /note="sll5042; ORF_ID:sll5042;
                     probable sulfotransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942198.1"
                     /db_xref="GI:38505577"
                     /db_xref="GeneID:2655985"
                     /translation="MKCATSTLHEQLALQPGIFMTSLKEPNFFSNDEEFAKGMDYYQS
                     LFAGAQPQDLCGESSTHYTKLPTYPDTVKRLAEAFPQTKFIYVMRHPIDRLVSQYIHE
                     WTQRVVNTDINTAIDQFPEMIEYSLYSKQLQPYFEQFGRERVLPVFFERMLAHSQAEL
                     ERVCNFIGYQGTPIWQELNPQNVSSDRIRISGWRDFLVEAPGLKQLRRWLIPKSLRTW
                     IRSLWSMKKRPQLSNERLAYLKKIFDQDLQVLGSWLGIPLDCTTFKTTVKSQNSAWFK
                     RDQI"
     misc_feature    complement(40519..>41019)
                     /locus_tag="sll5042"
                     /note="Sulfotransferase domain; Region: Sulfotransfer_1;
                     cl19239"
                     /db_xref="CDD:267592"
     gene            complement(41411..42397)
                     /locus_tag="sll5043"
                     /db_xref="GeneID:2655983"
     CDS             complement(41411..42397)
                     /locus_tag="sll5043"
                     /note="sll5043; ORF_ID:sll5043;
                     probable glycosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942199.1"
                     /db_xref="GI:38505578"
                     /db_xref="GeneID:2655983"
                     /translation="MAIIASNNSWDLYQLAVVILNYRTPQLVVDCLASLVSQIDPQTQ
                     QVIVVDNASGDDSVEEIEKAIANNNWQDWVRLLPSDVNGGFSAGNNLGIQAIRAENYL
                     LLNSDTIVRPGAIQTLLVALEQYPEAGLFSPRLEWPDGTPQISCFRDHSPLSEMIDGA
                     RTSVITKLLQPFDVPIPVTEQSFEPQWTSFACVLIRRSVVEQIGLMDDGYFMYYDDID
                     YCRRARQAAWKIRYIPQASVVHLRGGSGSVKSDVASRKRPRPYLYASRSRYFAKFYGP
                     LGLALANLGWLGGWGIAALREILGQKEPHTCDRQWQDIWFQWRQPLKPYRPE"
     misc_feature    complement(41501..42355)
                     /locus_tag="sll5043"
                     /note="Predicted glycosyltransferases [General function
                     prediction only]; Region: COG1216"
                     /db_xref="CDD:224137"
     misc_feature    complement(41672..42349)
                     /locus_tag="sll5043"
                     /note="Subfamily of Glycosyltransferase Family GT2 of
                     unknown function; Region: GT_2_like_c; cd04186"
                     /db_xref="CDD:133029"
     misc_feature    complement(order(42077..42082,42245..42247))
                     /locus_tag="sll5043"
                     /note="Probable Catalytic site; other site"
                     /db_xref="CDD:133029"
     misc_feature    complement(order(41744..41746,41750..41752,42077..42079))
                     /locus_tag="sll5043"
                     /note="metal-binding site"
                     /db_xref="CDD:133029"
     gene            complement(42442..43083)
                     /locus_tag="sll5044"
                     /db_xref="GeneID:2655981"
     CDS             complement(42442..43083)
                     /locus_tag="sll5044"
                     /note="ORF_ID:sll5044"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942200.1"
                     /db_xref="GI:38505579"
                     /db_xref="GeneID:2655981"
                     /translation="MIQEFQRFKILGLPKNAAFFTAVKPSDQGNFPSLGARGCFLSHL
                     GVLKVAKAQNLEQVLLLEDDATFTKDLVQNQTQLLQELQTTSWDFVYFGHNVSANTNS
                     LLHLYDEPIIQAHFLAIHSRIFDQLIDFLETLLERPGGHPDGGPMHVDGAYSTFRQQN
                     PQIKTLVASIPLGFQRASCSSIAPRQWFDRWPAATNIVNLARKAKNIYQKVAV"
     misc_feature    complement(<42874..43068)
                     /locus_tag="sll5044"
                     /note="Glycosyltransferase family 25 [lipooligosaccharide
                     (LOS) biosynthesis protein] is a family of
                     glycosyltransferases involved in LOS biosynthesis. The
                     members include the beta(1,4) galactosyltransferases: Lgt2
                     of Moraxella catarrhalis, LgtB and LgtE of...; Region:
                     Glyco_transf_25; cl01298"
                     /db_xref="CDD:260875"
     gene            complement(43110..43292)
                     /locus_tag="ssl5045"
                     /db_xref="GeneID:2655897"
     CDS             complement(43110..43292)
                     /locus_tag="ssl5045"
                     /note="ORF_ID:ssl5045"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942201.1"
                     /db_xref="GI:38505580"
                     /db_xref="GeneID:2655897"
                     /translation="MFEKPPWSPKFGGKLNQSPPVLGDLGGRIRLYKQILSNLLKGIP
                     CLPLSSTILMAHTLLT"
     gene            complement(43343..44293)
                     /locus_tag="sll5046"
                     /db_xref="GeneID:2655982"
     CDS             complement(43343..44293)
                     /locus_tag="sll5046"
                     /note="ORF_ID:sll5046"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942202.1"
                     /db_xref="GI:38505581"
                     /db_xref="GeneID:2655982"
                     /translation="MNTSFLESPTFLIGAERSGTTLLRLMLSHHSQIAWCNEFEYVID
                     QVSDNAQFPKVSDYQDWLKTHRIFQATGFEVSPNLTYGELVQSFLQQKQAQEQKPVVG
                     ATVHRHFDRLLAIWPNARFIHIVRDPRDVARSCIGMGWAGNVWTGSQRWLEAEQDWEA
                     LKQTLPVNNYVEISYENLIREPQTVLTQLANFLGVAYDPAMLQYNQDTTYDQPDSSFL
                     NQWRRKLGDREIQLVESRVGDLLLQRGYEASGLPTIQLTSSQIKSLKLQDWWARANFR
                     LQRYGAVLFTLNYITSRLPLRAWRDRIQLKINQIDLEYIK"
     misc_feature    complement(43643..44275)
                     /locus_tag="sll5046"
                     /note="Sulfotransferase domain; Region: Sulfotransfer_1;
                     cl19239"
                     /db_xref="CDD:267592"
     gene            complement(44338..45855)
                     /locus_tag="sll5047"
                     /db_xref="GeneID:2655980"
     CDS             complement(44338..45855)
                     /locus_tag="sll5047"
                     /note="ORF_ID:sll5047"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942203.1"
                     /db_xref="GI:38505582"
                     /db_xref="GeneID:2655980"
                     /translation="MTPQAQLVLLLWLPVILYFFRRYPPRTAVMVSFLGGLLFLPQRT
                     GFALPLIPDYQGMVATCYGIVVGLCIHDLERLKKFRIEWLDIPMMLWCISPFMSSVTN
                     GLGAYDGVNESITQTVVWGLPYMLGKLYFNRLIYLKQLAEGIIKAGLIYVPICLWEGR
                     MSPNLHLIVYGYYAHPSGISQAIRYGGYRPNGFMQHGLMVGMWMMTVALITIWLWQSK
                     TFTKIWNYEIKSLIPVLVFTVIWCRSTGAYGYFFYGLIILFTAKFLKSNLPLLILIFG
                     LGWFLYMNVTGQFHGDKILAFLSEYTNPDRIQSLGFRWINEEILAEKARERFWFGWAG
                     WKRNRVYEENWIGEIVDVSVTDSLWIIAFGIQGAFGLLNLTLALLLPPAVFATFRYPA
                     KLWLHPKVAPAAALATCLVLFKLDSVINNMYNPIFPLISGGLAGLCLQPPESLKPQSR
                     SPAVKQVKKQKQKSSEQGKLKTKPGRSKSGSGKRSKVRRKVVHRAGTKSDSDPSS"
     misc_feature    complement(44746..45165)
                     /locus_tag="sll5047"
                     /note="O-antigen ligase like membrane protein; Region:
                     O-antigen_lig; pfam13425"
                     /db_xref="CDD:257750"
     gene            complement(45852..46940)
                     /locus_tag="sll5048"
                     /db_xref="GeneID:2655974"
     CDS             complement(45852..46940)
                     /locus_tag="sll5048"
                     /note="sll5048; ORF_ID:sll5048;
                     probable glycosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942204.1"
                     /db_xref="GI:38505583"
                     /db_xref="GeneID:2655974"
                     /translation="MKITFVLPYAGLAGGIRVVAIYADRLQKRGHEVFIISQPLPKPG
                     IKQRISQWLRGKKTPAQPSASHFDGLNVPHKVLETCRAVGDRDLPDGDVVIATWWGTA
                     EWVAKLSPSKGQKVYFVQHHEIHPYFPVERVKATYRLPLYKIVIAEWLKKVMAEEYGD
                     SQVSLVPNSVDLELFSASPRGRQTVPTVGFMYSTKAWKGTDLAIQGWQLAQEKLPNLK
                     GIAFGSEPVSSNLPLPEAIAYHHKVAQEKLKEIYASCDAWLFTSRLEGFGLPILEAMA
                     CRTPVIGTPTGAAPELIEQGGGILVPPEDPAEIAAAIVKICTQPLEQWQTLSDKAYQT
                     ASCYSWDDATTLFEQALEEATMATANDP"
     misc_feature    complement(45876..46940)
                     /locus_tag="sll5048"
                     /note="Glycosyltransferase [Cell envelope biogenesis,
                     outer membrane]; Region: RfaG; COG0438"
                     /db_xref="CDD:223515"
     misc_feature    complement(45885..46937)
                     /locus_tag="sll5048"
                     /note="Glycosyltransferases catalyze the transfer of sugar
                     moieties from activated donor molecules to specific
                     acceptor molecules, forming glycosidic bonds. The acceptor
                     molecule can be a lipid, a protein, a heterocyclic
                     compound, or another carbohydrate...; Region:
                     Glycosyltransferase_GTB_type; cl10013"
                     /db_xref="CDD:263942"
     gene            complement(46945..48288)
                     /locus_tag="sll5049"
                     /db_xref="GeneID:2655975"
     CDS             complement(46945..48288)
                     /locus_tag="sll5049"
                     /note="sll5049; ORF_ID:sll5049;
                     similar to polysaccharide biosynthesis protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942205.1"
                     /db_xref="GI:38505584"
                     /db_xref="GeneID:2655975"
                     /translation="MASLNKLAIRGTIWTFVGYGSSQVLRLAGNLVLTRLLVPEMFGL
                     MALVNTFIIGLNLFSDIGIGPSIIQNKRGDEPSFLNTAWTIQVIRGVGLWLCCCLIAL
                     PVSRFYGDRQLIWLLPLVGFSTIIAGFNSTALFTLNRKIDLGKLTRFEFIVQSIGLVV
                     MIVWAWFNPTIWALVMGNFVLSLVKMIWSHYLVAEPRNRFTWDPTALQEIARFGRWIF
                     VSTAMTFLATQADRLILGKIFSLTLLGVYTIAFTLAELPRQVLSRVNGKVMFPVISQQ
                     IDLPRAELRSKILKKRWLLLGALAIAIAVMISFGDWLILFLYDERYRAGAWMLPILAA
                     GLWLPTLALTIDPVLYALGKPQLVAIGNFAKFAYMLIFIPLGFHSFGVLGAVIVVAAN
                     DLPYYLAVAYGVWQEKLSGFRQDLLSTLLLLGVASLLITIRWSLGLGLPIEALWS"
     misc_feature    complement(47083..48267)
                     /locus_tag="sll5049"
                     /note="Multidrug and toxic compound extrusion family and
                     similar proteins; Region: MATE_like; cl09326"
                     /db_xref="CDD:263758"
     gene            complement(48291..49616)
                     /locus_tag="sll5050"
                     /db_xref="GeneID:2655972"
     CDS             complement(48291..49616)
                     /locus_tag="sll5050"
                     /note="sll5050; ORF_ID:sll5050;
                     probable glycosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942206.1"
                     /db_xref="GI:38505585"
                     /db_xref="GeneID:2655972"
                     /translation="MVRSPQFRAQLALEAVKEVKIHLGGSNQWKRKLVQEFMKVAYLI
                     NQYPKISHSFIRREILALEELGVVVERISVRPIAQTDLADEADRQECQRTRALLGAGL
                     IPLLGSGLFLAISRLPPWLKTLGLTIQVGRRSHRGLLRHFAYFLEACLLWRWLKAAGI
                     THIHAHFGTNSTTVAMLCASLGDISYSFTVHGPEEFDRPEAIAIPEKISRARFVVAIS
                     SYGKSQLYRWCSLADWPKIQVVHCALAADYLQQEITPVPEVPQLVCVGRLCEQKGQLL
                     LVQAVRQLRDNGIAVKLVLVGDGELRSPIEELIEQYQLEENITITGWASSAMVQQHLL
                     ASRAMVLPSFAEGLPVVIMEAFALGRPVISTYVAGIPELVKPGVSGWLVPPGSIPDLV
                     EAMQSVLTMSCEQLTAMAAMGQQAVQMDHDVHKEAEKLAQHFHTYASAP"
     misc_feature    complement(48315..49505)
                     /locus_tag="sll5050"
                     /note="Glycosyltransferase [Cell envelope biogenesis,
                     outer membrane]; Region: RfaG; COG0438"
                     /db_xref="CDD:223515"
     misc_feature    complement(48327..49502)
                     /locus_tag="sll5050"
                     /note="This is a family of GT1 glycosyltransferases found
                     specifically in certain bacteria. amsK in Erwinia
                     amylovora, has been reported to be involved in the
                     biosynthesis of amylovoran, a exopolysaccharide acting as
                     a virulence factor; Region: GT1_amsK_like; cd03799"
                     /db_xref="CDD:99972"
     misc_feature    complement(order(48564..48566,48630..48632,48816..48824,
                     49419..49421))
                     /locus_tag="sll5050"
                     /note="putative ADP-binding pocket [chemical binding];
                     other site"
                     /db_xref="CDD:99972"
     gene            49707..50099
                     /locus_tag="slr5051"
                     /db_xref="GeneID:2655936"
     CDS             49707..50099
                     /locus_tag="slr5051"
                     /note="ORF_ID:slr5051"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942207.1"
                     /db_xref="GI:38505586"
                     /db_xref="GeneID:2655936"
                     /translation="MPTVETDLAQILERIDGKLDRIEKDISDIKVSQAEVKGEIRTLD
                     ERLSGQIKATDEKLSGQIKTTDEKLSGQIKTLDERLSGEISTLDEKVTGIGKRLENQE
                     FTSRGILTALIIALIAGAAKFFGIFPNP"
     misc_feature    49725..>49940
                     /locus_tag="slr5051"
                     /note="Syntaxin N-terminus domain; syntaxins are nervous
                     system-specific proteins implicated in the docking of
                     synaptic vesicles with the presynaptic plasma membrane;
                     they are a family of receptors for intracellular transport
                     vesicles; each target membrane may...; Region: SynN;
                     cd00179"
                     /db_xref="CDD:238105"
     gene            complement(50111..52333)
                     /locus_tag="sll5052"
                     /db_xref="GeneID:2655973"
     CDS             complement(50111..52333)
                     /locus_tag="sll5052"
                     /note="sll5052; ORF_ID:sll5052;
                     similar to exopolysaccharide export protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942208.1"
                     /db_xref="GI:38505587"
                     /db_xref="GeneID:2655973"
                     /translation="MAHDEAEEFLATEEAEIEAVSPPATSKNLVRVYLNLVLRKWFII
                     VAFAGAGLVVTSYLSTQDPSTYVGRFEILIEPVTSAEKLTDASVLTRSNDLPSQELLN
                     LDYPTQLKILKSTVLLSKIAAEVHNILPQIPEAAMLQNLQKNLIVKRVQEGNSRFDYT
                     KILEVIYEGNDAVLVETVLKVTAEQYLQYSLQERENSLQAGVSFIDEQIPILETQIRA
                     LQGQQRTLQQRYNIISPNQQATNLNEAYQANQLDIQKIDEELEELRSLKSNLESTLGL
                     SPSEALVVLDLSQNPERQNLLQQLQEVETMIAAESSRFTNENPIMQDLFQKRNNLQTL
                     LETRTKEILKSSSLKGDNNPNIFMFQNTSRITMLDQLIVTQNEIAKRLTRRQVLVANQ
                     ERLRINLDQFPTIAAQYDEVARQLDLKKGLLDTLANQRETLRVEAAQQDVPWKIISAP
                     AIPRGPDGLPISFPPDPKKKMIAGMGSGLVLGLLLAIAWERSRNIFYSNSDLKFGLGY
                     SVWGELPLLDSGIAHDKDALEDEVLPTEANEAIVAMGEDRGQQIYTNFYFQYQEQGIR
                     SMAMTAIDNESGQASVTMQFARAAVNAGQTVLVIDTNLQHPDIHHHGNNTDELEQGLV
                     NVLNSDTDPQQLLNLVHYEDGLAIIPVGTMNAGHPIRLQRWLSRLDPALQTLTHKYDL
                     VIYNAPLLTVPDTPFLLNRTDGVCLIVRLKYTSQSQTHQALTTVEKFQIPVLGVIATI
                     "
     misc_feature    complement(50918..52285)
                     /locus_tag="sll5052"
                     /note="Uncharacterized protein involved in
                     exopolysaccharide biosynthesis [Cell envelope biogenesis,
                     outer membrane]; Region: GumC; COG3206"
                     /db_xref="CDD:225747"
     misc_feature    complement(50120..>50602)
                     /locus_tag="sll5052"
                     /note="ATPases involved in chromosome partitioning [Cell
                     division and chromosome partitioning]; Region: Mrp;
                     COG0489"
                     /db_xref="CDD:223563"
     misc_feature    complement(50180..>50545)
                     /locus_tag="sll5052"
                     /note="The Fer4_NifH superfamily contains a variety of
                     proteins which share a common ATP-binding domain.
                     Functionally, proteins in this superfamily use the energy
                     from hydrolysis of NTP to transfer electron or ion;
                     Region: Fer4_NifH; cl17203"
                     /db_xref="CDD:266552"
     gene            52552..52992
                     /locus_tag="slr5053"
                     /db_xref="GeneID:2655990"
     CDS             52552..52992
                     /locus_tag="slr5053"
                     /note="ORF_ID:slr5053"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942209.1"
                     /db_xref="GI:38505588"
                     /db_xref="GeneID:2655990"
                     /translation="MVAIAKLSASQPGRVKTLSEHPFPYPQQVTLPSWQLKNSKTAIV
                     AGKSPGQRYILQKGDITATITACLNPNAPSTLTEQQFISNKYRHNLHFFAWLAGQKDL
                     TDSSCLWTLISAPIAPDATPDEITQTFQQLETAWVEWYQWWQLH"
     misc_feature    52609..52989
                     /locus_tag="slr5053"
                     /note="cyanosortase-associated protein; Region:
                     cyanosort_assoc; TIGR04153"
                     /db_xref="CDD:234484"
     gene            53037..54026
                     /locus_tag="slr5054"
                     /db_xref="GeneID:2655991"
     CDS             53037..54026
                     /locus_tag="slr5054"
                     /note="slr5054; ORF_ID:slr5054;
                     probable glycosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942210.1"
                     /db_xref="GI:38505589"
                     /db_xref="GeneID:2655991"
                     /translation="MEDLGIVVIGRNEGDRLKDCLRSVVEAGLVIYVDSGSTDNSIEF
                     AESLDVVVVRLDLAQPFTAARARNAGLAKLLELQRSTKYVQFVDGDCEVITNWLATAY
                     QFLEENRAIAVVCGRRRERYPEQSIYNQLCDLEWDTPVGQTKACGGDAMVRVTAFQTV
                     GGFNEGLIAGEEPELCVRLRQQQWQIWRLDTEMTWHDANMLHWHQWWKRHVRAGFAFA
                     EGAWLHGQPPEKHWVKESRSIWFWALIIPVVSLGSSCPTFGLSLVLLLGYPLIIYKTA
                     RYFQQQGLSAQLAWLYATSCLLAKFPQFIGQLRFHWLRLTKQTATIVEYKARS"
     misc_feature    53043..53672
                     /locus_tag="slr5054"
                     /note="Glycosyltransferase like family 2; Region:
                     Glyco_tranf_2_3; pfam13641"
                     /db_xref="CDD:257951"
     misc_feature    53052..53519
                     /locus_tag="slr5054"
                     /note="Glycosyl transferase family 2; Region:
                     Glycos_transf_2; pfam00535"
                     /db_xref="CDD:249939"
     misc_feature    order(53061..53063,53067..53069,53133..53135,53298..53300,
                     53304..53306)
                     /locus_tag="slr5054"
                     /note="active site"
                     /db_xref="CDD:132997"
     misc_feature    <53472..53642
                     /locus_tag="slr5054"
                     /note="N-terminal domain of galactosyltransferase; Region:
                     Glyco_transf_7C; cl17476"
                     /db_xref="CDD:266715"
     gene            54119..54910
                     /locus_tag="slr5055"
                     /db_xref="GeneID:2655867"
     CDS             54119..54910
                     /locus_tag="slr5055"
                     /note="slr5055; ORF_ID:slr5055;
                     similar to UDP-N-acetyl-D-mannosaminuronic acid
                     transferase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942211.1"
                     /db_xref="GI:38505590"
                     /db_xref="GeneID:2655867"
                     /translation="MNSITLLNTTIHNYSMVELLEDLNKRGGFVVTPNVDHMVKLQED
                     AELQEVYQVADYRVCDSKIIEYILKLLGTPIKEKISGSDLFPAFYEYNKDNTDTKIFL
                     LGAKEGVADRARQKINEKVGREMIVDSYSPSFGFEQNPEECAYILERIKQSGATVLAV
                     GLGAPKQEKWIAKYRHQLPNIKIFLAIGATIDFEAGEKARSPQWMSKVGLEWLHRLAS
                     EPQRLWKRYLVESLPFFALVLQYKLQTLLSEPAYPQLSTADSRTV"
     misc_feature    54269..54799
                     /locus_tag="slr5055"
                     /note="The glycosyltransferase WecG/TagA superfamily
                     contains Escherichia coli WecG, Bacillus subtilis TagA and
                     related proteins. E. coli WecG is believed to be a
                     UDP-N-acetyl-D-mannosaminuronic acid transferase, and is
                     involved in enterobacterial common...; Region:
                     Glyco_transf_WecG_TagA; cd06533"
                     /db_xref="CDD:119439"
     gene            54911..56281
                     /locus_tag="slr5056"
                     /db_xref="GeneID:2655868"
     CDS             54911..56281
                     /locus_tag="slr5056"
                     /note="slr5056; ORF_ID:slr5056;
                     probable glycosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942212.1"
                     /db_xref="GI:38505591"
                     /db_xref="GeneID:2655868"
                     /translation="MFRGCLAKEWGNFEGRSPCPIAIRVLDNLNDLTLPQVSFHSPLS
                     SQLAAMLITVFISAIAVVVLVPSAILLLECGAACLAPSERTQAVPGNQARTPAGLRVA
                     VLVPAHNEAQVIAETLQSIQPQLTPADTLLVVADNCTDTTAIIAEREGATVIERIDQE
                     KRGKGYALDYGVQYLAQHREPDIVILMDADCYVHPNCIEQLTTMAAQRQRPIQSCYVM
                     ATPAEPSIKDRLSAFAFLVKNWVRPLGLSQLGAPCLLTGTGMAFPWTILKNAPLASDN
                     IVEDMQLGLDLAIAGYAPLFCPMALVTGLLPKAQDTAIQQRTRWEHGHLKTFISQAPR
                     LLKAAIGQVRLDLLALVGELSIPPISFLVLLWLTYAFVSLLASLASDSYLPLLLATIA
                     GAMLGMAILLAWMKAAQEILPFTTLLMTPLYLLWKIPLYFNFFRKPQTNWNKTKRDTA
                     IGKRDT"
     misc_feature    55208..55879
                     /locus_tag="slr5056"
                     /note="Glycosyltransferase like family 2; Region:
                     Glyco_tranf_2_3; pfam13641"
                     /db_xref="CDD:257951"
     misc_feature    55217..55759
                     /locus_tag="slr5056"
                     /note="EpsO protein participates in the methanolan
                     synthesis; Region: EpsO_like; cd06438"
                     /db_xref="CDD:133060"
     misc_feature    55472..55480
                     /locus_tag="slr5056"
                     /note="DXD motif; other site"
                     /db_xref="CDD:133060"
     gene            complement(56854..57807)
                     /locus_tag="sll5057"
                     /db_xref="GeneID:2655970"
     CDS             complement(56854..57807)
                     /locus_tag="sll5057"
                     /note="sll5057; ORF_ID:sll5057;
                     probable glycosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942213.1"
                     /db_xref="GI:38505592"
                     /db_xref="GeneID:2655970"
                     /translation="MASTIQLIEVPQSFCQQEVAFIQSQLAEWFEAEAQVGRLVFDFA
                     KTRVLDSAAIVYLRQLSQQAKDKGVELLGWSLRPQLKQVLTLAGIDQYFTFTETTNQV
                     FGDNVDVAFDQQVHPSVISKGKRLLDIVGALVGLTITSVLFIPLAIAIKLDSPGPVLF
                     SQTRCGYKGQQFKIWKFRSMVTNAEALKHQVENEIDGAFFKNTNDPRITKVGKFLRKT
                     SLDEFAQFWNVLIGEMSLVGTRPPTLDEVAQYNSHQSNRLEVKPGLTGEWQVNGRSTV
                     LNFDQVVEMDLNYQKRWSLGYDIKLILKTIQVVFSKRSGAC"
     misc_feature    complement(57517..>57735)
                     /locus_tag="sll5057"
                     /note="Sulphate Transporter and Anti-Sigma factor
                     antagonist) domain of anti-anti-sigma factors, key
                     regulators of anti-sigma factors by phosphorylation;
                     Region: STAS_anti-anti-sigma_factors; cd07043"
                     /db_xref="CDD:132914"
     misc_feature    complement(order(57541..57543,57547..57552,57562..57564,
                     57628..57633,57640..57648,57652..57660,57664..57666,
                     57727..57729))
                     /locus_tag="sll5057"
                     /note="anti sigma factor interaction site; other site"
                     /db_xref="CDD:132914"
     misc_feature    complement(57655..57657)
                     /locus_tag="sll5057"
                     /note="regulatory phosphorylation site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:132914"
     misc_feature    complement(56872..57438)
                     /locus_tag="sll5057"
                     /note="Bacterial sugar transferase; Region: Bac_transf;
                     pfam02397"
                     /db_xref="CDD:251270"
     gene            57972..60323
                     /locus_tag="slr5058"
                     /db_xref="GeneID:2655931"
     CDS             57972..60323
                     /locus_tag="slr5058"
                     /note="slr5058; ORF_ID:slr5058;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942214.1"
                     /db_xref="GI:38505593"
                     /db_xref="GeneID:2655931"
                     /translation="MAKRSLKASPDGQAQAKQAMLCRGWTQEYLAIEAGLSTRNSVWK
                     FLTGRPVDRNIFMEICFQLDLDWQDIADLPTFPLEKVKATEPVDRPVTDESLKTTTIP
                     DVPDLAIIKTKFKVLVDTWCSRLPSYVDSNQSLLLTEVYVDVQVFPFAPDQQWLAQQN
                     SLTGLRANTFSNQRLAPTSKREQSVSALESVLQHNHVMVLGKPGTGKTLFLKYLALQC
                     YGQSAGFDLLPIFVSLRSFVEFIEAYENADLFSYLEHILRQAALSEAEVDYLFEQHKL
                     LLLLNAFDEVSVEKADFVYQKIYQFTEKYHQNKIIISCRSASQNYYFQGFTHLELAGF
                     SSPQIQQFTQRWFSATLQDSEQGEQKAAQFLETLSRQDNQAIQELAHTPILLALLCSV
                     FLARSEFPNKRSRLYQEALAILLTRWDQTRGIKRDQIYENLTLLDKLKLLSTIAAIAF
                     EQGQYLIEQEELLQIILDFLSTLPNADDDLDALWLNSETLLKEMEIQQGIIVQMAKGV
                     YAFSHLTFQEYLTARKIVVDSTSEFPTLSLQELADHVMMPQWREVILLTVEMLPDPVK
                     LLRLIQSQIDGLLRNDVGLQQFLQHVATKAESLDVPYLSAAVRAFYLGLFCGRELNLA
                     SALDPKIVGDLAPDMALDLALLRVLHLGERLIEQPTLEKLLELGFGLDLENRFTLTAP
                     LLGSLHRLKQRLPASSQDLDTQLTWWQQEGHGWCEAWRQMLIEQRGFGQPWQLTGSQQ
                     EKLEDYYQGNLFLLECLEQVTTRYRKAIAAQLLLPHDQGEKVS"
     misc_feature    57972..60296
                     /locus_tag="slr5058"
                     /note="Predicted NTPase (NACHT family) [Signal
                     transduction mechanisms]; Region: COG5635"
                     /db_xref="CDD:227922"
     misc_feature    58512..58853
                     /locus_tag="slr5058"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    58572..58595
                     /locus_tag="slr5058"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    58575..58598
                     /locus_tag="slr5058"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     gene            complement(60291..61199)
                     /locus_tag="sll5059"
                     /db_xref="GeneID:2655971"
     CDS             complement(60291..61199)
                     /locus_tag="sll5059"
                     /note="ORF_ID:sll5059"
                     /codon_start=1
                     /transl_table=11
                     /product="two-component response regulator"
                     /protein_id="NP_942215.1"
                     /db_xref="GI:38505594"
                     /db_xref="GeneID:2655971"
                     /translation="MTETSPTVDEQRSPLILVTDDDNSLRSLLVMALRADGYVIEEAV
                     NGQECLAKYQRLQPDLVILDAMMPEMDGFTCCQQLRQFPQSLNIPILMITFLDDRESI
                     EQAFTAGATDYITKPIHWSVLKQRVRYLLSASQSLKQGAIQQQQLDRQLIWQEDWSEL
                     LAQLAAVKSLTTDLVSGLEPLREGLGIDRFVVYGADLTPQLESVAANSPSALNYSLLD
                     LGLNQLLPSGEILAIADIPQSSLSPASKTKLKDLQTTALLLIPIGSSSKPLGWLGLYR
                     QFTGEWDSFVQGRCQDLANLFALVMG"
     misc_feature    complement(60807..61151)
                     /locus_tag="sll5059"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(60849..60854,60861..60863,60918..60920,
                     60984..60986,61008..61010,61137..61142))
                     /locus_tag="sll5059"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(61008..61010)
                     /locus_tag="sll5059"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(60984..60992,60996..61001))
                     /locus_tag="sll5059"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(60846..60854)
                     /locus_tag="sll5059"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            complement(61202..64831)
                     /locus_tag="sll5060"
                     /db_xref="GeneID:2655968"
     CDS             complement(61202..64831)
                     /locus_tag="sll5060"
                     /note="ORF_ID:sll5060"
                     /codon_start=1
                     /transl_table=11
                     /product="two-component hybrid sensor and regulator"
                     /protein_id="NP_942216.1"
                     /db_xref="GI:38505595"
                     /db_xref="GeneID:2655968"
                     /translation="MINSGTLITKIEELQSTLAKMDIALGTVDEAIVWTDGTGQIQWC
                     NTAFDHLMGKLHILILGKNLVELLPLHRNSQPLEVSHHPFTIIVATQQKFTDHYEFNQ
                     NGKWLHLEIMTSPLMNAQGAVLVIRDISDRHLQEQTLQQLNENLEKRVLERTQAVSLI
                     NNKLEQELRERKKTEIALKATTSRLEALIQNLQAGVLVENENGKIVLVNQVFCDLFGI
                     DVPPEKLIGFDCRQSAQFAKILFEDPEAFIIGIDNILQNRQIVTNEELRLKDGRTFAR
                     DYVPIEVGNHHDGRLWLYRNITPQKQAEVSLRKQYQRTLLLKEITEEIRQSLDPVKIF
                     QVAVSRLGQTLQVSRCIVHLYSDMPQPHLTCVAEYLIPGMTSMLDLNLLIADNPHLLR
                     ALNQDDAVQVDNLKMVPTAVPLQDFYNQLQVYSLLIIRTSYQDKTNGLLILHQCDRSR
                     SWNTEEVELVKAVADQVGIALAQAKLLEQEREIRQQLIEQNKALMTATKAAEDANRAK
                     SDFLATMSHEIRTPMNAVIGMTGLLLDTHLNTQQQQFTETIRSSGEALLSLINDILDF
                     SKIESGQFKLEIHPFEIQQCVEECLDLVAPQAFAKKLDLVYQIEPQVPMAILGDLTRV
                     RQVLVNILANAVKFTTSGSIQVRVSATVANQQQNKYTIQFSIKDTGIGISPDQQSALF
                     KSFSQVNTSIARKYGGTGLGLAICKRLTEMMGGQIWVESYGEIAGNPPVDWAKTSKNN
                     PLESTGATFYFTITAQSTTIVRRPNDLSCQLSLAGKRLLIVDDNQLSCEGLKQLVTAW
                     GLQAQATTSGWEAFSWLRQGECFDLAIIDLQMEEVDGLQLAEALRTLPTGESLPLVIL
                     TPSPTSLAELSARTDISIAACLSSPIKKSLVYEVLCEVFKADETDNSLFNGDWRSGIT
                     EAVKRTCSPQEREARIKTLSPLRILLVEDNNINQRVALLMLEKLGYRPDIAGNGLEAL
                     QVLHQASYDVILMDVEMPEMDGLSATKAIRQDFPADEQPWIIAVTAYAMQGDRETCLA
                     AGMNDYITKPIRENDLLDALQRIDFSVLSLTKNKPAPLSEPVVNVGLVNPVPEVLKAD
                     QLEENLVLDLSILTGIREMAGPDGATFLQVIIGDYLHTTPSLLEKLKTAIAAQEIDTV
                     RATAHSLGSSSANLGAVEFAKQCKQLENLARSGMLSGVDGQYIQLEKEYEKVSQALAL
                     QLNPN"
     misc_feature    complement(63920..64741)
                     /locus_tag="sll5060"
                     /note="FOG: PAS/PAC domain [Signal transduction
                     mechanisms]; Region: AtoS; COG2202"
                     /db_xref="CDD:225112"
     misc_feature    complement(<64010..64258)
                     /locus_tag="sll5060"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(64019..64021,64034..64036,64109..64117,
                     64124..64126,64178..64180,64196..64198,64208..64210))
                     /locus_tag="sll5060"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(64079..64084,64091..64093,64115..64117,
                     64133..64135))
                     /locus_tag="sll5060"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    complement(63380..63898)
                     /locus_tag="sll5060"
                     /note="FOG: GAF domain [Signal transduction mechanisms];
                     Region: FhlA; COG2203"
                     /db_xref="CDD:225113"
     misc_feature    complement(63128..63319)
                     /locus_tag="sll5060"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(63143..63145,63155..63157,63164..63166,
                     63176..63178,63185..63187,63197..63199,63245..63247,
                     63254..63256,63266..63268,63275..63277,63287..63289,
                     63299..63301))
                     /locus_tag="sll5060"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(63281..63283)
                     /locus_tag="sll5060"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(62669..62959)
                     /locus_tag="sll5060"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(62669..62671,62675..62677,62723..62734,
                     62813..62818,62822..62824,62828..62830,62834..62836,
                     62921..62923,62930..62932,62942..62944))
                     /locus_tag="sll5060"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(62930..62932)
                     /locus_tag="sll5060"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(62726..62728,62732..62734,62816..62818,
                     62822..62824))
                     /locus_tag="sll5060"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(<62261..62497)
                     /locus_tag="sll5060"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(62261..62263,62327..62329,62351..62353,
                     62483..62488))
                     /locus_tag="sll5060"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(62351..62353)
                     /locus_tag="sll5060"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(62327..62335,62339..62344))
                     /locus_tag="sll5060"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(61673..62017)
                     /locus_tag="sll5060"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(61712..61717,61724..61726,61781..61783,
                     61850..61852,61874..61876,62003..62008))
                     /locus_tag="sll5060"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(61874..61876)
                     /locus_tag="sll5060"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(61850..61858,61862..61867))
                     /locus_tag="sll5060"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(61709..61717)
                     /locus_tag="sll5060"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(<61295..61477)
                     /locus_tag="sll5060"
                     /note="Histidine Phosphotransfer domain, involved in
                     signalling through a two part component systems in which
                     an autophosphorylating histidine protein kinase serves as
                     a phosphoryl donor to a response regulator protein; the
                     response regulator protein is...; Region: HPT; cd00088"
                     /db_xref="CDD:238041"
     misc_feature    complement(order(61313..61315,61322..61324,61367..61372,
                     61379..61381))
                     /locus_tag="sll5060"
                     /note="putative binding surface; other site"
                     /db_xref="CDD:238041"
     misc_feature    complement(61379..61381)
                     /locus_tag="sll5060"
                     /note="active site"
                     /db_xref="CDD:238041"
     gene            complement(64868..65245)
                     /locus_tag="sll5061"
                     /db_xref="GeneID:2655969"
     CDS             complement(64868..65245)
                     /locus_tag="sll5061"
                     /note="sll5061; ORF_ID:sll5061;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942217.1"
                     /db_xref="GI:38505596"
                     /db_xref="GeneID:2655969"
                     /translation="MITLTSPGDSTELPLIATDHLGIVIRINTAFEETYGWSAADLVG
                     QPLTLILPSYFQDSHHLGFARFNTTSISTILNHPLQLKVVTKDQQEVDSEHFIIVEKQ
                     GEQWIFAATLRPLITEENEERTI"
     misc_feature    complement(64871..65206)
                     /locus_tag="sll5061"
                     /note="PAS domain; Region: PAS_9; pfam13426"
                     /db_xref="CDD:257751"
     misc_feature    complement(<65069..65206)
                     /locus_tag="sll5061"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(65087..65098,65135..65137,65153..65155,
                     65165..65167))
                     /locus_tag="sll5061"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     gene            complement(65331..65786)
                     /locus_tag="sll5062"
                     /db_xref="GeneID:2655967"
     CDS             complement(65331..65786)
                     /locus_tag="sll5062"
                     /note="ORF_ID:sll5062"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942218.1"
                     /db_xref="GI:38505597"
                     /db_xref="GeneID:2655967"
                     /translation="MGSFGLLFSDEPTCLHTIQEYGLRFDIEEAFLDDQSNGWNLQKS
                     EIRFVCALSRLFFLLALATLYATAQGVEVFATGKHRWVAPHWFRGNSYFRIGWDWLKT
                     SLEQGWTLIRHVRFTHALDPQPAMASRKLHHQRIYSIEFKINIYCYPVD"
     gene            complement(65758..66411)
                     /locus_tag="sll5063"
                     /db_xref="GeneID:2655965"
     CDS             complement(65758..66411)
                     /locus_tag="sll5063"
                     /note="ORF_ID:sll5063"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942219.1"
                     /db_xref="GI:38505598"
                     /db_xref="GeneID:2655965"
                     /translation="MIALLQRGEVSLTLWLPYIPCRGVQAQSKQRRLSRWLHNSRLNV
                     HRLYKSLIQAALADWQEEILYLSLDTSLFWDEYCLVRLAVVYRGRALPVVWRVLKHRS
                     ASIAFRQYWEMLYQAANRLSQGVKVVLLADRGFIHTDAMTAVTTHLGWHYRIRLKRNT
                     WIWRAGHGWCQFKDIHLQRGEAFCWHNVRLHKGDYYGPVHVAFGCNNVNGEFWAIVQ"
     gene            complement(66782..67072)
                     /locus_tag="ssl5064"
                     /db_xref="GeneID:2655898"
     CDS             complement(66782..67072)
                     /locus_tag="ssl5064"
                     /note="ssl5064; ORF_ID:ssl5064;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942220.1"
                     /db_xref="GI:38505599"
                     /db_xref="GeneID:2655898"
                     /translation="MKDNRYSPDWPQLALSKKQSVNWICERCGVQCLKPGEGKGLLKE
                     ERYRLRMAVHHCDYDPSNNSPSNLMALCSPCHLYYHRRQRGNVTPGQLLLLR"
     misc_feature    complement(<66824..>67006)
                     /locus_tag="ssl5064"
                     /note="HNH nucleases; HNH endonuclease signature which is
                     found in viral, prokaryotic, and eukaryotic proteins. The
                     alignment includes members of the large group of homing
                     endonucleases, yeast intron 1 protein, MutS, as well as
                     bacterial colicins, pyocins, and...; Region: HNHc;
                     cl00083"
                     /db_xref="CDD:260180"
     gene            complement(67163..67378)
                     /locus_tag="ssl5065"
                     /db_xref="GeneID:2655899"
     CDS             complement(67163..67378)
                     /locus_tag="ssl5065"
                     /note="ORF_ID:ssl5065"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942221.1"
                     /db_xref="GI:38505600"
                     /db_xref="GeneID:2655899"
                     /translation="MGRLSKVFDTAKAESVPEPEITKARSNEFVNLNFKVTPEMRRKL
                     KQYAAKHDLSLKEVFEAALDFYIEHHP"
     gene            complement(67362..67976)
                     /locus_tag="sll5066"
                     /db_xref="GeneID:2655966"
     CDS             complement(67362..67976)
                     /locus_tag="sll5066"
                     /note="sll5066; ORF_ID:sll5066;
                     probable plasmid partitioning protein, ParA family"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942222.1"
                     /db_xref="GI:38505601"
                     /db_xref="GeneID:2655966"
                     /translation="MKIIAVTGYKGGVGKTITSIHIARYLADKGKVLLIDSDPNRSVE
                     KWAARGEKQPLFKVKNEKSAPAHIAGNDFLVLDTPARPDSNELKEISQEAHLTILPCV
                     PDAISLDPMLQMFHDLFPGAVYRVLITIAPPYPSKSADELRSVLAENQIEVFKGFIRR
                     SASVVKAIDMGVTTAEMKGRDHYPWQDYKTIGKEIMEVINGTAQ"
     misc_feature    complement(67374..67976)
                     /locus_tag="sll5066"
                     /note="ATPases involved in chromosome partitioning [Cell
                     division and chromosome partitioning]; Region: Soj;
                     COG1192"
                     /db_xref="CDD:224113"
     misc_feature    complement(67590..67970)
                     /locus_tag="sll5066"
                     /note="ParA and ParB of Caulobacter crescentus belong to a
                     conserved family of bacterial proteins implicated in
                     chromosome segregation. ParB binds to DNA sequences
                     adjacent to the origin of replication and localizes to
                     opposite cell poles shortly following the...; Region:
                     ParA; cd02042"
                     /db_xref="CDD:238997"
     misc_feature    complement(67929..67949)
                     /locus_tag="sll5066"
                     /note="P-loop; other site"
                     /db_xref="CDD:238997"
     misc_feature    complement(order(67746..67748,67929..67931))
                     /locus_tag="sll5066"
                     /note="Magnesium ion binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238997"
     gene            complement(68050..68574)
                     /locus_tag="sll5067"
                     /db_xref="GeneID:2655962"
     CDS             complement(68050..68574)
                     /locus_tag="sll5067"
                     /note="sll5067; ORF_ID:sll5067;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942223.1"
                     /db_xref="GI:38505602"
                     /db_xref="GeneID:2655962"
                     /translation="MLKTAYIVCGSPGAGKTFYGKELAKLKQAIFLDIDTATERLVRL
                     ALQLSGQDPNDRDSLYFKSNFRNPIYEQLFDIAQDNLLWNDVVITGPFTKEIKDPDWA
                     NKLSTRLGVPVQVHYVFCPPSIRQARIRDRNNPRDLAKLASWEDYLLYYEAELPPACE
                     HILVDNTLNKEIKK"
     misc_feature    complement(68116..68556)
                     /locus_tag="sll5067"
                     /note="AAA domain; Region: AAA_33; pfam13671"
                     /db_xref="CDD:257977"
     misc_feature    complement(68176..68556)
                     /locus_tag="sll5067"
                     /note="AAA domain; Region: AAA_18; pfam13238"
                     /db_xref="CDD:257595"
     gene            complement(69121..69348)
                     /locus_tag="ssl5068"
                     /db_xref="GeneID:2655900"
     CDS             complement(69121..69348)
                     /locus_tag="ssl5068"
                     /note="ORF_ID:ssl5068"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942224.1"
                     /db_xref="GI:38505603"
                     /db_xref="GeneID:2655900"
                     /translation="MRSSSHGTLKHLDLFAGCGGFTLAAEQTRGKIQTTQFVEIDPDC
                     HAILQHHWPQGENKTSMALTGSTPPAISRPG"
     misc_feature    complement(<69190..69324)
                     /locus_tag="ssl5068"
                     /note="Cytosine-C5 specific DNA methylases; Methyl
                     transfer reactions play an important role in many aspects
                     of biology. Cytosine-specific DNA methylases are found
                     both in prokaryotes and eukaryotes. DNA methylation, or
                     the covalent addition of a methyl group...; Region:
                     Cyt_C5_DNA_methylase; cl19095"
                     /db_xref="CDD:267448"
     misc_feature    complement(order(69226..69237,69289..69306))
                     /locus_tag="ssl5068"
                     /note="cofactor binding site; other site"
                     /db_xref="CDD:238192"
     gene            complement(69335..70810)
                     /locus_tag="sll5069"
                     /db_xref="GeneID:2655963"
     CDS             complement(69335..70810)
                     /locus_tag="sll5069"
                     /note="ORF_ID:sll5069"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942225.1"
                     /db_xref="GI:38505604"
                     /db_xref="GeneID:2655963"
                     /translation="MTQFYKLTTETIHEVIAADLPKSAHKLWLWVCELDPFGDRQVQI
                     TWERAKEVLGIGKTTFYRALNQLVDAGLLFSHRIVGFCVSSKNGTQDPNLEIESQNCN
                     PQFQKWDSSLYTDLQTFPYSPDSQSEEKEKIPDRSINTNGRSGIKPKIPEKLATAEIS
                     QNSSAIATSQGEEKYSAAGRTKKRTKKNQSFDWLPDGPWSIEGKLDPNFRDWLARNWQ
                     KRYGGDFHDKQADVLAHFRKDPANLPIRWEQYQKEFIHRVENTQMRLANGCQIPEDQQ
                     QNLITHQRAVTAVLPPEINPVAVVATQSPVLVPGVEEVTRGLEGVEPVADLSSNKNLE
                     EAELAPTETCSLVTDCESSPWESESPTEEPEAVANLSPSKNSETESTPTDNCPEYTIL
                     PDGTRLKVFKRQPEPEPVAPEQAQAFRQMMQGLFKSFGGKREVCPKPQSELERLNQWL
                     YDPALREEAIHYARRARSVPSASPNYKYCSETDQIIHCEEF"
     gene            complement(71192..71446)
                     /locus_tag="ssl5070"
                     /db_xref="GeneID:2655901"
     CDS             complement(71192..71446)
                     /locus_tag="ssl5070"
                     /note="ORF_ID:ssl5070"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942226.1"
                     /db_xref="GI:38505605"
                     /db_xref="GeneID:2655901"
                     /translation="MVLHGKIYYYPCGSTLAYKKSGKLITVSRSMFKSKKFYDSIVQV
                     IYRQSPDNRTPQVLRWHFHKLNIAPPRKFMEERHFTEQDH"
     gene            71474..71818
                     /locus_tag="slr5071"
                     /db_xref="GeneID:2655932"
     CDS             71474..71818
                     /locus_tag="slr5071"
                     /note="ORF_ID:slr5071"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942227.1"
                     /db_xref="GI:38505606"
                     /db_xref="GeneID:2655932"
                     /translation="MDDRDLVKIFKVKLSEQGIRQTEVCQEAGKPQSHLSKLLCGGKS
                     PNLQTLLDFINATDRLYPGFADQYWLAVAGRPTIRTLVDSMDSTELAVLLKVVGDRVA
                     EAKLKAPMMEVA"
     misc_feature    71495..71641
                     /locus_tag="slr5071"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(71504..71506,71516..71518,71591..71593)
                     /locus_tag="slr5071"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(71513..71515,71588..71590)
                     /locus_tag="slr5071"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(71534..71539,71570..71572,71579..71581,71591..71596)
                     /locus_tag="slr5071"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            complement(71882..72190)
                     /locus_tag="sll5072"
                     /db_xref="GeneID:2655964"
     CDS             complement(71882..72190)
                     /locus_tag="sll5072"
                     /note="sll5072; ORF_ID:sll5072;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942228.1"
                     /db_xref="GI:38505607"
                     /db_xref="GeneID:2655964"
                     /translation="MGDRLTLTGSLTIHGEDRSITRQATGTEEIDCNSYGDPSSNAEA
                     MALRRCCAKFGLGRDLWRKDKPQPLKMEQRQQQEKQPVLTPGTISREEWLKRKAGKAR
                     "
     gene            72425..73159
                     /locus_tag="slr5073"
                     /db_xref="GeneID:2655994"
     CDS             72425..73159
                     /locus_tag="slr5073"
                     /note="ORF_ID:slr5073"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942229.1"
                     /db_xref="GI:38505608"
                     /db_xref="GeneID:2655994"
                     /translation="MIVERCYFPLPKYFFCDGPSYVITSSSFGGSLLTPETLPELLQN
                     GDEKVINQLLEEGICLPLFFPGDCALDGAIFIVGDLTPIEEQEWIGRIQSKLKIPCGK
                     LLVVCGGGSPEDFEGVIAGNGINDYTDYFCVLDVPKGDYLVEVLAYVSSMSVDFYFEE
                     NEPLTEWFYRTRPGEILPQWLETFQSKGYIGELSDQLLTYIVHLTPLIDEPSLLTLIS
                     EIGWCGEFEFRRPEICPRGIPRSYYA"
     gene            73270..73485
                     /locus_tag="ssr5074"
                     /db_xref="GeneID:2655918"
     CDS             73270..73485
                     /locus_tag="ssr5074"
                     /note="ORF_ID:ssr5074"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942230.1"
                     /db_xref="GI:38505609"
                     /db_xref="GeneID:2655918"
                     /translation="MFKFIGIVLIGGLAGYALGVAAGIFIVNNFSTNVQDKPLELAMT
                     SIFFFGPMGALIGLIIAVVYQLLRRYL"
     gene            complement(73728..74147)
                     /locus_tag="sll5075"
                     /db_xref="GeneID:2655960"
     CDS             complement(73728..74147)
                     /locus_tag="sll5075"
                     /note="sll5075; ORF_ID:sll5075;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942231.1"
                     /db_xref="GI:38505610"
                     /db_xref="GeneID:2655960"
                     /translation="MKEDFGFTHIALFAKNIDLSISFYNRYANMSIVHERLDKDTGKR
                     VVWLSDKIRPFVLVLVQDENPTPILGPFAHLGIGCKDKSEVDYLCEQARQEGILAKDA
                     TDSGYPVGYWAFINDPDGHTLEVSYGQEIGLTIDKPA"
     misc_feature    complement(73773..74123)
                     /locus_tag="sll5075"
                     /note="This domain superfamily is found in a variety of
                     structurally related metalloproteins, including the type I
                     extradiol dioxygenases, glyoxalase I and a group of
                     antibiotic resistance proteins; Region: Glo_EDI_BRP_like;
                     cd06587"
                     /db_xref="CDD:211348"
     misc_feature    complement(order(73776..73778,73782..73784,73806..73808,
                     73926..73928,73968..73970,73974..73976,74013..74015,
                     74109..74111,74121..74123))
                     /locus_tag="sll5075"
                     /note="active site"
                     /db_xref="CDD:211348"
     misc_feature    complement(order(73776..73778,73926..73928,74121..74123))
                     /locus_tag="sll5075"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:211348"
     gene            complement(74510..75055)
                     /locus_tag="sll5076"
                     /db_xref="GeneID:2655961"
     CDS             complement(74510..75055)
                     /locus_tag="sll5076"
                     /note="sll5076; ORF_ID:sll5076;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942232.1"
                     /db_xref="GI:38505611"
                     /db_xref="GeneID:2655961"
                     /translation="MKATVYIATSVDGFIARNNGGIDWLPSAGDTDSSEDYGYQEFID
                     SVDALVMGRNTYELALSFDSWPYGEKPVFVLSSRKVDIPEDITKIVESMSVPPREVVC
                     RLSKRGFQHLYIDGGKTIQGFLSEGLIQQLIITKVPILIGEGIPLFSALPHDVRLHHL
                     ETRQFENGLVQSKYKVIEDIA"
     misc_feature    complement(74522..75040)
                     /locus_tag="sll5076"
                     /note="Dihydrofolate reductase [Coenzyme metabolism];
                     Region: FolA; COG0262"
                     /db_xref="CDD:223340"
     misc_feature    complement(order(74651..74653,74711..74713,74846..74848,
                     74948..74950,74984..74986,75038..75040))
                     /locus_tag="sll5076"
                     /note="folate binding site [chemical binding]; other site"
                     /db_xref="CDD:238127"
     misc_feature    complement(order(74699..74710,74825..74827,74891..74899,
                     75011..75013,75032..75034))
                     /locus_tag="sll5076"
                     /note="NADP+ binding site [chemical binding]; other site"
                     /db_xref="CDD:238127"
     gene            75147..75929
                     /locus_tag="slr5077"
                     /db_xref="GeneID:2655995"
     CDS             75147..75929
                     /locus_tag="slr5077"
                     /note="slr5077; ORF_ID:slr5077;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942233.1"
                     /db_xref="GI:38505612"
                     /db_xref="GeneID:2655995"
                     /translation="MFDNLCKFLAESFSEDYAAWLLGRPIKLTKLSPTELSLEPIRAD
                     SLILEQSEDLVLHLEFQTEPDPTMGFRMLDYRVRVYRRFPQKTMHQFVIYLKRSNNDL
                     VYQDSFQLGETVHRYQAIRLWEQPSETFLQSPGLLPLAVLTQTSDPTLKLREVATALE
                     QIEDNRVKANLMAATSVFGGILLSPEIIKTILRSEIMKESAVYQEILEEGEQRGILKG
                     KLEGKLETIPLLKKLGLTIAEIAKELDIDVELVNRFVANQNN"
     misc_feature    75147..75926
                     /locus_tag="slr5077"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG5464"
                     /db_xref="CDD:227751"
     gene            76050..76988
                     /locus_tag="slr5078"
                     /db_xref="GeneID:2655870"
     CDS             76050..76988
                     /locus_tag="slr5078"
                     /note="slr5078; ORF_ID:slr5078;
                     similar to potassium channel protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942234.1"
                     /db_xref="GI:38505613"
                     /db_xref="GeneID:2655870"
                     /translation="MKFSFPWHWGKSHKLKPVTHPIRHLRPIQSGDSRQKKIQPMVTD
                     LYHWLLVLSWPKFLATIGIFYFSLNVFFALIFSLTGDSIANAKPGSFLDLFFFSIQTL
                     STVGYGAMYPKTVAAQIVVSVEIFVGLISLAILTGLMFSRFAKPTSRVLFSEVAVVCP
                     FEEIPTLMFRAANQRNNRILEAQIRVSLVQDEQTKEGHKMRRFYDLNLLRSHTPVFGL
                     SWLIMHPIDSNSPLYGFSEVSNQQQRLELWISFTGLDESFSQTIHSRYAYEGADIRWQ
                     YRFVDIFHQTPEGKWFINMDNFHQIEPYHPKSPENS"
     misc_feature    76260..76952
                     /locus_tag="slr5078"
                     /note="Inward rectifier potassium channel; Region: IRK;
                     pfam01007"
                     /db_xref="CDD:250289"
     gene            complement(77192..78010)
                     /locus_tag="sll5079"
                     /db_xref="GeneID:2655958"
     CDS             complement(77192..78010)
                     /locus_tag="sll5079"
                     /note="sll5079; ORF_ID:sll5079;
                     probable short chain dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942235.1"
                     /db_xref="GI:38505614"
                     /db_xref="GeneID:2655958"
                     /translation="MILVSLYPFRVDRSNSIHTTLTIVKKLDGKVAVVTGASKGIGAE
                     IAKHLAGEGAAVVVNYASSKEGADRVVDEIVSTGGKAIAVQANVAKKAEIQQLFAETK
                     QAFGKLDILVNNAGIYEFSPLEGITEEHFYKQFDLNVLGLLLTSQQAVKSFGEEGGSI
                     INISSIVSTLTPANSLVYNATKAAVDAITKSLAKELGSRNIRVNSINPGMVETEGART
                     AGITESEGRRQVEAITPLGRIGQPHDIAPAVVFLASSDSAWITGETLYITGGLY"
     misc_feature    complement(77198..77938)
                     /locus_tag="sll5079"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Provisional; Region: fabG; PRK07231"
                     /db_xref="CDD:235975"
     misc_feature    complement(77201..77932)
                     /locus_tag="sll5079"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    complement(order(77378..77389,77465..77467,77477..77479,
                     77519..77527,77663..77671,77825..77833,77888..77890,
                     77894..77899,77903..77905))
                     /locus_tag="sll5079"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    complement(order(77465..77467,77477..77479,77519..77521,
                     77597..77599))
                     /locus_tag="sll5079"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            complement(78057..78881)
                     /locus_tag="sll5080"
                     /db_xref="GeneID:2655956"
     CDS             complement(78057..78881)
                     /locus_tag="sll5080"
                     /note="ORF_ID:sll5080"
                     /codon_start=1
                     /transl_table=11
                     /product="non-heme chloroperoxidase"
                     /protein_id="NP_942236.1"
                     /db_xref="GI:38505615"
                     /db_xref="GeneID:2655956"
                     /translation="MSTITTKDGTEIYYKDWGSGQPITFSHGWPLSADAWESQMFFLA
                     SHGYRCIAHDRRGHGRSSQPWNGNDMDTYADDLAELFEALDLKDVVMIGHSTGGGEVA
                     RFIGRHGTQRVSKAVLMGAVPPLMLKTEANPGGLPIEVFDGFRAAFLADRSQFFLDIA
                     SGPFFGFNRPGAKVSQGLIYSWWMQGMMAGHKNAYDCIKAFSETDFTEDLKKFDVPTL
                     IIHGDDDQIVPIGASALLSAKLVKNSILKIYPGGSHSLGDTSKEQLNADLLEFVES"
     misc_feature    complement(78060..78881)
                     /locus_tag="sll5080"
                     /note="Predicted hydrolases or acyltransferases
                     (alpha/beta hydrolase superfamily) [General function
                     prediction only]; Region: MhpC; COG0596"
                     /db_xref="CDD:223669"
     misc_feature    complement(78636..78857)
                     /locus_tag="sll5080"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     misc_feature    complement(<78513..78722)
                     /locus_tag="sll5080"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     misc_feature    complement(78060..>78251)
                     /locus_tag="sll5080"
                     /note="Prolyl oligopeptidase family; Region: Peptidase_S9;
                     cl19144"
                     /db_xref="CDD:267497"
     gene            complement(79505..80293)
                     /locus_tag="sll5081"
                     /db_xref="GeneID:2655957"
     CDS             complement(79505..80293)
                     /locus_tag="sll5081"
                     /note="sll5081; ORF_ID:sll5081;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942237.1"
                     /db_xref="GI:38505616"
                     /db_xref="GeneID:2655957"
                     /translation="MNEKFFKLGKNCLRLVTSEIESASFLGGKPLVSSSINWPRKNDK
                     PLGFIAQLDLSEINNEQAIEWLPNSGRLLFFYDFYEWPWGFAPEDRGGWAILYENGSE
                     ELHFQELPSDLHKEHIASSIKYVVSEKFMSYPDGQRINFEEGELSEIDKEQYYDFIDE
                     YYRNKTLHQIGGYPRPIQNDDMEKECQLISSGINYAYPEDYNSEEAKQLREQVNDWRL
                     VFQFDSDDDIDVMWGDMGMLYFWVKESESKNCNFSNSWMILQCC"
     misc_feature    complement(79511..80224)
                     /locus_tag="sll5081"
                     /note="Domain of unknown function (DUF1963); Region:
                     DUF1963; pfam09234"
                     /db_xref="CDD:255244"
     gene            80783..81613
                     /locus_tag="slr5082"
                     /db_xref="GeneID:2655871"
     CDS             80783..81613
                     /locus_tag="slr5082"
                     /note="slr5082; ORF_ID:slr5082;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942238.1"
                     /db_xref="GI:38505617"
                     /db_xref="GeneID:2655871"
                     /translation="MFDNLCKFLAESFSEDYAAWLLGRPIKLTKLSPTELSLEPIRAD
                     SLILEQSEDLVLHLEFQTEPDPTMGFRMLDYRVRVYRRFPQKTMHQFVIYLKRSNNDL
                     VYQDSFQVGETVHRYQAIRLWEQPSETFLQSPGLLPLAVLTQTSDPTLKLREVATALE
                     QIEDNRVKANLMAATSVFGGILLAPELIKTILRSEIMKESAVYQEILEEGKIAGKLEG
                     RLEGKLEGKLEGKLEGRLEAKLETIPLLKKLGLTIAEIAKELDIDVELVNRFVANQNN
                     "
     misc_feature    80783..81610
                     /locus_tag="slr5082"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG5464"
                     /db_xref="CDD:227751"
     gene            complement(82309..84186)
                     /locus_tag="sll5083"
                     /db_xref="GeneID:2655954"
     CDS             complement(82309..84186)
                     /locus_tag="sll5083"
                     /note="ORF_ID:sll5083"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942239.1"
                     /db_xref="GI:38505618"
                     /db_xref="GeneID:2655954"
                     /translation="MIFPFDININLSDSGITGIQNKTITINGGVTTFLGPNGSGKTQL
                     LRGLKLSLRSYANGKKIRYISAGRLGPMEAYRSDYDGQRGRQIRFDQATFGDKSSTTR
                     RHKNETILGDFGTLSERPDILIKVQERLRKLFKRDLMLDWDGGNLKVFFSRVDQETSS
                     NYSSAREASGLLHLVAILAALYDDEVGCLLIDEPEVSLHPQLQSFVMDEILKVAGPNN
                     EAGKKLVFISTHSTEFIEVNSVEQLSTIVFCKDILEEAVQIDPSIGEFRSRKLQALLT
                     RLGQEHKLALFCHSPLLVEGPSDEIICSAINRKLNINLEAAGSQVLPVTGKGQFPVVI
                     KLLRLIGKSPALLADADALTDNLDIIGVFTSLDKANIFANELGHRDAPALAGTIYNDF
                     CKLVADQWSNIQAQAELHYYWINRDIDKDELIAKRRSAFCWMFSNDETSILNIDNGAN
                     WVSIKHRLSTLLDLLEKLGCFILKKGTVEGYYQHVSNLTNDEKPNAASYEVNGLMEAN
                     IEAVTTAYDDILSALKYCSQAKDINEAEAIRDLLLAVITPALASIKKETSDAELRLHS
                     NNLFGAKSSLFKLSKEQDGNDIYLLVELASNILEVEGFPLRIKKGSNPIDMVNKALKL
                     K"
     misc_feature    complement(<83764..84135)
                     /locus_tag="sll5083"
                     /note="AAA domain; Region: AAA_23; pfam13476"
                     /db_xref="CDD:257800"
     misc_feature    complement(84061..84084)
                     /locus_tag="sll5083"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(84058..84066,84070..84075))
                     /locus_tag="sll5083"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(83479..>83679)
                     /locus_tag="sll5083"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cd00267"
                     /db_xref="CDD:213179"
     misc_feature    complement(83659..83679)
                     /locus_tag="sll5083"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(83608..83622,83629..83631))
                     /locus_tag="sll5083"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(83590..83601)
                     /locus_tag="sll5083"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(83491..83511)
                     /locus_tag="sll5083"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(<83119..83331)
                     /locus_tag="sll5083"
                     /note="TOPRIM_OLD: topoisomerase-primase (TOPRIM)
                     nucleotidyl transferase/hydrolase domain of the type found
                     in bacterial and archaeal nucleases of the OLD (overcome
                     lysogenization defect) family.  The bacteriophage P2 OLD
                     protein, which has DNase as well as...; Region:
                     TOPRIM_OLD; cd01026"
                     /db_xref="CDD:173776"
     misc_feature    complement(order(83134..83136,83140..83142,83290..83292,
                     83299..83304))
                     /locus_tag="sll5083"
                     /note="putative active site [active]"
                     /db_xref="CDD:173776"
     misc_feature    complement(order(83140..83142,83302..83304))
                     /locus_tag="sll5083"
                     /note="putative metal-binding site [ion binding]; other
                     site"
                     /db_xref="CDD:173776"
     gene            complement(84439..85155)
                     /locus_tag="sll5084"
                     /db_xref="GeneID:2655955"
     CDS             complement(84439..85155)
                     /locus_tag="sll5084"
                     /note="sll5084; ORF_ID:sll5084;
                     probable plasmid partitioning protein, ParB"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942240.1"
                     /db_xref="GI:38505619"
                     /db_xref="GeneID:2655955"
                     /translation="MSLSGAILYVPLFLSMLFLLAIYGITFCFIFCINYSFDVYNCQI
                     LFSNSMDKNIWLILSLCTTMITACSQKQMQEMASNTMVTQNRTPDKTWRVKPGSVHDG
                     DTFRAVADVTNEEIKVRLACIDAPELEQAGGVEARDYLRSMLTDNREIILMGAGKDQY
                     GRSVVEVFAITDTPGLEVGVNGEMVLAGMAHYYERYKRSCPENAEQYEFLEQEAISSK
                     AGVWANGDAERPWNWRGRNK"
     misc_feature    complement(84958..>85155)
                     /locus_tag="sll5084"
                     /note="Domain of unknown function (DUF4271); Region:
                     DUF4271; pfam14093"
                     /db_xref="CDD:258314"
     misc_feature    complement(84484..84864)
                     /locus_tag="sll5084"
                     /note="Staphylococcal nuclease homologues. SNase
                     homologues are found in bacteria, archaea, and eukaryotes.
                     They contain no disufide bonds; Region: SNc; cd00175"
                     /db_xref="CDD:238102"
     misc_feature    complement(84484..84864)
                     /locus_tag="sll5084"
                     /note="Staphylococcal nuclease homologues; Region: SNc;
                     smart00318"
                     /db_xref="CDD:214615"
     misc_feature    complement(order(84670..84672,84676..84681,84775..84777,
                     84784..84786,84802..84804,84847..84849))
                     /locus_tag="sll5084"
                     /note="Catalytic site; other site"
                     /db_xref="CDD:238102"
     gene            85149..85469
                     /locus_tag="slr5085"
                     /db_xref="GeneID:2655872"
     CDS             85149..85469
                     /locus_tag="slr5085"
                     /note="ORF_ID:slr5085"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942241.1"
                     /db_xref="GI:38505620"
                     /db_xref="GeneID:2655872"
                     /translation="MTLPAIMKYKILSSLALVTLGITALAPGAFANPTVGRETRTGDI
                     YVSGLGSYQSIKGEYSSLPRSTNKNANECGVIKLSGSSASLPINGRSYSVGPNSVHCP
                     LPQN"
     gene            complement(85552..86982)
                     /locus_tag="sll5086"
                     /db_xref="GeneID:2655952"
     CDS             complement(85552..86982)
                     /locus_tag="sll5086"
                     /note="ORF_ID:sll5086"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulatory protein"
                     /protein_id="NP_942242.1"
                     /db_xref="GI:38505621"
                     /db_xref="GeneID:2655952"
                     /translation="MTTSPNQTLYQTVADQIHGLISEGTFQPGDRLPSVRKLHQQWSV
                     SISTVLEAYRLLEDRGLIEARPQSGYFVKTILNFLPDEPSPSTPQSADNPVDTSLAFR
                     VNNSMLKPGIIGLGAAIAGSNLLPIATLNRLMGQVIRAKPEVTHRYSSPQGCEELRHE
                     VARRLIDTGCSITPDQIVITNGTTEALYLSLKAVTKPGDTVVIESPTYHLLLETLEAL
                     HLRILELPTHPQHGISLIHLEDALKNDQISACVLIANFSNPLGSCMSDSKKKQLIGLI
                     NHYNVPLIEDDIYGDLNFTGNRPKSIKSFDTQGLVLYCSSISKTLSPGLRIGWAVPGR
                     YQTKVEQLKMTTNYMTAVAPQLTIAAFLANGGYDRHLRKLRRTYQAQMMDMTQAICNY
                     FPKMTRVSRPKGGYILWIEMPEIVDTLQLYEDALRHNIAIAPGSMFSSSGGYRNCFRL
                     NFGLPFTEEIQQAMIVLGQLLHEQTK"
     misc_feature    complement(85564..86967)
                     /locus_tag="sll5086"
                     /note="Transcriptional regulators containing a DNA-binding
                     HTH domain and an aminotransferase domain (MocR family)
                     and their eukaryotic orthologs [Transcription / Amino acid
                     transport and metabolism]; Region: ARO8; COG1167"
                     /db_xref="CDD:224089"
     misc_feature    complement(86764..86961)
                     /locus_tag="sll5086"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    complement(order(86773..86784,86788..86793,86821..86823,
                     86830..86835,86839..86853,86875..86880,86884..86886,
                     86953..86955,86959..86961))
                     /locus_tag="sll5086"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    complement(85576..86574)
                     /locus_tag="sll5086"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(86005..86007,86026..86031,86035..86037,
                     86116..86118,86209..86211,86359..86361,86431..86439))
                     /locus_tag="sll5086"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(85912..85914,85921..85923,86005..86013,
                     86137..86139,86329..86331,86428..86430))
                     /locus_tag="sll5086"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    complement(86026..86028)
                     /locus_tag="sll5086"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            87601..88020
                     /locus_tag="slr5087"
                     /db_xref="GeneID:2655873"
     CDS             87601..88020
                     /locus_tag="slr5087"
                     /note="slr5087; ORF_ID:slr5087;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942243.1"
                     /db_xref="GI:38505622"
                     /db_xref="GeneID:2655873"
                     /translation="MPVPAEYQRASDNFYEYLVDTRNIAGLWSTHVAYTMTQGVFQVF
                     RRRLSTENAIAFANVLPVCLRALFVTDWNIHESKKPFGDYAEMIQEVKLLREEHNFSP
                     DTAIRDVAIALRKHINEKAFQKVLSTFPKEAADFWNV"
     misc_feature    87637..88011
                     /locus_tag="slr5087"
                     /note="Uncharacterized conserved protein (DUF2267);
                     Region: DUF2267; pfam10025"
                     /db_xref="CDD:255704"
     gene            88114..88830
                     /locus_tag="slr5088"
                     /db_xref="GeneID:2655874"
     CDS             88114..88830
                     /locus_tag="slr5088"
                     /note="slr5088; ORF_ID:slr5088;
                     probable short-chain dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942244.1"
                     /db_xref="GI:38505623"
                     /db_xref="GeneID:2655874"
                     /translation="MKLMVIGASKGLGKAFVEGLCSDGDMVIGVSRSQPQDLRLPESI
                     LLDWIEADLEKPLQAIQILKKYTPNELDVLIYNLGIWEKTAFSEEYSFLDDEDKSLID
                     MVNVNITSAILVLKHLIPRLLKSSQPRLILTGSTSGLRQSGRPEVTFGASKFALSGIA
                     DALRESFRSEGLGVTCLQLGYLNTEDSLQVPVAEAAQRGNGELIPLHDVINLVKAIIN
                     MSKASYVRELVLPAIQDERF"
     misc_feature    88126..88809
                     /locus_tag="slr5088"
                     /note="Dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases) [Secondary
                     metabolites biosynthesis, transport, and catabolism /
                     General function prediction only]; Region: FabG; COG1028"
                     /db_xref="CDD:223959"
     misc_feature    88126..88788
                     /locus_tag="slr5088"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    order(88132..88134,88138..88149,88204..88212,88264..88272,
                     88342..88350,88429..88431,88510..88518,88558..88560,
                     88570..88572,88648..88659,88663..88668)
                     /locus_tag="slr5088"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    order(88432..88434,88516..88518,88558..88560,88570..88572)
                     /locus_tag="slr5088"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            complement(88902..89669)
                     /locus_tag="sll5089"
                     /db_xref="GeneID:2655953"
     CDS             complement(88902..89669)
                     /locus_tag="sll5089"
                     /note="ORF_ID:sll5089"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942245.1"
                     /db_xref="GI:38505624"
                     /db_xref="GeneID:2655953"
                     /translation="MAQPAVEACYRQPELEGLLHSLYSARSVLVTSGEGMGKTYLVRQ
                     VWERLLSDGVTCQYFEPATPKTLLMAIASLLPDIDISTSPAGRILPFISRPLEQRFSH
                     RSATHSLLASLTLAVVSYGLWFLAPVIPLVIIHAINIGYFAGWFLDCFTKSGVEMFYP
                     LGVRCVCPGNRNLRISTGSAAEYWLMVFVVAIAKRDKQRLEIAKVSYPFGEGDSERYL
                     AQLSSYDRQKAATFREWSRLRNQVVQVKLLVLGTGED"
     misc_feature    complement(<89439..89639)
                     /locus_tag="sll5089"
                     /note="AAA ATPase domain; Region: AAA_16; pfam13191"
                     /db_xref="CDD:257559"
     misc_feature    complement(89091..89462)
                     /locus_tag="sll5089"
                     /note="Predicted membrane-bound metal-dependent hydrolase
                     (DUF457); Region: DUF457; pfam04307"
                     /db_xref="CDD:252517"
     gene            complement(89699..90253)
                     /locus_tag="sll5090"
                     /db_xref="GeneID:2655950"
     CDS             complement(89699..90253)
                     /locus_tag="sll5090"
                     /note="ORF_ID:sll5090"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942246.1"
                     /db_xref="GI:38505625"
                     /db_xref="GeneID:2655950"
                     /translation="MSIAGKSKGDVVQQLEKSYGVARTTVFNRLKYLGYSLDKVDDLF
                     SLSNEQMAELDNLHRWISDGGKMADYPKPGQLTMITDEGELEQYGEVINFDALEGDEE
                     LGHAELIRAAQNQAAGILIAQNLLTAEILKNPQHLPADLQAQVEQSKVAIAPKPQNPL
                     VIASQWITKAKAYQSNQNHGQLAA"
     gene            complement(90353..90601)
                     /locus_tag="ssl5091"
                     /db_xref="GeneID:2655902"
     CDS             complement(90353..90601)
                     /locus_tag="ssl5091"
                     /note="ORF_ID:ssl5091"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942247.1"
                     /db_xref="GI:38505626"
                     /db_xref="GeneID:2655902"
                     /translation="MDFNPNEWPTHKQGEVVRQLILDALDSPKTKEELSSLCNKSVRQ
                     ITRHLQRLSSENKILSTGKGQFVRRIAAGFLLLYVGQI"
     gene            90973..91218
                     /locus_tag="ssr5092"
                     /db_xref="GeneID:2655919"
     CDS             90973..91218
                     /locus_tag="ssr5092"
                     /note="ssr5092; ORF_ID:ssr5092;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942248.1"
                     /db_xref="GI:38505627"
                     /db_xref="GeneID:2655919"
                     /translation="MINQAIQLAQLFGNLLTMADYSMACALLSPERQRQYPPMEPNDV
                     VWLYVSLEGEDFVEAVSVIIEDREGKLAIRWLEWGRP"
     gene            91316..92692
                     /locus_tag="slr5093"
                     /db_xref="GeneID:2655875"
     CDS             91316..92692
                     /locus_tag="slr5093"
                     /note="slr5093; ORF_ID:slr5093;
                     probable flavin-containing amine oxidase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942249.1"
                     /db_xref="GI:38505628"
                     /db_xref="GeneID:2655875"
                     /translation="MIRRRSFFKLSQLMFVSYLLSTSCGKNNTPVTANDAPSILIIGA
                     GLAGLAAAQSLMKQGYTVRVLEARDRLGGRTWTSNYWDDAPLDMGASWIQGTEGNPIT
                     ELAEKIATPLVMTSYDNAITYEVGGQPFTAKEDRIIEQLEKKWQGAIATAQNGDGDQS
                     LQAVIENVFDLENQPLETKQIIDWYMNSTIEHEYAGSLKDTSIYWFDGDGGFGGDDAI
                     FVEGYQAIVNYLAKDISIELNQIVESIDYSEEIPKIITNQGAYTADQVIITLPLGVLK
                     SGQVKFIPELPSPKRKAIKALGMGILNKCYLRFPKVFWPKKVDWIEQVPTERGLWSEW
                     VNIFRVNQLPILLGFNAADEGKEIETWTDEEIIKSAMKTLRHLFGDDIPDPTDYQITR
                     WQSDSFSRGSYSFNALGSHPDMRDHLAKSLNDQIFFAGEATERDYFATAHGAYLSGLR
                     VAEEINNL"
     misc_feature    91478..92680
                     /locus_tag="slr5093"
                     /note="probable polyamine oxidase; Region: PLN02268"
                     /db_xref="CDD:177909"
     misc_feature    <91979..92686
                     /locus_tag="slr5093"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            complement(92805..93236)
                     /locus_tag="sll5094"
                     /db_xref="GeneID:2655951"
     CDS             complement(92805..93236)
                     /locus_tag="sll5094"
                     /note="ORF_ID:sll5094"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid stabilization protein"
                     /protein_id="NP_942250.1"
                     /db_xref="GI:38505629"
                     /db_xref="GeneID:2655951"
                     /translation="MKGWLLDTNVISELRKKNCHPAVKAWADRQSPTSFYLSTITMAE
                     IRFGIEKAEDEAFRQELNQWLDQVLRPWFGDRLLGVDEDVILQWRWLVEKGRKQNYTF
                     SQPDLFIAAIAVVHDLCVVTRNVGDFEKSGVPVFNPFLFAQ"
     misc_feature    complement(92826..93224)
                     /locus_tag="sll5094"
                     /note="PIN domain of ribonucleases (toxins), VapC and
                     FitB, of prokaryotic toxin/antitoxin operons, Pyrococcus
                     horikoshii protein PH0500, and other similar bacterial and
                     archaeal homologs; Region: PIN_VapC-FitB; cd09881"
                     /db_xref="CDD:189051"
     misc_feature    complement(order(92853..92855,92910..92915,92919..92924,
                     92928..92930,92949..92951,92958..92963,92970..92975,
                     92979..92981,92994..93002,93006..93008,93051..93053,
                     93060..93062,93093..93101,93105..93113,93117..93122,
                     93132..93134,93156..93158,93165..93167,93189..93197,
                     93201..93206,93213..93221))
                     /locus_tag="sll5094"
                     /note="oligomeric interface; other site"
                     /db_xref="CDD:189051"
     misc_feature    complement(order(92865..92867,92919..92921,93105..93107,
                     93216..93218))
                     /locus_tag="sll5094"
                     /note="putative active site [active]"
                     /db_xref="CDD:189051"
     misc_feature    complement(order(92916..92918,92922..92927,92958..92963,
                     92967..92975,92979..92984,92997..92999,93045..93047,
                     93054..93059,93096..93101,93105..93110,93117..93122))
                     /locus_tag="sll5094"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:189051"
     gene            complement(93233..93520)
                     /locus_tag="ssl5095"
                     /db_xref="GeneID:2655903"
     CDS             complement(93233..93520)
                     /locus_tag="ssl5095"
                     /note="ssl5095; ORF_ID:ssl5095;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942251.1"
                     /db_xref="GI:38505630"
                     /db_xref="GeneID:2655903"
                     /translation="MTNSATQGLDALQTWKLEDAKARFSELVRLAQGENPQLVTVRGK
                     DAVVVLAADQFAKLLPLMAQPNIHEFLSQSPLNRLDFEHSSVQSPVRELEL"
     misc_feature    complement(93326..93481)
                     /locus_tag="ssl5095"
                     /note="Antitoxin Phd_YefM, type II toxin-antitoxin system;
                     Region: PhdYeFM_antitox; cl09153"
                     /db_xref="CDD:263731"
     gene            complement(93656..93865)
                     /locus_tag="ssl5096"
                     /db_xref="GeneID:2655904"
     CDS             complement(93656..93865)
                     /locus_tag="ssl5096"
                     /note="ORF_ID:ssl5096"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942252.1"
                     /db_xref="GI:38505631"
                     /db_xref="GeneID:2655904"
                     /translation="MMTNFIDLAFPIKGTVLNADHNYFLYSAIAKRLNESRVKTSRGG
                     RWYAKTVSNIINREHEFLSKNGGFL"
     misc_feature    complement(<93698..93856)
                     /locus_tag="ssl5096"
                     /note="CRISPR/Cas system-associated RAMP superfamily
                     protein Cas6; Region: Cas6-I-III; cl09782"
                     /db_xref="CDD:263875"
     gene            complement(93862..94866)
                     /locus_tag="sll5097"
                     /db_xref="GeneID:2655947"
     CDS             complement(93862..94866)
                     /locus_tag="sll5097"
                     /note="sll5097; ORF_ID:sll5097;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942253.1"
                     /db_xref="GI:38505632"
                     /db_xref="GeneID:2655947"
                     /translation="MTAQNVLSPRQLERLLAIDEYIRSPIRYTAKVIAEKLSVAERTI
                     RLDFAFLRDRFNAPIQFNQSKGYYYSDNTWRLPTIPLTQGELFALTLGAKALEAYSGT
                     AYEAELKSSIKQLATRLPEKVWVNLEKLVDEKINFRPGAELLNLDPDIYQILHEAWKS
                     SRQLWIRYYTAGRNEESERIVDPYYLDIYRGSNPYLVAFCHNRQAFREFRLDRIREYR
                     ILDEYFEPNPNFDWKKYSKNAFQIEKGNCLHEVVIDFTCKVAPYIREWKWHHSQVIDE
                     HHDGSLTLHLEVGGLQEVKRWVLGYGKDALVKSPPELVKLLQEETEVIARQNETGDFE
                     "
     misc_feature    complement(93907..94839)
                     /locus_tag="sll5097"
                     /note="Predicted transcriptional regulator
                     [Transcription]; Region: COG2378"
                     /db_xref="CDD:225253"
     misc_feature    complement(94666..94833)
                     /locus_tag="sll5097"
                     /note="HTH domain; Region: HTH_11; cl17392"
                     /db_xref="CDD:266661"
     misc_feature    complement(93892..94422)
                     /locus_tag="sll5097"
                     /note="WYL domain; Region: WYL; pfam13280"
                     /db_xref="CDD:257623"
     gene            complement(94925..95137)
                     /locus_tag="ssl5098"
                     /db_xref="GeneID:2655905"
     CDS             complement(94925..95137)
                     /locus_tag="ssl5098"
                     /note="ORF_ID:ssl5098"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942254.1"
                     /db_xref="GI:38505633"
                     /db_xref="GeneID:2655905"
                     /translation="MKSRRLSIRVPDPLLSQLQSYLDHQGLTVTEGVLAPIASYVGDN
                     DKLPLVERVSRIEKRLAALENNIFIR"
     gene            complement(95256..95549)
                     /locus_tag="ssl5099"
                     /db_xref="GeneID:2655906"
     CDS             complement(95256..95549)
                     /locus_tag="ssl5099"
                     /note="ssl5099; ORF_ID:ssl5099;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942255.1"
                     /db_xref="GI:38505634"
                     /db_xref="GeneID:2655906"
                     /translation="MKGDHYSPNWPQLALSKKQSVNWVCERCGVQCLKPGEGKGLLKE
                     ERYRFRMAVHHCDYDPSNNSPSNLMALCSLCHLYYHRRQQGNISLGQLSLEFY"
     misc_feature    complement(<95301..>95483)
                     /locus_tag="ssl5099"
                     /note="HNH nucleases; HNH endonuclease signature which is
                     found in viral, prokaryotic, and eukaryotic proteins. The
                     alignment includes members of the large group of homing
                     endonucleases, yeast intron 1 protein, MutS, as well as
                     bacterial colicins, pyocins, and...; Region: HNHc;
                     cl00083"
                     /db_xref="CDD:260180"
     gene            complement(95697..95903)
                     /locus_tag="ssl5100"
                     /db_xref="GeneID:2655907"
     CDS             complement(95697..95903)
                     /locus_tag="ssl5100"
                     /note="ssl5100; ORF_ID:ssl5100;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942256.1"
                     /db_xref="GI:38505635"
                     /db_xref="GeneID:2655907"
                     /translation="MQSFNRRSPLDKHRELEEAATHNWILSTTEIKKLLGVKPKGETF
                     TRGCWIFRRSGKIGNQSAWIVEKI"
     gene            96124..96561
                     /locus_tag="slr5101"
                     /db_xref="GeneID:2655876"
     CDS             96124..96561
                     /locus_tag="slr5101"
                     /note="slr5101; ORF_ID:slr5101;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942257.1"
                     /db_xref="GI:38505636"
                     /db_xref="GeneID:2655876"
                     /translation="MRRRRPTRRRVSSRIVTQSIADQIANSQQQVFMRQDFEDLGNYE
                     QVGRSLRSLIQQNQLIRIGQGLYAKAQISPLSGKPVPRLGIKELAKEALQRLEVETFP
                     SSYEKQYNDGKTTQVPTGRVIGVKGRVQRRIGYNGKYVKFEHV"
     gene            96554..97156
                     /locus_tag="slr5102"
                     /db_xref="GeneID:2655877"
     CDS             96554..97156
                     /locus_tag="slr5102"
                     /note="slr5102; ORF_ID:slr5102;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942258.1"
                     /db_xref="GI:38505637"
                     /db_xref="GeneID:2655877"
                     /translation="MSSTLAITEIIQAIAAEFVVDECFIEKDWYAMRIIGVLSQIQDP
                     TFQLVFSGGTSLSKGFGLIQRFSEDLDFKVKIINNHPPSKNRQQKQRKAFRDKILENL
                     EQYQTDWQVDLNALQKGNESKFFKVPIRYQPLFQVSNSLRPHVQLEVTFESPALEPEL
                     KDLQSFVGKALKQQPEAINFPCVNPIETAADKLSALVWRI"
     misc_feature    96578..>96775
                     /locus_tag="slr5102"
                     /note="Nucleotidyl transferase of unknown function
                     (DUF1814); Region: DUF1814; cl00973"
                     /db_xref="CDD:260726"
     misc_feature    96692..>97150
                     /locus_tag="slr5102"
                     /note="Nucleotidyl transferase of unknown function
                     (DUF1814); Region: DUF1814; pfam08843"
                     /db_xref="CDD:255068"
     gene            complement(97547..97735)
                     /locus_tag="ssl5103"
                     /db_xref="GeneID:2655908"
     CDS             complement(97547..97735)
                     /locus_tag="ssl5103"
                     /note="ORF_ID:ssl5103"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942259.1"
                     /db_xref="GI:38505638"
                     /db_xref="GeneID:2655908"
                     /translation="MELMKDDRYSPDWKNIAITKKQSVHWVCERCGVQCLKPGKGKGL
                     STGDLLRQKLNQRRYKGG"
     gene            complement(97790..98224)
                     /locus_tag="sll5104"
                     /db_xref="GeneID:2655945"
     CDS             complement(97790..98224)
                     /locus_tag="sll5104"
                     /note="ORF_ID:sll5104"
                     /codon_start=1
                     /transl_table=11
                     /product="arsenate reductase"
                     /protein_id="NP_942260.1"
                     /db_xref="GI:38505639"
                     /db_xref="GeneID:2655945"
                     /translation="MTENMIVIYHNPDCGTSRNVLQLIEAAGYLPQVIEYVKEGWTKP
                     QLLGLFAAADLTPRSALRTTKSPAAELNLLEETVTDAQILDAMVEYPILVNRPIVCTP
                     KGVRLCRPSEVVLDLLDHWPSGPFAKEDGELIIDERGNRVYT"
     misc_feature    complement(97874..98209)
                     /locus_tag="sll5104"
                     /note="Arsenate Reductase (ArsC) family, ArsC subfamily;
                     arsenic reductases similar to that encoded by arsC on the
                     R733 plasmid of Escherichia coli. E. coli ArsC catalyzes
                     the reduction of arsenate [As(V)] to arsenite [As(III)],
                     the first step in the...; Region: ArsC_ArsC; cd03034"
                     /db_xref="CDD:239332"
     misc_feature    complement(order(97898..97900,97937..97939,98039..98041,
                     98183..98185))
                     /locus_tag="sll5104"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239332"
     gene            98614..99219
                     /locus_tag="slr5105"
                     /db_xref="GeneID:2655878"
     CDS             98614..99219
                     /locus_tag="slr5105"
                     /note="ORF_ID:slr5105;
                     ParA family"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid partitioning protein"
                     /protein_id="NP_942261.1"
                     /db_xref="GI:38505640"
                     /db_xref="GeneID:2655878"
                     /translation="MIITVASFKGGVGKTTTAVHLSAYLALQGETLLIDGDPNRSATG
                     WGKRGSLPFKVVDERQAAKYAPKYQNIVIDTQARPEDEDLEALADGCDLLVIPSTPDA
                     LALDALILTIETLQKLGNNRFRILLTIIPPYPSKDGDEARQLLTTAGLPLFKRGIKRY
                     SAFQKASLNGVVVSEVSDSKAGIAWSDYKATGKEIVEEILI"
     misc_feature    98614..99213
                     /locus_tag="slr5105"
                     /note="ATPases involved in chromosome partitioning [Cell
                     division and chromosome partitioning]; Region: Soj;
                     COG1192"
                     /db_xref="CDD:224113"
     misc_feature    98617..98997
                     /locus_tag="slr5105"
                     /note="ParA and ParB of Caulobacter crescentus belong to a
                     conserved family of bacterial proteins implicated in
                     chromosome segregation. ParB binds to DNA sequences
                     adjacent to the origin of replication and localizes to
                     opposite cell poles shortly following the...; Region:
                     ParA; cd02042"
                     /db_xref="CDD:238997"
     misc_feature    98638..98658
                     /locus_tag="slr5105"
                     /note="P-loop; other site"
                     /db_xref="CDD:238997"
     misc_feature    order(98656..98658,98833..98835)
                     /locus_tag="slr5105"
                     /note="Magnesium ion binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238997"
     gene            99216..99449
                     /locus_tag="ssr5106"
                     /db_xref="GeneID:2655920"
     CDS             99216..99449
                     /locus_tag="ssr5106"
                     /note="ssr5106; ORF_ID:ssr5106;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942262.1"
                     /db_xref="GI:38505641"
                     /db_xref="GeneID:2655920"
                     /translation="MSKFKGILDSHKQTAPAESQRKTKTRGKRSDPDYEQVSAYIRKE
                     TYRNVKIALLQEEEKRDFSDLVETLLSEWLNNQ"
     gene            complement(99565..99981)
                     /locus_tag="sll5107"
                     /db_xref="GeneID:2655946"
     CDS             complement(99565..99981)
                     /locus_tag="sll5107"
                     /EC_number="3.5.4.5"
                     /note="Reclaims exogenous and endogenous cytidine and
                     2'-deoxycytidine molecules for UMP synthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="cytidine deaminase"
                     /protein_id="NP_942263.1"
                     /db_xref="GI:38505642"
                     /db_xref="GeneID:2655946"
                     /translation="MVDICWEQLHRSAIEVRQNAYAPYSHFLVGAAGLVDDGRIVVGC
                     NIENASYGLTLCAECGLVSHLIATGGGRLLAVVCVDSQDNYLAPCGRCRQVLLEHGGK
                     ELQVMTPTGPLPMAELLPWSFGPQDLRRVGGLNTNP"
     misc_feature    complement(99592..99975)
                     /locus_tag="sll5107"
                     /note="Cytidine deaminase [Nucleotide transport and
                     metabolism]; Region: Cdd; COG0295"
                     /db_xref="CDD:223372"
     misc_feature    complement(99655..99945)
                     /locus_tag="sll5107"
                     /note="Cytidine deaminase zinc-binding domain. These
                     enzymes are Zn dependent. The zinc ion in the active site
                     plays a central role in the proposed catalytic mechanism,
                     activating a water molecule to form a hydroxide ion that
                     performs a nucleophilic attack on...; Region:
                     cytidine_deaminase; cd01283"
                     /db_xref="CDD:238610"
     misc_feature    complement(order(99706..99708,99715..99717,99808..99816,
                     99841..99843,99847..99849,99895..99897,99901..99903))
                     /locus_tag="sll5107"
                     /note="active site"
                     /db_xref="CDD:238610"
     misc_feature    complement(order(99706..99708,99715..99720,99808..99816))
                     /locus_tag="sll5107"
                     /note="catalytic motif [active]"
                     /db_xref="CDD:238610"
     misc_feature    complement(order(99706..99708,99715..99717,99808..99810,
                     99814..99816))
                     /locus_tag="sll5107"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:238610"
     gene            complement(100584..100811)
                     /locus_tag="ssl5108"
                     /db_xref="GeneID:2655909"
     CDS             complement(100584..100811)
                     /locus_tag="ssl5108"
                     /note="ORF_ID:ssl5108"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942264.1"
                     /db_xref="GI:38505643"
                     /db_xref="GeneID:2655909"
                     /translation="MRSSSHGKLKHLDLFAGCGGFTLAAEQTGGKIQTTQFVEIDPDC
                     HAILQHHWPQGENKTSMALTGSTPPAISRPG"
     misc_feature    complement(<100644..100796)
                     /locus_tag="ssl5108"
                     /note="Site-specific DNA methylase [DNA replication,
                     recombination, and repair]; Region: Dcm; COG0270"
                     /db_xref="CDD:223348"
     misc_feature    complement(order(100689..100700,100752..100769))
                     /locus_tag="ssl5108"
                     /note="cofactor binding site; other site"
                     /db_xref="CDD:238192"
     gene            complement(100798..102288)
                     /locus_tag="sll5109"
                     /db_xref="GeneID:2655943"
     CDS             complement(100798..102288)
                     /locus_tag="sll5109"
                     /note="ORF_ID:sll5109"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942265.1"
                     /db_xref="GI:38505644"
                     /db_xref="GeneID:2655943"
                     /translation="MTQFYKLTSQTIDQLIAADLPKSAHKLWLWICRLDPFGNRQVQI
                     TWERAKEVLGIGKTTFYRALNQLVDAGLLFSHRIVGFCVSSKNGTQDPNLEIESQNCN
                     PQFQKWDSSLYTDLQTFPYSSDDQSEGKEKIPDRSINTNGQGNGIKPKIPEKPATAEI
                     SQNSSVIATSQGEEKYSAAGRTKKRTKKNQSFDWLPDGPWSIEGKLDPNFRDWLAKNW
                     QKRYGGDFHDKQADVLAHFRKDPANLPIRWEQYQKEFIHRVENTQMRLANGCQIPEDQ
                     QQNLITHQRAVTTVLPPEINPVAVVATQSPVLLPGVEEVTRGLEGVEPVADLSASKNL
                     EEAELATTETCSLVTECEPSPWESESPTEELEAVTRGLESVEPVANLSPNKNLEGAEL
                     AATDNCPEYTTLPDGTRLKVFKRQPEPEPVAPEQAQAFRQMMQGLFKGFGSKREVCPK
                     PQSELERLNQWLYDPALREEAINYARRSPNYKYCSETDQIIHCEEF"
     misc_feature    complement(102070..102234)
                     /locus_tag="sll5109"
                     /note="Helix-turn-helix domain; Region: HTH_36; pfam13730"
                     /db_xref="CDD:258026"
     gene            102741..103151
                     /locus_tag="slr5110"
                     /db_xref="GeneID:2655879"
     CDS             102741..103151
                     /locus_tag="slr5110"
                     /note="ORF_ID:slr5110"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942266.1"
                     /db_xref="GI:38505645"
                     /db_xref="GeneID:2655879"
                     /translation="MLLREQPFNPHIKVYSRLSLLGKKMDFSEIFNQKLKHWRISGRA
                     LAVASGRSETNISQIRNGVVSPSISDFQELIRICDDLKPGFASDYYSSLSPVAFSPEQ
                     FITHLDSSQLASLMSAIGQRIKDYGRDAQFLKAS"
     misc_feature    102837..102977
                     /locus_tag="slr5110"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(102846..102848,102921..102923)
                     /locus_tag="slr5110"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(102855..102857,102918..102920)
                     /locus_tag="slr5110"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(102864..102869,102900..102902,102909..102911,
                     102921..102926)
                     /locus_tag="slr5110"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            103631..104083
                     /locus_tag="slr5111"
                     /db_xref="GeneID:2655880"
     CDS             103631..104083
                     /locus_tag="slr5111"
                     /note="ORF_ID:slr5111"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942267.1"
                     /db_xref="GI:38505646"
                     /db_xref="GeneID:2655880"
                     /translation="MQINYYTAKPMNNPLLMLKDKTGSMKIKLLISLLILTPITALSS
                     VVFAQSMHSEQSKKAEQNSEAAFDYAGYYYVETYCQARSYNKPHFDSVKNATSSYNDR
                     FKVYMNRNGVTNTNAIATASQQMFFRNGQVITNAIKETCASVMVGTGR"
     gene            104141..105274
                     /locus_tag="slr5112"
                     /db_xref="GeneID:2655881"
     CDS             104141..105274
                     /locus_tag="slr5112"
                     /note="ORF_ID:slr5112"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942268.1"
                     /db_xref="GI:38505647"
                     /db_xref="GeneID:2655881"
                     /translation="MIVQVTSGFLVVGLIALFVFYRNQNYSYIELAENLINSYSAQQS
                     TDDINNLEQLILDHEIIIKKLSAIRNCPFLPYEAAQDYKQKIELSLQQINEKKENLIL
                     LNELNQNFNEAQKLAGEAINLAKNPPHSIEVWQNIIDKWQQAIIRLNKISVTGLDEKF
                     LLEINNNRNFYEKNLSIANQSLENERTGKSLFATGQKLLNEAHQLSNDNLLTNKQNAF
                     KKRIEGIKKLSDIPPGTTFSKTAEGKIKQHGEIVNVELKKREEKTDKKQPVELDKKPE
                     VQLTNGNKIKNPIEDYFRTVINGDREEKYWCNSFVEQSFFSPTDYKILGDNSISNDQK
                     GAIYKIRVNASNAAGQPIIGTYRFYFENKNDKWCIFAFEKVKY"
     gene            complement(105753..106043)
                     /locus_tag="ssl5113"
                     /db_xref="GeneID:2655910"
     CDS             complement(105753..106043)
                     /locus_tag="ssl5113"
                     /note="ORF_ID:ssl5113"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942269.1"
                     /db_xref="GI:38505648"
                     /db_xref="GeneID:2655910"
                     /translation="MSTVTESDLKELKDLIVELKLGQAEMKGQLAGIDNRLIRLETKM
                     ETKLDTLEPSIQKIPDLAEKVGELKNWKQIGLTLGGAIIGGIITYLARNANP"
     gene            complement(106087..106371)
                     /locus_tag="ssl5114"
                     /db_xref="GeneID:2655911"
     CDS             complement(106087..106371)
                     /locus_tag="ssl5114"
                     /note="ORF_ID:ssl5114"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942270.1"
                     /db_xref="GI:38505649"
                     /db_xref="GeneID:2655911"
                     /translation="MATVTDTDLKELKDLVIEVKVSQARMEAQLAGIDKRLDVIKTRV
                     GGLTNWIVGILFALVGGLLGLLGKAIRKENDPVNGDRRQSVTLKVERESR"
     gene            106537..106950
                     /locus_tag="slr5115"
                     /db_xref="GeneID:2655882"
     CDS             106537..106950
                     /locus_tag="slr5115"
                     /note="slr5115; ORF_ID:slr5115;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-tRNA hydrolase domain protein"
                     /protein_id="NP_942271.1"
                     /db_xref="GI:38505650"
                     /db_xref="GeneID:2655882"
                     /translation="MLQITKSLSIALTEIEMTALRSQGAGGQNVNKVASAIHLRFDIG
                     ASSLPDVYKERLLNLNDQRITKDGIVVIKAQSHRTQEQNREEALKRLQGLISSVITLP
                     KPRRPTKPTRSSQRKRLDAKTKRSAVKALRKSIDE"
     misc_feature    106537..106947
                     /locus_tag="slr5115"
                     /note="hypothetical protein; Provisional; Region:
                     PRK09256"
                     /db_xref="CDD:181730"
     misc_feature    <106546..106935
                     /locus_tag="slr5115"
                     /note="Protein chain release factor B [Translation,
                     ribosomal structure and biogenesis]; Region: PrfB;
                     COG1186"
                     /db_xref="CDD:224107"
     gene            107105..107527
                     /locus_tag="slr5116"
                     /db_xref="GeneID:2655883"
     CDS             107105..107527
                     /locus_tag="slr5116"
                     /note="slr5116; ORF_ID:slr5116;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942272.1"
                     /db_xref="GI:38505651"
                     /db_xref="GeneID:2655883"
                     /translation="MNNRIVIDTSVFVGALIGSQGPSRELIRRCLLSEYQPLMGNALF
                     AEYEAVVGRKEIISQCLLSRTEVISLLEALMSVCEWINIYYLWRPNLRDEGDNHLIEL
                     AISGNAHYIATNNVKDFQGTELIFPHLSILKPEHLLRG"
     misc_feature    107114..107455
                     /locus_tag="slr5116"
                     /note="PIN domain; Region: PIN_3; pfam13470"
                     /db_xref="CDD:257794"
     gene            107531..107746
                     /locus_tag="ssr5117"
                     /db_xref="GeneID:2655921"
     CDS             107531..107746
                     /locus_tag="ssr5117"
                     /note="ssr5117; ORF_ID:ssr5117;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942273.1"
                     /db_xref="GI:38505652"
                     /db_xref="GeneID:2655921"
                     /translation="MGTLTIRMPDDKHSRLKQLAESRGISVNKLVEELSTIALTEFDA
                     YNRFRLMAARGSVTEGLKLLDKLDGLD"
     misc_feature    <107534..107629
                     /locus_tag="ssr5117"
                     /note="HicB family; Region: HicB; pfam05534"
                     /db_xref="CDD:114265"
     gene            107767..108585
                     /locus_tag="slr5118"
                     /db_xref="GeneID:2655884"
     CDS             107767..108585
                     /locus_tag="slr5118"
                     /note="slr5118; ORF_ID:slr5118;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942274.1"
                     /db_xref="GI:38505653"
                     /db_xref="GeneID:2655884"
                     /translation="MFDNLCKFLAESFSEDYAAWLLGRPIKLTKLSPTELSLEPIRAD
                     SLILEQSEDLVLHLEFQTEPDPTMGFRMLDYRVRVYRRFPQKTMHQFVIHLKRSNNDL
                     VYQDSFQVGETLHRYQAIRLWEQPSEIFLQSPGLLPLAVLTQTSDPTLKLREVATALE
                     QIEDNRVKANLMAATSVFGGILLAPELIKTILRSEIMKESAVYQEILEEGKIAGKLEG
                     RLEGKLEGKLEGRLEAKLETIPLLKKLGLTIVEIAKELDIDVELVNKFVANQNN"
     misc_feature    107767..108582
                     /locus_tag="slr5118"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG5464"
                     /db_xref="CDD:227751"
     gene            108733..109503
                     /locus_tag="slr5119"
                     /db_xref="GeneID:2655885"
     CDS             108733..109503
                     /locus_tag="slr5119"
                     /note="slr5119; ORF_ID:slr5119;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942275.1"
                     /db_xref="GI:38505654"
                     /db_xref="GeneID:2655885"
                     /translation="MFDNLCKFLAESFSEDYAAWLLGRPIKLTKLSPTELSLEPIRAD
                     SLILEQSEDLVLHLEFQTEPDPTMGFRMLDYRVRVYRRFPQKTMHQFVIYLKRSNNDL
                     VYQDSFQLRETLHRYQVIRLWEQSSETFLQSSGLLPLAVLTQTSDPTLKLREVATALE
                     QIEDNRVKANLMAATSVFGGILLAPELIKTILRSEIMKESAVYQEILREGEQRGLLKG
                     KLETIPLLKKLGLTIAEIAKELDIDVELVNRFVANQNN"
     misc_feature    108733..109500
                     /locus_tag="slr5119"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG5464"
                     /db_xref="CDD:227751"
     gene            109617..109907
                     /locus_tag="ssr5120"
                     /db_xref="GeneID:2655922"
     CDS             109617..109907
                     /locus_tag="ssr5120"
                     /note="ORF_ID:ssr5120"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942276.1"
                     /db_xref="GI:38505655"
                     /db_xref="GeneID:2655922"
                     /translation="MPLNIDPTESRALAGRTLPPIINQQELLAIAIYRLAWCGAQGAT
                     IVEFPARFRVVPLVLSNDFSPPLYRQTLWNGGISKFRLISCCLAPTRGAAGQ"
     gene            110068..110283
                     /locus_tag="ssr5121"
                     /db_xref="GeneID:2655923"
     CDS             110068..110283
                     /locus_tag="ssr5121"
                     /note="ssr5121; ORF_ID:ssr5121;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942277.1"
                     /db_xref="GI:38505656"
                     /db_xref="GeneID:2655923"
                     /translation="MLKFIGIALLAALVGYAFGVMAGIFIVNNFSTNVQDKPLELAMT
                     SIFFFGPVGALIGLIIAVVYQLLHRYL"
     gene            complement(110524..111786)
                     /locus_tag="sll5122"
                     /db_xref="GeneID:2655944"
     CDS             complement(110524..111786)
                     /locus_tag="sll5122"
                     /note="sll5122; ORF_ID:sll5122;
                     SOS mutagenesis and repair, UmuC protein homolog"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942278.1"
                     /db_xref="GI:38505657"
                     /db_xref="GeneID:2655944"
                     /translation="MNSIALVDCNNFYVSCERVFQPLLNGKPVVVLSNNDGCVVARSS
                     EAKALGIKMGVPLFKIRDLVERHNIQVFSSNYCLYGDLSHRIMTSLQLFSPVVEIYSI
                     DEAFLELTPNQSNTNYGEEIRRCLKQWVGIPVSIGIAPTKVLAKVATDVAKQSGAGTF
                     CLDKAEAADTILATMPIADIWGIGRRLEKWFTTRGVSTALQFKQANPELIRKKMGVVG
                     QRLLLELQGISCLPLELIPNPKQETCVSRSFAQAVTTLDELQTAIAFFVSRAAEKLRR
                     QQQTPAVMIIFARTSFFIEQPISISQTIALPTPTHYTPELLKLAQTSLKQIFRPHHPY
                     KKAGVIMTGLQSERIVQGDLFEQPRDTERQQRLMLTVDQLNQKFGRETLGFGIFGQQQ
                     DWRMKSDLRSPRFTTAWDDLPEVKAGFY"
     misc_feature    complement(110539..111774)
                     /locus_tag="sll5122"
                     /note="DNA polymerase V subunit UmuC; Reviewed; Region:
                     umuC; PRK03609"
                     /db_xref="CDD:179607"
     misc_feature    complement(110758..111774)
                     /locus_tag="sll5122"
                     /note="umuC subunit of DNA Polymerase V; Region:
                     PolY_Pol_V_umuC; cd01700"
                     /db_xref="CDD:176454"
     misc_feature    complement(order(111328..111330,111475..111480,
                     111646..111648,111655..111657,111748..111753,
                     111760..111765))
                     /locus_tag="sll5122"
                     /note="active site"
                     /db_xref="CDD:176454"
     misc_feature    complement(order(110893..110895,110899..110913,
                     110968..110970,111049..111066,111139..111141,
                     111226..111246,111475..111477,111484..111486))
                     /locus_tag="sll5122"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:176454"
     misc_feature    complement(110542..110697)
                     /locus_tag="sll5122"
                     /note="Domain of unknown function (DUF4113); Region:
                     DUF4113; pfam13438"
                     /db_xref="CDD:257763"
     gene            complement(111783..112217)
                     /locus_tag="sll5123"
                     /db_xref="GeneID:2655978"
     CDS             complement(111783..112217)
                     /locus_tag="sll5123"
                     /note="sll5123; ORF_ID:sll5123;
                     SOS mutagenesis and repair, UmuD protein homolog"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942279.1"
                     /db_xref="GI:38505658"
                     /db_xref="GeneID:2655978"
                     /translation="MPANVLPEIYRPSRRTVYELPLYACPVSAGFPSPAEDYLEGKLD
                     LNQYLIKHPAATFFVRVTGDSMIGAGIHAGDILIVDRSLEPRDGKVVIAVVNGELLVK
                     RLRMEKQKIYLASENSDYPPLVITDLMDFEVWGVVTNVIHPL"
     misc_feature    complement(111786..>112139)
                     /locus_tag="sll5123"
                     /note="SOS-response transcriptional repressors
                     (RecA-mediated autopeptidases) [Transcription / Signal
                     transduction mechanisms]; Region: LexA; COG1974"
                     /db_xref="CDD:224885"
     misc_feature    complement(111804..112049)
                     /locus_tag="sll5123"
                     /note="Peptidase S24 LexA-like proteins are involved in
                     the SOS response leading to the repair of single-stranded
                     DNA within the bacterial cell. This family includes: the
                     lambda repressor CI/C2 family and related bacterial
                     prophage repressor proteins; LexA (EC...; Region:
                     S24_LexA-like; cd06529"
                     /db_xref="CDD:119397"
     misc_feature    complement(order(111912..111914,112023..112025))
                     /locus_tag="sll5123"
                     /note="Catalytic site [active]"
                     /db_xref="CDD:119397"
     gene            112352..113182
                     /locus_tag="slr5124"
                     /db_xref="GeneID:2655886"
     CDS             112352..113182
                     /locus_tag="slr5124"
                     /note="slr5124; ORF_ID:slr5124;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942280.1"
                     /db_xref="GI:38505659"
                     /db_xref="GeneID:2655886"
                     /translation="MFDNLCKFLAESFSEDYAAWLLGRPIKLTKLSPTELSLEPIRAD
                     SLILEQSEDLVLHLEFQTEPDPTMGFRMLDYRVRVYRRFPQKTMHQFVIYLKRSSNDL
                     VYQDSFQVGETLHRYQAIRLWEQPSEAFLQSPGLLPLAVLTQTSDPTLKLREVATALE
                     QIEDNRVKANLMAATSVFGGILLAPELIKTILRSEIMKESAVYQEILEEGKIAGKLEG
                     RLEGKLEGKLEGKLEGRLEAKLETIPLLKKLGLTITEIAKELDIDVELVNRFVANQNN
                     "
     misc_feature    112352..113179
                     /locus_tag="slr5124"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG5464"
                     /db_xref="CDD:227751"
     gene            complement(113239..113463)
                     /locus_tag="ssl5125"
                     /db_xref="GeneID:2655912"
     CDS             complement(113239..113463)
                     /locus_tag="ssl5125"
                     /note="ORF_ID:ssl5125"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942281.1"
                     /db_xref="GI:38505660"
                     /db_xref="GeneID:2655912"
                     /translation="MGKAVAFGIVARFGCTKSSIATSIVRPVRFALPAPKKMIIQLLV
                     CGVYLFGRFAPFLKERSGTPPSLDYSKAKM"
     gene            113953..114423
                     /locus_tag="slr5126"
                     /db_xref="GeneID:2655887"
     CDS             113953..114423
                     /locus_tag="slr5126"
                     /note="ORF_ID:slr5126"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942282.1"
                     /db_xref="GI:38505661"
                     /db_xref="GeneID:2655887"
                     /translation="MKKLLLLLTTILLIPLNATPSNAGAYSEECRNRMRSFQDLIEDK
                     FKTSLYANRNNLTGNPPLEGARDWIDVQLGDLSDPRNHENGNKVMESPVFLKNAAKQI
                     MDSCYPVIGRISFSLAGSDYRRSYSYIPGKGVEEDKCLPEITLGEEPWGFQNCL"
     gene            114514..115284
                     /locus_tag="slr5127"
                     /db_xref="GeneID:2655888"
     CDS             114514..115284
                     /locus_tag="slr5127"
                     /note="ORF_ID:slr5127"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942283.1"
                     /db_xref="GI:38505662"
                     /db_xref="GeneID:2655888"
                     /translation="MRKISINRLLAIKVAGSFAAATICGFAGYAIFLYFRPINAIGPF
                     SEEKTAFIRSEDGNITIANVHIKDGSFIESIGGVEKVQGRLAKGKDGSFSINNDGTVS
                     YNCLSSDESKAVCGSVRFQKSLGKFQFDRKIPFQMEETIYHPRGIGANAKQNATIMFK
                     SEDQSFWVKSEKVGTYNFLTPTSFEITWKTPAILWNGAGYSDEYIIRTANCTFHAEPI
                     QSVICEGTSKIDIASYTAIWTLIDSDDVPSMKSDETLD"
     gene            complement(115503..116540)
                     /locus_tag="sll5128"
                     /db_xref="GeneID:2655979"
     CDS             complement(115503..116540)
                     /locus_tag="sll5128"
                     /note="ORF_ID:sll5128"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942284.1"
                     /db_xref="GI:38505663"
                     /db_xref="GeneID:2655979"
                     /translation="MTTQSLTAEFAIEQLKILCQDGDVSDAFPHFEKSSDDEDEGVNE
                     NDINNFVGILAKSNWESEEEFFKFYKFVGYELFTTASDPELSDPSGDKTLIRTSPHDI
                     QFSPYTLTSIGGYFDLYARAREFLKQDQQNGQYAYEEVEIPPQCDAESEDITVIDLIP
                     GATAYIYDHGSYLSGLSPLFDKLQVQFWCDLIYFLGAGYVESSYSYDDTFPKRDIALC
                     LDNGVVLEHLFYGTEETNNDTYIYSQDCIDHLCTNQSTTSQILKTIALAATRNYEKLA
                     AELEEEEIWNGSEDSFEKFREYIMEDLDWDTEEILEAVRSHPNCTDEILEIIAQYESE
                     NSDDDGEEDDL"
     gene            complement(116636..116830)
                     /locus_tag="ssl5129"
                     /db_xref="GeneID:2655913"
     CDS             complement(116636..116830)
                     /locus_tag="ssl5129"
                     /note="ssl5129; ORF_ID:ssl5129;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942285.1"
                     /db_xref="GI:38505664"
                     /db_xref="GeneID:2655913"
                     /translation="MTGLWLHMMERALRPAPRKDYLVLLDHTKNDTIQGFPTRKRLWT
                     LEGVENFDGDRQLNGLKQRS"
     gene            complement(116886..117293)
                     /locus_tag="sll5130"
                     /db_xref="GeneID:2655976"
     CDS             complement(116886..117293)
                     /locus_tag="sll5130"
                     /note="sll5130; ORF_ID:sll5130;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942286.1"
                     /db_xref="GI:38505665"
                     /db_xref="GeneID:2655976"
                     /translation="MRFNDSEIEHIWANHFEEHTDEFSHEYEFRDYRNRLGGLVLLPK
                     SVNASLQDKPYSHKVNVYSTQNLLAGSLHPQTYENKPKVKQMQERTGLDLKPIYQEDG
                     KSQFTKVSFEERFALYRGIAEQMWSVESLKELV"
     misc_feature    complement(117093..>117287)
                     /locus_tag="sll5130"
                     /note="Protein of unknown function (DUF1524); Region:
                     DUF1524; pfam07510"
                     /db_xref="CDD:254249"
     gene            complement(117345..118361)
                     /locus_tag="sll5131"
                     /db_xref="GeneID:2655977"
     CDS             complement(117345..118361)
                     /locus_tag="sll5131"
                     /note="ORF_ID:sll5131"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="NP_942287.1"
                     /db_xref="GI:38505666"
                     /db_xref="GeneID:2655977"
                     /translation="MISNFGHIVKTYLSNFPKDDYPVLDTFKFVSIWLGLVLDQSQTS
                     MRSMFKRLNLRGETVDISTFSKASKKRDVGVFREIIFSLKKELSKRKEIKQGELEIFP
                     LDSTIVSITSKLMWNLGFHQVKVFSGINLSTGIPGGIVIHFGQGHDNKYGNETIEETP
                     ENGVAVMDRGFCDLQRIKRLQKENNKYHVLRIKNNIKLEKLANDNYMVGTGKNKIESR
                     VVIFTHDNSEFRLVTNLPIESKEIEGVSDEKIAEIYKKRWQIELLWKFLKMHLKLNRL
                     IAKNENAIGIQIYTCIIAYLILKLLVIPKEAGTTMLDKLRYLQAFMCEKISYVHWLRE
                     LALR"
     misc_feature    complement(117348..118226)
                     /locus_tag="sll5131"
                     /note="FOG: Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3385"
                     /db_xref="CDD:225920"
     misc_feature    complement(117471..118076)
                     /locus_tag="sll5131"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
CONTIG      join(AP004310.1:1..119895)
//
DBGET integrated database retrieval system