GenomeNet

Database: RefSeq
Entry: NC_005230
LinkDB: NC_005230
Original site: NC_005230 
LOCUS       NC_005230             103307 bp    DNA     circular CON 17-AUG-2015
DEFINITION  Synechocystis sp. PCC 6803 plasmid pSYSA DNA, complete genome.
ACCESSION   NC_005230
VERSION     NC_005230.1  GI:38505668
DBLINK      BioProject: PRJNA224116
            Assembly: GCF_000009725.1
KEYWORDS    RefSeq.
SOURCE      Synechocystis sp. PCC 6803
  ORGANISM  Synechocystis sp. PCC 6803
            Bacteria; Cyanobacteria; Oscillatoriophycideae; Chroococcales;
            Synechocystis.
REFERENCE   1
  AUTHORS   Kaneko,T., Nakamura,Y., Sasamoto,S., Watanabe,A., Kohara,M.,
            Matsumoto,M., Shimpo,S., Yamada,M. and Tabata,S.
  TITLE     Structural analysis of four large plasmids harboring in a
            unicellular cyanobacterium, Synechocystis sp. PCC 6803
  JOURNAL   DNA Res. 10 (5), 221-228 (2003)
   PUBMED   14686584
REFERENCE   2  (bases 1 to 103307)
  AUTHORS   Sato,S. and Kaneko,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-NOV-2001) Contact:Shusei Sato Kazusa DNA Research
            Institute, Department of Plant Genome Research; 2-6-7
            Kazusa-kamatari, Kisarazu, Chiba 292-0812, Japan URL
            :http://www.kazusa.or.jp/rhizobase/
COMMENT     REFSEQ INFORMATION: The reference sequence was derived from
            AP004311.
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider                    :: NCBI
            Annotation Date                        :: 08/17/2015 19:20:20
            Annotation Pipeline                    :: NCBI Prokaryotic Genome
                                                      Annotation Pipeline
            Annotation Method                      :: Best-placed reference
                                                      protein set; GeneMarkS+
            Annotation Software revision           :: 3.0
            Features Annotated                     :: Gene; CDS; rRNA; tRNA;
                                                      ncRNA; repeat_region
            Genes                                  :: 3,673
            CDS                                       3,602
            Pseudo Genes                           :: 23
            CRISPR Arrays                          :: 3
            rRNAs                                  :: 2, 2, 2 (5S, 16S, 23S)
            complete rRNAs                         :: 2, 2, 2 (5S, 16S, 23S)
            tRNAs                                  :: 41
            ncRNA                                  :: 1
            Frameshifted Genes                     :: 13
            Frameshifted Genes On Monomer Runs     :: 3
            Frameshifted Genes Not On Monomer Runs :: 2
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..103307
                     /organism="Synechocystis sp. PCC 6803"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:1148"
                     /plasmid="pSYSA"
     gene            complement(join(101524..103307,1..85))
                     /locus_tag="SGL_RS00625"
                     /old_locus_tag="sll7106"
     CDS             complement(join(101524..103307,1..85))
                     /locus_tag="SGL_RS00625"
                     /old_locus_tag="sll7106"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153669.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease V subunit alpha"
                     /protein_id="WP_011153669.1"
                     /db_xref="GI:499467029"
                     /translation="MEKSTDYLTGVIERITFHSEETGYTVARLQMSRAKELTTVVGNF
                     ANIQAGQTLKLAGIWKEHPKYGSQFQVNNYHETKPATLTGIEKYLGSGLIKGVGPVTA
                     KRIVAHFGLETLEIIEGESDRLMEVTGIGKKRVRMIQRAWAEQKAIKEVMLFLQGHGV
                     STTYAVKIYKEYGDDAIRVVTHNPYQLADDIFGIGFLTADKIAQQVGIDPTSKFRYRA
                     GILHTLGEAAEQGHCYLPQPELIKAAIAKLSTEEYEAMAEALLAVIEEMVAVQDLIRE
                     ILSEEEILLFKPTFYHTECKLAGYVKQKLVNSQIIDIDRVKTWINRYTDKNELELSKQ
                     QYTAVLLAATTGVMILTGGPGTGKTFTTRTIVALWRAMGKKIGLAAPTGRAAQRLGEM
                     TGLEAKTLHRLLEFDPNSMGFKRNEDNPLPFDAVIVDESSMLDLFLAHSLLKAISPNT
                     QLLLVGDIDQLPSVGPGSVLGDLIASEQITMVRLNQVFRQAAASAIIRHAHQINRGQY
                     PPMEAISDQPLSDCLWHNGGTEPDHGVQLIGELLTDFIPKQGFNLLQDVQVLCPMQRG
                     IIGARNLNAVVQSIVVSNKAETLNATVRTDNFIKRRVNRSVHSSSFQGTKVMLNII"
     gene            complement(182..490)
                     /locus_tag="SGL_RS00630"
                     /old_locus_tag="sll7001"
     CDS             complement(182..490)
                     /locus_tag="SGL_RS00630"
                     /old_locus_tag="sll7001"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153670.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_011153670.1"
                     /db_xref="GI:499467030"
                     /translation="MMCAYCMICFYDENFNSTLNSTSKYHQKHEKWDKEEGWKKWLNN
                     LRLVISVFNAINLIKKWLKVFPFAHILDELTKLYNKVNKLDRLKYLLNSWNTFYSSSA
                     "
     gene            complement(706..1101)
                     /locus_tag="SGL_RS00635"
                     /old_locus_tag="sll7002"
     CDS             complement(706..1101)
                     /locus_tag="SGL_RS00635"
                     /old_locus_tag="sll7002"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010872993.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_041428284.1"
                     /db_xref="GI:752788428"
                     /translation="MSVNAYGYCDGVTFTLESKVFKPKERLKEGDKYKTKPELAVEII
                     KELEESGFKIKRVVSDSLYGESHSNFISAVEELKIEYAVGIWSNHGVWLPKEAKVRAN
                     KWRRFEHIRWDGKQEDRYIREIVYGKKAQ"
     gene            complement(1399..1827)
                     /locus_tag="SGL_RS00640"
                     /old_locus_tag="sll7003"
     CDS             complement(1399..1827)
                     /locus_tag="SGL_RS00640"
                     /old_locus_tag="sll7003"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153672.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase"
                     /protein_id="WP_011153672.1"
                     /db_xref="GI:499467032"
                     /translation="MTEPVKYLIDTNVISELRKQDRADPGVLAFFQQAQHLYLSVITI
                     GELRRGVELIRHRGDVQQANLLEEWLEIVIADYADHILDFTIFEAQVLGKLRVPNPHN
                     ALDKQIAATALSYGLTLVTRNVKDFADTGVCLLNPFTGNQ"
     gene            complement(1799..2032)
                     /locus_tag="SGL_RS00645"
                     /old_locus_tag="ssl7004"
     CDS             complement(1799..2032)
                     /locus_tag="SGL_RS00645"
                     /old_locus_tag="ssl7004"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153673.1"
                     /note="ssl7004; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_011153673.1"
                     /db_xref="GI:499467033"
                     /translation="MANLIVRNIDEAVVVALKKRAGQHGISAEAEHRKILEQALLRLP
                     RKPFAEVLRQIPNVGNDSDFERIQDDRASQIFD"
     gene            2399..2965
                     /locus_tag="SGL_RS00650"
                     /old_locus_tag="slr7005"
     CDS             2399..2965
                     /locus_tag="SGL_RS00650"
                     /old_locus_tag="slr7005"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153878.1"
                     /note="slr7005; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153674.1"
                     /db_xref="GI:499467034"
                     /translation="MKINRQGQAKVLTEQELHDLFTVGLLTPRDRLLFGICLYTGCRI
                     GEACSLAWADITTDAMTFRIEKTKTKSSRTVAISPALQVLFDEYRQAQQFVRFPSSYV
                     FRGKRVGSHLHPSMAHKILKAATDRISVRGVSTHSFRRTALTMMCRKGINLRVIQKIS
                     GHKNLNVLSHYLEVSEQEKEQALSTISF"
     gene            complement(3041..3364)
                     /locus_tag="SGL_RS00655"
                     /old_locus_tag="sll7006"
     CDS             complement(3041..3364)
                     /locus_tag="SGL_RS00655"
                     /old_locus_tag="sll7006"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153675.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153675.1"
                     /db_xref="GI:499467035"
                     /translation="MSRLTLRLPESLHQQLSHQASQEGVSLNQYIVYALTRQITQQYL
                     VKPVLSEDIEKQQASFLSLLNNLGTATSEDIQLVLEEREIVASEDELTPDIVAQFQQK
                     IKTNS"
     gene            complement(3367..3819)
                     /locus_tag="SGL_RS00660"
     CDS             complement(3367..3819)
                     /locus_tag="SGL_RS00660"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012308549.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="toxin-antitoxin system toxin component, PIN
                     family protein"
                     /protein_id="WP_048908403.1"
                     /db_xref="GI:890839003"
                     /translation="MRCYSGGTANQVFPRLVIDTNVVLEGLTKQGGASGLIIEAWLAK
                     LFVVNVSTAIAYEYQDVLARKLSAHRWQTLKPVLGKLLSLAEFTTIYFTWRPTSPDPG
                     DDLIIDCAMNANAAIVISNIKDFRSAQQILGLQIFTPVELILKLINNN"
     gene            4241..5257
                     /locus_tag="SGL_RS00665"
                     /old_locus_tag="slr7008"
     CDS             4241..5257
                     /locus_tag="SGL_RS00665"
                     /old_locus_tag="slr7008"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010872778.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_011153677.1"
                     /db_xref="GI:499467037"
                     /translation="MISNFGHIVKTYLSNFPKDDYPVLDTFKFVSIWLGLVLDQSQTS
                     MRSMFKRLNLRGETVDISTFSKASKKRDVGVFREIIFSLKKELSKRKEIKQGELEIFP
                     LDSTIVSITSKLMWNLGFHQVKVFSGINLSTGIPGGIVIHFGQGHDNKYGNETIEETP
                     ENGVAVMDRGFCDLQRIKRLQKENNKYHVLRIKNNIKLEKLANDNYMVGTEKNKIESR
                     VVIFTHDNSEFRLVTNLPIESKEIEGVSDEKIAEIYKKRWQIELLWKFLKMHLKLNRL
                     IAKNENAIGIQIYTCIIAYLILKLLVIPKEAGTTMLDKLRYLQAFMCEKISYVHWLRE
                     LALR"
     gene            complement(5340..6284)
                     /locus_tag="SGL_RS00670"
                     /old_locus_tag="sll7009"
     CDS             complement(5340..6284)
                     /locus_tag="SGL_RS00670"
                     /old_locus_tag="sll7009"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153678.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_011153678.1"
                     /db_xref="GI:499467038"
                     /translation="MKFQYNSLTFAIEVLKALAKEPCYRKNLTEQLELFLEQHQQPAD
                     DVAQKLTRTIRKLRDCGFEIESAPHRPYVLKKSNFPVILSADQRQALYLATHLLEQMG
                     FSQQASQLQDICPLTEGDRPRHLRADFNPPVDYSDIKTKEIITNLQKRLETACRFTIR
                     YRNSLGKEALWDLDRSELRLHNGSLYLFAYVPDILTQRIQKRPNIEQNVLFRIDRILS
                     VNPSSNIHWLLSSFPTLKVQYRMIGSLSKYKPRRHNETVINRNVEQNYVEIETNEDCL
                     FWFRQRILQYGSNVQILTPQWLHQEIVEEHLKAIQSTK"
     gene            6373..8517
                     /locus_tag="SGL_RS00675"
                     /old_locus_tag="slr7010"
     CDS             6373..8517
                     /locus_tag="SGL_RS00675"
                     /old_locus_tag="slr7010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153679.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein Cas3"
                     /protein_id="WP_041428276.1"
                     /db_xref="GI:752788420"
                     /translation="MKVQVKPLYAKLNEGLGQCPLGCQSVCTVREQAPEMQPPDGCSC
                     PLYDHQAQTYALTTAGDTDIIFNRVATGGGKSLGATLPALLPKVHPDFRVMGLYPTIE
                     LVEDQYRQQQQYHQMFGLNAEKRVDRLYGAELARRISEKDSNRFQELLKSIEQKPVIQ
                     TNPDIFHYITHFRYRDNARSQSELPMVMAKFPDLWVFDEFHIFGEHQMAAALNSLLLI
                     RHATQSKRKFLFTSATPKTSFVESLKNSGFKIAEIQGEYSDRPQQGYRQILQNINLEF
                     VHLKDTDTESWLLAQSQNLRDLLHQEKNGRGLIIVNSVAAAGHLCRNLSKILPDVEVR
                     EISGRCDRQERQQTQTYLQKSEKSVLVVATSAVDVGVDFKIHVLICESSDSATVIQRL
                     GRLGRHGGFQQYQAYVLIPSQTQWVIASLKEELEEDSSIDRLELSTVIETAFNAPQEF
                     KQYQKIWGELQAQGMLYQMVYGGSRSESKDNLAVTQDLRDRMIESLEKIYQKQINGFG
                     RWWGLSNDAVGKATQEELLRFRGGSSLQSGIWDGDRLYSYDLLKVLTYATVEVIDREI
                     FLEAAQKLNHGIEEFPEQYLTGYFKITKWLDQRLNFSLFSTHSHLASCQLMLLDRLQL
                     KGHIQPELSRCLGRRKYLAYLVPINRNNPSSHWDISRKLRLSPLFGLYRLTDSGGNAY
                     GCAFNHDALLLEALKWRLGDFCKQATSQSLIF"
     gene            8531..11458
                     /locus_tag="SGL_RS00680"
                     /old_locus_tag="slr7011"
     CDS             8531..11458
                     /locus_tag="SGL_RS00680"
                     /old_locus_tag="slr7011"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153680.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein Csc3"
                     /protein_id="WP_011153680.1"
                     /db_xref="GI:499467040"
                     /translation="MTTLLQTLLIRTLSEQKDYILLEYFQTILPALEEHFGNTSGLGG
                     SFISHQKHFGTQGYDTEKAKKMAQGFAKKGDQTLAAHILNALLTTWNVMQELEFPLND
                     IERRLLCLGITLHDYDKHCHAQDMAAPEPDNIQEIINICLELGKRLNFDEFWADWRDY
                     IAEISYLAQNTHGKQHTNLISSNWSNAGYPFTIKERKLDHPLRHLLTFGDVAVHLSSP
                     HDLVSSTMGDRLRDLLNRLGIEKRFVYHHLRDTTGILSNAIHNVILRTVQKLDWKPLL
                     FFAQGVIYFAPQDTEIPERNEIKQIVWQGISQELGKKMSAGDVGFKRDGKGLKVSPQT
                     SELLAAADIVRILPQVISVKVNNAKSPATPKRLEKLELGDAEREKLYEVADLRCDRLA
                     ELLGLVQKEIFLLPEPFIEWVLKDLELTSVIMPEETQVQSGGVNYGWYRVAAHYVANH
                     ATWDLEEFQEFLQGFGDRLATWAEEEGYFAEHQSPTRQIFEDYLDRYLEIQGWESDHQ
                     AFIQELENYVNAKTKKSKQPICSLSSGEFPSEDQMDSVVLFKPQQYSNKNPLGGGQIK
                     RGISKIWSLEMLLRQAFWSVPSGKFEDQQPIFIYLYPAYVYAPQVVEAIRELVYGIAS
                     VNLWDVRKHWVNNKMDLTSLKSLPWLNEEVEAGTNAQLKYTKEDLPFLATVYTTTREK
                     TDTDAWVKPAFLALLLPYLLGVKAIATRSMVPLYRSDQDFRESIHLDGVAGFWSLLGI
                     PTDLRVEDITPALNKLLAIYTLHLAARSSPPKARWQDLPKTVQEVMTDVLNVFALAEQ
                     GLRREKRDRPYESEVTEYWQFAELFSQGNIVMTEKLKLTKRLVEEYRRFYQVELSKKP
                     STHAILLPLSKALEQILSVPDDWDEEELILQGSGQLQAALDRQEVYTRPIIKDKSVAY
                     ETRQLQELEAIQIFMTTCVRDLFGEMCKGDRAILQEQRNRIKSGAEFAYRLLALEAQQ
                     NQN"
     gene            11524..12513
                     /locus_tag="SGL_RS00685"
                     /old_locus_tag="slr7012"
     CDS             11524..12513
                     /locus_tag="SGL_RS00685"
                     /old_locus_tag="slr7012"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153681.1"
                     /note="slr7012; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein Csc2"
                     /protein_id="WP_011153681.1"
                     /db_xref="GI:499467041"
                     /translation="MLDSLKSQFQPSFPRLASGHYVHFLMLRHSQSFPVFQTDGVLNT
                     TRTQAGLLEKTDQLSRLVMFKRKQTTPERLAGRELLRNLGLTSADKSAKNLCEYNGEG
                     SCKQCPDCILYGFAIGDSGSERSKVYSDSAFSLGAYEQSHRSFTFNAPFEGGTMSEAG
                     VMRSAINELDHILPEVTFPTVESLRDATYEGFIYVLGNLLRTKRYGAQESRTGTMKNH
                     LVGIVFADGEIFSNLHLTQALYDQMGGELNKPISELCETAATVAQDLLNKEPVRKSEL
                     IFGAHLDTLLQEVNDIYQNDAELTKLLGSLYQQTQDYATEFGALSGGKKKAKS"
     gene            12674..13438
                     /locus_tag="SGL_RS00690"
                     /old_locus_tag="slr7013"
     CDS             12674..13438
                     /locus_tag="SGL_RS00690"
                     /old_locus_tag="slr7013"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153682.1"
                     /note="slr7013; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein Csc1"
                     /protein_id="WP_011153682.1"
                     /db_xref="GI:499467042"
                     /translation="MTKIYRCKLTLHDNVFFASREMGILYETEKYFHNWALSYAFFKG
                     TIIPHPYGLVGQNAQTPAYLDRDREQNLLHLNDSGIYVFPAQPIHWSYQINTFKAAQS
                     AYYGRSVQFGGKGATKNYPINYGRAKELAVGSEFLTYIVSQKELDLPVWIRLGKWSSK
                     IRVEVEAIAPDQIKTASGVYVCNHPLNPLDCPANQQILLYNRVVMPPSSLFSQSQLQG
                     DYWQIDRNTFLPQGFHYGATTAIAQDSPQLSLLDTN"
     gene            13441..14229
                     /locus_tag="SGL_RS00695"
                     /old_locus_tag="slr7014"
     CDS             13441..14229
                     /locus_tag="SGL_RS00695"
                     /old_locus_tag="slr7014"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153683.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein Cas5"
                     /protein_id="WP_011153683.1"
                     /db_xref="GI:499467043"
                     /translation="MFDDRYSLYSVVIELGAAKKGFPTGILGRALHSQVLEWLKIGEP
                     SLAEELHQSQISPFSISPLIGKRRSKLTEEGDRFFFRISLLNGSLLQPLLKGLEQQDK
                     QIVMLDKFAFRLCHIHILPGSHSLARASSYALTTQAPTSSKITLKFHSATSFKIDRNT
                     IQPFPLGDSVFNSLLRRWNHFAPEELYFPSVSWQIPVAAFELKTYSVQLKKSEIGSEG
                     WVTYLFPDQEQAKIASVLSQFAFFAGVGRKTSMGMGQVSVNNHG"
     gene            14219..14794
                     /locus_tag="SGL_RS00700"
                     /old_locus_tag="slr7015"
     CDS             14219..14794
                     /locus_tag="SGL_RS00700"
                     /old_locus_tag="slr7015"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153684.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein Cas4"
                     /protein_id="WP_041428285.1"
                     /db_xref="GI:752788429"
                     /translation="MMDDYLPLAYLNAWEYCHRRFYLEYVLGEMEINEHIIRGNHLHR
                     NINEAGTSVDGDTRIHRQQWVWSDRLKVKGIIDAVEESDGLLIPVEYKKGKMGKHLND
                     HFQLCAAALCLEEKTGKSITYGEIFYYGNRRRQPVEFTQALRNMTEQAIIAAHLACNG
                     PMPRPIANTKKCADCSLERLCLPKELKKLTK"
     gene            14804..15781
                     /locus_tag="SGL_RS00705"
                     /old_locus_tag="slr7016"
     CDS             14804..15781
                     /locus_tag="SGL_RS00705"
                     /old_locus_tag="slr7016"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153685.1"
                     /note="slr7016; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein Cas1"
                     /protein_id="WP_011153685.1"
                     /db_xref="GI:499467045"
                     /translation="MSTLYLTQPDAVLSKKHEAFHVALKQEDGSWKKQPIPAQTLEDI
                     VLLGYPSITGEALGYALELGLPVHYLTQFGKYVGSALPSESRNGQLRLAQFRAHEDPI
                     QRLDIVKAFVKGKVHNQYNLLYRRGQVDNPLKGRGKLVMRQQTLEQVRGIEGLAAREY
                     FASWQEMLGHEWTFTGRFRRPPTDPVNALLSFGYGLLRTQVTAAVHIAGLDPYIGFLH
                     ETTRGQPAMILDLMEEFRALVADSVVLTVLKQREIQRQDFTESLGAFRLTDSATKTFL
                     GAFDRKLSSEFKHPIFNYKCTYRRAIELQARLLARHLQEGVVYEPLVIR"
     gene            15813..16097
                     /locus_tag="SGL_RS00710"
                     /old_locus_tag="ssr7017"
     CDS             15813..16097
                     /locus_tag="SGL_RS00710"
                     /old_locus_tag="ssr7017"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q6ZEI1.1"
                     /note="ssr7017; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated endonuclease Cas2"
                     /protein_id="WP_011153686.1"
                     /db_xref="GI:499467046"
                     /translation="MLYLIIYDVPATKAGNKRRTRLFDLLSGYGKWRQFSVFECFLSV
                     KQFAKLQTAMEKLIKLDEDAVCIYVLDENTVQRTITYGTPQPEKPGSIII"
     repeat_region   16310..19901
                     /inference="COORDINATES: alignment:crt:1.2"
                     /inference="COORDINATES: alignment:pilercr:v1.02"
                     /rpt_family="CRISPR"
                     /rpt_type=direct
                     /rpt_unit_range=16310..16346
                     /rpt_unit_seq="ctttccttctactaatcccggcgatcgggactgaaac"
     repeat_region   16967..17151
     repeat_region   18410..18752
     repeat_region   19149..19329
     gene            20266..22182
                     /locus_tag="SGL_RS00715"
                     /old_locus_tag="slr7023"
     CDS             20266..22182
                     /locus_tag="SGL_RS00715"
                     /old_locus_tag="slr7023"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153692.1"
                     /note="slr7023; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153692.1"
                     /db_xref="GI:499467052"
                     /translation="MPKLKKLTPKAEAQSESTSLDRLRELAQDPKLAKLVAANYMAPP
                     DLLEELSHTSDKPLLKALVSNPNTPTEVLLKLGSLFPEQLLDNPVFDILLIENPNLLS
                     EFPKSSLNSLLKREVAPVSFLRWAATNGDENTLQSLLINPNVPAEVVQGLTEHGDWDV
                     VIAAKLHVNSGVEVEPSWEEQGLKRRVPEKENERVTDFFRYFWPELKDLVCLNYWIRR
                     RIASHPNCPVDVLAQLALDDDLDVRICVAKNPNCPVELRLKLLTQLALDDGCWVRICV
                     AENPNCPVDVLTQFALDNNSYVRRDVASNLNCPVEVLTQLALDDDYRVRRDVASNPNC
                     PVDVLTQLALDNNSDVRIGITLNLNCPVDVLTQLALDNNSDVRIGITLNPNCPVELRL
                     KLLTQLALDNNSDVRIDVTLNPNCPVEVLTQLALDDSYVRRGIALNLNCPVEVLTQLA
                     LDNNSDVRRGVASNPNCPVEVLTQLALDNNSDVRRGVASNPNCPVEVLTQLALDNNSD
                     VRRGVASNPNCPVEVLTQLALDNNSDVRRGVASNLNCPPADLIVDSFLEQFTKSSIPT
                     YPRLIAFRSPHCPTGALAKNYRSRDWLERCAIAEHPKTPDATLQKLLLDGNRLVRQKA
                     QANLEQRQNIIPED"
     repeat_region   21582..21902
     gene            22328..24058
                     /locus_tag="SGL_RS00720"
                     /old_locus_tag="slr7024"
     CDS             22328..24058
                     /locus_tag="SGL_RS00720"
                     /old_locus_tag="slr7024"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153693.1"
                     /note="slr7024; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153693.1"
                     /db_xref="GI:499467053"
                     /translation="MTIYALEHPLRNVFSPKDYQFKIPEYQRPYAWTNDQAEEFWNDL
                     INALDQKEEEEPEYFLGSMVLVKSENKPEAEVVDGQQRLTTLTILFAVIRHHLSPSST
                     AYSKIENLFFEEDFDGQKRPGLTTRKQDNQFFADNIYTPGGIENLIKQDSGFDSDSQI
                     KMRDNAIFFDKQLKNKLKEISDQDKDQWLTKLLGNILKCCHLVVVSTNDFEKAYRIFS
                     TINSRGLNLTHNDILKAEIISKMDDGKKRKEYTEIWDSMEGDLGRSQFESLFAYIFRI
                     EYQERPSKSILTEYRKRVLPKYEEKYPKDHVFKFVDELLLPSSKVLEIINNQNFECED
                     LEIQDSINNYLGWLNLIDNDDWKAPLISFMIRYRNESTKLLKFLVELERYAAAIMFLR
                     FDINARARAYRPVILATLESAGEAIDTLEKALDIEKQDELIKKVLEGDIYKDKTRRKY
                     ILLRLDSALAESGQSESLKSKTLTIEHVLPQSLTLEWKSLGWNEENHAIWVNRLGNLA
                     LLSQKKNSSGSNLSFEIKKKEYFQKKGSVTFPITTRILSYSTWTPAIVEQNQNFYIKT
                     LKKVWRLSLM"
     gene            24079..24495
                     /locus_tag="SGL_RS00725"
                     /old_locus_tag="slr7025"
     CDS             24079..24495
                     /locus_tag="SGL_RS00725"
                     /old_locus_tag="slr7025"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153694.1"
                     /note="slr7025; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153694.1"
                     /db_xref="GI:499467054"
                     /translation="MNITFKFNFMSYKHYFSPKHKPEITQAITITEPAIIFRLNKTYS
                     TNLSQQEIYDITRSDWILGHRREKAEYGFAAFKGVVLQVYRIDRWDFSGKVTDVGRQR
                     WFFEGKVATEMQDYINGNISHYFKKGDRSPTKYLNC"
     gene            24509..24886
                     /locus_tag="SGL_RS00730"
                     /old_locus_tag="slr7026"
     CDS             24509..24886
                     /locus_tag="SGL_RS00730"
                     /old_locus_tag="slr7026"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153695.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153695.1"
                     /db_xref="GI:499467055"
                     /translation="MLKMNSPTFFEKGTTFYSKSDFNKALSQWYNKTDEVTIGDTSYS
                     QASWIFIKLGMYDFQLNADTKRIGVFDYLQILKQYEQDLPWHIVENTRNSKINKAVFG
                     EDFKKISGFYLYIKKALETTITI"
     gene            complement(24925..25509)
                     /locus_tag="SGL_RS00735"
                     /old_locus_tag="sll7027"
     CDS             complement(24925..25509)
                     /locus_tag="SGL_RS00735"
                     /old_locus_tag="sll7027"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153696.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153696.1"
                     /db_xref="GI:499467056"
                     /translation="MVLGLNPGVGYPELQSRDGVWANRIRQTSFSKCFDRSPPGDQAW
                     LKLHVKESPYWRSLMSFGQRCCGNNFEFSQILNFELYPWHSSALTSALNCPPSIIDLY
                     VFQPLAEVQTRHIFAFGKPWDKVFQGLGLTEVRRYGDGFQPLPGVSTPGWTVVIFRSA
                     LMTVPIIVSWQQGYAGPPGKPRLQALRAIIENEG"
     gene            complement(26004..26195)
                     /locus_tag="SGL_RS00740"
     CDS             complement(26004..26195)
                     /locus_tag="SGL_RS00740"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013320616.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_051045132.1"
                     /db_xref="GI:916310086"
                     /translation="MLNQDFKEFIELLNKNQVKYLVIGGYAVAIHGHPRYTKDIDIWV
                     EIGENYLWHWHGLDLIVWG"
     gene            complement(26352..27608)
                     /locus_tag="SGL_RS00745"
                     /old_locus_tag="sll7028"
     CDS             complement(26352..27608)
                     /locus_tag="SGL_RS00745"
                     /old_locus_tag="sll7028"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153697.1"
                     /note="sll7028; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153697.1"
                     /db_xref="GI:499467057"
                     /translation="MSDDCQALLSATRLRLRMQSPFFATLALFARYYVTEAIPTAGTE
                     GKNIYFNPHYLAQLTPAERDGLFLHELLHGALLHQSRRASRLPELWNIAADIVVNGMI
                     VAEGKFVIPKGGLREPELEKYSVEEVYELLIKRESPPALPIADLLQEIPNLTTQSDSN
                     NNDNDLNSNDSEPNGGQSSANSSKIHSHSQDDQEIHRNRLESPRHQEEQLAVHWRNAI
                     QQATVVARSQFQGNLPEGLERHLGEIGQPQLDWRTYLWRFLVHTPNDFQGYDRRFIHQ
                     GLYLEALVGESVEVFCCIDTSGSVGDEEMGIFLSELRGIFGSYPQIKCWLWYADADCY
                     GPYELDNLNAVPKPQGGGGTDFRPFFTAVDEKWSREKQAVICYLTDGYGSFPDQAPPL
                     DTLWVVSPGGKNSDGFPFGEVVRLRS"
     gene            complement(27605..28630)
                     /locus_tag="SGL_RS00750"
                     /old_locus_tag="sll7029"
     CDS             complement(27605..28630)
                     /locus_tag="SGL_RS00750"
                     /old_locus_tag="sll7029"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153698.1"
                     /note="sll7029; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_011153698.1"
                     /db_xref="GI:499467058"
                     /translation="MTPVQLKNYLEQLVGNQIKTSTMIWGPPGIGKSSIVAQIAEEGK
                     LRFIDLRLSQLAPTDLRGLPVAIPTSKTKPQTGTSAWYPPEFLPKDGAGILFLDELNM
                     APPAMQGVAQQLILDRRVGSYEVPTDWFIWAAGNRKEDRASVFEMPAPLANRFLHLDV
                     QPDFESFKQYALEQKYHEQVIAFLSFRPGLIHKLDLQRPAWPSPRSWAIANGLHQVNL
                     DVSPAVGEGCAAEFSAFVQLYKDLPDLEAIFRGQGQNIGFPTEPSSGYASTIGLAVRA
                     KDATAGVNAFHWLTDKADSEWVQLFVTDMAGQLRRAGHLGALSIMAKKEPKLKQFMQG
                     YQELLAI"
     gene            complement(28850..29353)
                     /locus_tag="SGL_RS00755"
                     /old_locus_tag="sll7030"
     CDS             complement(28850..29353)
                     /locus_tag="SGL_RS00755"
                     /old_locus_tag="sll7030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153699.1"
                     /note="sll7030; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase GCN5"
                     /protein_id="WP_011153699.1"
                     /db_xref="GI:499467059"
                     /translation="MVLKIELLDSRIHQRSDFYCGEASLDTYIQKQASQDLKRKIATI
                     FVLVDNLDKKVLGYYTLSAYTVNIAYLETDFAKGLPRYPMLPATLLGRLAVDQNYKGQ
                     GLGELLLIDALKRAWETSQLIASLAVIVEALNDQASNFYIKYGFVPFNQQPSKLYLAM
                     KSVERLF"
     gene            complement(29337..29639)
                     /locus_tag="SGL_RS00760"
                     /old_locus_tag="sll7031"
     CDS             complement(29337..29639)
                     /locus_tag="SGL_RS00760"
                     /old_locus_tag="sll7031"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153700.1"
                     /note="sll7031; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153700.1"
                     /db_xref="GI:499467060"
                     /translation="MTQITKSKALARLEARISPETKALMQKAAALEGRSLTDFVVASA
                     QAAALKVIEQHQTLQLTIADSQAFVDALLRPSEPNSKLKKAALRHQQIIEIDGVKN"
     gene            complement(30008..30142)
                     /locus_tag="SGL_RS00765"
     CDS             complement(30008..30142)
                     /locus_tag="SGL_RS00765"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016516077.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional aconitate hydratase
                     2/2-methylisocitrate dehydratase"
                     /protein_id="WP_041428277.1"
                     /db_xref="GI:752788421"
                     /translation="MLQGYRRHAANRQKLGIPPLPLNAQQTTELCELLKIPPKRKKKN
                     "
     gene            30352..30669
                     /locus_tag="SGL_RS00770"
                     /old_locus_tag="slr7032"
     CDS             30352..30669
                     /locus_tag="SGL_RS00770"
                     /old_locus_tag="slr7032"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153701.1"
                     /note="slr7032; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153701.1"
                     /db_xref="GI:499467061"
                     /translation="MNRDLASILDALIFARRIVTFTTNMTEENFFTDIKTQDAVMRNI
                     AVLGEALRRISPEFRQTYSKIPYNQGNYLKLQDELFTGETIKSLGRNFLEFEANKSQE
                     TVP"
     gene            complement(30699..31040)
                     /locus_tag="SGL_RS00775"
                     /old_locus_tag="sll7033"
     CDS             complement(30699..31040)
                     /locus_tag="SGL_RS00775"
                     /old_locus_tag="sll7033"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153702.1"
                     /note="sll7033; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153702.1"
                     /db_xref="GI:499467062"
                     /translation="MSRLYGDENFPMPVVQALRELGHDVLTCLDAGQADKAIPDEDVL
                     AFAVAEQRAVLTINRKDFIRLHLQNECHCGIIVCTFNADFLAQAKQIDAALEQISEPS
                     NQLIRINRLQG"
     gene            complement(31037..31369)
                     /locus_tag="SGL_RS00780"
                     /old_locus_tag="sll7034"
     CDS             complement(31037..31369)
                     /locus_tag="SGL_RS00780"
                     /old_locus_tag="sll7034"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153703.1"
                     /note="sll7034; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153703.1"
                     /db_xref="GI:499467063"
                     /translation="MTSALQAIANLLPQLSGGERAQLLQWVAQDLGDLAPGVEVHPLV
                     CGGEPCIVRTRIPVWVLEQARRQGLNDGEILRCYPSLRAEDLVNAWAYVRRHRSEVEG
                     QINENEAL"
     gene            31822..32097
                     /locus_tag="SGL_RS00785"
                     /old_locus_tag="ssr7035"
     CDS             31822..32097
                     /locus_tag="SGL_RS00785"
                     /old_locus_tag="ssr7035"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153704.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153704.1"
                     /db_xref="GI:499467064"
                     /translation="MRPIQSGSLLLPVAGRPRLGDRALDFDSPSTEVVCGQNHHNEFP
                     EVPIAFFGWRSPVSWGEIEQGSMLDQGNIEVFERKPKERKPFPEQAL"
     gene            32289..32483
                     /locus_tag="SGL_RS00790"
                     /old_locus_tag="ssr7036"
     CDS             32289..32483
                     /locus_tag="SGL_RS00790"
                     /old_locus_tag="ssr7036"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153705.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153705.1"
                     /db_xref="GI:499467065"
                     /translation="METGHSIALIAAQTPKTKETPHALDGTEGVPKVLKAHQPRAIGA
                     FKLNFSNGKPQLAKFAGGAA"
     gene            32647..35523
                     /locus_tag="SGL_RS00795"
                     /old_locus_tag="slr7037"
     CDS             32647..35523
                     /locus_tag="SGL_RS00795"
                     /old_locus_tag="slr7037"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153706.1"
                     /note="slr7037; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153706.1"
                     /db_xref="GI:499467066"
                     /translation="MKVRPQHWQEWVNSGIAPEIIEANLKSLDNAYGWLLYSEKLPRR
                     NDGRLSQGILTQYRHLEQGGWYCSGLDAITLEDSQWGCFKPDQPRLSQEGKLIKYEHP
                     PKTSTEAFCLKITRHQWRQIAQKAGLECPDLEHIPNQEIAQSFWQWVKNNPAVPIIIT
                     EGAKKTASLLSYGYAALGLPGIYSGYRSKDSEGIELVHKQLIPQLETFCQQGREFVFC
                     FDNDNKPTTKHNVRKAIANTGCLMELQGCKVTVMTWAGLAKGIDDVIVGNGETSLDRI
                     YSARQSLEAHKLSEFTDLTPLISQIVNCRYLDQDILANVTSRLVGIKAAKGTGKTEAL
                     AQQVQQAIAKGLPVIVLTHREQLAKELAQRFGLPYRSELEFGAESFHGYVLCVDSLHP
                     QAKPAFDSSRYPDALVILDEAEQVIWHLLNSVTCQRNRPAILETLSQLLNGAGQIVLS
                     DADLTRISLDYLHGLLTVQCAPWVLVNEYHPASARKAFLYDAPEALFSDALECIQNGE
                     RLIIHTGAQKVSSKWGTINLETTLSGAFPELNILRIDAESVAEPGHPAYGVMGNLNAI
                     IPLYDIVIASPTLETGVSIDVKGHFHRVFCFAPGSQTAEAVCQSLARVREDLPRHLWI
                     KKYSNQSIGNGSTIPKILVSSQQKLFKANSLLLGQADTIANLDGHCSRHMVTWARYSA
                     LHNHGFKKYRDVILSRLEAEGYSILSTDAPDDAKSVGEFMKAYTEANYQQHCEKVAAA
                     PLLDDLEFERISRARAKSEPERLSEQKTAISKRYLTDDITPELVSQDDKGLYGQLQLR
                     YYLTLGREFLAERDTHRVKKLTKQTGEAFTPDINSTCYSAKVKTLEIINIGQFLDGSA
                     HTSESLRDWFEHICQFRDDIKAILNQSINPERDTPIAVAQRLLGLMGLKMTGKQYRIN
                     GGRQRIYALVDSPPDDPAKIIMERWFERDSSRVPCHTSSLKELC"
     gene            complement(35891..36178)
                     /locus_tag="SGL_RS00800"
                     /old_locus_tag="ssl7038"
     CDS             complement(35891..36178)
                     /locus_tag="SGL_RS00800"
                     /old_locus_tag="ssl7038"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153707.1"
                     /note="ssl7038; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="addiction module antitoxin"
                     /protein_id="WP_011153707.1"
                     /db_xref="GI:499467067"
                     /translation="METLKTIPWDAADHLESREDMAAYLEAALEEGDPALILVALGDI
                     ARSKGMTLIAKETGLGRESLYKALSANGNPEFVTVLKVMEALGLRLQATTL"
     gene            complement(36189..36479)
                     /locus_tag="SGL_RS00805"
                     /old_locus_tag="ssl7039"
     CDS             complement(36189..36479)
                     /locus_tag="SGL_RS00805"
                     /old_locus_tag="ssl7039"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153708.1"
                     /note="ssl7039; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153708.1"
                     /db_xref="GI:499467068"
                     /translation="MIEIRQTETYARWFKSLRDCQAKARIDIRIRRLSLVNAGDVKSV
                     GGGVSELRINYGPGYRIYFTQQGEQLIILLAGGDKQTQSNDITIARDLAKEL"
     gene            36597..36848
                     /locus_tag="SGL_RS00810"
                     /old_locus_tag="ssr7040"
     CDS             36597..36848
                     /locus_tag="SGL_RS00810"
                     /old_locus_tag="ssr7040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153709.1"
                     /note="ssr7040; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell growth regulatory protein"
                     /protein_id="WP_011153709.1"
                     /db_xref="GI:499467069"
                     /translation="MEVRLKKWGNSIGLRIPHPLAISWGFDESTVVDLVETEQGLMIR
                     KRSSPGSLEALLTSIPADFTYPGDVSDFVESEATGQEWL"
     gene            36839..37201
                     /locus_tag="SGL_RS00815"
                     /old_locus_tag="slr7041"
     CDS             36839..37201
                     /locus_tag="SGL_RS00815"
                     /old_locus_tag="slr7041"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153710.1"
                     /note="slr7041; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="growth inhibitor PemK"
                     /protein_id="WP_011153710.1"
                     /db_xref="GI:499467070"
                     /translation="MVMTSTVPQYPERGAVIRLNLNPTQGREQMGEARPCLVLSHTAF
                     NKARNGLIIVSPITNTIKPEIQTLVVLPDGYRVQGSVIAEQIRTVDLSLRWWRDTGEV
                     LPPSFVDQVLAVLQLIIG"
     gene            complement(37267..37521)
                     /locus_tag="SGL_RS00820"
                     /old_locus_tag="ssl7042"
     CDS             complement(37267..37521)
                     /locus_tag="SGL_RS00820"
                     /old_locus_tag="ssl7042"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153711.1"
                     /note="ssl7042; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153711.1"
                     /db_xref="GI:499467071"
                     /translation="MGTATRYTVSIARSGLRLRESRIIADLLLQKISDGDWQRKILEE
                     NVLQIGNVESIKRIAHLLRSRIEPLGESLWLLIRDGDASH"
     gene            complement(37554..38138)
                     /locus_tag="SGL_RS00825"
                     /old_locus_tag="sll7043"
     CDS             complement(37554..38138)
                     /locus_tag="SGL_RS00825"
                     /old_locus_tag="sll7043"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153712.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153712.1"
                     /db_xref="GI:499467072"
                     /translation="MPKKLSVPEIRVTSSEQQGLFAQAADPITPLKEIDMNGATLMEL
                     EDIVKAAHQSFQSHLGDALQAGLIAGKALLTAKQQFTYNRQTGGFRGWLERIEVSKST
                     AYRYIELATNEPIVSQAGTLSEAMERLAQHRAEQRALKAGEEQVEVKKRRVTLKLSNE
                     RDQKLESIAKSRGGDVSALIKEIVEQWLANEQDS"
     gene            complement(38131..38712)
                     /locus_tag="SGL_RS00830"
                     /old_locus_tag="sll7044"
     CDS             complement(38131..38712)
                     /locus_tag="SGL_RS00830"
                     /old_locus_tag="sll7044"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153713.1"
                     /note="sll7044; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153713.1"
                     /db_xref="GI:499467073"
                     /translation="MKIVVFNGKGGVGKSTIAANLAVISASPLLDADPQATCCYWADR
                     RGSNSPEVVDVSLGRVAIRLKALERAIVDLPGASVPGVHDALSVADVVLVPVVYDQAT
                     LDALPATLELARNAHRPTTMLLNRLHPRAHADGIVTSLAPLNVPICLTPVRERASHRD
                     WWSQGLVAADFPDTDAGGDILQIWQWLQTQNYA"
     repeat_region   39319..39495
     gene            complement(39500..39682)
                     /locus_tag="SGL_RS00835"
     CDS             complement(39500..39682)
                     /locus_tag="SGL_RS00835"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_048908404.1"
                     /db_xref="GI:890839004"
                     /translation="MNAKLKLPWANAGAQGRTNSGLGLLSILLTPLLLAGTLCLVEGS
                     GGLAFLVPFSPALPLR"
     gene            complement(40013..40234)
                     /locus_tag="SGL_RS00840"
                     /old_locus_tag="ssl7045"
     CDS             complement(40013..40234)
                     /locus_tag="SGL_RS00840"
                     /old_locus_tag="ssl7045"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153714.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153714.1"
                     /db_xref="GI:499467074"
                     /translation="MAAKLSCAVEGNFRKEAGLVLRSAGRVKTISADPLPLTKGFPQP
                     GESGVVGSDDVAVQTQGGVDGDYWGLLES"
     gene            complement(40245..40514)
                     /locus_tag="SGL_RS00845"
                     /old_locus_tag="ssl7046"
     CDS             complement(40245..40514)
                     /locus_tag="SGL_RS00845"
                     /old_locus_tag="ssl7046"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153715.1"
                     /note="ssl7046; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153715.1"
                     /db_xref="GI:499467075"
                     /translation="MQVLTYLKFRLNAAEQEELLADYLPFCETVEIPNPPPPTPLCRD
                     PFDVPFLVLALVGQADYLITGDKDLLELEEPFPCPIVALEQFLFK"
     gene            complement(40637..41368)
                     /locus_tag="SGL_RS00850"
                     /old_locus_tag="sll7047"
     CDS             complement(40637..41368)
                     /locus_tag="SGL_RS00850"
                     /old_locus_tag="sll7047"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153716.1"
                     /note="sll7047; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153716.1"
                     /db_xref="GI:499467076"
                     /translation="MTNRMIETSPLVYARAAGLLYLIIIVLGLFAEIFVRSSIITPGD
                     ATATAGSILGAEGLFRAGFLADSIMLLSDVALAVLLFTLLKPVNKTLALVALFFRLTQ
                     TAVIAVNLLNYYAAVLLLKGPGYATIFGVAQLNSLSLLFLDLHSYGYDLGLILFGVHC
                     LILGYLIAKSLYLPKAIGYLVMAAGVTYLIGSYTRFLFPDFVGAVSPIYVVPIVSELS
                     LCLWLLIKGVDLERWREVTGSAGVV"
     gene            complement(41419..41640)
                     /locus_tag="SGL_RS00855"
                     /old_locus_tag="ssl7048"
     CDS             complement(41419..41640)
                     /locus_tag="SGL_RS00855"
                     /old_locus_tag="ssl7048"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153799.1"
                     /note="ssl7048; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AbrB family transcriptional regulator"
                     /protein_id="WP_011153717.1"
                     /db_xref="GI:499467077"
                     /translation="MLAKLTSKNQLTLPKSVTQQIGAAEYFEVTVQSGQIILTPVRIQ
                     RADAVRAKLALLDIIEEDINNAVDWARQS"
     gene            41845..42492
                     /locus_tag="SGL_RS00860"
                     /old_locus_tag="slr7049"
     CDS             41845..42492
                     /locus_tag="SGL_RS00860"
                     /old_locus_tag="slr7049"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153718.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="resolvase"
                     /protein_id="WP_011153718.1"
                     /db_xref="GI:499467078"
                     /translation="MLIGYMRVSKTDGSQHLDLQKDALLAAGVKEDRIYQDCGSGRNS
                     QRPGLEAGLKALQPGNTLVVWKLDRLGRNLKDLVMIVEGLRQREVGFKVLAGAGAEID
                     TSTANGRLFFAVFAALAEYEAELISERTRAGLQAARARGRMGGRPRKMDRVMLQMLME
                     AMKNPEACAKAVAQKLNISTATLYSYVNGDGTPKEAGLRLLRKAHGEQQESEGPR"
     gene            complement(43053..43646)
                     /locus_tag="SGL_RS00865"
                     /old_locus_tag="sll7050"
     CDS             complement(43053..43646)
                     /locus_tag="SGL_RS00865"
                     /old_locus_tag="sll7050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153719.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153719.1"
                     /db_xref="GI:499467079"
                     /translation="MLITLEPTFYLRNHPLYYSPYDTLMITSIESPIKLSIPDEDFTI
                     REVGFLHAYRLNLSFPPDLLLTYADMLSDSVSNVADYFLGEGQSSCFPENVVSSAQQI
                     IYIEDFYVEPQYRGRNIGLKSLALFLQMLGQGAIVAGCPFPAGEEDSPGARRRQRLLI
                     DYWSKLGLLCHCQKRNILWNDNWQLPKWLEECLWHEI"
     gene            complement(43751..44017)
                     /locus_tag="SGL_RS00870"
                     /old_locus_tag="ssl7051"
     CDS             complement(43751..44017)
                     /locus_tag="SGL_RS00870"
                     /old_locus_tag="ssl7051"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153720.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153720.1"
                     /db_xref="GI:499467080"
                     /translation="MFGGGNHLSISTNPPQHFELLQDLESLAAGISTVLRLLVHRVLE
                     PDDGLLVHQPFLYCAGFARDLVTELRGKQKTTPISLGANHGYRH"
     gene            43997..44320
                     /locus_tag="SGL_RS00875"
                     /old_locus_tag="slr7052"
     CDS             43997..44320
                     /locus_tag="SGL_RS00875"
                     /old_locus_tag="slr7052"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153721.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153721.1"
                     /db_xref="GI:499467081"
                     /translation="MVAPSEHQSSLMEKAEDNGVVPGLGNGIVEMPGLRINPAGDGKT
                     KGQAVVSFSLQFLENVRGEDSGGVSADSKSLTELVIASLPLTKEDEVLIHNGELKGGA
                     AQGIQ"
     gene            complement(44777..45019)
                     /locus_tag="SGL_RS00880"
                     /old_locus_tag="ssl7053"
     CDS             complement(44777..45019)
                     /locus_tag="SGL_RS00880"
                     /old_locus_tag="ssl7053"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153722.1"
                     /note="ssl7053; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153722.1"
                     /db_xref="GI:499467082"
                     /translation="MLEETIAVTLAYLAVVILLMAPAQRTHSSKAPQGGRGAQSLCLK
                     QLTIRELKQRARRAKIRGYGSMRKVELLQHLLASPE"
     gene            45058..45630
                     /locus_tag="SGL_RS00885"
                     /old_locus_tag="slr7054"
     CDS             45058..45630
                     /locus_tag="SGL_RS00885"
                     /old_locus_tag="slr7054"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153723.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153723.1"
                     /db_xref="GI:499467083"
                     /translation="MYIHLKRGLTFPCFGHIRGSAPMANSDFTLATFRIQASQWDSFK
                     QWAKDRGNSASGELQHFIARVVQGDYVDPPALPEGLTTRAELDETVAALEERLMAEIK
                     SLQVRLDRHQLPDGAGQSTASPKEEKLTTTELAELLKRAGIWKSKRTLQEYAQENRYP
                     DDLPWRAHKSGGKWYWSELPAKGGAGLLSP"
     gene            complement(45712..46254)
                     /locus_tag="SGL_RS00890"
                     /old_locus_tag="sll7055"
     CDS             complement(45712..46254)
                     /locus_tag="SGL_RS00890"
                     /old_locus_tag="sll7055"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153724.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153724.1"
                     /db_xref="GI:499467084"
                     /translation="MGSSYPFTCHQKHSWRKLAGIFKDPMQWSPFFHRTHRSINPVGG
                     ADSGHGSLSPFPLPHQGKAYHNPLSAVDSKNREERETYINWYNAMPHQNFDYSELSPN
                     VTLKLKVIVVMIKDLDLNEDFQLIGELLAEVFLNYLPAAKQKSWVESELQGLMTFTEA
                     MAYYLTEILGEEELISIERL"
     gene            complement(46666..47043)
                     /locus_tag="SGL_RS00895"
                     /old_locus_tag="sll7056"
     CDS             complement(46666..47043)
                     /locus_tag="SGL_RS00895"
                     /old_locus_tag="sll7056"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153725.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153725.1"
                     /db_xref="GI:499467085"
                     /translation="MMVLILNNSRGIYVQEESFLLTALRLKSGKEINGSTVLLINAWG
                     EFRPPFKLPVCVTPAELVQPLEEELEGALVIRRAASLCPEAPGLEGAVIPRVQQRVPL
                     LYSTVDTVLFPSRTSMASTPHPQ"
     repeat_region   47321..47497
     gene            47529..48242
                     /locus_tag="SGL_RS00900"
                     /old_locus_tag="slr7057"
     CDS             47529..48242
                     /locus_tag="SGL_RS00900"
                     /old_locus_tag="slr7057"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153726.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153726.1"
                     /db_xref="GI:499467086"
                     /translation="MTRTLPPVFKTQATNRRKRTRHGSMQALRESVAKVKSFGYLDFT
                     SWKINKDGYLFLTRGKRSELFKLLENSGFFEFHETNISQDSVYQHQVSKFLATGYELY
                     GRGYYARKGEVEIHHLDGNQQNNDPRNLRYVSPGLNYFIARSLRFPYTGNQSNRITES
                     AEEARNMLRLSLKRTLNVRGKRFSQEQLDFLLSLRLEQARNILDEWYLAGNSYNNLIN
                     KRVEQFSLTMTTEGIVAQL"
     gene            48790..49434
                     /locus_tag="SGL_RS00905"
                     /old_locus_tag="slr7059"
     CDS             48790..49434
                     /locus_tag="SGL_RS00905"
                     /old_locus_tag="slr7059"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153728.1"
                     /note="slr7059; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcriptional regulator"
                     /protein_id="WP_011153728.1"
                     /db_xref="GI:499467088"
                     /translation="MSTLQQFSQAPKPWSLDEFVEIVNGLLPQFLPEEKSHTRVREEM
                     TSRLVRHYTGMGLLDEPLKEGREARYLYRHLLQALLVRRLLVEGYGASAIDNLAKSKT
                     NQELEALLQGGVVLTLTPANPALNFLQEIQQRSAKSAPAPSQSRKVGKADDSNLEKTA
                     LPTPSVWTRLVILPGLEVHVRNDFLLPSTHQEQENLWQRILQSLSSIKKKRFNQ"
     gene            49431..51197
                     /locus_tag="SGL_RS00910"
                     /old_locus_tag="slr7060"
     CDS             49431..51197
                     /locus_tag="SGL_RS00910"
                     /old_locus_tag="slr7060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153729.1"
                     /note="slr7060; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153729.1"
                     /db_xref="GI:499467089"
                     /translation="MNTPQVSFIPLKNAVCSERAVTLDLIIRITPPSPPAMDQPRPSL
                     NLGFVIDRSGSMEGHNKITYARQAVCYAIDQLSPGDHLSVTIFDDQVQTLIPSTLVKD
                     KAQFKRLVQGINPGGCTDLHGGWLQGGIQVSQNLSAELNRIILLSDGLANRGETNPDI
                     IATDVHGLAQRGASTTTLGLGDDYNEDLLEAMARSGDGNYYYVADAEQLPTIFERELQ
                     GLAATYGNGVTLTATSQAGVQVLDLLNDFELDNQGRYQLPNLIYGDSIDVVVRLKVPA
                     IKEEQILGTVTLSWLDGERQKQTLMVNLQLPVLTKVEFEALPSNQEVQQQVALMMSAR
                     AKKEAMERVDRGDYGGAGQVLQEARAEIVGANLPMSAPEAAALEDLEQKLNQREYKSY
                     RKMASAQNYRRNYQRSAGHSDLRYAFQKGPRLGDITKEKAEAIVNSTDRNLSNSGALS
                     RAIHQAAGPELLQACQDLQGCTVGGAKLTPGFNLRANWVIHTVAPKWKGGNQGEEELL
                     VSCYQNCLQLAVSQSIRSLAFPAIACGAMGFPPEIAARIALETVSNFLLSNMAIGSVA
                     FICADKETLQYYQEAFQRVVAW"
     gene            51537..52805
                     /locus_tag="SGL_RS00915"
                     /old_locus_tag="slr7061"
     CDS             51537..52805
                     /locus_tag="SGL_RS00915"
                     /old_locus_tag="slr7061"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153730.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153730.1"
                     /db_xref="GI:499467090"
                     /translation="MKIISFLGFNNYQTTTYVHPTNPEITCKTRFFQEALVDFYRPTE
                     IYVLLTKTVATVAPRGAEVTNWQGLQDCLADKVTIRPIEDIPEGSAPEDLWDIFDCIT
                     DCLDHGDRVIFDFTHGYRFLPVVALLAISYLRTVRQVQVEGVLYGAFDPNSQGESSPT
                     YDLLPMLSLLDWLAATDRFVNLGDGLPLAQLLQTAIPGAERRDNPEVRNPGSRLDQAG
                     KVIAEISQAIALARPMETLELTVQLEEIINRASDSFDQRAKPFNLIKDQLLAEYGQFA
                     LPESWEPENLQRNLWLQFQLINWYLQRGQAVQAMTLASEWLISVVAFRLGAKQILDHR
                     KQINFALNNGGAVQKKREPVGPSSFDEQFQALSQYQFLSQLWNDLTEIRNDLAHCGMR
                     KDPKSAKKLQEKANKIFPQLEEIANSLLKQ"
     gene            complement(52881..53996)
                     /locus_tag="SGL_RS00920"
                     /old_locus_tag="sll7062"
     CDS             complement(52881..53996)
                     /locus_tag="SGL_RS00920"
                     /old_locus_tag="sll7062"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153731.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153731.1"
                     /db_xref="GI:499467091"
                     /translation="MPNVIVSPCGTSLLTNQIDDSLRKLINRNSNLKEAEISSEDKAQ
                     IDRHYQQRSQELNEEDIEGAKKLSAELNGILTYSKGQISTSDHYYLIATDTYVGGLTA
                     TLVTDWIQSHQGNAFLTIIRDLSTKEIETFRLAMSEIVRWCDYELNNQYPQPAWKRIF
                     NLTGGFKSVNGFLQALAMFYADESIYIFESDGQLLTIPKLPIKLSPEDDLANNLDIFR
                     RLAILGHEIPANECQNISGALLEQVDGRASLSEWGQLVWQQFSGGHYQNQLLPPLTSK
                     LKYSEEFVIDIQSLPRDRLAIINARLDDLTRCLESNGEYNPRSLRFHSLEGRLFRGRL
                     SPEPTHECYAWSDKDAKRIYGHFEDNVFIIDKLGLHL"
     gene            complement(54005..56392)
                     /locus_tag="SGL_RS00925"
                     /old_locus_tag="sll7063"
     CDS             complement(54005..56392)
                     /locus_tag="SGL_RS00925"
                     /old_locus_tag="sll7063"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153732.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153732.1"
                     /db_xref="GI:499467092"
                     /translation="MTVGTLGVVGSAKNLKLQLSFINTRQQYVQITLFERNSFKVAEE
                     EFSTELVEIIKTALPTLKNKKVEFEEDGDQIKQIREKGQAWVGAAEQIAPYVLPSGNI
                     TETPRNVNASNFHNPYNFVPALPRDGITGDLGDCAPAGHSYYHGDKYSGRIAVKLTTV
                     TPLLIPDASKEEINNNHKTYPVRIGKDGKPYLPPTSIKGMLRSAYEAVTNSRLAVFED
                     HDSRLAYRMPATMGLQMVPARIEGDNIVLYPGTSRIGNNGRPANNDPMYAAWLPYYQN
                     RIAYDGSRDYQMAEHGDHVRFWAERYTRGNFCYWRVRQIARHNQNLGNRPERGRNYGQ
                     HHSTGVIEQFEGFVYKTNKNIGNKHDERVFIIDRESIEIPLSRDLRRKWRELITSYQE
                     IHKKEVDRGDTGPSAVNGAVWSRQIIADESERNLSDGTLCYAHVKKEDGQYKILNLYP
                     VMITRGLYEIAPVDLLDETLKPATDKKQLSPADRVFGWVNQRGNGCYKGQLRIHSVTC
                     QHDDAIDDFGNQNFSVPLAILGQPKPEQARFYCADDRKGIPLEDGYDRDDGYSDSEQG
                     LRGRKVYPHHKGLPNGYWSNPTEDRSQQAIQGHYQEYRRPKKDGLEQRDDQNRSVKGW
                     VKPLTEFTFEIDVTNLSEVELGALLWLLTLPDLHFHRLGGGKPLGFGSVRLDIDPDKT
                     DLRNGAGWRDYYGSLLETSQPDFTTLISQWINAFQTAVKEEYGSSSFDQVTFIKASGQ
                     SLQGFHDNASIHYPRSTPEPKPDGEAFKWFVANEKGRRLALPALEKSQSFPIKPS"
     gene            complement(56394..56975)
                     /locus_tag="SGL_RS00930"
                     /old_locus_tag="sll7064"
     CDS             complement(56394..56975)
                     /locus_tag="SGL_RS00930"
                     /old_locus_tag="sll7064"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153733.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153733.1"
                     /db_xref="GI:499467093"
                     /translation="MPAGGRLMKNLYHYHQYEITLESAVDSCKNHLQAAIGLLYSPQK
                     CELVKLDNSGKLVDSYNRLKFNNLGVFEARFFNLNCELRWVNESNGNGTAVLLSESDI
                     TLTGFEKGLQEFITAIDQQYLLWGEPAKHPPNADGWQRLAEARIGKLDIPLDNPLKPK
                     DRVFLTSEEYIAEVDDFGNCAVIDERLIKLEVK"
     gene            complement(56954..58522)
                     /locus_tag="SGL_RS00935"
                     /old_locus_tag="sll7065"
     CDS             complement(56954..58522)
                     /locus_tag="SGL_RS00935"
                     /old_locus_tag="sll7065"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153734.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153734.1"
                     /db_xref="GI:499467094"
                     /translation="MARKVTTRWKITGTLIAETPLHIGGVGGDADTDLALAVNGAGEY
                     YVPGTSLAGALRGWMTQLLNNDESQIKDLWGDHLDAKRGASFVIVDDAVIHIPNNADV
                     EIREGVGIDRHFGTAANGFKYSRAVIPKGSKFKLPLTFDSQDDGLPNALIQLLCALEA
                     GDIRLGAAKTRGLGRIKLDDLKLKSFALDKPEGIFSALLDQGKKLDWNQLKANVTYQS
                     PPYLGISITWNPKDPVMVKAEGDGLAIDILPLVSQVGSDVRFVIPGSSIKGILRTQAE
                     RIIRTICQSNGSEKNFLEQLRINLVNELFGSASLSQKQNGKDIDLGKIGALAVNDCFS
                     SLSMTPDQWKAVENATEMTGNLQPALKQATGYPNNISQAYKVLQPAMHVAVDRWTGGA
                     AEGMLYSVLEPIGVTWEPIQVHLDIARLKNYYHGKEEKLKPAIALLLLVLRDLANKKI
                     PVGYGTNRGMGTITVSQITLNGKALPTELEPLNKTMTCPNLTDLDEAFRQDLSTAWKE
                     WIADPIDLCQQEAA"
     gene            complement(58527..60902)
                     /locus_tag="SGL_RS00940"
                     /old_locus_tag="sll7066"
     CDS             complement(58527..60902)
                     /locus_tag="SGL_RS00940"
                     /old_locus_tag="sll7066"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153735.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153735.1"
                     /db_xref="GI:499467095"
                     /translation="MRGIEITITMQSDWHVGTGMGRGELDSVVQRDGDNLPYIPGKTL
                     TGILRDSCEQVALGLDNGQTRGLWHGWINFIFGDQPALAQGAIEPEPRPALIAIGSAH
                     LDPKLKAAFQGKKQLQEAIAFMKPGVAIDAITGTAKKDFLRFEEVVRLGAKLTAEVEL
                     NLPDNLSETNKKVIAGILASGAKLTERLGGKRRRGNGRCELKFSGYSDQQIQWLKDNY
                     QSVDQPPKYQQNKLQSAGDNPEQQPPWHIIPLTIKTLSPVVLPARTVGNVVECLDYIP
                     GRYLLGYIHKTLGEYFDVSQAIAAGDLIITNATIKIDGKAGRATPFCLFGEKLDGGLG
                     KGKGVYNRFQESEPDGIQLKGERGGYVGQFEQEQRNLPNTGKINSELFTHNTIQDDVQ
                     RPTSDVGGVYSYEAIIAGQTFVAELRLPDSLVKQITSKNKNWQAQLKATIRIGQSKKD
                     QYGKIEVTSGNSADLPKPTGNNKTLSIWFLSDILLRGDRLNFNATPDDLKKYLENALD
                     IKLKERSDNDLICIALRSQRTESWQVRWGLPRPSLVGWQAGSCLIYDIESGTVNAEKL
                     QELMITGIGDRCTEGYGQIGFNDPLLSASLGKLTAKPKASNNQSQNSQSNPLPTNHPT
                     QDYARLIEKAAWREAIQNKALALASSRAKREEILGIKIMGKDSQPTMTQLGGFRSVLK
                     RLHSRNNRDIVTGYLTALEQVSNRKEKWSNTSQGLTKIRNLVTQENLIWNHLDIDFSP
                     LTITQNGVNQLKSELWAEAVRTLVDAIIRGHKRDLEKAQENESNQQSQGAA"
     gene            complement(60905..62581)
                     /locus_tag="SGL_RS00945"
                     /old_locus_tag="sll7067"
     CDS             complement(60905..62581)
                     /locus_tag="SGL_RS00945"
                     /old_locus_tag="sll7067"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153736.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153736.1"
                     /db_xref="GI:499467096"
                     /translation="MFLVLIETSGNQHFIFSTNKLRENIGASELTYLATTEILFQGVD
                     RVFQTNYYDQWSDTNSLNFLADSKLNPAIDDPKNNADIEILLATSGKAIALVKEEGKA
                     KQLIKEVTKQALINAPGLEIGGIYVNCNWQDKLGVAKAVKEAHKQFEVNRAKRAGANG
                     RFLRLPIAAGCSVSELPASDFDYNADGDKIPVSTVSKVKRETAKSAKKRLRSVDGRLV
                     NDLAQLEKSFDELDWLAVVHADGNGLGQILLSLEKYIGEQTNRNYIDKYRRLSLALDN
                     CTINAFKMAIAVFKEDSKKIDLPIVPLILGGDDLTVICRGDYALEFTREFLEAFEGQT
                     ETHDDIKVIAQKAFGVDRLSACAGISIIKPHFPFSVAYTLAERLIKSAKEVKQKVTVT
                     NSSPITPFPCSAIDFHILYDSSGIDFDRIREKLRPEDNTELYNRPYVVTAAENLSQAQ
                     GYEWSQAHSLQTLADRVSYLRSEDGEGKSALPSSQSHALRTALYLEKNEADAQYSLIS
                     QRYKILKNFAEDGENKSLFHLENGKYVTRFLDALDAKDFFANANHKNQGE"
     gene            62908..64011
                     /locus_tag="SGL_RS00950"
                     /old_locus_tag="slr7068"
     CDS             62908..64011
                     /locus_tag="SGL_RS00950"
                     /old_locus_tag="slr7068"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153737.1"
                     /note="slr7068; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153737.1"
                     /db_xref="GI:499467097"
                     /translation="MVDLKSLAGAEMVGLRWQLRFDRPCRLESHYVKGLHAWFLHQVQ
                     AIDPDVSAWLHDGQGEKPFTISRLIGPTLWQEGHWHWQINKTYHWQLNLLSGALIEAL
                     QPWLARLPNKIVLARQTLWVEAVDCYLAPHNYQQLWPQGALPRRQEFTFTSPTSFRRQ
                     GNHYPLPEPRNVLQSYLRRWNDFSGLAFEPEPFLDYWVPQNVVIDRHWLESVKTTAGK
                     QGSVVGFVGAVSLVLTPQARNDGDDYGRLFHALCRYGPYCGTGHKTTFGLGQTMAGWA
                     TPDLKTFACLQEDLQTQVLTQRIDQCASLLLAQRQRTGGQRAQEICHTLATIFVRREQ
                     GESLQEIALDLQLPYETARTYSKRAKRALANVQ"
     gene            complement(64005..64319)
                     /locus_tag="SGL_RS00955"
                     /old_locus_tag="sll7069"
     CDS             complement(64005..64319)
                     /locus_tag="SGL_RS00955"
                     /old_locus_tag="sll7069"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153738.1"
                     /note="sll7069; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153738.1"
                     /db_xref="GI:499467098"
                     /translation="MKIIITAKGALLRNLATALVNGAITLTILLIAPLGLLAVITNTV
                     LIMISTFVVNSFGDRVVQWVLKPETMGAQIGYGEQTNVNKENLLPGQGLPQSRDQGPR
                     NY"
     gene            complement(64316..64690)
                     /locus_tag="SGL_RS00960"
                     /old_locus_tag="sll7070"
     CDS             complement(64316..64690)
                     /locus_tag="SGL_RS00960"
                     /old_locus_tag="sll7070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153739.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153739.1"
                     /db_xref="GI:499467099"
                     /translation="MENPNQYQNYAQQMDKEKSERLVRKTLYISRRAIWVNILLSILI
                     SYVAGYIHTRRWKALGIVVVGTFVFGFLTASENESLEEAVERGITLSPLFGLIGTIDN
                     SLAIRRARQTVANGNVDAPGNQ"
     gene            64822..65832
                     /locus_tag="SGL_RS00965"
                     /old_locus_tag="slr7071"
     CDS             64822..65832
                     /locus_tag="SGL_RS00965"
                     /old_locus_tag="slr7071"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153740.1"
                     /note="slr7071; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein Cas1"
                     /protein_id="WP_011153740.1"
                     /db_xref="GI:499467100"
                     /translation="MTSIYLTEPGTKVSYHNQQLQIKQKSRQVITRLAEIDLLVLFPG
                     VQLTDVAIAVLMDQGIETIFLRRDGQFRGRLQGQFATNPLTRIAQYRVLDSTFGTALA
                     QRLILGKVTNQRAILQRRHRDTGKKNNALAEAIDLIGAYRLSLRSGLGNSSRDQLMGI
                     EGICAKHYYQVFQFCLPEGWSFTGRNRRPPKDPVNALLSWGYGVLLARVFSAIVQAGL
                     DPYLGFFHATQPYRPNLALDLMEEFRPVVVDQAIVRLLRSGILDPLDFEPSYDGLGIW
                     LGITAKKLFLTELESILQTSFLYSPQSRRLKLQQIILEQARCLGRCCLESSLDYEPFT
                     LS"
     gene            65842..66123
                     /locus_tag="SGL_RS00970"
                     /old_locus_tag="ssr7072"
     CDS             65842..66123
                     /locus_tag="SGL_RS00970"
                     /old_locus_tag="ssr7072"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q6ZEC6.1"
                     /note="ssr7072; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated endonuclease Cas2"
                     /protein_id="WP_011153741.1"
                     /db_xref="GI:499467101"
                     /translation="MDFWLVCYDVRDDKRRRKLAKLLEQRCQRVQYSVFECPLPEKVL
                     TDLLHRRWLKELNLKEDSLRAYPLQRQSRSQAKIFGSPDLYEPPDFLIL"
     gene            66223..66567
                     /locus_tag="SGL_RS00975"
                     /old_locus_tag="slr7073"
     CDS             66223..66567
                     /locus_tag="SGL_RS00975"
                     /old_locus_tag="slr7073"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153742.1"
                     /note="slr7073; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153742.1"
                     /db_xref="GI:499467102"
                     /translation="MPNPTVEIKLEDILVSIQKDLNELKVSQAEIKGQISALDEKLTG
                     QINALDERLTGQIKAVDEKLTGQIKTLDEKVSGIGKRLENQEFLNRGILTALIVALIA
                     GAAKLFGWLPTS"
     gene            complement(66610..66906)
                     /locus_tag="SGL_RS00980"
                     /old_locus_tag="ssl7074"
     CDS             complement(66610..66906)
                     /locus_tag="SGL_RS00980"
                     /old_locus_tag="ssl7074"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153743.1"
                     /note="ssl7074; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153743.1"
                     /db_xref="GI:499467103"
                     /translation="MCQENPGHFGTSTTMPTIETDLKEILTKIDDHLGKIDDRLGRLE
                     TGQARMEEKLGNLDSRVEKLEDSQSKQIWTLIGIIGTTVIGVMIRYVLTALPNP"
     gene            complement(66936..67976)
                     /locus_tag="SGL_RS00985"
                     /old_locus_tag="sll7075"
     CDS             complement(66936..67976)
                     /locus_tag="SGL_RS00985"
                     /old_locus_tag="sll7075"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153744.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153744.1"
                     /db_xref="GI:499467104"
                     /translation="MSILRYEENGIEFFTVQATGESGMSQSGLARLCGVDEKSIRVVL
                     KSVRSSSCSNFLKPLQNIELTVRNSYHEFKNVTILRDTVCAHILEWYAFESQRPNETA
                     RQAFRKFASMGIRTWIQGITGWEQGTEALTLEPEAKKTTADLGKIKTELEQLEHSLLV
                     ALKHRHAIHNIVEQPTVVDLTLQQIIHTAVHVQAKTLNEALKQLALLRHWFTEWDFSA
                     LMDANQISQHNQFWEEVGTLRAENEALTRRLAILQAQRSNLPYTSPEQAKMNLEERIE
                     WLTQALLTHQKRPDGDRAKKICRLQATILARYEAGESLKAIAQELELDYETARTYVKR
                     TRANLRLQVVMS"
     repeat_region   68499..72780
                     /inference="COORDINATES: alignment:crt:1.2"
                     /inference="COORDINATES: alignment:pilercr:v1.02"
                     /rpt_family="CRISPR"
                     /rpt_type=direct
                     /rpt_unit_range=68499..68535
                     /rpt_unit_seq="gttcaacaccctcttttccccgtcaggggactgaaac"
     repeat_region   68874..69215
     repeat_region   71221..71557
     gene            complement(72878..73459)
                     /locus_tag="SGL_RS00990"
                     /old_locus_tag="sll7077"
     CDS             complement(72878..73459)
                     /locus_tag="SGL_RS00990"
                     /old_locus_tag="sll7077"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153746.1"
                     /note="sll7077; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphohydrolase"
                     /protein_id="WP_011153746.1"
                     /db_xref="GI:499467106"
                     /translation="MNLSHPTPLTPRFGDALVLANQLHAQQFRKGSPVPYISHLLGVT
                     ALVLEMGGNEDEAIAALLHDAVEDQGGEATLNVIREKFGETVAQLVLGCSDSSTVPKP
                     PWEERKQQHLQKMSRISLAVLKISLADTLHNARTIEIDLHRYGNDIWQKFSRSKSGII
                     WYYQSLWQIYQDRNPNPWSNELIDIINGWAYGK"
     gene            complement(73483..74928)
                     /locus_tag="SGL_RS00995"
                     /old_locus_tag="sll7078"
     CDS             complement(73483..74928)
                     /locus_tag="SGL_RS00995"
                     /old_locus_tag="sll7078"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015216194.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153747.1"
                     /db_xref="GI:499467107"
                     /translation="MESTFEYSPTVPLLSHLLQGKSLKNPINLGKAIRLWVLLRCIYG
                     HESDPIYCHLNESFTYPEWRDAFFLEQKLFHQNFNRDSLEHSNNQCPCHKSIHQWLFA
                     DYLATDQQQWYEDFRGTCYLAEDADIQGFLDTLSWERSKSNDGKNRLFACVPRTINNN
                     LKELVKLGYLEKIGDKFHKLEEIDFSSLAQSKPVDANFNFPNLSYIRHEDLSEIPDLF
                     RATMGQKQRFFMHVDYVVAKRDLDNDWPYRFQQLWQENEFPILRLEYDSVSLHRLVKR
                     ITYPVCIYYYQRALYLCAYGQDPKDRNKLDWYNYRLDRIKAMANLDWSDPEIPLPLQE
                     QYQQQNLFTADYIDTQLSRGFGFDFYKPLKTMVLRFNQDFSERYIDESFRHETFKKFD
                     TVQQLSTWLGQQQLQPTEKEQLQRAIKQWQAQGKQEPTHSYFRMDYRDQDNNVIMRLR
                     AWGPNVEVLFPLDLRQRMASDVQAMAALYSH"
     gene            75157..76089
                     /locus_tag="SGL_RS01000"
                     /old_locus_tag="slr7080"
     CDS             75157..76089
                     /locus_tag="SGL_RS01000"
                     /old_locus_tag="slr7080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153748.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153748.1"
                     /db_xref="GI:499467108"
                     /translation="MVSYHLHLRENTLYVGFNREQSASGDRLVRDAASQIDQLIRQGQ
                     LTGGELLKVDGPQSVAIAYVLAQRLTPLYGAIAILDPKVCRPGHRVYIVAISRNADYP
                     LGSLIEVPIGGSALLKVAVCGFPQTGKSCLIEGIRQAICSQIGAPYPYVIRACPDGEG
                     AWLHQTQVNNPALAENLRAQNKRDWNATFAETAADWVRSANEAINLIDTGGLPSPENR
                     LIMAEASHAIILYKTVAEREQWLNFCQDLGLPPLAIVESRLGNASDEVNLSTKDQPIT
                     GVVYGLSRGKANLRDKLMIQAIAHRLIDLTSSEK"
     gene            76204..77592
                     /locus_tag="SGL_RS01005"
                     /old_locus_tag="slr7081"
     CDS             76204..77592
                     /locus_tag="SGL_RS01005"
                     /old_locus_tag="slr7081"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153749.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153749.1"
                     /db_xref="GI:499467109"
                     /translation="MVSIHITRHAIQQLRKLRSAMNNRVIPDIFEQLSLGMNAGNHIL
                     RHSQCTEYRKRRLEGGGYLRLFFDDHSPSHYKVIAAVLRDDDTYKREFDDLPRDPCYG
                     WNGETGWEWDWYINEGYLYSAQPSDQQIRDTNEAVKTDNYHRNDGNNHPDYHRVPYHS
                     TIDQSAPGTGKTLNAAEKACELAYVGQNVVFLLPEALIDQQVTKYRCIRQSLQEPAGE
                     NLFIGTFHQWLAKAFPQLPFQVASPAKELQVLQEIAQQHRHWQTSGRDPITYRDVLLY
                     QLYVINKNCREDDVFWDNKPRIEELRDIRPQWWQGAWTQEELCRRDYTLQVLQYFQQN
                     PPAPPTPSWGTSIIIDEAQDYLVEEIEIIKHLCHHWQTEAKHPVNLWLLGDINQRIAP
                     VDFTWGGLQLNKTRELQWDNYRTTESILTLANRFQARADASKPADAKWLPKPTDPKFC
                     FEKPGDAVKLLV"
     gene            77632..78591
                     /locus_tag="SGL_RS01010"
                     /old_locus_tag="slr7082"
     CDS             77632..78591
                     /locus_tag="SGL_RS01010"
                     /old_locus_tag="slr7082"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153750.1"
                     /db_xref="GI:499467110"
                     /translation="MATISQQISEWQEKHSLQWRLAARARLFCSDHYHVSPDRVKFLE
                     FMPVSQAKGREFDSCIAFCLFDLPQNGGRMEAYTKWYTQLTRARSRLLIVTTEAQLAQ
                     MGEEIFENLTITKGEKTVNAVERLNYQNPKEVTDALGWITELTSSLDTSATGRQGLRE
                     IILEGALQSDPILYYDLYYVLKSYDISSQETMAIEADIVNLLFNNAELQAPLKAYFEQ
                     PEVEEVPRLQTLIYRCLGQSWQAAEIAQSRKQSDPGTYQEVMAGIQQDLQHRHLPLEA
                     DRLARFYGLETSTNKFDNASWFKTSDKLIPLLKNWTEEQLKVG"
     gene            78642..79775
                     /locus_tag="SGL_RS01015"
                     /old_locus_tag="slr7083"
     CDS             78642..79775
                     /locus_tag="SGL_RS01015"
                     /old_locus_tag="slr7083"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153751.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153751.1"
                     /db_xref="GI:499467111"
                     /translation="MTSQNFVSDQDTITALQQLTDLIHQGLQQAWDPNIITQAKAEIN
                     QTAEQCKEQFHTIHQDVEDLQGSLLEIDQRSGQLTDSIVTAEKVTEVITKMGGPDQLR
                     QDFDRLEQLRSITGQIGEAQAMAQQLQQQTEQLRTDGDRLGQTLTQLGGADALLAQLA
                     QLEEIASQLAGLDSHIDQVTTAIIDRYLPSFEAGKEQIAQWRSEVKDQLNLTLASLEQ
                     QKQEINGLIADLTTQSGQVSSQLTDLEQQQLKLEPLLTAIAKLADQLGGQDLLQKVAT
                     DLGLLDETIAQQQRELVSLKTDLRAEFQRMFNQELEQFKNEQLQVNQRLLVENRQLKE
                     EITKISQELNYNADQLRRLQAIKCDRPVWTLSNLRRPTPPYLP"
     gene            79821..80048
                     /locus_tag="SGL_RS01020"
                     /old_locus_tag="ssr7084"
     CDS             79821..80048
                     /locus_tag="SGL_RS01020"
                     /old_locus_tag="ssr7084"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153752.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153752.1"
                     /db_xref="GI:499467112"
                     /translation="MASLVEIKEDLYVQLQGINVADKHGRDMEIQHYQQLHKCIELIE
                     ELETELVKCELMKGQTFEGVYKETLERPGEV"
     gene            complement(80203..81933)
                     /locus_tag="SGL_RS01025"
                     /old_locus_tag="sll7085"
     CDS             complement(80203..81933)
                     /locus_tag="SGL_RS01025"
                     /old_locus_tag="sll7085"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153753.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153753.1"
                     /db_xref="GI:499467113"
                     /translation="MEYLRWMRPADHQYKDATKVQILQKAMENAKNYDARLSVCNQRT
                     KAIAKETFEVTCPWRIRVGGHRGPESILLPAFDALGMPYIPSATLRGVARTQAIREVM
                     QNTGKNWKDAEKDSLIVKHFGALDADKADQAGKVVFLDAYPTSGKCLAVDMANNIWSW
                     EGNHLDYSPNPNPFLSLKEPTFLIGLRLISNCSDQQVLTQVKKWLINGLANGAGSQIN
                     TGYGQLLENPKKLLSKPFLEVEFALEGQLIHGYQKPGEWSWNNNKNEWQMRGSNQAEV
                     RPTAFKSMLRYWFRVFALGVMPPKNTKVLEAKIFGSLDPQSMGIIKVTVLEKEPENEN
                     EQSGTLRLFFTSEVDENQKDNLQNLFSNLIWLMFYLGGIGQGARRPCYYRKGNPKIRG
                     SSFFVQNPSEFSSIPGNIDEFRLRILGKITQLIDLLSLLKTTFNFTERSNNFNHSSHQ
                     WTECADLNMRIFVVPNANQDNAKSYALSKLNQKFHQLDDQIKSLKKEKNFPELKRVYS
                     ELKSLCGGVQKDKILVNGQQKERKVLPSPIWVRSLGPFDVVTIFGATASPRSDYLRSL
                     QGAIQIFPLS"
     gene            complement(82196..82591)
                     /locus_tag="SGL_RS01030"
                     /old_locus_tag="sll7086"
     CDS             complement(82196..82591)
                     /locus_tag="SGL_RS01030"
                     /old_locus_tag="sll7086"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153754.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153754.1"
                     /db_xref="GI:499467114"
                     /translation="MPNFDPRTINKQAFQSLQALRHQAGQDNALLKEQKNQAMELYTY
                     LSTWGLMRLKAEEVALSQTGKKQVVQRFFNDLGTLSGRNNLADSQGLNTLVALSANEY
                     LGLTGLGIELANEFGFWANAVYHDITGAQ"
     gene            complement(82630..83409)
                     /locus_tag="SGL_RS01035"
                     /old_locus_tag="sll7087"
     CDS             complement(82630..83409)
                     /locus_tag="SGL_RS01035"
                     /old_locus_tag="sll7087"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153755.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein Cmr4"
                     /protein_id="WP_041428283.1"
                     /db_xref="GI:752788427"
                     /translation="MNIQHLYLLSPLHTGGTTQEGNLLGIARESHTNFPYIPSSTIRG
                     RLRAAVDDNKRDALFGNDLNSDNGNLTQGSVWVGDGSLLWLPVPSLSHGVIWISCPLL
                     LNRYARVANVAAQPAIVPYLCNFYQANEKVYLKDAIFDHSELNQWSQAEVKKFIPNQS
                     NMTIERALVLPDQHCATVIQMGLWRQVKIKLDQHKTVDGGFRYEEAIPPDTLMYFPWG
                     ITAQAKGNQEAGEQFQDLLTVNEIMQIGGQESLGRGFVECF"
     gene            83501..83881
                     /locus_tag="SGL_RS01040"
                     /old_locus_tag="slr7088"
     CDS             83501..83881
                     /locus_tag="SGL_RS01040"
                     /old_locus_tag="slr7088"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153756.1"
                     /note="slr7088; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="WP_011153756.1"
                     /db_xref="GI:499467116"
                     /translation="MDLAVSKIQLSNPSQNHLQALTVEALADSETVHLCIPDHIQIQL
                     QLEIVDQKEVTLADGSRRLIPYVGPIKIKFENRIGFAGALVMGDQVLLGAIPMEDMDL
                     IIIPSERRLAVNPHSPNIATSIAK"
     gene            complement(83905..85017)
                     /locus_tag="SGL_RS01045"
                     /old_locus_tag="sll7089"
     CDS             complement(83905..85017)
                     /locus_tag="SGL_RS01045"
                     /old_locus_tag="sll7089"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153757.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153757.1"
                     /db_xref="GI:499467117"
                     /translation="MYWYSLTPLDILLLRDAKPFTPGDRAWAGSIFPPNGHTLAGAVR
                     SLLPQNQTISLIGPLLYHKETLYFPRPLGFVGKTPLLPLPWHDATSPLRSQMLWDKTQ
                     PAPLAPLETVSQTDIKRDEKQARTWLPLDVMMGYLQTGAIKPEDWARPEDEDSQPWTM
                     ESRPHNSIEAGTRQVKESDGYFVENGIRLKENWSLAIAVDPTTHQQLQSLPQPLSMRL
                     GGEGHRVTLVHRPALDQQWQRLQTLSDQNYQQRQKAIAYLMTPGIFERGRDGVSTCRP
                     YPWEWKLTHNQGSFISMATDRAVAISPRIRDRQRNPGHSIPAPQVFAAPPGTVYYLNQ
                     PQGLFADQDNAPKHLQQTRKLGYSHLLWVNLQEVNR"
     gene            complement(85199..88138)
                     /locus_tag="SGL_RS01050"
                     /old_locus_tag="sll7090"
     CDS             complement(85199..88138)
                     /locus_tag="SGL_RS01050"
                     /old_locus_tag="sll7090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153758.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein Crm2"
                     /protein_id="WP_011153758.1"
                     /db_xref="GI:499467118"
                     /translation="MSEVYWQAKIWGLLHDPALKALHNNSGRGGEGAWQSLGCMQNWV
                     SPKSSTEKKDGELSNSWLDHIGLSDLIASASDRGAIHYIGTPIDYDGKGLELSHLLSG
                     AKLPLKLANHSEIIGQGNRRTYLEQKELELIQQMPAEFLHGTDKAQECFWWLWRCLPE
                     AVAEQFGPESLLMPAETRLPDASIWSHGSMTAALAGALAGYDTNIEDIAKGARNTPKS
                     QAYLAVFTFSPIQELIKASRKIKDFWAGSWILHYLSAKVCWELAQQYGPDCFLYPSLY
                     GQPLIDHWLLEKYGEQGFSQWVPQPGDRQLLTAGFPNVIMLVLPKEKVSAAMQSAKNH
                     LLNAWRNIAHLVFAELQQRHWQKQLNPTDPTWKHWLDAQWQTYWSAMAIGAEGKTLKS
                     VGIPTQTPESKAQRDQWVREQNEAFSASLFAQEELDFIEKSTDLFIQQRNRNYAGSLN
                     VGSWWADIFGQTRFTLSAVKNARNWKIPTAFGPRSTISGLGPVVHPQAPSHQRDWVTE
                     GDTQKYWQRQAGLFDGSEQLNATETVKRGLEKVLPALLGRGAKELKTYYPDLTVGIAG
                     YLKTQPDGLPIFEQACSAISQKILGDRHKVADSVTQDWGIPWVEENMEKKYHPRLLNS
                     GWLVEELEDLDQTELPSYRQALQTEIEKFYPQNNPTSWYVLAAGDGDGMSEWLKGTKM
                     RTYGDYFPQVLTVPEDLQPTFQPFSEQPKRMGPATHNALSRALLDFSNQLVPYLTEQR
                     YAGRLIYSGGDDVLAYTNLWEWDQWLWDIRQAFRGDRDEHREFDSTGHYWHSKTAHKN
                     LPQRPLFTMGDGATISFGITIAHHSVPLAIALEHLWEAEEEAKEHEYGEGEDKKSKDA
                     VQVRVIYGNGNVLTATSKFEVFKTWKDLLDIETIDASTYETAATVLEQHPIPVREAIM
                     PWVNVLVERRDALDKDQQSTLRSRLACFLIQLWQTTSQKNWEKEAKNWLKVAAFMKRN
                     RYIKFPN"
     gene            88262..88630
                     /locus_tag="SGL_RS01055"
                     /old_locus_tag="slr7091"
     CDS             88262..88630
                     /locus_tag="SGL_RS01055"
                     /old_locus_tag="slr7091"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153759.1"
                     /note="slr7091; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153759.1"
                     /db_xref="GI:499467119"
                     /translation="MFKKLHTIFVVGGVKISATFLTVARSMYSPSRLLFARNLVLAIA
                     NGLITLVILLIAPLGLAAVIINTLLVACSTFMLSVFGDVVVRWLLQGTNPHGLPTNAN
                     PNVGITPQTSHQPTQRPDRW"
     gene            88627..89616
                     /locus_tag="SGL_RS01060"
                     /old_locus_tag="slr7092"
     CDS             88627..89616
                     /locus_tag="SGL_RS01060"
                     /old_locus_tag="slr7092"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153760.1"
                     /note="slr7092; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein Cas1"
                     /protein_id="WP_011153760.1"
                     /db_xref="GI:499467120"
                     /translation="MKTLYVSQSDCYVSLRKEFLLVKRQDRILAEVQLPFLEQVLIFG
                     KAQVTTQAIHACLSRNIPILYLSRMGFCYGRIIAIERGYRHLSRYQQELGWQQRLITA
                     RTIVAAKIKNARVFLQRQHRKHPTPSLQLAIDGLKHFVELTVKADKLEQLLGYEGTAA
                     NLYFQAWADCIENSNFIFFGRSRRPPGNPVNAMLSFGYQVLWNHLLTLIELQGLDPYQ
                     ACLHQGSERHAALASDLIEEFRVPIVDSLVLYMINRRLIDVGEDFVFQNGGCFLNSSG
                     RRKWLGAFVGRMEEFLSFDQGDFPRWHCLIDQVKKYKAFIYSPSNSYSPFLIR"
     gene            89620..89898
                     /locus_tag="SGL_RS01065"
                     /old_locus_tag="ssr7093"
     CDS             89620..89898
                     /locus_tag="SGL_RS01065"
                     /old_locus_tag="ssr7093"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q6ZEA5.1"
                     /note="ssr7093; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated endonuclease Cas2"
                     /protein_id="WP_011153761.1"
                     /db_xref="GI:499467121"
                     /translation="MFLYVIAYDIPDDRRRKKMADLLEGYGQRVQYSVFECTLSKSKF
                     NELQKRLRKIYQSEEDSLRFYPLSGHTLTQVDIWGEPPLTKPPGSVIV"
     repeat_region   90105..92958
                     /inference="COORDINATES: alignment:crt:1.2"
                     /inference="COORDINATES: alignment:pilercr:v1.02"
                     /rpt_family="CRISPR"
                     /rpt_type=direct
                     /rpt_unit_range=90105..90140
                     /rpt_unit_seq="gtctccactcgtaggagaaattaattgattggaaac"
     gene            93265..93654
                     /locus_tag="SGL_RS01070"
                     /old_locus_tag="slr7094"
     CDS             93265..93654
                     /locus_tag="SGL_RS01070"
                     /old_locus_tag="slr7094"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153762.1"
                     /note="slr7094; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153762.1"
                     /db_xref="GI:499467122"
                     /translation="MNSIFTINPYWTGSTWAFDAAEVGLLGEPFVSGADAILSAIVKR
                     ELALETEQGSQFELIFSAEGFPSYHACFERQEPEYGGYWYKVVDAGNDYQDLDFGDRG
                     WLCPATLHFFPGGHPEKLYIQVRAINK"
     gene            93673..94188
                     /locus_tag="SGL_RS01075"
                     /old_locus_tag="slr7095"
     CDS             93673..94188
                     /locus_tag="SGL_RS01075"
                     /old_locus_tag="slr7095"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153763.1"
                     /note="slr7095; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153763.1"
                     /db_xref="GI:499467123"
                     /translation="MTSVFHVLIGCPASGKSTLAAHLHQAIPQSQIISTDQIREDLFG
                     DAATQGVWALINNEISTQITQAIAAGKQIIYDATNAEKAWRSELLGSLKKLDDLKIIG
                     WYLQTPLEVCYQRNKNRLRQVPEDVIETYAIALEQSPPSKDEGFTELHRIPYNQLENI
                     DFSQLRSQWKN"
     gene            94198..94611
                     /locus_tag="SGL_RS01080"
                     /old_locus_tag="slr7096"
     CDS             94198..94611
                     /locus_tag="SGL_RS01080"
                     /old_locus_tag="slr7096"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153764.1"
                     /note="slr7096; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153764.1"
                     /db_xref="GI:499467124"
                     /translation="MRYKNNCRINRIGKDKMTTCINNSLFTIEPYWVGRTWAFDAPNL
                     GVMAEPFVAGTNIVLTQLAKTRLGIEPSDGAKFQLIFSAQKFPGLHLSFRRQEPEFDG
                     YWYISESQDWAWFSSAMTSFFSNGHPEELHLQVLR"
     gene            94718..95344
                     /locus_tag="SGL_RS01085"
                     /old_locus_tag="slr7097"
     CDS             94718..95344
                     /locus_tag="SGL_RS01085"
                     /old_locus_tag="slr7097"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153765.1"
                     /note="slr7097; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkylated DNA repair protein"
                     /protein_id="WP_011153765.1"
                     /db_xref="GI:499467125"
                     /translation="MIKQLSLFDIYPNGSPEEIIISDGHLQLYHSIFSDVEASRYYDR
                     LEKEICWQQDSIILFGKSQPLPRLTAWYGDPERSYTYSGIAMEPTPWIPLLQTIKTKA
                     ETLAKATFNSVLLNFYRTGTDGVSWHADDEPELKKNYPIASVSFGGTRRFLLKHKTDP
                     TIEKVELILTSGSILLMLGTTQEYWLHQVPKTKKFVEPRINLTFRFIQ"
     gene            95369..96241
                     /locus_tag="SGL_RS01090"
                     /old_locus_tag="slr7098"
     CDS             95369..96241
                     /locus_tag="SGL_RS01090"
                     /old_locus_tag="slr7098"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153766.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153766.1"
                     /db_xref="GI:499467126"
                     /translation="MYDALLPIVMDSYGQNSRCMPSFLSGLQPAVKELRQRYRTNNVQ
                     VDYGQPQIQAAYLLTYYPYYVQQTHHNLSLASQHHHVAHLLRQRNLQVTLLGSGPMPE
                     AAALATYRQKLQFASSLKAISYDLNVHQWRSACQITARLMADLAPNITYKYEGHPLNL
                     AQHHALFPAQWNIQNSQLIIIQNCLNEIYRANLGAFKQNMQFLMNNMAPGSALLLSDL
                     DYHQTSRCLQLLKQLADATPGITTVFDHGDRLLKYENSFSLPFSIRRHLLTGQNGLIP
                     KKWIRQFSLCLLKQ"
     gene            96348..96938
                     /locus_tag="SGL_RS01095"
                     /old_locus_tag="slr7099"
     CDS             96348..96938
                     /locus_tag="SGL_RS01095"
                     /old_locus_tag="slr7099"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153767.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153767.1"
                     /db_xref="GI:499467127"
                     /translation="MTDFKALIESKLSSLLGKEIKVTDKAKECLQRLAESEQNFYSWH
                     LKLLSIIFDVSPEIWDILKEVDEGFNNFNYAVLDAQVRDYFVKNESTPTVICDQISDF
                     DDFLATLFFKAANTGGLGVVYTSPPPSKAEIIQDTITIDHLVGMLFYVLYAGYYESDL
                     AVALLIMNNFDIAFGRNNRRYLDELENIMTKTELRS"
     gene            97173..98522
                     /locus_tag="SGL_RS01100"
                     /old_locus_tag="slr7100"
     CDS             97173..98522
                     /locus_tag="SGL_RS01100"
                     /old_locus_tag="slr7100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153768.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153768.1"
                     /db_xref="GI:499467128"
                     /translation="MTINTDAILITDGDRQQVRDLIQWLKTNRPDLVEKARNPDILQQ
                     EQDHAQTFRGKIEQLQKLVPGFTYVHPDSLHGHYHVTPDLKKSAKATAVVMTTSNWID
                     TVGNLPVFFFAFKSLTFLPALGMAVLLSIPVLAASNALSTAVAHGHKGRWKLAIAALV
                     FGLIPLNILQTVTTGIGMEVINNQSALAQVAAGDALDNIVEAKQQNLQFAETNLHPDI
                     AKCEEGRQELEAMPRRNAMEEKAFQSRYVRLYGTFSSQSQPMTVPIEQLPLCVRANRI
                     QAEQQDQLQQLGQQLQDFKLERQTLGNDLMFLKQMAPQQYGKTFVEVRPFWGLGGGEP
                     TVEVRNGLELVSLGVNSFQTKFATGQWDQLGISLFFVGISAITSAASVAMGISFPLGK
                     DTQRSYDESHKEKVNRFFQRARMTLTQMHDEQQQELLEPGADDDNLLEDDYEFGRYN"
     gene            98473..99015
                     /locus_tag="SGL_RS01105"
                     /old_locus_tag="slr7101"
     CDS             98473..99015
                     /locus_tag="SGL_RS01105"
                     /old_locus_tag="slr7101"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153769.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153769.1"
                     /db_xref="GI:499467129"
                     /translation="MMIICWRMTMSLADITDFSEALALLGLYEREVMTTGVMEYVVPP
                     KVPAKPAPVPDSVASPSPPNEQASSHPPANIPQDTPALPEATPTSSPVNNTTINEGII
                     IVNGVHDSEDGNEPPSQIQKVDASQETLPLPTPGPSELELLLEQQQVEKRLFYLFVEE
                     IEKTGDLGKLPVALQPTGKS"
     gene            99125..100141
                     /locus_tag="SGL_RS01110"
                     /old_locus_tag="slr7102"
     CDS             99125..100141
                     /locus_tag="SGL_RS01110"
                     /old_locus_tag="slr7102"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153770.1"
                     /note="slr7102; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153770.1"
                     /db_xref="GI:499467130"
                     /translation="MKKLLKSLKWPALFVGIILLLAACHRAPTRTAKETDKMKGVWLT
                     DVGTMGLTYSTLLDETLHHISKSDYDRVYFSVYGLRGQLYPTRQRGDLIPKLPFPNAV
                     GSMARESRRQGLKPYAWFEYGLMLPQFDPVAKNNPDWLLTMANGEQVIENHGVPMVWL
                     DPSNPEVEAYILAHIDDILKEKSLAGIQLDDHWAVPRQFGDYRRSLTALTTKVHEHIK
                     TKNPEFELSLSPNPYQFSLNEYNQDWLRWVKQGIVDEVVVQIYRSSPAEVQQAVNNSG
                     IYTASRYVPVGVGLYTGRKIKPFNLQSIKDQINAVEKQNLGHSLFVWEFMVLRVINIH
                     LNIL"
     gene            complement(100246..100632)
                     /locus_tag="SGL_RS01115"
                     /old_locus_tag="sll7103"
     CDS             complement(100246..100632)
                     /locus_tag="SGL_RS01115"
                     /old_locus_tag="sll7103"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153771.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease V alpha chain"
                     /protein_id="WP_011153771.1"
                     /db_xref="GI:499467131"
                     /translation="MQLKNDYHREVFNGDQGTITAIEREEQILTITYDDRPVDYDFAD
                     LNEIDLAWAISIHKSQGSEYPVVILPLYMQHFLLLSRNLFYTGLTRAKRLALVIGSQK
                     AIGYAVRQQKERYRYTRLADRLVISP"
     gene            100781..101628
                     /locus_tag="SGL_RS01120"
                     /pseudo
     CDS             100781..101628
                     /locus_tag="SGL_RS01120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010873460.1"
                     /exception="annotated by transcript or proteomic data"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
CONTIG      join(AP004311.1:1..103307)
//
DBGET integrated database retrieval system