GenomeNet

Database: RefSeq
Entry: NC_005230
LinkDB: NC_005230
Original site: NC_005230 
LOCUS       NC_005230             103307 bp    DNA     circular CON 19-MAR-2014
DEFINITION  Synechocystis sp. PCC 6803 plasmid pSYSA, complete sequence.
ACCESSION   NC_005230
VERSION     NC_005230.1  GI:38505668
DBLINK      Project: 57659
            BioProject: PRJNA57659
KEYWORDS    RefSeq.
SOURCE      Synechocystis sp. PCC 6803 (Synechocystis PCC6803)
  ORGANISM  Synechocystis sp. PCC 6803
            Bacteria; Cyanobacteria; Oscillatoriophycideae; Chroococcales;
            Synechocystis.
REFERENCE   1
  AUTHORS   Kaneko,T., Nakamura,Y., Sasamoto,S., Watanabe,A., Kohara,M.,
            Matsumoto,M., Shimpo,S., Yamada,M. and Tabata,S.
  TITLE     Structural analysis of four large plasmids harboring in a
            unicellular cyanobacterium, Synechocystis sp. PCC 6803
  JOURNAL   DNA Res. 10 (5), 221-228 (2003)
   PUBMED   14686584
REFERENCE   2  (bases 1 to 103307)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (25-NOV-2003) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 103307)
  AUTHORS   Kaneko,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-NOV-2001) Kazusa DNA Research Institute, The First
            Laboratory for Plant Gene Research; 2-6-7 Kazusa-kamatari,
            Kisarazu, Chiba 292-0818, Japan
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AP004311.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..103307
                     /organism="Synechocystis sp. PCC 6803"
                     /mol_type="genomic DNA"
                     /strain="PCC 6803"
                     /db_xref="taxon:1148"
                     /plasmid="pSYSA"
                     /synonym="Synechocystis PCC6803"
     gene            complement(join(101524..103307,1..85))
                     /locus_tag="sll7106"
                     /db_xref="GeneID:2655999"
     CDS             complement(join(101524..103307,1..85))
                     /locus_tag="sll7106"
                     /note="ORF_ID:sll7106"
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease V alpha chain"
                     /protein_id="NP_942288.1"
                     /db_xref="GI:38505774"
                     /db_xref="GeneID:2655999"
                     /translation="MEKSTDYLTGVIERITFHSEETGYTVARLQMSRAKELTTVVGNF
                     ANIQAGQTLKLAGIWKEHPKYGSQFQVNNYHETKPATLTGIEKYLGSGLIKGVGPVTA
                     KRIVAHFGLETLEIIEGESDRLMEVTGIGKKRVRMIQRAWAEQKAIKEVMLFLQGHGV
                     STTYAVKIYKEYGDDAIRVVTHNPYQLADDIFGIGFLTADKIAQQVGIDPTSKFRYRA
                     GILHTLGEAAEQGHCYLPQPELIKAAIAKLSTEEYEAMAEALLAVIEEMVAVQDLIRE
                     ILSEEEILLFKPTFYHTECKLAGYVKQKLVNSQIIDIDRVKTWINRYTDKNELELSKQ
                     QYTAVLLAATTGVMILTGGPGTGKTFTTRTIVALWRAMGKKIGLAAPTGRAAQRLGEM
                     TGLEAKTLHRLLEFDPNSMGFKRNEDNPLPFDAVIVDESSMLDLFLAHSLLKAISPNT
                     QLLLVGDIDQLPSVGPGSVLGDLIASEQITMVRLNQVFRQAAASAIIRHAHQINRGQY
                     PPMEAISDQPLSDCLWHNGGTEPDHGVQLIGELLTDFIPKQGFNLLQDVQVLCPMQRG
                     IIGARNLNAVVQSIVVSNKAETLNATVRTDNFIKRRVNRSVHSSSFQGTKVMLNII"
     misc_feature    complement(102961..103113)
                     /locus_tag="sll7106"
                     /note="Helix-hairpin-helix domain; Region: HHH_5;
                     pfam14520"
                     /db_xref="CDD:258660"
     misc_feature    complement(102691..102972)
                     /locus_tag="sll7106"
                     /note="Helix-hairpin-helix containing domain; Region:
                     HHH_4; pfam14490"
                     /db_xref="CDD:258630"
     misc_feature    complement(102001..102405)
                     /locus_tag="sll7106"
                     /note="AAA domain; Region: AAA_11; pfam13086"
                     /db_xref="CDD:257489"
     misc_feature    complement(101872..102402)
                     /locus_tag="sll7106"
                     /note="AAA domain; Region: AAA_30; pfam13604"
                     /db_xref="CDD:257919"
     gene            complement(182..490)
                     /locus_tag="sll7001"
                     /db_xref="GeneID:2656005"
     CDS             complement(182..490)
                     /locus_tag="sll7001"
                     /note="ORF_ID:sll7001"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="NP_942289.1"
                     /db_xref="GI:38505669"
                     /db_xref="GeneID:2656005"
                     /translation="MMCAYCMICFYDENFNSTLNSTSKYHQKHEKWDKEEGWKKWLNN
                     LRLVISVFNAINLIKKWLKVFPFAHILDELTKLYNKVNKLDRLKYLLNSWNTFYSSSA
                     "
     gene            complement(706..1287)
                     /locus_tag="sll7002"
                     /db_xref="GeneID:2656037"
     CDS             complement(706..1287)
                     /locus_tag="sll7002"
                     /note="ORF_ID:sll7002"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="NP_942290.1"
                     /db_xref="GI:38505670"
                     /db_xref="GeneID:2656037"
                     /translation="MTDFPWELKELEKRRLNIILEILEGREIIVIIDETGDPKKGKTT
                     DYVKRQYIGNLGKIESGIVSVNAYGYCDGVTFTLESKVFKPKERLKEGDKYKTKPELA
                     VEIIKELEESGFKIKRVVSDSLYGESHSNFISAVEELKIEYAVGIWSNHGVWLPKEAK
                     VRANKWRRFEHIRWDGKQEDRYIREIVYGKKAQ"
     misc_feature    complement(<709..1287)
                     /locus_tag="sll7002"
                     /note="FOG: Transposase [DNA replication, recombination,
                     and repair]; Region: COG5659"
                     /db_xref="CDD:227946"
     gene            complement(1399..1827)
                     /locus_tag="sll7003"
                     /db_xref="GeneID:2656038"
     CDS             complement(1399..1827)
                     /locus_tag="sll7003"
                     /note="ORF_ID:sll7003"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid stability protein"
                     /protein_id="NP_942291.1"
                     /db_xref="GI:38505671"
                     /db_xref="GeneID:2656038"
                     /translation="MTEPVKYLIDTNVISELRKQDRADPGVLAFFQQAQHLYLSVITI
                     GELRRGVELIRHRGDVQQANLLEEWLEIVIADYADHILDFTIFEAQVLGKLRVPNPHN
                     ALDKQIAATALSYGLTLVTRNVKDFADTGVCLLNPFTGNQ"
     misc_feature    complement(1435..1806)
                     /locus_tag="sll7003"
                     /note="PIN domain of ribonucleases (toxins), VapC and
                     FitB, of prokaryotic toxin/antitoxin operons, Pyrococcus
                     horikoshii protein PH0500, and other similar bacterial and
                     archaeal homologs; Region: PIN_VapC-FitB; cd09881"
                     /db_xref="CDD:189051"
     misc_feature    complement(order(1447..1449,1504..1509,1513..1518,
                     1522..1524,1528..1530,1537..1542,1549..1554,1558..1560,
                     1573..1581,1585..1587,1621..1623,1630..1632,1678..1686,
                     1690..1698,1702..1707,1717..1719,1732..1734,1741..1743,
                     1771..1779,1783..1788,1795..1803))
                     /locus_tag="sll7003"
                     /note="oligomeric interface; other site"
                     /db_xref="CDD:189051"
     misc_feature    complement(order(1459..1461,1513..1515,1690..1692,
                     1798..1800))
                     /locus_tag="sll7003"
                     /note="putative active site [active]"
                     /db_xref="CDD:189051"
     misc_feature    complement(order(1510..1512,1516..1521,1537..1542,
                     1546..1554,1558..1563,1576..1578,1615..1617,1624..1629,
                     1681..1686,1690..1695,1702..1707))
                     /locus_tag="sll7003"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:189051"
     gene            complement(1799..2032)
                     /locus_tag="ssl7004"
                     /db_xref="GeneID:2656047"
     CDS             complement(1799..2032)
                     /locus_tag="ssl7004"
                     /note="ssl7004; ORF_ID:ssl7004;
                     probable plasmid stability protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942292.1"
                     /db_xref="GI:38505672"
                     /db_xref="GeneID:2656047"
                     /translation="MANLIVRNIDEAVVVALKKRAGQHGISAEAEHRKILEQALLRLP
                     RKPFAEVLRQIPNVGNDSDFERIQDDRASQIFD"
     misc_feature    complement(<1910..2032)
                     /locus_tag="ssl7004"
                     /note="Plasmid stability protein [General function
                     prediction only]; Region: StbC; COG4691"
                     /db_xref="CDD:227035"
     gene            2399..2965
                     /locus_tag="slr7005"
                     /db_xref="GeneID:2656000"
     CDS             2399..2965
                     /locus_tag="slr7005"
                     /note="slr7005; ORF_ID:slr7005;
                     integrase/recombinase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942293.1"
                     /db_xref="GI:38505673"
                     /db_xref="GeneID:2656000"
                     /translation="MKINRQGQAKVLTEQELHDLFTVGLLTPRDRLLFGICLYTGCRI
                     GEACSLAWADITTDAMTFRIEKTKTKSSRTVAISPALQVLFDEYRQAQQFVRFPSSYV
                     FRGKRVGSHLHPSMAHKILKAATDRISVRGVSTHSFRRTALTMMCRKGINLRVIQKIS
                     GHKNLNVLSHYLEVSEQEKEQALSTISF"
     misc_feature    <2426..2914
                     /locus_tag="slr7005"
                     /note="Integrase [DNA replication, recombination, and
                     repair]; Region: XerC; COG0582"
                     /db_xref="CDD:223655"
     misc_feature    2477..2914
                     /locus_tag="slr7005"
                     /note="DNA breaking-rejoining enzymes,
                     intergrase/recombinases, C-terminal catalytic domain. The
                     tyrosine recombinase/integrase family share the same
                     catalytic domain containing six conserved active site
                     residues. The best-studied members of this diverse
                     family...; Region: INT_REC_C; cd01182"
                     /db_xref="CDD:238587"
     misc_feature    order(2525..2530,2600..2602,2801..2806,2909..2911)
                     /locus_tag="slr7005"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238587"
     misc_feature    order(2525..2527,2600..2602,2804..2806,2813..2815,
                     2882..2884,2909..2911)
                     /locus_tag="slr7005"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238587"
     misc_feature    order(2525..2527,2804..2806,2813..2815,2882..2884,
                     2909..2911)
                     /locus_tag="slr7005"
                     /note="active site"
                     /db_xref="CDD:238587"
     misc_feature    order(2525..2527,2813..2815,2909..2911)
                     /locus_tag="slr7005"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238587"
     gene            complement(3041..3364)
                     /locus_tag="sll7006"
                     /db_xref="GeneID:2656059"
     CDS             complement(3041..3364)
                     /locus_tag="sll7006"
                     /note="ORF_ID:sll7006"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942294.1"
                     /db_xref="GI:38505674"
                     /db_xref="GeneID:2656059"
                     /translation="MSRLTLRLPESLHQQLSHQASQEGVSLNQYIVYALTRQITQQYL
                     VKPVLSEDIEKQQASFLSLLNNLGTATSEDIQLVLEEREIVASEDELTPDIVAQFQQK
                     IKTNS"
     misc_feature    complement(3260..>3358)
                     /locus_tag="sll7006"
                     /note="HicB family; Region: HicB; pfam05534"
                     /db_xref="CDD:114265"
     gene            complement(3367..3591)
                     /locus_tag="ssl7007"
                     /db_xref="GeneID:2656048"
     CDS             complement(3367..3591)
                     /locus_tag="ssl7007"
                     /note="ssl7007; ORF_ID:ssl7007;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942295.1"
                     /db_xref="GI:38505675"
                     /db_xref="GeneID:2656048"
                     /translation="MLGKLLSLAEFTTIYFTWRPTSPDPGDDLIIDCAMNANAAIVIS
                     NIKDFRSAQQILGLQIFTPVELILKLINNN"
     misc_feature    complement(3451..>3570)
                     /locus_tag="ssl7007"
                     /note="PIN domain; Region: PIN_3; pfam13470"
                     /db_xref="CDD:257794"
     gene            4241..5257
                     /locus_tag="slr7008"
                     /db_xref="GeneID:2656001"
     CDS             4241..5257
                     /locus_tag="slr7008"
                     /note="ORF_ID:slr7008"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="NP_942296.1"
                     /db_xref="GI:38505676"
                     /db_xref="GeneID:2656001"
                     /translation="MISNFGHIVKTYLSNFPKDDYPVLDTFKFVSIWLGLVLDQSQTS
                     MRSMFKRLNLRGETVDISTFSKASKKRDVGVFREIIFSLKKELSKRKEIKQGELEIFP
                     LDSTIVSITSKLMWNLGFHQVKVFSGINLSTGIPGGIVIHFGQGHDNKYGNETIEETP
                     ENGVAVMDRGFCDLQRIKRLQKENNKYHVLRIKNNIKLEKLANDNYMVGTEKNKIESR
                     VVIFTHDNSEFRLVTNLPIESKEIEGVSDEKIAEIYKKRWQIELLWKFLKMHLKLNRL
                     IAKNENAIGIQIYTCIIAYLILKLLVIPKEAGTTMLDKLRYLQAFMCEKISYVHWLRE
                     LALR"
     misc_feature    4376..5254
                     /locus_tag="slr7008"
                     /note="FOG: Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3385"
                     /db_xref="CDD:225920"
     misc_feature    4526..5131
                     /locus_tag="slr7008"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     gene            complement(5340..6284)
                     /locus_tag="sll7009"
                     /db_xref="GeneID:2656060"
     CDS             complement(5340..6284)
                     /locus_tag="sll7009"
                     /note="ORF_ID:sll7009"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942297.1"
                     /db_xref="GI:38505677"
                     /db_xref="GeneID:2656060"
                     /translation="MKFQYNSLTFAIEVLKALAKEPCYRKNLTEQLELFLEQHQQPAD
                     DVAQKLTRTIRKLRDCGFEIESAPHRPYVLKKSNFPVILSADQRQALYLATHLLEQMG
                     FSQQASQLQDICPLTEGDRPRHLRADFNPPVDYSDIKTKEIITNLQKRLETACRFTIR
                     YRNSLGKEALWDLDRSELRLHNGSLYLFAYVPDILTQRIQKRPNIEQNVLFRIDRILS
                     VNPSSNIHWLLSSFPTLKVQYRMIGSLSKYKPRRHNETVINRNVEQNYVEIETNEDCL
                     FWFRQRILQYGSNVQILTPQWLHQEIVEEHLKAIQSTK"
     misc_feature    complement(6012..6194)
                     /locus_tag="sll7009"
                     /note="HTH domain; Region: HTH_11; cl17392"
                     /db_xref="CDD:266661"
     misc_feature    complement(5355..5861)
                     /locus_tag="sll7009"
                     /note="WYL domain; Region: WYL; pfam13280"
                     /db_xref="CDD:257623"
     gene            6349..8517
                     /locus_tag="slr7010"
                     /db_xref="GeneID:2656002"
     CDS             6349..8517
                     /locus_tag="slr7010"
                     /note="ORF_ID:slr7010"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942298.1"
                     /db_xref="GI:38505678"
                     /db_xref="GeneID:2656002"
                     /translation="MSLPKVGAMKVQVKPLYAKLNEGLGQCPLGCQSVCTVREQAPEM
                     QPPDGCSCPLYDHQAQTYALTTAGDTDIIFNRVATGGGKSLGATLPALLPKVHPDFRV
                     MGLYPTIELVEDQYRQQQQYHQMFGLNAEKRVDRLYGAELARRISEKDSNRFQELLKS
                     IEQKPVIQTNPDIFHYITHFRYRDNARSQSELPMVMAKFPDLWVFDEFHIFGEHQMAA
                     ALNSLLLIRHATQSKRKFLFTSATPKTSFVESLKNSGFKIAEIQGEYSDRPQQGYRQI
                     LQNINLEFVHLKDTDTESWLLAQSQNLRDLLHQEKNGRGLIIVNSVAAAGHLCRNLSK
                     ILPDVEVREISGRCDRQERQQTQTYLQKSEKSVLVVATSAVDVGVDFKIHVLICESSD
                     SATVIQRLGRLGRHGGFQQYQAYVLIPSQTQWVIASLKEELEEDSSIDRLELSTVIET
                     AFNAPQEFKQYQKIWGELQAQGMLYQMVYGGSRSESKDNLAVTQDLRDRMIESLEKIY
                     QKQINGFGRWWGLSNDAVGKATQEELLRFRGGSSLQSGIWDGDRLYSYDLLKVLTYAT
                     VEVIDREIFLEAAQKLNHGIEEFPEQYLTGYFKITKWLDQRLNFSLFSTHSHLASCQL
                     MLLDRLQLKGHIQPELSRCLGRRKYLAYLVPINRNNPSSHWDISRKLRLSPLFGLYRL
                     TDSGGNAYGCAFNHDALLLEALKWRLGDFCKQATSQSLIF"
     misc_feature    6517..7560
                     /locus_tag="slr7010"
                     /note="CRISPR/Cas system-associated protein Cas3; Distinct
                     diverged subfamily of Cas3 helicase domain; Region:
                     Cas3_I-D; cd09710"
                     /db_xref="CDD:187841"
     misc_feature    6517..7560
                     /locus_tag="slr7010"
                     /note="CRISPR-associated helicase Cas3, subtype CYANO;
                     Region: cas3_cyano; TIGR03158"
                     /db_xref="CDD:234127"
     gene            8531..11458
                     /locus_tag="slr7011"
                     /db_xref="GeneID:2656003"
     CDS             8531..11458
                     /locus_tag="slr7011"
                     /note="ORF_ID:slr7011"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942299.1"
                     /db_xref="GI:38505679"
                     /db_xref="GeneID:2656003"
                     /translation="MTTLLQTLLIRTLSEQKDYILLEYFQTILPALEEHFGNTSGLGG
                     SFISHQKHFGTQGYDTEKAKKMAQGFAKKGDQTLAAHILNALLTTWNVMQELEFPLND
                     IERRLLCLGITLHDYDKHCHAQDMAAPEPDNIQEIINICLELGKRLNFDEFWADWRDY
                     IAEISYLAQNTHGKQHTNLISSNWSNAGYPFTIKERKLDHPLRHLLTFGDVAVHLSSP
                     HDLVSSTMGDRLRDLLNRLGIEKRFVYHHLRDTTGILSNAIHNVILRTVQKLDWKPLL
                     FFAQGVIYFAPQDTEIPERNEIKQIVWQGISQELGKKMSAGDVGFKRDGKGLKVSPQT
                     SELLAAADIVRILPQVISVKVNNAKSPATPKRLEKLELGDAEREKLYEVADLRCDRLA
                     ELLGLVQKEIFLLPEPFIEWVLKDLELTSVIMPEETQVQSGGVNYGWYRVAAHYVANH
                     ATWDLEEFQEFLQGFGDRLATWAEEEGYFAEHQSPTRQIFEDYLDRYLEIQGWESDHQ
                     AFIQELENYVNAKTKKSKQPICSLSSGEFPSEDQMDSVVLFKPQQYSNKNPLGGGQIK
                     RGISKIWSLEMLLRQAFWSVPSGKFEDQQPIFIYLYPAYVYAPQVVEAIRELVYGIAS
                     VNLWDVRKHWVNNKMDLTSLKSLPWLNEEVEAGTNAQLKYTKEDLPFLATVYTTTREK
                     TDTDAWVKPAFLALLLPYLLGVKAIATRSMVPLYRSDQDFRESIHLDGVAGFWSLLGI
                     PTDLRVEDITPALNKLLAIYTLHLAARSSPPKARWQDLPKTVQEVMTDVLNVFALAEQ
                     GLRREKRDRPYESEVTEYWQFAELFSQGNIVMTEKLKLTKRLVEEYRRFYQVELSKKP
                     STHAILLPLSKALEQILSVPDDWDEEELILQGSGQLQAALDRQEVYTRPIIKDKSVAY
                     ETRQLQELEAIQIFMTTCVRDLFGEMCKGDRAILQEQRNRIKSGAEFAYRLLALEAQQ
                     NQN"
     misc_feature    8747..11428
                     /locus_tag="slr7011"
                     /note="CRISPR/Cas system-associated protein Cas10d;
                     Region: Cas10d_I-D; cd09712"
                     /db_xref="CDD:187843"
     gene            11524..12513
                     /locus_tag="slr7012"
                     /db_xref="GeneID:2656004"
     CDS             11524..12513
                     /locus_tag="slr7012"
                     /note="slr7012; ORF_ID:slr7012;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942300.1"
                     /db_xref="GI:38505680"
                     /db_xref="GeneID:2656004"
                     /translation="MLDSLKSQFQPSFPRLASGHYVHFLMLRHSQSFPVFQTDGVLNT
                     TRTQAGLLEKTDQLSRLVMFKRKQTTPERLAGRELLRNLGLTSADKSAKNLCEYNGEG
                     SCKQCPDCILYGFAIGDSGSERSKVYSDSAFSLGAYEQSHRSFTFNAPFEGGTMSEAG
                     VMRSAINELDHILPEVTFPTVESLRDATYEGFIYVLGNLLRTKRYGAQESRTGTMKNH
                     LVGIVFADGEIFSNLHLTQALYDQMGGELNKPISELCETAATVAQDLLNKEPVRKSEL
                     IFGAHLDTLLQEVNDIYQNDAELTKLLGSLYQQTQDYATEFGALSGGKKKAKS"
     misc_feature    11578..12330
                     /locus_tag="slr7012"
                     /note="CRISPR/Cas system-associated protein Csc2; Region:
                     Csc2_I-D; cl11869"
                     /db_xref="CDD:245790"
     gene            12674..13438
                     /locus_tag="slr7013"
                     /db_xref="GeneID:2656071"
     CDS             12674..13438
                     /locus_tag="slr7013"
                     /note="slr7013; ORF_ID:slr7013;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942301.1"
                     /db_xref="GI:38505681"
                     /db_xref="GeneID:2656071"
                     /translation="MTKIYRCKLTLHDNVFFASREMGILYETEKYFHNWALSYAFFKG
                     TIIPHPYGLVGQNAQTPAYLDRDREQNLLHLNDSGIYVFPAQPIHWSYQINTFKAAQS
                     AYYGRSVQFGGKGATKNYPINYGRAKELAVGSEFLTYIVSQKELDLPVWIRLGKWSSK
                     IRVEVEAIAPDQIKTASGVYVCNHPLNPLDCPANQQILLYNRVVMPPSSLFSQSQLQG
                     DYWQIDRNTFLPQGFHYGATTAIAQDSPQLSLLDTN"
     misc_feature    12698..13378
                     /locus_tag="slr7013"
                     /note="CRISPR/Cas system-associated protein Csc1; Region:
                     Csc1_I-D; cd09711"
                     /db_xref="CDD:187842"
     gene            13441..14229
                     /locus_tag="slr7014"
                     /db_xref="GeneID:2656072"
     CDS             13441..14229
                     /locus_tag="slr7014"
                     /note="ORF_ID:slr7014"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942302.1"
                     /db_xref="GI:38505682"
                     /db_xref="GeneID:2656072"
                     /translation="MFDDRYSLYSVVIELGAAKKGFPTGILGRALHSQVLEWLKIGEP
                     SLAEELHQSQISPFSISPLIGKRRSKLTEEGDRFFFRISLLNGSLLQPLLKGLEQQDK
                     QIVMLDKFAFRLCHIHILPGSHSLARASSYALTTQAPTSSKITLKFHSATSFKIDRNT
                     IQPFPLGDSVFNSLLRRWNHFAPEELYFPSVSWQIPVAAFELKTYSVQLKKSEIGSEG
                     WVTYLFPDQEQAKIASVLSQFAFFAGVGRKTSMGMGQVSVNNHG"
     misc_feature    13609..14208
                     /locus_tag="slr7014"
                     /note="CRISPR/Cas system-associated RAMP superfamily
                     protein Cas6; Region: Cas6-I-III; cd09652"
                     /db_xref="CDD:187783"
     gene            14222..14794
                     /locus_tag="slr7015"
                     /db_xref="GeneID:2656073"
     CDS             14222..14794
                     /locus_tag="slr7015"
                     /note="slr7015; ORF_ID:slr7015;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942303.1"
                     /db_xref="GI:38505683"
                     /db_xref="GeneID:2656073"
                     /translation="MDDYLPLAYLNAWEYCHRRFYLEYVLGEMEINEHIIRGNHLHRN
                     INEAGTSVDGDTRIHRQQWVWSDRLKVKGIIDAVEESDGLLIPVEYKKGKMGKHLNDH
                     FQLCAAALCLEEKTGKSITYGEIFYYGNRRRQPVEFTQALRNMTEQAIIAAHLACNGP
                     MPRPIANTKKCADCSLERLCLPKELKKLTK"
     misc_feature    14234..14767
                     /locus_tag="slr7015"
                     /note="CRISPR/Cas system-associated protein Cas4; Region:
                     Cas4_I-A_I-B_I-C_I-D_II-B; cl00641"
                     /db_xref="CDD:260548"
     gene            14804..15781
                     /locus_tag="slr7016"
                     /db_xref="GeneID:2656074"
     CDS             14804..15781
                     /locus_tag="slr7016"
                     /note="slr7016; ORF_ID:slr7016;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942304.1"
                     /db_xref="GI:38505684"
                     /db_xref="GeneID:2656074"
                     /translation="MSTLYLTQPDAVLSKKHEAFHVALKQEDGSWKKQPIPAQTLEDI
                     VLLGYPSITGEALGYALELGLPVHYLTQFGKYVGSALPSESRNGQLRLAQFRAHEDPI
                     QRLDIVKAFVKGKVHNQYNLLYRRGQVDNPLKGRGKLVMRQQTLEQVRGIEGLAAREY
                     FASWQEMLGHEWTFTGRFRRPPTDPVNALLSFGYGLLRTQVTAAVHIAGLDPYIGFLH
                     ETTRGQPAMILDLMEEFRALVADSVVLTVLKQREIQRQDFTESLGAFRLTDSATKTFL
                     GAFDRKLSSEFKHPIFNYKCTYRRAIELQARLLARHLQEGVVYEPLVIR"
     misc_feature    14810..15748
                     /locus_tag="slr7016"
                     /note="CRISPR/Cas system-associated protein Cas1; Region:
                     Cas1_I-II-III; cd09634"
                     /db_xref="CDD:187766"
     gene            15813..16097
                     /locus_tag="ssr7017"
                     /db_xref="GeneID:2656024"
     CDS             15813..16097
                     /locus_tag="ssr7017"
                     /note="ssr7017; ORF_ID:ssr7017;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942305.1"
                     /db_xref="GI:38505685"
                     /db_xref="GeneID:2656024"
                     /translation="MLYLIIYDVPATKAGNKRRTRLFDLLSGYGKWRQFSVFECFLSV
                     KQFAKLQTAMEKLIKLDEDAVCIYVLDENTVQRTITYGTPQPEKPGSIII"
     misc_feature    15819..16064
                     /locus_tag="ssr7017"
                     /note="CRISPR/Cas system-associated protein Cas2; Region:
                     Cas2_I_II_III; cd09725"
                     /db_xref="CDD:187856"
     gene            17795..18016
                     /locus_tag="ssr7018"
                     /db_xref="GeneID:2656025"
     CDS             17795..18016
                     /locus_tag="ssr7018"
                     /note="ORF_ID:ssr7018"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942306.1"
                     /db_xref="GI:38505686"
                     /db_xref="GeneID:2656025"
                     /translation="MRGPDPCQIPQSFLLLIPAIGTETLDLWHKATETDPFLLLIPAI
                     GTETIIVLPSMLTLLSFLLLIPAIGTETP"
     gene            complement(18056..18313)
                     /locus_tag="ssl7019"
                     /db_xref="GeneID:2656049"
     CDS             complement(18056..18313)
                     /locus_tag="ssl7019"
                     /note="ORF_ID:ssl7019"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942307.1"
                     /db_xref="GI:38505687"
                     /db_xref="GeneID:2656049"
                     /translation="MPALVSVPIAGISRRKARRRHYPGGKPEFQSRSPGLVEGKFHSQ
                     SLMTSLASWFQSRSPGLVEGKPGFPYLSDGVTYSFSPDRRD"
     gene            complement(19089..19259)
                     /locus_tag="ssl7020"
                     /db_xref="GeneID:2656050"
     CDS             complement(19089..19259)
                     /locus_tag="ssl7020"
                     /note="ORF_ID:ssl7020"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942308.1"
                     /db_xref="GI:38505688"
                     /db_xref="GeneID:2656050"
                     /translation="MFQSRSPGLVEGKFAGNTINFPLVVFQSRSPGLVEGKPKRDTTY
                     PRKGSFSPDRRD"
     gene            complement(19594..19779)
                     /locus_tag="ssl7021"
                     /db_xref="GeneID:2656051"
     CDS             complement(19594..19779)
                     /locus_tag="ssl7021"
                     /note="ORF_ID:ssl7021"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942309.1"
                     /db_xref="GI:38505689"
                     /db_xref="GeneID:2656051"
                     /translation="MWEGLVSVPIAGISRRKATARYAPSLEKSFQSRSPGLVEGKIAD
                     RSGQYAGSDGFSPDRRD"
     gene            complement(19808..19996)
                     /locus_tag="ssl7022"
                     /db_xref="GeneID:2656052"
     CDS             complement(19808..19996)
                     /locus_tag="ssl7022"
                     /note="ORF_ID:ssl7022"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942310.1"
                     /db_xref="GI:38505690"
                     /db_xref="GeneID:2656052"
                     /translation="MADSQIAVFSATGGVQFRLGDDVNWRWWAGGVFQSRSPGLVEGK
                     NPCEYKSYRRSFSPDRRD"
     gene            20266..22182
                     /locus_tag="slr7023"
                     /db_xref="GeneID:2656075"
     CDS             20266..22182
                     /locus_tag="slr7023"
                     /note="slr7023; ORF_ID:slr7023;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942311.1"
                     /db_xref="GI:38505691"
                     /db_xref="GeneID:2656075"
                     /translation="MPKLKKLTPKAEAQSESTSLDRLRELAQDPKLAKLVAANYMAPP
                     DLLEELSHTSDKPLLKALVSNPNTPTEVLLKLGSLFPEQLLDNPVFDILLIENPNLLS
                     EFPKSSLNSLLKREVAPVSFLRWAATNGDENTLQSLLINPNVPAEVVQGLTEHGDWDV
                     VIAAKLHVNSGVEVEPSWEEQGLKRRVPEKENERVTDFFRYFWPELKDLVCLNYWIRR
                     RIASHPNCPVDVLAQLALDDDLDVRICVAKNPNCPVELRLKLLTQLALDDGCWVRICV
                     AENPNCPVDVLTQFALDNNSYVRRDVASNLNCPVEVLTQLALDDDYRVRRDVASNPNC
                     PVDVLTQLALDNNSDVRIGITLNLNCPVDVLTQLALDNNSDVRIGITLNPNCPVELRL
                     KLLTQLALDNNSDVRIDVTLNPNCPVEVLTQLALDDSYVRRGIALNLNCPVEVLTQLA
                     LDNNSDVRRGVASNPNCPVEVLTQLALDNNSDVRRGVASNPNCPVEVLTQLALDNNSD
                     VRRGVASNPNCPVEVLTQLALDNNSDVRRGVASNLNCPPADLIVDSFLEQFTKSSIPT
                     YPRLIAFRSPHCPTGALAKNYRSRDWLERCAIAEHPKTPDATLQKLLLDGNRLVRQKA
                     QANLEQRQNIIPED"
     gene            22328..24058
                     /locus_tag="slr7024"
                     /db_xref="GeneID:2656076"
     CDS             22328..24058
                     /locus_tag="slr7024"
                     /note="slr7024; ORF_ID:slr7024;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942312.1"
                     /db_xref="GI:38505692"
                     /db_xref="GeneID:2656076"
                     /translation="MTIYALEHPLRNVFSPKDYQFKIPEYQRPYAWTNDQAEEFWNDL
                     INALDQKEEEEPEYFLGSMVLVKSENKPEAEVVDGQQRLTTLTILFAVIRHHLSPSST
                     AYSKIENLFFEEDFDGQKRPGLTTRKQDNQFFADNIYTPGGIENLIKQDSGFDSDSQI
                     KMRDNAIFFDKQLKNKLKEISDQDKDQWLTKLLGNILKCCHLVVVSTNDFEKAYRIFS
                     TINSRGLNLTHNDILKAEIISKMDDGKKRKEYTEIWDSMEGDLGRSQFESLFAYIFRI
                     EYQERPSKSILTEYRKRVLPKYEEKYPKDHVFKFVDELLLPSSKVLEIINNQNFECED
                     LEIQDSINNYLGWLNLIDNDDWKAPLISFMIRYRNESTKLLKFLVELERYAAAIMFLR
                     FDINARARAYRPVILATLESAGEAIDTLEKALDIEKQDELIKKVLEGDIYKDKTRRKY
                     ILLRLDSALAESGQSESLKSKTLTIEHVLPQSLTLEWKSLGWNEENHAIWVNRLGNLA
                     LLSQKKNSSGSNLSFEIKKKEYFQKKGSVTFPITTRILSYSTWTPAIVEQNQNFYIKT
                     LKKVWRLSLM"
     misc_feature    22355..23041
                     /locus_tag="slr7024"
                     /note="Protein of unknown function DUF262; Region: DUF262;
                     pfam03235"
                     /db_xref="CDD:251819"
     misc_feature    23615..24022
                     /locus_tag="slr7024"
                     /note="Protein of unknown function (DUF1524); Region:
                     DUF1524; pfam07510"
                     /db_xref="CDD:254249"
     gene            24079..24495
                     /locus_tag="slr7025"
                     /db_xref="GeneID:2656077"
     CDS             24079..24495
                     /locus_tag="slr7025"
                     /note="slr7025; ORF_ID:slr7025;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942313.1"
                     /db_xref="GI:38505693"
                     /db_xref="GeneID:2656077"
                     /translation="MNITFKFNFMSYKHYFSPKHKPEITQAITITEPAIIFRLNKTYS
                     TNLSQQEIYDITRSDWILGHRREKAEYGFAAFKGVVLQVYRIDRWDFSGKVTDVGRQR
                     WFFEGKVATEMQDYINGNISHYFKKGDRSPTKYLNC"
     misc_feature    <24166..24483
                     /locus_tag="slr7025"
                     /note="GIY-YIG nuclease domain superfamily; Region:
                     GIY-YIG_SF; cl15257"
                     /db_xref="CDD:265657"
     gene            24509..24886
                     /locus_tag="slr7026"
                     /db_xref="GeneID:2656078"
     CDS             24509..24886
                     /locus_tag="slr7026"
                     /note="ORF_ID:slr7026"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942314.1"
                     /db_xref="GI:38505694"
                     /db_xref="GeneID:2656078"
                     /translation="MLKMNSPTFFEKGTTFYSKSDFNKALSQWYNKTDEVTIGDTSYS
                     QASWIFIKLGMYDFQLNADTKRIGVFDYLQILKQYEQDLPWHIVENTRNSKINKAVFG
                     EDFKKISGFYLYIKKALETTITI"
     gene            complement(24925..25509)
                     /locus_tag="sll7027"
                     /db_xref="GeneID:2656061"
     CDS             complement(24925..25509)
                     /locus_tag="sll7027"
                     /note="ORF_ID:sll7027"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942315.1"
                     /db_xref="GI:38505695"
                     /db_xref="GeneID:2656061"
                     /translation="MVLGLNPGVGYPELQSRDGVWANRIRQTSFSKCFDRSPPGDQAW
                     LKLHVKESPYWRSLMSFGQRCCGNNFEFSQILNFELYPWHSSALTSALNCPPSIIDLY
                     VFQPLAEVQTRHIFAFGKPWDKVFQGLGLTEVRRYGDGFQPLPGVSTPGWTVVIFRSA
                     LMTVPIIVSWQQGYAGPPGKPRLQALRAIIENEG"
     gene            complement(26352..27608)
                     /locus_tag="sll7028"
                     /db_xref="GeneID:2656062"
     CDS             complement(26352..27608)
                     /locus_tag="sll7028"
                     /note="sll7028; ORF_ID:sll7028;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942316.1"
                     /db_xref="GI:38505696"
                     /db_xref="GeneID:2656062"
                     /translation="MSDDCQALLSATRLRLRMQSPFFATLALFARYYVTEAIPTAGTE
                     GKNIYFNPHYLAQLTPAERDGLFLHELLHGALLHQSRRASRLPELWNIAADIVVNGMI
                     VAEGKFVIPKGGLREPELEKYSVEEVYELLIKRESPPALPIADLLQEIPNLTTQSDSN
                     NNDNDLNSNDSEPNGGQSSANSSKIHSHSQDDQEIHRNRLESPRHQEEQLAVHWRNAI
                     QQATVVARSQFQGNLPEGLERHLGEIGQPQLDWRTYLWRFLVHTPNDFQGYDRRFIHQ
                     GLYLEALVGESVEVFCCIDTSGSVGDEEMGIFLSELRGIFGSYPQIKCWLWYADADCY
                     GPYELDNLNAVPKPQGGGGTDFRPFFTAVDEKWSREKQAVICYLTDGYGSFPDQAPPL
                     DTLWVVSPGGKNSDGFPFGEVVRLRS"
     misc_feature    complement(26361..27593)
                     /locus_tag="sll7028"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3864"
                     /db_xref="CDD:226382"
     misc_feature    complement(26757..27584)
                     /locus_tag="sll7028"
                     /note="Putative metallopeptidase domain; Region:
                     DUF2201_N; pfam13203"
                     /db_xref="CDD:257570"
     misc_feature    complement(26361..26729)
                     /locus_tag="sll7028"
                     /note="Von Willebrand factor type A (vWA) domain was
                     originally found in the blood coagulation protein von
                     Willebrand factor (vWF). Typically, the vWA domain is made
                     up of approximately 200 amino acid residues folded into a
                     classic a/b para-rossmann type of...; Region: vWFA;
                     cl00057"
                     /db_xref="CDD:260163"
     misc_feature    complement(order(26469..26471,26547..26549,26724..26726))
                     /locus_tag="sll7028"
                     /note="metal ion-dependent adhesion site (MIDAS); other
                     site"
                     /db_xref="CDD:238119"
     gene            complement(27605..28630)
                     /locus_tag="sll7029"
                     /db_xref="GeneID:2656063"
     CDS             complement(27605..28630)
                     /locus_tag="sll7029"
                     /note="sll7029; ORF_ID:sll7029;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942317.1"
                     /db_xref="GI:38505697"
                     /db_xref="GeneID:2656063"
                     /translation="MTPVQLKNYLEQLVGNQIKTSTMIWGPPGIGKSSIVAQIAEEGK
                     LRFIDLRLSQLAPTDLRGLPVAIPTSKTKPQTGTSAWYPPEFLPKDGAGILFLDELNM
                     APPAMQGVAQQLILDRRVGSYEVPTDWFIWAAGNRKEDRASVFEMPAPLANRFLHLDV
                     QPDFESFKQYALEQKYHEQVIAFLSFRPGLIHKLDLQRPAWPSPRSWAIANGLHQVNL
                     DVSPAVGEGCAAEFSAFVQLYKDLPDLEAIFRGQGQNIGFPTEPSSGYASTIGLAVRA
                     KDATAGVNAFHWLTDKADSEWVQLFVTDMAGQLRRAGHLGALSIMAKKEPKLKQFMQG
                     YQELLAI"
     misc_feature    complement(28166..28618)
                     /locus_tag="sll7029"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(28166..28570)
                     /locus_tag="sll7029"
                     /note="ATPases associated with a variety of cellular
                     activities; Region: AAA; smart00382"
                     /db_xref="CDD:214640"
     misc_feature    complement(28532..28555)
                     /locus_tag="sll7029"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(28223..28225,28337..28339,28529..28552))
                     /locus_tag="sll7029"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(28334..28351)
                     /locus_tag="sll7029"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(28169..28171)
                     /locus_tag="sll7029"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     gene            complement(28850..29353)
                     /locus_tag="sll7030"
                     /db_xref="GeneID:2656064"
     CDS             complement(28850..29353)
                     /locus_tag="sll7030"
                     /note="sll7030; ORF_ID:sll7030;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942318.1"
                     /db_xref="GI:38505698"
                     /db_xref="GeneID:2656064"
                     /translation="MVLKIELLDSRIHQRSDFYCGEASLDTYIQKQASQDLKRKIATI
                     FVLVDNLDKKVLGYYTLSAYTVNIAYLETDFAKGLPRYPMLPATLLGRLAVDQNYKGQ
                     GLGELLLIDALKRAWETSQLIASLAVIVEALNDQASNFYIKYGFVPFNQQPSKLYLAM
                     KSVERLF"
     misc_feature    complement(28916..29323)
                     /locus_tag="sll7030"
                     /note="Acetyltransferases [General function prediction
                     only]; Region: RimI; COG0456"
                     /db_xref="CDD:223532"
     misc_feature    complement(29000..29224)
                     /locus_tag="sll7030"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    complement(<28883..>29101)
                     /locus_tag="sll7030"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cl17182"
                     /db_xref="CDD:266534"
     misc_feature    complement(order(29036..29041,29069..29077))
                     /locus_tag="sll7030"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            complement(29337..29639)
                     /locus_tag="sll7031"
                     /db_xref="GeneID:2656065"
     CDS             complement(29337..29639)
                     /locus_tag="sll7031"
                     /note="sll7031; ORF_ID:sll7031;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942319.1"
                     /db_xref="GI:38505699"
                     /db_xref="GeneID:2656065"
                     /translation="MTQITKSKALARLEARISPETKALMQKAAALEGRSLTDFVVASA
                     QAAALKVIEQHQTLQLTIADSQAFVDALLRPSEPNSKLKKAALRHQQIIEIDGVKN"
     misc_feature    complement(29367..29606)
                     /locus_tag="sll7031"
                     /note="Protein of unknown function (DUF1778); Region:
                     DUF1778; pfam08681"
                     /db_xref="CDD:254971"
     gene            30352..30669
                     /locus_tag="slr7032"
                     /db_xref="GeneID:2656079"
     CDS             30352..30669
                     /locus_tag="slr7032"
                     /note="slr7032; ORF_ID:slr7032;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942320.1"
                     /db_xref="GI:38505700"
                     /db_xref="GeneID:2656079"
                     /translation="MNRDLASILDALIFARRIVTFTTNMTEENFFTDIKTQDAVMRNI
                     AVLGEALRRISPEFRQTYSKIPYNQGNYLKLQDELFTGETIKSLGRNFLEFEANKSQE
                     TVP"
     misc_feature    30352..>30558
                     /locus_tag="slr7032"
                     /note="Protein of unknown function DUF86; Region: DUF86;
                     cl01031"
                     /db_xref="CDD:260757"
     gene            complement(30699..31040)
                     /locus_tag="sll7033"
                     /db_xref="GeneID:2656017"
     CDS             complement(30699..31040)
                     /locus_tag="sll7033"
                     /note="sll7033; ORF_ID:sll7033;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942321.1"
                     /db_xref="GI:38505701"
                     /db_xref="GeneID:2656017"
                     /translation="MSRLYGDENFPMPVVQALRELGHDVLTCLDAGQADKAIPDEDVL
                     AFAVAEQRAVLTINRKDFIRLHLQNECHCGIIVCTFNADFLAQAKQIDAALEQISEPS
                     NQLIRINRLQG"
     misc_feature    complement(30741..31034)
                     /locus_tag="sll7033"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4634"
                     /db_xref="CDD:226981"
     gene            complement(31037..31369)
                     /locus_tag="sll7034"
                     /db_xref="GeneID:2656018"
     CDS             complement(31037..31369)
                     /locus_tag="sll7034"
                     /note="sll7034; ORF_ID:sll7034;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942322.1"
                     /db_xref="GI:38505702"
                     /db_xref="GeneID:2656018"
                     /translation="MTSALQAIANLLPQLSGGERAQLLQWVAQDLGDLAPGVEVHPLV
                     CGGEPCIVRTRIPVWVLEQARRQGLNDGEILRCYPSLRAEDLVNAWAYVRRHRSEVEG
                     QINENEAL"
     misc_feature    complement(31067..31279)
                     /locus_tag="sll7034"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG2442"
                     /db_xref="CDD:225291"
     gene            31822..32097
                     /locus_tag="ssr7035"
                     /db_xref="GeneID:2656026"
     CDS             31822..32097
                     /locus_tag="ssr7035"
                     /note="ORF_ID:ssr7035"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942323.1"
                     /db_xref="GI:38505703"
                     /db_xref="GeneID:2656026"
                     /translation="MRPIQSGSLLLPVAGRPRLGDRALDFDSPSTEVVCGQNHHNEFP
                     EVPIAFFGWRSPVSWGEIEQGSMLDQGNIEVFERKPKERKPFPEQAL"
     gene            32289..32483
                     /locus_tag="ssr7036"
                     /db_xref="GeneID:2656027"
     CDS             32289..32483
                     /locus_tag="ssr7036"
                     /note="ORF_ID:ssr7036"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942324.1"
                     /db_xref="GI:38505704"
                     /db_xref="GeneID:2656027"
                     /translation="METGHSIALIAAQTPKTKETPHALDGTEGVPKVLKAHQPRAIGA
                     FKLNFSNGKPQLAKFAGGAA"
     gene            32647..35523
                     /locus_tag="slr7037"
                     /db_xref="GeneID:2656080"
     CDS             32647..35523
                     /locus_tag="slr7037"
                     /note="slr7037; ORF_ID:slr7037;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942325.1"
                     /db_xref="GI:38505705"
                     /db_xref="GeneID:2656080"
                     /translation="MKVRPQHWQEWVNSGIAPEIIEANLKSLDNAYGWLLYSEKLPRR
                     NDGRLSQGILTQYRHLEQGGWYCSGLDAITLEDSQWGCFKPDQPRLSQEGKLIKYEHP
                     PKTSTEAFCLKITRHQWRQIAQKAGLECPDLEHIPNQEIAQSFWQWVKNNPAVPIIIT
                     EGAKKTASLLSYGYAALGLPGIYSGYRSKDSEGIELVHKQLIPQLETFCQQGREFVFC
                     FDNDNKPTTKHNVRKAIANTGCLMELQGCKVTVMTWAGLAKGIDDVIVGNGETSLDRI
                     YSARQSLEAHKLSEFTDLTPLISQIVNCRYLDQDILANVTSRLVGIKAAKGTGKTEAL
                     AQQVQQAIAKGLPVIVLTHREQLAKELAQRFGLPYRSELEFGAESFHGYVLCVDSLHP
                     QAKPAFDSSRYPDALVILDEAEQVIWHLLNSVTCQRNRPAILETLSQLLNGAGQIVLS
                     DADLTRISLDYLHGLLTVQCAPWVLVNEYHPASARKAFLYDAPEALFSDALECIQNGE
                     RLIIHTGAQKVSSKWGTINLETTLSGAFPELNILRIDAESVAEPGHPAYGVMGNLNAI
                     IPLYDIVIASPTLETGVSIDVKGHFHRVFCFAPGSQTAEAVCQSLARVREDLPRHLWI
                     KKYSNQSIGNGSTIPKILVSSQQKLFKANSLLLGQADTIANLDGHCSRHMVTWARYSA
                     LHNHGFKKYRDVILSRLEAEGYSILSTDAPDDAKSVGEFMKAYTEANYQQHCEKVAAA
                     PLLDDLEFERISRARAKSEPERLSEQKTAISKRYLTDDITPELVSQDDKGLYGQLQLR
                     YYLTLGREFLAERDTHRVKKLTKQTGEAFTPDINSTCYSAKVKTLEIINIGQFLDGSA
                     HTSESLRDWFEHICQFRDDIKAILNQSINPERDTPIAVAQRLLGLMGLKMTGKQYRIN
                     GGRQRIYALVDSPPDDPAKIIMERWFERDSSRVPCHTSSLKELC"
     misc_feature    33112..33408
                     /locus_tag="slr7037"
                     /note="TOPRIM_primases: The topoisomerase-primase (TORPIM)
                     nucleotidyl transferase/hydrolase domain found in the
                     active site regions of bacterial DnaG-type primases and
                     their homologs. Primases synthesize RNA primers for the
                     initiation of DNA replication. DnaG...; Region:
                     TOPRIM_primases; cd01029"
                     /db_xref="CDD:173779"
     misc_feature    order(33127..33132,33139..33141,33304..33306,33310..33312,
                     33316..33318)
                     /locus_tag="slr7037"
                     /note="active site"
                     /db_xref="CDD:173779"
     misc_feature    order(33127..33129,33304..33306)
                     /locus_tag="slr7037"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:173779"
     misc_feature    order(33133..33138,33154..33159,33175..33177)
                     /locus_tag="slr7037"
                     /note="interdomain interaction site; other site"
                     /db_xref="CDD:173779"
     misc_feature    33625..>33885
                     /locus_tag="slr7037"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    33625..33639
                     /locus_tag="slr7037"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    33877..33885
                     /locus_tag="slr7037"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     gene            complement(35891..36178)
                     /locus_tag="ssl7038"
                     /db_xref="GeneID:2656053"
     CDS             complement(35891..36178)
                     /locus_tag="ssl7038"
                     /note="ssl7038; ORF_ID:ssl7038;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942326.1"
                     /db_xref="GI:38505706"
                     /db_xref="GeneID:2656053"
                     /translation="METLKTIPWDAADHLESREDMAAYLEAALEEGDPALILVALGDI
                     ARSKGMTLIAKETGLGRESLYKALSANGNPEFVTVLKVMEALGLRLQATTL"
     misc_feature    complement(35900..36166)
                     /locus_tag="ssl7038"
                     /note="Predicted transcriptional regulator
                     [Transcription]; Region: COG3636; cl17681"
                     /db_xref="CDD:248235"
     gene            complement(36189..36479)
                     /locus_tag="ssl7039"
                     /db_xref="GeneID:2656054"
     CDS             complement(36189..36479)
                     /locus_tag="ssl7039"
                     /note="ssl7039; ORF_ID:ssl7039;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942327.1"
                     /db_xref="GI:38505707"
                     /db_xref="GeneID:2656054"
                     /translation="MIEIRQTETYARWFKSLRDCQAKARIDIRIRRLSLVNAGDVKSV
                     GGGVSELRINYGPGYRIYFTQQGEQLIILLAGGDKQTQSNDITIARDLAKEL"
     misc_feature    complement(36192..36476)
                     /locus_tag="ssl7039"
                     /note="putative addiction module killer protein; Region:
                     upstrm_HI1419; TIGR02683"
                     /db_xref="CDD:162974"
     gene            36597..36848
                     /locus_tag="ssr7040"
                     /db_xref="GeneID:2656028"
     CDS             36597..36848
                     /locus_tag="ssr7040"
                     /note="ssr7040; ORF_ID:ssr7040;
                     probable cell growth regulatory protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942328.1"
                     /db_xref="GI:38505708"
                     /db_xref="GeneID:2656028"
                     /translation="MEVRLKKWGNSIGLRIPHPLAISWGFDESTVVDLVETEQGLMIR
                     KRSSPGSLEALLTSIPADFTYPGDVSDFVESEATGQEWL"
     misc_feature    36612..36743
                     /locus_tag="ssr7040"
                     /note="Antidote-toxin recognition MazE; Region:
                     Antitoxin-MazE; pfam04014"
                     /db_xref="CDD:252315"
     gene            36839..37201
                     /locus_tag="slr7041"
                     /db_xref="GeneID:2656081"
     CDS             36839..37201
                     /locus_tag="slr7041"
                     /note="slr7041; ORF_ID:slr7041;
                     probable growth inhibitor, PemK-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942329.1"
                     /db_xref="GI:38505709"
                     /db_xref="GeneID:2656081"
                     /translation="MVMTSTVPQYPERGAVIRLNLNPTQGREQMGEARPCLVLSHTAF
                     NKARNGLIIVSPITNTIKPEIQTLVVLPDGYRVQGSVIAEQIRTVDLSLRWWRDTGEV
                     LPPSFVDQVLAVLQLIIG"
     misc_feature    36872..37195
                     /locus_tag="slr7041"
                     /note="PemK-like protein; Region: PemK; cl00995"
                     /db_xref="CDD:260736"
     gene            complement(37267..37521)
                     /locus_tag="ssl7042"
                     /db_xref="GeneID:2656055"
     CDS             complement(37267..37521)
                     /locus_tag="ssl7042"
                     /note="ssl7042; ORF_ID:ssl7042;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942330.1"
                     /db_xref="GI:38505710"
                     /db_xref="GeneID:2656055"
                     /translation="MGTATRYTVSIARSGLRLRESRIIADLLLQKISDGDWQRKILEE
                     NVLQIGNVESIKRIAHLLRSRIEPLGESLWLLIRDGDASH"
     misc_feature    complement(<37273..37506)
                     /locus_tag="ssl7042"
                     /note="Putative inner membrane protein (DUF1819); Region:
                     DUF1819; pfam08849"
                     /db_xref="CDD:149795"
     gene            complement(37554..38138)
                     /locus_tag="sll7043"
                     /db_xref="GeneID:2656019"
     CDS             complement(37554..38138)
                     /locus_tag="sll7043"
                     /note="ORF_ID:sll7043"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942331.1"
                     /db_xref="GI:38505711"
                     /db_xref="GeneID:2656019"
                     /translation="MPKKLSVPEIRVTSSEQQGLFAQAADPITPLKEIDMNGATLMEL
                     EDIVKAAHQSFQSHLGDALQAGLIAGKALLTAKQQFTYNRQTGGFRGWLERIEVSKST
                     AYRYIELATNEPIVSQAGTLSEAMERLAQHRAEQRALKAGEEQVEVKKRRVTLKLSNE
                     RDQKLESIAKSRGGDVSALIKEIVEQWLANEQDS"
     misc_feature    complement(37569..37685)
                     /locus_tag="sll7043"
                     /note="Ribbon-helix-helix protein, copG family; Region:
                     RHH_1; pfam01402"
                     /db_xref="CDD:201775"
     gene            complement(38131..38712)
                     /locus_tag="sll7044"
                     /db_xref="GeneID:2656020"
     CDS             complement(38131..38712)
                     /locus_tag="sll7044"
                     /note="sll7044; ORF_ID:sll7044;
                     plasmid partition protein ParA homolog"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942332.1"
                     /db_xref="GI:38505712"
                     /db_xref="GeneID:2656020"
                     /translation="MKIVVFNGKGGVGKSTIAANLAVISASPLLDADPQATCCYWADR
                     RGSNSPEVVDVSLGRVAIRLKALERAIVDLPGASVPGVHDALSVADVVLVPVVYDQAT
                     LDALPATLELARNAHRPTTMLLNRLHPRAHADGIVTSLAPLNVPICLTPVRERASHRD
                     WWSQGLVAADFPDTDAGGDILQIWQWLQTQNYA"
     misc_feature    complement(<38323..38712)
                     /locus_tag="sll7044"
                     /note="ParA-like protein; Provisional; Region: PHA02518"
                     /db_xref="CDD:222854"
     misc_feature    complement(<38608..38706)
                     /locus_tag="sll7044"
                     /note="ParA and ParB of Caulobacter crescentus belong to a
                     conserved family of bacterial proteins implicated in
                     chromosome segregation. ParB binds to DNA sequences
                     adjacent to the origin of replication and localizes to
                     opposite cell poles shortly following the...; Region:
                     ParA; cd02042"
                     /db_xref="CDD:238997"
     misc_feature    complement(38668..38688)
                     /locus_tag="sll7044"
                     /note="P-loop; other site"
                     /db_xref="CDD:238997"
     misc_feature    complement(38668..38670)
                     /locus_tag="sll7044"
                     /note="Magnesium ion binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238997"
     gene            complement(40013..40234)
                     /locus_tag="ssl7045"
                     /db_xref="GeneID:2656056"
     CDS             complement(40013..40234)
                     /locus_tag="ssl7045"
                     /note="ORF_ID:ssl7045"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942333.1"
                     /db_xref="GI:38505713"
                     /db_xref="GeneID:2656056"
                     /translation="MAAKLSCAVEGNFRKEAGLVLRSAGRVKTISADPLPLTKGFPQP
                     GESGVVGSDDVAVQTQGGVDGDYWGLLES"
     gene            complement(40245..40514)
                     /locus_tag="ssl7046"
                     /db_xref="GeneID:2656057"
     CDS             complement(40245..40514)
                     /locus_tag="ssl7046"
                     /note="ssl7046; ORF_ID:ssl7046;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942334.1"
                     /db_xref="GI:38505714"
                     /db_xref="GeneID:2656057"
                     /translation="MQVLTYLKFRLNAAEQEELLADYLPFCETVEIPNPPPPTPLCRD
                     PFDVPFLVLALVGQADYLITGDKDLLELEEPFPCPIVALEQFLFK"
     misc_feature    complement(40296..>40514)
                     /locus_tag="ssl7046"
                     /note="PIN domain; Region: PIN_3; cl17397"
                     /db_xref="CDD:266665"
     gene            complement(40637..41368)
                     /locus_tag="sll7047"
                     /db_xref="GeneID:2656033"
     CDS             complement(40637..41368)
                     /locus_tag="sll7047"
                     /note="sll7047; ORF_ID:sll7047;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942335.1"
                     /db_xref="GI:38505715"
                     /db_xref="GeneID:2656033"
                     /translation="MTNRMIETSPLVYARAAGLLYLIIIVLGLFAEIFVRSSIITPGD
                     ATATAGSILGAEGLFRAGFLADSIMLLSDVALAVLLFTLLKPVNKTLALVALFFRLTQ
                     TAVIAVNLLNYYAAVLLLKGPGYATIFGVAQLNSLSLLFLDLHSYGYDLGLILFGVHC
                     LILGYLIAKSLYLPKAIGYLVMAAGVTYLIGSYTRFLFPDFVGAVSPIYVVPIVSELS
                     LCLWLLIKGVDLERWREVTGSAGVV"
     misc_feature    complement(40685..41326)
                     /locus_tag="sll7047"
                     /note="Domain of unknown function (DUF4386); Region:
                     DUF4386; pfam14329"
                     /db_xref="CDD:258503"
     gene            complement(41419..41640)
                     /locus_tag="ssl7048"
                     /db_xref="GeneID:2656058"
     CDS             complement(41419..41640)
                     /locus_tag="ssl7048"
                     /note="ssl7048; ORF_ID:ssl7048;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942336.1"
                     /db_xref="GI:38505716"
                     /db_xref="GeneID:2656058"
                     /translation="MLAKLTSKNQLTLPKSVTQQIGAAEYFEVTVQSGQIILTPVRIQ
                     RADAVRAKLALLDIIEEDINNAVDWARQS"
     misc_feature    complement(41515..41634)
                     /locus_tag="ssl7048"
                     /note="SpoVT / AbrB like domain; Region: SpoVT_AbrB;
                     smart00966"
                     /db_xref="CDD:198034"
     gene            41845..42492
                     /locus_tag="slr7049"
                     /db_xref="GeneID:2656082"
     CDS             41845..42492
                     /locus_tag="slr7049"
                     /note="ORF_ID:slr7049"
                     /codon_start=1
                     /transl_table=11
                     /product="resolvase"
                     /protein_id="NP_942337.1"
                     /db_xref="GI:38505717"
                     /db_xref="GeneID:2656082"
                     /translation="MLIGYMRVSKTDGSQHLDLQKDALLAAGVKEDRIYQDCGSGRNS
                     QRPGLEAGLKALQPGNTLVVWKLDRLGRNLKDLVMIVEGLRQREVGFKVLAGAGAEID
                     TSTANGRLFFAVFAALAEYEAELISERTRAGLQAARARGRMGGRPRKMDRVMLQMLME
                     AMKNPEACAKAVAQKLNISTATLYSYVNGDGTPKEAGLRLLRKAHGEQQESEGPR"
     misc_feature    41845..42408
                     /locus_tag="slr7049"
                     /note="multiple promoter invertase; Provisional; Region:
                     mpi; PRK13413"
                     /db_xref="CDD:184041"
     misc_feature    41848..42243
                     /locus_tag="slr7049"
                     /note="Serine Recombinase (SR) family, Resolvase and
                     Invertase subfamily, catalytic domain; members contain a
                     C-terminal DNA binding domain. Serine recombinases
                     catalyze site-specific recombination of DNA molecules by a
                     concerted, four-strand cleavage and...; Region: SR_ResInv;
                     cd03768"
                     /db_xref="CDD:239737"
     misc_feature    order(41863..41865,41869..41871,42046..42051,42058..42060)
                     /locus_tag="slr7049"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239737"
     misc_feature    41869..41871
                     /locus_tag="slr7049"
                     /note="catalytic nucleophile [active]"
                     /db_xref="CDD:239737"
     misc_feature    order(42043..42045,42184..42189,42193..42198,42208..42210)
                     /locus_tag="slr7049"
                     /note="Presynaptic Site I dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    order(42061..42063,42076..42081,42172..42174,42181..42186,
                     42193..42198,42205..42207,42214..42216)
                     /locus_tag="slr7049"
                     /note="Synaptic Antiparallel dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    order(42130..42132,42142..42147,42172..42177,42184..42189,
                     42196..42198,42208..42210,42217..42219,42229..42231)
                     /locus_tag="slr7049"
                     /note="Synaptic Flat tetramer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    order(42130..42132,42187..42189,42196..42198,42208..42210,
                     42217..42219,42229..42231)
                     /locus_tag="slr7049"
                     /note="Synaptic Site I dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    order(42211..42213,42229..42234)
                     /locus_tag="slr7049"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:239737"
     misc_feature    42277..42405
                     /locus_tag="slr7049"
                     /note="Helix-turn-helix domain of Hin and related
                     proteins; Region: HTH_Hin_like; cl17393"
                     /db_xref="CDD:266662"
     misc_feature    order(42280..42288,42385..42390,42394..42402)
                     /locus_tag="slr7049"
                     /note="DNA-binding interface [nucleotide binding]; DNA
                     binding site"
                     /db_xref="CDD:259851"
     gene            complement(43053..43646)
                     /locus_tag="sll7050"
                     /db_xref="GeneID:2656034"
     CDS             complement(43053..43646)
                     /locus_tag="sll7050"
                     /note="ORF_ID:sll7050"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942338.1"
                     /db_xref="GI:38505718"
                     /db_xref="GeneID:2656034"
                     /translation="MLITLEPTFYLRNHPLYYSPYDTLMITSIESPIKLSIPDEDFTI
                     REVGFLHAYRLNLSFPPDLLLTYADMLSDSVSNVADYFLGEGQSSCFPENVVSSAQQI
                     IYIEDFYVEPQYRGRNIGLKSLALFLQMLGQGAIVAGCPFPAGEEDSPGARRRQRLLI
                     DYWSKLGLLCHCQKRNILWNDNWQLPKWLEECLWHEI"
     gene            complement(43751..44017)
                     /locus_tag="ssl7051"
                     /db_xref="GeneID:2656021"
     CDS             complement(43751..44017)
                     /locus_tag="ssl7051"
                     /note="ORF_ID:ssl7051"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942339.1"
                     /db_xref="GI:38505719"
                     /db_xref="GeneID:2656021"
                     /translation="MFGGGNHLSISTNPPQHFELLQDLESLAAGISTVLRLLVHRVLE
                     PDDGLLVHQPFLYCAGFARDLVTELRGKQKTTPISLGANHGYRH"
     gene            43997..44320
                     /locus_tag="slr7052"
                     /db_xref="GeneID:2656083"
     CDS             43997..44320
                     /locus_tag="slr7052"
                     /note="ORF_ID:slr7052"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942340.1"
                     /db_xref="GI:38505720"
                     /db_xref="GeneID:2656083"
                     /translation="MVAPSEHQSSLMEKAEDNGVVPGLGNGIVEMPGLRINPAGDGKT
                     KGQAVVSFSLQFLENVRGEDSGGVSADSKSLTELVIASLPLTKEDEVLIHNGELKGGA
                     AQGIQ"
     gene            complement(44777..45019)
                     /locus_tag="ssl7053"
                     /db_xref="GeneID:2656022"
     CDS             complement(44777..45019)
                     /locus_tag="ssl7053"
                     /note="ssl7053; ORF_ID:ssl7053;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942341.1"
                     /db_xref="GI:38505721"
                     /db_xref="GeneID:2656022"
                     /translation="MLEETIAVTLAYLAVVILLMAPAQRTHSSKAPQGGRGAQSLCLK
                     QLTIRELKQRARRAKIRGYGSMRKVELLQHLLASPE"
     misc_feature    complement(<44792..44893)
                     /locus_tag="ssl7053"
                     /note="Rho termination factor, N-terminal domain; Region:
                     Rho_N; pfam07498"
                     /db_xref="CDD:254238"
     gene            45058..45630
                     /locus_tag="slr7054"
                     /db_xref="GeneID:2656084"
     CDS             45058..45630
                     /locus_tag="slr7054"
                     /note="ORF_ID:slr7054"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942342.1"
                     /db_xref="GI:38505722"
                     /db_xref="GeneID:2656084"
                     /translation="MYIHLKRGLTFPCFGHIRGSAPMANSDFTLATFRIQASQWDSFK
                     QWAKDRGNSASGELQHFIARVVQGDYVDPPALPEGLTTRAELDETVAALEERLMAEIK
                     SLQVRLDRHQLPDGAGQSTASPKEEKLTTTELAELLKRAGIWKSKRTLQEYAQENRYP
                     DDLPWRAHKSGGKWYWSELPAKGGAGLLSP"
     gene            complement(45712..46254)
                     /locus_tag="sll7055"
                     /db_xref="GeneID:2656035"
     CDS             complement(45712..46254)
                     /locus_tag="sll7055"
                     /note="ORF_ID:sll7055"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942343.1"
                     /db_xref="GI:38505723"
                     /db_xref="GeneID:2656035"
                     /translation="MGSSYPFTCHQKHSWRKLAGIFKDPMQWSPFFHRTHRSINPVGG
                     ADSGHGSLSPFPLPHQGKAYHNPLSAVDSKNREERETYINWYNAMPHQNFDYSELSPN
                     VTLKLKVIVVMIKDLDLNEDFQLIGELLAEVFLNYLPAAKQKSWVESELQGLMTFTEA
                     MAYYLTEILGEEELISIERL"
     gene            complement(46666..47043)
                     /locus_tag="sll7056"
                     /db_xref="GeneID:2656036"
     CDS             complement(46666..47043)
                     /locus_tag="sll7056"
                     /note="ORF_ID:sll7056"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942344.1"
                     /db_xref="GI:38505724"
                     /db_xref="GeneID:2656036"
                     /translation="MMVLILNNSRGIYVQEESFLLTALRLKSGKEINGSTVLLINAWG
                     EFRPPFKLPVCVTPAELVQPLEEELEGALVIRRAASLCPEAPGLEGAVIPRVQQRVPL
                     LYSTVDTVLFPSRTSMASTPHPQ"
     gene            47529..48242
                     /locus_tag="slr7057"
                     /db_xref="GeneID:2656085"
     CDS             47529..48242
                     /locus_tag="slr7057"
                     /note="ORF_ID:slr7057"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942345.1"
                     /db_xref="GI:38505725"
                     /db_xref="GeneID:2656085"
                     /translation="MTRTLPPVFKTQATNRRKRTRHGSMQALRESVAKVKSFGYLDFT
                     SWKINKDGYLFLTRGKRSELFKLLENSGFFEFHETNISQDSVYQHQVSKFLATGYELY
                     GRGYYARKGEVEIHHLDGNQQNNDPRNLRYVSPGLNYFIARSLRFPYTGNQSNRITES
                     AEEARNMLRLSLKRTLNVRGKRFSQEQLDFLLSLRLEQARNILDEWYLAGNSYNNLIN
                     KRVEQFSLTMTTEGIVAQL"
     misc_feature    <47868..47942
                     /locus_tag="slr7057"
                     /note="HNH endonuclease; Region: HNH_3; pfam13392"
                     /db_xref="CDD:257717"
     gene            48431..48733
                     /locus_tag="slr7058"
                     /db_xref="GeneID:2656086"
     CDS             48431..48733
                     /locus_tag="slr7058"
                     /note="slr7058; ORF_ID:slr7058;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942346.1"
                     /db_xref="GI:38505726"
                     /db_xref="GeneID:2656086"
                     /translation="MKDDRYPSEWAQLALQKKQSVNWACERCGVQCLKPGEGKGLSTG
                     DRYRLRMAVHHCDYDPGNNSPSNLKALCSPCHLYFHRRQRGNVIPGQLRLKFSFLI"
     misc_feature    <48587..48670
                     /locus_tag="slr7058"
                     /note="HNH nucleases; HNH endonuclease signature which is
                     found in viral, prokaryotic, and eukaryotic proteins. The
                     alignment includes members of the large group of homing
                     endonucleases, yeast intron 1 protein, MutS, as well as
                     bacterial colicins, pyocins, and...; Region: HNHc;
                     cd00085"
                     /db_xref="CDD:238038"
     misc_feature    order(48590..48598,48629..48634,48644..48649,48656..48658,
                     48668..48670)
                     /locus_tag="slr7058"
                     /note="active site"
                     /db_xref="CDD:238038"
     gene            48790..49434
                     /locus_tag="slr7059"
                     /db_xref="GeneID:2656087"
     CDS             48790..49434
                     /locus_tag="slr7059"
                     /note="slr7059; ORF_ID:slr7059;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942347.1"
                     /db_xref="GI:38505727"
                     /db_xref="GeneID:2656087"
                     /translation="MSTLQQFSQAPKPWSLDEFVEIVNGLLPQFLPEEKSHTRVREEM
                     TSRLVRHYTGMGLLDEPLKEGREARYLYRHLLQALLVRRLLVEGYGASAIDNLAKSKT
                     NQELEALLQGGVVLTLTPANPALNFLQEIQQRSAKSAPAPSQSRKVGKADDSNLEKTA
                     LPTPSVWTRLVILPGLEVHVRNDFLLPSTHQEQENLWQRILQSLSSIKKKRFNQ"
     misc_feature    48922..>49089
                     /locus_tag="slr7059"
                     /note="Helix-Turn-Helix DNA binding domain of
                     transcription regulators from the MerR superfamily;
                     Region: HTH_MerR-SF; cl02600"
                     /db_xref="CDD:261364"
     misc_feature    order(48937..48939,48985..48993)
                     /locus_tag="slr7059"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:133389"
     gene            49431..51197
                     /locus_tag="slr7060"
                     /db_xref="GeneID:2656088"
     CDS             49431..51197
                     /locus_tag="slr7060"
                     /note="slr7060; ORF_ID:slr7060;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942348.1"
                     /db_xref="GI:38505728"
                     /db_xref="GeneID:2656088"
                     /translation="MNTPQVSFIPLKNAVCSERAVTLDLIIRITPPSPPAMDQPRPSL
                     NLGFVIDRSGSMEGHNKITYARQAVCYAIDQLSPGDHLSVTIFDDQVQTLIPSTLVKD
                     KAQFKRLVQGINPGGCTDLHGGWLQGGIQVSQNLSAELNRIILLSDGLANRGETNPDI
                     IATDVHGLAQRGASTTTLGLGDDYNEDLLEAMARSGDGNYYYVADAEQLPTIFERELQ
                     GLAATYGNGVTLTATSQAGVQVLDLLNDFELDNQGRYQLPNLIYGDSIDVVVRLKVPA
                     IKEEQILGTVTLSWLDGERQKQTLMVNLQLPVLTKVEFEALPSNQEVQQQVALMMSAR
                     AKKEAMERVDRGDYGGAGQVLQEARAEIVGANLPMSAPEAAALEDLEQKLNQREYKSY
                     RKMASAQNYRRNYQRSAGHSDLRYAFQKGPRLGDITKEKAEAIVNSTDRNLSNSGALS
                     RAIHQAAGPELLQACQDLQGCTVGGAKLTPGFNLRANWVIHTVAPKWKGGNQGEEELL
                     VSCYQNCLQLAVSQSIRSLAFPAIACGAMGFPPEIAARIALETVSNFLLSNMAIGSVA
                     FICADKETLQYYQEAFQRVVAW"
     misc_feature    49545..50579
                     /locus_tag="slr7060"
                     /note="Uncharacterized protein containing a von Willebrand
                     factor type A (vWA) domain [General function prediction
                     only]; Region: COG2304"
                     /db_xref="CDD:225187"
     misc_feature    49560..50069
                     /locus_tag="slr7060"
                     /note="Von Willebrand factor type A (vWA) domain was
                     originally found in the blood coagulation protein von
                     Willebrand factor (vWF). Typically, the vWA domain is made
                     up of approximately 200 amino acid residues folded into a
                     classic a/b para-rossmann type of...; Region: vWFA;
                     cl00057"
                     /db_xref="CDD:260163"
     misc_feature    order(49581..49583,49797..49799,49872..49874)
                     /locus_tag="slr7060"
                     /note="metal ion-dependent adhesion site (MIDAS); other
                     site"
                     /db_xref="CDD:238119"
     misc_feature    50703..51179
                     /locus_tag="slr7060"
                     /note="Macro domain, a high-affinity ADP-ribose binding
                     module found in a variety of proteins as a stand-alone
                     domain or in combination with other domains like in
                     histone macroH2A and some PARPs (poly ADP-ribose
                     polymerases). Some macro domains recognize poly...;
                     Region: Macro; cl00019"
                     /db_xref="CDD:260140"
     misc_feature    order(50706..50708,50748..50750,50769..50771,50775..50780,
                     51027..51029,51033..51041)
                     /locus_tag="slr7060"
                     /note="ADP-ribose binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239150"
     gene            51537..52805
                     /locus_tag="slr7061"
                     /db_xref="GeneID:2656089"
     CDS             51537..52805
                     /locus_tag="slr7061"
                     /note="ORF_ID:slr7061"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942349.1"
                     /db_xref="GI:38505729"
                     /db_xref="GeneID:2656089"
                     /translation="MKIISFLGFNNYQTTTYVHPTNPEITCKTRFFQEALVDFYRPTE
                     IYVLLTKTVATVAPRGAEVTNWQGLQDCLADKVTIRPIEDIPEGSAPEDLWDIFDCIT
                     DCLDHGDRVIFDFTHGYRFLPVVALLAISYLRTVRQVQVEGVLYGAFDPNSQGESSPT
                     YDLLPMLSLLDWLAATDRFVNLGDGLPLAQLLQTAIPGAERRDNPEVRNPGSRLDQAG
                     KVIAEISQAIALARPMETLELTVQLEEIINRASDSFDQRAKPFNLIKDQLLAEYGQFA
                     LPESWEPENLQRNLWLQFQLINWYLQRGQAVQAMTLASEWLISVVAFRLGAKQILDHR
                     KQINFALNNGGAVQKKREPVGPSSFDEQFQALSQYQFLSQLWNDLTEIRNDLAHCGMR
                     KDPKSAKKLQEKANKIFPQLEEIANSLLKQ"
     misc_feature    51540..52115
                     /locus_tag="slr7061"
                     /note="CRISPR/Cas system-associated protein Csx1; Region:
                     Csx1_III-U; cd09668"
                     /db_xref="CDD:187799"
     gene            complement(52881..53996)
                     /locus_tag="sll7062"
                     /db_xref="GeneID:2656066"
     CDS             complement(52881..53996)
                     /locus_tag="sll7062"
                     /note="ORF_ID:sll7062"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942350.1"
                     /db_xref="GI:38505730"
                     /db_xref="GeneID:2656066"
                     /translation="MPNVIVSPCGTSLLTNQIDDSLRKLINRNSNLKEAEISSEDKAQ
                     IDRHYQQRSQELNEEDIEGAKKLSAELNGILTYSKGQISTSDHYYLIATDTYVGGLTA
                     TLVTDWIQSHQGNAFLTIIRDLSTKEIETFRLAMSEIVRWCDYELNNQYPQPAWKRIF
                     NLTGGFKSVNGFLQALAMFYADESIYIFESDGQLLTIPKLPIKLSPEDDLANNLDIFR
                     RLAILGHEIPANECQNISGALLEQVDGRASLSEWGQLVWQQFSGGHYQNQLLPPLTSK
                     LKYSEEFVIDIQSLPRDRLAIINARLDDLTRCLESNGEYNPRSLRFHSLEGRLFRGRL
                     SPEPTHECYAWSDKDAKRIYGHFEDNVFIIDKLGLHL"
     misc_feature    complement(53364..53909)
                     /locus_tag="sll7062"
                     /note="CRISPR/Cas system-associated protein Csm6; Region:
                     Csm6_III-A; cd09742"
                     /db_xref="CDD:187873"
     gene            complement(54005..56392)
                     /locus_tag="sll7063"
                     /db_xref="GeneID:2656067"
     CDS             complement(54005..56392)
                     /locus_tag="sll7063"
                     /note="ORF_ID:sll7063"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942351.1"
                     /db_xref="GI:38505731"
                     /db_xref="GeneID:2656067"
                     /translation="MTVGTLGVVGSAKNLKLQLSFINTRQQYVQITLFERNSFKVAEE
                     EFSTELVEIIKTALPTLKNKKVEFEEDGDQIKQIREKGQAWVGAAEQIAPYVLPSGNI
                     TETPRNVNASNFHNPYNFVPALPRDGITGDLGDCAPAGHSYYHGDKYSGRIAVKLTTV
                     TPLLIPDASKEEINNNHKTYPVRIGKDGKPYLPPTSIKGMLRSAYEAVTNSRLAVFED
                     HDSRLAYRMPATMGLQMVPARIEGDNIVLYPGTSRIGNNGRPANNDPMYAAWLPYYQN
                     RIAYDGSRDYQMAEHGDHVRFWAERYTRGNFCYWRVRQIARHNQNLGNRPERGRNYGQ
                     HHSTGVIEQFEGFVYKTNKNIGNKHDERVFIIDRESIEIPLSRDLRRKWRELITSYQE
                     IHKKEVDRGDTGPSAVNGAVWSRQIIADESERNLSDGTLCYAHVKKEDGQYKILNLYP
                     VMITRGLYEIAPVDLLDETLKPATDKKQLSPADRVFGWVNQRGNGCYKGQLRIHSVTC
                     QHDDAIDDFGNQNFSVPLAILGQPKPEQARFYCADDRKGIPLEDGYDRDDGYSDSEQG
                     LRGRKVYPHHKGLPNGYWSNPTEDRSQQAIQGHYQEYRRPKKDGLEQRDDQNRSVKGW
                     VKPLTEFTFEIDVTNLSEVELGALLWLLTLPDLHFHRLGGGKPLGFGSVRLDIDPDKT
                     DLRNGAGWRDYYGSLLETSQPDFTTLISQWINAFQTAVKEEYGSSSFDQVTFIKASGQ
                     SLQGFHDNASIHYPRSTPEPKPDGEAFKWFVANEKGRRLALPALEKSQSFPIKPS"
     misc_feature    complement(<55712..55918)
                     /locus_tag="sll7063"
                     /note="CRISPR/Cas system-associated RAMP superfamily
                     protein; Region: RAMP_I_III; cd09726"
                     /db_xref="CDD:187857"
     gene            complement(56394..56975)
                     /locus_tag="sll7064"
                     /db_xref="GeneID:2656068"
     CDS             complement(56394..56975)
                     /locus_tag="sll7064"
                     /note="ORF_ID:sll7064"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942352.1"
                     /db_xref="GI:38505732"
                     /db_xref="GeneID:2656068"
                     /translation="MPAGGRLMKNLYHYHQYEITLESAVDSCKNHLQAAIGLLYSPQK
                     CELVKLDNSGKLVDSYNRLKFNNLGVFEARFFNLNCELRWVNESNGNGTAVLLSESDI
                     TLTGFEKGLQEFITAIDQQYLLWGEPAKHPPNADGWQRLAEARIGKLDIPLDNPLKPK
                     DRVFLTSEEYIAEVDDFGNCAVIDERLIKLEVK"
     misc_feature    complement(56403..56867)
                     /locus_tag="sll7064"
                     /note="CRISPR-associated protein, TIGR03984 family;
                     Region: TIGR03984"
                     /db_xref="CDD:234429"
     gene            complement(56954..58522)
                     /locus_tag="sll7065"
                     /db_xref="GeneID:2656069"
     CDS             complement(56954..58522)
                     /locus_tag="sll7065"
                     /note="ORF_ID:sll7065"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942353.1"
                     /db_xref="GI:38505733"
                     /db_xref="GeneID:2656069"
                     /translation="MARKVTTRWKITGTLIAETPLHIGGVGGDADTDLALAVNGAGEY
                     YVPGTSLAGALRGWMTQLLNNDESQIKDLWGDHLDAKRGASFVIVDDAVIHIPNNADV
                     EIREGVGIDRHFGTAANGFKYSRAVIPKGSKFKLPLTFDSQDDGLPNALIQLLCALEA
                     GDIRLGAAKTRGLGRIKLDDLKLKSFALDKPEGIFSALLDQGKKLDWNQLKANVTYQS
                     PPYLGISITWNPKDPVMVKAEGDGLAIDILPLVSQVGSDVRFVIPGSSIKGILRTQAE
                     RIIRTICQSNGSEKNFLEQLRINLVNELFGSASLSQKQNGKDIDLGKIGALAVNDCFS
                     SLSMTPDQWKAVENATEMTGNLQPALKQATGYPNNISQAYKVLQPAMHVAVDRWTGGA
                     AEGMLYSVLEPIGVTWEPIQVHLDIARLKNYYHGKEEKLKPAIALLLLVLRDLANKKI
                     PVGYGTNRGMGTITVSQITLNGKALPTELEPLNKTMTCPNLTDLDEAFRQDLSTAWKE
                     WIADPIDLCQQEAA"
     misc_feature    complement(58001..58474)
                     /locus_tag="sll7065"
                     /note="CRISPR/Cas system-associated RAMP superfamily
                     protein; Region: RAMP_I_III; cd09726"
                     /db_xref="CDD:187857"
     misc_feature    complement(<57524..57805)
                     /locus_tag="sll7065"
                     /note="CRISPR/Cas system-associated RAMP superfamily
                     protein; Region: RAMP_I_III; cd09726"
                     /db_xref="CDD:187857"
     gene            complement(58527..60902)
                     /locus_tag="sll7066"
                     /db_xref="GeneID:2656070"
     CDS             complement(58527..60902)
                     /locus_tag="sll7066"
                     /note="ORF_ID:sll7066"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942354.1"
                     /db_xref="GI:38505734"
                     /db_xref="GeneID:2656070"
                     /translation="MRGIEITITMQSDWHVGTGMGRGELDSVVQRDGDNLPYIPGKTL
                     TGILRDSCEQVALGLDNGQTRGLWHGWINFIFGDQPALAQGAIEPEPRPALIAIGSAH
                     LDPKLKAAFQGKKQLQEAIAFMKPGVAIDAITGTAKKDFLRFEEVVRLGAKLTAEVEL
                     NLPDNLSETNKKVIAGILASGAKLTERLGGKRRRGNGRCELKFSGYSDQQIQWLKDNY
                     QSVDQPPKYQQNKLQSAGDNPEQQPPWHIIPLTIKTLSPVVLPARTVGNVVECLDYIP
                     GRYLLGYIHKTLGEYFDVSQAIAAGDLIITNATIKIDGKAGRATPFCLFGEKLDGGLG
                     KGKGVYNRFQESEPDGIQLKGERGGYVGQFEQEQRNLPNTGKINSELFTHNTIQDDVQ
                     RPTSDVGGVYSYEAIIAGQTFVAELRLPDSLVKQITSKNKNWQAQLKATIRIGQSKKD
                     QYGKIEVTSGNSADLPKPTGNNKTLSIWFLSDILLRGDRLNFNATPDDLKKYLENALD
                     IKLKERSDNDLICIALRSQRTESWQVRWGLPRPSLVGWQAGSCLIYDIESGTVNAEKL
                     QELMITGIGDRCTEGYGQIGFNDPLLSASLGKLTAKPKASNNQSQNSQSNPLPTNHPT
                     QDYARLIEKAAWREAIQNKALALASSRAKREEILGIKIMGKDSQPTMTQLGGFRSVLK
                     RLHSRNNRDIVTGYLTALEQVSNRKEKWSNTSQGLTKIRNLVTQENLIWNHLDIDFSP
                     LTITQNGVNQLKSELWAEAVRTLVDAIIRGHKRDLEKAQENESNQQSQGAA"
     misc_feature    complement(60363..60869)
                     /locus_tag="sll7066"
                     /note="CRISPR/Cas system-associated RAMP superfamily
                     protein; Region: RAMP_I_III; cd09726"
                     /db_xref="CDD:187857"
     misc_feature    complement(59133..60164)
                     /locus_tag="sll7066"
                     /note="CRISPR/Cas system-associated RAMP superfamily
                     protein Csx10; Region: Csx10; cl17558"
                     /db_xref="CDD:248112"
     gene            complement(60905..62581)
                     /locus_tag="sll7067"
                     /db_xref="GeneID:2656006"
     CDS             complement(60905..62581)
                     /locus_tag="sll7067"
                     /note="ORF_ID:sll7067"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942355.1"
                     /db_xref="GI:38505735"
                     /db_xref="GeneID:2656006"
                     /translation="MFLVLIETSGNQHFIFSTNKLRENIGASELTYLATTEILFQGVD
                     RVFQTNYYDQWSDTNSLNFLADSKLNPAIDDPKNNADIEILLATSGKAIALVKEEGKA
                     KQLIKEVTKQALINAPGLEIGGIYVNCNWQDKLGVAKAVKEAHKQFEVNRAKRAGANG
                     RFLRLPIAAGCSVSELPASDFDYNADGDKIPVSTVSKVKRETAKSAKKRLRSVDGRLV
                     NDLAQLEKSFDELDWLAVVHADGNGLGQILLSLEKYIGEQTNRNYIDKYRRLSLALDN
                     CTINAFKMAIAVFKEDSKKIDLPIVPLILGGDDLTVICRGDYALEFTREFLEAFEGQT
                     ETHDDIKVIAQKAFGVDRLSACAGISIIKPHFPFSVAYTLAERLIKSAKEVKQKVTVT
                     NSSPITPFPCSAIDFHILYDSSGIDFDRIREKLRPEDNTELYNRPYVVTAAENLSQAQ
                     GYEWSQAHSLQTLADRVSYLRSEDGEGKSALPSSQSHALRTALYLEKNEADAQYSLIS
                     QRYKILKNFAEDGENKSLFHLENGKYVTRFLDALDAKDFFANANHKNQGE"
     misc_feature    complement(61424..>61984)
                     /locus_tag="sll7067"
                     /note="CRISPR/Cas system-associated protein Cas10; Region:
                     Cas10_III; cd09679"
                     /db_xref="CDD:187810"
     gene            62908..64011
                     /locus_tag="slr7068"
                     /db_xref="GeneID:2656090"
     CDS             62908..64011
                     /locus_tag="slr7068"
                     /note="slr7068; ORF_ID:slr7068;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942356.1"
                     /db_xref="GI:38505736"
                     /db_xref="GeneID:2656090"
                     /translation="MVDLKSLAGAEMVGLRWQLRFDRPCRLESHYVKGLHAWFLHQVQ
                     AIDPDVSAWLHDGQGEKPFTISRLIGPTLWQEGHWHWQINKTYHWQLNLLSGALIEAL
                     QPWLARLPNKIVLARQTLWVEAVDCYLAPHNYQQLWPQGALPRRQEFTFTSPTSFRRQ
                     GNHYPLPEPRNVLQSYLRRWNDFSGLAFEPEPFLDYWVPQNVVIDRHWLESVKTTAGK
                     QGSVVGFVGAVSLVLTPQARNDGDDYGRLFHALCRYGPYCGTGHKTTFGLGQTMAGWA
                     TPDLKTFACLQEDLQTQVLTQRIDQCASLLLAQRQRTGGQRAQEICHTLATIFVRREQ
                     GESLQEIALDLQLPYETARTYSKRAKRALANVQ"
     misc_feature    63088..63717
                     /locus_tag="slr7068"
                     /note="CRISPR/Cas system-associated RAMP superfamily
                     protein Cas6; Region: Cas6-I-III; cd09652"
                     /db_xref="CDD:187783"
     gene            complement(64005..64319)
                     /locus_tag="sll7069"
                     /db_xref="GeneID:2656007"
     CDS             complement(64005..64319)
                     /locus_tag="sll7069"
                     /note="sll7069; ORF_ID:sll7069;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942357.1"
                     /db_xref="GI:38505737"
                     /db_xref="GeneID:2656007"
                     /translation="MKIIITAKGALLRNLATALVNGAITLTILLIAPLGLLAVITNTV
                     LIMISTFVVNSFGDRVVQWVLKPETMGAQIGYGEQTNVNKENLLPGQGLPQSRDQGPR
                     NY"
     gene            complement(64316..64690)
                     /locus_tag="sll7070"
                     /db_xref="GeneID:2656008"
     CDS             complement(64316..64690)
                     /locus_tag="sll7070"
                     /note="ORF_ID:sll7070"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942358.1"
                     /db_xref="GI:38505738"
                     /db_xref="GeneID:2656008"
                     /translation="MENPNQYQNYAQQMDKEKSERLVRKTLYISRRAIWVNILLSILI
                     SYVAGYIHTRRWKALGIVVVGTFVFGFLTASENESLEEAVERGITLSPLFGLIGTIDN
                     SLAIRRARQTVANGNVDAPGNQ"
     misc_feature    complement(<64469..64582)
                     /locus_tag="sll7070"
                     /note="Organic Anion Transporter Polypeptide (OATP)
                     family; Region: OATP; pfam03137"
                     /db_xref="CDD:251753"
     gene            64822..65832
                     /locus_tag="slr7071"
                     /db_xref="GeneID:2656091"
     CDS             64822..65832
                     /locus_tag="slr7071"
                     /note="slr7071; ORF_ID:slr7071;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942359.1"
                     /db_xref="GI:38505739"
                     /db_xref="GeneID:2656091"
                     /translation="MTSIYLTEPGTKVSYHNQQLQIKQKSRQVITRLAEIDLLVLFPG
                     VQLTDVAIAVLMDQGIETIFLRRDGQFRGRLQGQFATNPLTRIAQYRVLDSTFGTALA
                     QRLILGKVTNQRAILQRRHRDTGKKNNALAEAIDLIGAYRLSLRSGLGNSSRDQLMGI
                     EGICAKHYYQVFQFCLPEGWSFTGRNRRPPKDPVNALLSWGYGVLLARVFSAIVQAGL
                     DPYLGFFHATQPYRPNLALDLMEEFRPVVVDQAIVRLLRSGILDPLDFEPSYDGLGIW
                     LGITAKKLFLTELESILQTSFLYSPQSRRLKLQQIILEQARCLGRCCLESSLDYEPFT
                     LS"
     misc_feature    64828..65796
                     /locus_tag="slr7071"
                     /note="CRISPR/Cas system-associated protein Cas1; Region:
                     Cas1_I-II-III; cd09634"
                     /db_xref="CDD:187766"
     gene            65842..66123
                     /locus_tag="ssr7072"
                     /db_xref="GeneID:2656029"
     CDS             65842..66123
                     /locus_tag="ssr7072"
                     /note="ssr7072; ORF_ID:ssr7072;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942360.1"
                     /db_xref="GI:38505740"
                     /db_xref="GeneID:2656029"
                     /translation="MDFWLVCYDVRDDKRRRKLAKLLEQRCQRVQYSVFECPLPEKVL
                     TDLLHRRWLKELNLKEDSLRAYPLQRQSRSQAKIFGSPDLYEPPDFLIL"
     misc_feature    65851..66090
                     /locus_tag="ssr7072"
                     /note="CRISPR/Cas system-associated protein Cas2; Region:
                     Cas2_I_II_III; cd09725"
                     /db_xref="CDD:187856"
     gene            66223..66567
                     /locus_tag="slr7073"
                     /db_xref="GeneID:2656092"
     CDS             66223..66567
                     /locus_tag="slr7073"
                     /note="slr7073; ORF_ID:slr7073;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942361.1"
                     /db_xref="GI:38505741"
                     /db_xref="GeneID:2656092"
                     /translation="MPNPTVEIKLEDILVSIQKDLNELKVSQAEIKGQISALDEKLTG
                     QINALDERLTGQIKAVDEKLTGQIKTLDEKVSGIGKRLENQEFLNRGILTALIVALIA
                     GAAKLFGWLPTS"
     misc_feature    <66244..>66510
                     /locus_tag="slr7073"
                     /note="chromosome segregation protein SMC, common
                     bacterial type; Region: SMC_prok_B; TIGR02168"
                     /db_xref="CDD:233757"
     gene            complement(66610..66906)
                     /locus_tag="ssl7074"
                     /db_xref="GeneID:2656023"
     CDS             complement(66610..66906)
                     /locus_tag="ssl7074"
                     /note="ssl7074; ORF_ID:ssl7074;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942362.1"
                     /db_xref="GI:38505742"
                     /db_xref="GeneID:2656023"
                     /translation="MCQENPGHFGTSTTMPTIETDLKEILTKIDDHLGKIDDRLGRLE
                     TGQARMEEKLGNLDSRVEKLEDSQSKQIWTLIGIIGTTVIGVMIRYVLTALPNP"
     misc_feature    complement(66640..66855)
                     /locus_tag="ssl7074"
                     /note="Haemolysin XhlA; Region: XhlA; pfam10779"
                     /db_xref="CDD:256162"
     gene            complement(66936..67976)
                     /locus_tag="sll7075"
                     /db_xref="GeneID:2656009"
     CDS             complement(66936..67976)
                     /locus_tag="sll7075"
                     /note="ORF_ID:sll7075"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942363.1"
                     /db_xref="GI:38505743"
                     /db_xref="GeneID:2656009"
                     /translation="MSILRYEENGIEFFTVQATGESGMSQSGLARLCGVDEKSIRVVL
                     KSVRSSSCSNFLKPLQNIELTVRNSYHEFKNVTILRDTVCAHILEWYAFESQRPNETA
                     RQAFRKFASMGIRTWIQGITGWEQGTEALTLEPEAKKTTADLGKIKTELEQLEHSLLV
                     ALKHRHAIHNIVEQPTVVDLTLQQIIHTAVHVQAKTLNEALKQLALLRHWFTEWDFSA
                     LMDANQISQHNQFWEEVGTLRAENEALTRRLAILQAQRSNLPYTSPEQAKMNLEERIE
                     WLTQALLTHQKRPDGDRAKKICRLQATILARYEAGESLKAIAQELELDYETARTYVKR
                     TRANLRLQVVMS"
     misc_feature    complement(66948..>67082)
                     /locus_tag="sll7075"
                     /note="RNA polymerase sigma factor, sigma-70 family;
                     Region: sigma70-ECF; TIGR02937"
                     /db_xref="CDD:234065"
     gene            69379..69768
                     /locus_tag="slr7076"
                     /db_xref="GeneID:2656093"
     CDS             69379..69768
                     /locus_tag="slr7076"
                     /note="slr7076; ORF_ID:slr7076;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942364.1"
                     /db_xref="GI:38505744"
                     /db_xref="GeneID:2656093"
                     /translation="MSLDTLVPDSSTPSFPRQGTETWADWSCHLPMACSSTPSFPRQG
                     TETSQSQLAQARQAILSSTPSFPRQGTETRASAHRKRLIPQRSTPSFPRQGTETTGSP
                     SGGHRGGARSTPSFPRQGTETPATFSD"
     gene            complement(72878..73459)
                     /locus_tag="sll7077"
                     /db_xref="GeneID:2656010"
     CDS             complement(72878..73459)
                     /locus_tag="sll7077"
                     /note="sll7077; ORF_ID:sll7077;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942365.1"
                     /db_xref="GI:38505745"
                     /db_xref="GeneID:2656010"
                     /translation="MNLSHPTPLTPRFGDALVLANQLHAQQFRKGSPVPYISHLLGVT
                     ALVLEMGGNEDEAIAALLHDAVEDQGGEATLNVIREKFGETVAQLVLGCSDSSTVPKP
                     PWEERKQQHLQKMSRISLAVLKISLADTLHNARTIEIDLHRYGNDIWQKFSRSKSGII
                     WYYQSLWQIYQDRNPNPWSNELIDIINGWAYGK"
     misc_feature    complement(<72899..73459)
                     /locus_tag="sll7077"
                     /note="Guanosine polyphosphate
                     pyrophosphohydrolases/synthetases [Signal transduction
                     mechanisms / Transcription]; Region: SpoT; COG0317"
                     /db_xref="CDD:223394"
     misc_feature    complement(73004..73357)
                     /locus_tag="sll7077"
                     /note="Metal dependent phosphohydrolases with conserved
                     'HD' motif; Region: HDc; cd00077"
                     /db_xref="CDD:238032"
     misc_feature    complement(order(73073..73075,73268..73273,73343..73345))
                     /locus_tag="sll7077"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    complement(73268..73270)
                     /locus_tag="sll7077"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     gene            complement(73483..74928)
                     /locus_tag="sll7078"
                     /db_xref="GeneID:2656011"
     CDS             complement(73483..74928)
                     /locus_tag="sll7078"
                     /note="ORF_ID:sll7078"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942366.2"
                     /db_xref="GI:304569842"
                     /db_xref="GeneID:2656011"
                     /translation="MESTFEYSPTVPLLSHLLQGKSLKNPINLGKAIRLWVLLRCIYG
                     HESDPIYCHLNESFTYPEWRDAFFLEQKLFHQNFNRDSLEHSNNQCPCHKSIHQWLFA
                     DYLATDQQQWYEDFRGTCYLAEDADIQGFLDTLSWERSKSNDGKNRLFACVPRTINNN
                     LKELVKLGYLEKIGDKFHKLEEIDFSSLAQSKPVDANFNFPNLSYIRHEDLSEIPDLF
                     RATMGQKQRFFMHVDYVVAKRDLDNDWPYRFQQLWQENEFPILRLEYDSVSLHRLVKR
                     ITYPVCIYYYQRALYLCAYGQDPKDRNKLDWYNYRLDRIKAMANLDWSDPEIPLPLQE
                     QYQQQNLFTADYIDTQLSRGFGFDFYKPLKTMVLRFNQDFSERYIDESFRHETFKKFD
                     TVQQLSTWLGQQQLQPTEKEQLQRAIKQWQAQGKQEPTHSYFRMDYRDQDNNVIMRLR
                     AWGPNVEVLFPLDLRQRMASDVQAMAALYSH"
     misc_feature    complement(73489..74253)
                     /locus_tag="sll7078"
                     /note="CRISPR-associated protein, TIGR03985 family;
                     Region: TIGR03985"
                     /db_xref="CDD:188500"
     gene            75157..76089
                     /locus_tag="slr7080"
                     /db_xref="GeneID:2656094"
     CDS             75157..76089
                     /locus_tag="slr7080"
                     /note="ORF_ID:slr7080"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942368.1"
                     /db_xref="GI:38505748"
                     /db_xref="GeneID:2656094"
                     /translation="MVSYHLHLRENTLYVGFNREQSASGDRLVRDAASQIDQLIRQGQ
                     LTGGELLKVDGPQSVAIAYVLAQRLTPLYGAIAILDPKVCRPGHRVYIVAISRNADYP
                     LGSLIEVPIGGSALLKVAVCGFPQTGKSCLIEGIRQAICSQIGAPYPYVIRACPDGEG
                     AWLHQTQVNNPALAENLRAQNKRDWNATFAETAADWVRSANEAINLIDTGGLPSPENR
                     LIMAEASHAIILYKTVAEREQWLNFCQDLGLPPLAIVESRLGNASDEVNLSTKDQPIT
                     GVVYGLSRGKANLRDKLMIQAIAHRLIDLTSSEK"
     gene            76204..77592
                     /locus_tag="slr7081"
                     /db_xref="GeneID:2656095"
     CDS             76204..77592
                     /locus_tag="slr7081"
                     /note="ORF_ID:slr7081"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942369.1"
                     /db_xref="GI:38505749"
                     /db_xref="GeneID:2656095"
                     /translation="MVSIHITRHAIQQLRKLRSAMNNRVIPDIFEQLSLGMNAGNHIL
                     RHSQCTEYRKRRLEGGGYLRLFFDDHSPSHYKVIAAVLRDDDTYKREFDDLPRDPCYG
                     WNGETGWEWDWYINEGYLYSAQPSDQQIRDTNEAVKTDNYHRNDGNNHPDYHRVPYHS
                     TIDQSAPGTGKTLNAAEKACELAYVGQNVVFLLPEALIDQQVTKYRCIRQSLQEPAGE
                     NLFIGTFHQWLAKAFPQLPFQVASPAKELQVLQEIAQQHRHWQTSGRDPITYRDVLLY
                     QLYVINKNCREDDVFWDNKPRIEELRDIRPQWWQGAWTQEELCRRDYTLQVLQYFQQN
                     PPAPPTPSWGTSIIIDEAQDYLVEEIEIIKHLCHHWQTEAKHPVNLWLLGDINQRIAP
                     VDFTWGGLQLNKTRELQWDNYRTTESILTLANRFQARADASKPADAKWLPKPTDPKFC
                     FEKPGDAVKLLV"
     misc_feature    <76693..>76806
                     /locus_tag="slr7081"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cl17251"
                     /db_xref="CDD:266587"
     gene            77632..78591
                     /locus_tag="slr7082"
                     /db_xref="GeneID:2656096"
     CDS             77632..78591
                     /locus_tag="slr7082"
                     /note="ORF_ID:slr7082"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942370.1"
                     /db_xref="GI:38505750"
                     /db_xref="GeneID:2656096"
                     /translation="MATISQQISEWQEKHSLQWRLAARARLFCSDHYHVSPDRVKFLE
                     FMPVSQAKGREFDSCIAFCLFDLPQNGGRMEAYTKWYTQLTRARSRLLIVTTEAQLAQ
                     MGEEIFENLTITKGEKTVNAVERLNYQNPKEVTDALGWITELTSSLDTSATGRQGLRE
                     IILEGALQSDPILYYDLYYVLKSYDISSQETMAIEADIVNLLFNNAELQAPLKAYFEQ
                     PEVEEVPRLQTLIYRCLGQSWQAAEIAQSRKQSDPGTYQEVMAGIQQDLQHRHLPLEA
                     DRLARFYGLETSTNKFDNASWFKTSDKLIPLLKNWTEEQLKVG"
     misc_feature    <77701..77913
                     /locus_tag="slr7082"
                     /note="UvrD-like helicase C-terminal domain; Region:
                     UvrD_C_2; cl19402"
                     /db_xref="CDD:267755"
     gene            78642..79775
                     /locus_tag="slr7083"
                     /db_xref="GeneID:2656097"
     CDS             78642..79775
                     /locus_tag="slr7083"
                     /note="ORF_ID:slr7083"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942371.1"
                     /db_xref="GI:38505751"
                     /db_xref="GeneID:2656097"
                     /translation="MTSQNFVSDQDTITALQQLTDLIHQGLQQAWDPNIITQAKAEIN
                     QTAEQCKEQFHTIHQDVEDLQGSLLEIDQRSGQLTDSIVTAEKVTEVITKMGGPDQLR
                     QDFDRLEQLRSITGQIGEAQAMAQQLQQQTEQLRTDGDRLGQTLTQLGGADALLAQLA
                     QLEEIASQLAGLDSHIDQVTTAIIDRYLPSFEAGKEQIAQWRSEVKDQLNLTLASLEQ
                     QKQEINGLIADLTTQSGQVSSQLTDLEQQQLKLEPLLTAIAKLADQLGGQDLLQKVAT
                     DLGLLDETIAQQQRELVSLKTDLRAEFQRMFNQELEQFKNEQLQVNQRLLVENRQLKE
                     EITKISQELNYNADQLRRLQAIKCDRPVWTLSNLRRPTPPYLP"
     misc_feature    <79092..>79706
                     /locus_tag="slr7083"
                     /note="Chromosome segregation ATPases [Cell division and
                     chromosome partitioning]; Region: Smc; COG1196"
                     /db_xref="CDD:224117"
     gene            79821..80048
                     /locus_tag="ssr7084"
                     /db_xref="GeneID:2656031"
     CDS             79821..80048
                     /locus_tag="ssr7084"
                     /note="ORF_ID:ssr7084"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942372.1"
                     /db_xref="GI:38505752"
                     /db_xref="GeneID:2656031"
                     /translation="MASLVEIKEDLYVQLQGINVADKHGRDMEIQHYQQLHKCIELIE
                     ELETELVKCELMKGQTFEGVYKETLERPGEV"
     gene            complement(80203..81933)
                     /locus_tag="sll7085"
                     /db_xref="GeneID:2656012"
     CDS             complement(80203..81933)
                     /locus_tag="sll7085"
                     /note="ORF_ID:sll7085"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942373.1"
                     /db_xref="GI:38505753"
                     /db_xref="GeneID:2656012"
                     /translation="MEYLRWMRPADHQYKDATKVQILQKAMENAKNYDARLSVCNQRT
                     KAIAKETFEVTCPWRIRVGGHRGPESILLPAFDALGMPYIPSATLRGVARTQAIREVM
                     QNTGKNWKDAEKDSLIVKHFGALDADKADQAGKVVFLDAYPTSGKCLAVDMANNIWSW
                     EGNHLDYSPNPNPFLSLKEPTFLIGLRLISNCSDQQVLTQVKKWLINGLANGAGSQIN
                     TGYGQLLENPKKLLSKPFLEVEFALEGQLIHGYQKPGEWSWNNNKNEWQMRGSNQAEV
                     RPTAFKSMLRYWFRVFALGVMPPKNTKVLEAKIFGSLDPQSMGIIKVTVLEKEPENEN
                     EQSGTLRLFFTSEVDENQKDNLQNLFSNLIWLMFYLGGIGQGARRPCYYRKGNPKIRG
                     SSFFVQNPSEFSSIPGNIDEFRLRILGKITQLIDLLSLLKTTFNFTERSNNFNHSSHQ
                     WTECADLNMRIFVVPNANQDNAKSYALSKLNQKFHQLDDQIKSLKKEKNFPELKRVYS
                     ELKSLCGGVQKDKILVNGQQKERKVLPSPIWVRSLGPFDVVTIFGATASPRSDYLRSL
                     QGAIQIFPLS"
     misc_feature    complement(81262..>81699)
                     /locus_tag="sll7085"
                     /note="CRISPR/Cas system-associated RAMP superfamily
                     protein Cmr6; Region: Cmr6_III-B; cl18978"
                     /db_xref="CDD:267331"
     misc_feature    complement(80764..81144)
                     /locus_tag="sll7085"
                     /note="CRISPR/Cas system-associated RAMP superfamily
                     protein Cmr1; Region: Cmr1_III-B; cl17436"
                     /db_xref="CDD:247990"
     gene            complement(82196..82591)
                     /locus_tag="sll7086"
                     /db_xref="GeneID:2656013"
     CDS             complement(82196..82591)
                     /locus_tag="sll7086"
                     /note="ORF_ID:sll7086"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942374.1"
                     /db_xref="GI:38505754"
                     /db_xref="GeneID:2656013"
                     /translation="MPNFDPRTINKQAFQSLQALRHQAGQDNALLKEQKNQAMELYTY
                     LSTWGLMRLKAEEVALSQTGKKQVVQRFFNDLGTLSGRNNLADSQGLNTLVALSANEY
                     LGLTGLGIELANEFGFWANAVYHDITGAQ"
     gene            complement(82630..83436)
                     /locus_tag="sll7087"
                     /db_xref="GeneID:2656014"
     CDS             complement(82630..83436)
                     /locus_tag="sll7087"
                     /note="ORF_ID:sll7087"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942375.1"
                     /db_xref="GI:38505755"
                     /db_xref="GeneID:2656014"
                     /translation="MTVLLLSISMNIQHLYLLSPLHTGGTTQEGNLLGIARESHTNFP
                     YIPSSTIRGRLRAAVDDNKRDALFGNDLNSDNGNLTQGSVWVGDGSLLWLPVPSLSHG
                     VIWISCPLLLNRYARVANVAAQPAIVPYLCNFYQANEKVYLKDAIFDHSELNQWSQAE
                     VKKFIPNQSNMTIERALVLPDQHCATVIQMGLWRQVKIKLDQHKTVDGGFRYEEAIPP
                     DTLMYFPWGITAQAKGNQEAGEQFQDLLTVNEIMQIGGQESLGRGFVECF"
     misc_feature    complement(82639..83394)
                     /locus_tag="sll7087"
                     /note="CRISPR/Cas system-associated RAMP superfamily
                     protein Cmr4; Region: Cmr4_III-B; cl17440"
                     /db_xref="CDD:247994"
     gene            83501..83881
                     /locus_tag="slr7088"
                     /db_xref="GeneID:2656098"
     CDS             83501..83881
                     /locus_tag="slr7088"
                     /note="slr7088; ORF_ID:slr7088;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942376.1"
                     /db_xref="GI:38505756"
                     /db_xref="GeneID:2656098"
                     /translation="MDLAVSKIQLSNPSQNHLQALTVEALADSETVHLCIPDHIQIQL
                     QLEIVDQKEVTLADGSRRLIPYVGPIKIKFENRIGFAGALVMGDQVLLGAIPMEDMDL
                     IIIPSERRLAVNPHSPNIATSIAK"
     misc_feature    83522..83833
                     /locus_tag="slr7088"
                     /note="Predicted aspartyl protease [Posttranslational
                     modification, protein turnover, chaperones]; Region:
                     COG5550; cl17622"
                     /db_xref="CDD:248176"
     gene            complement(83905..85017)
                     /locus_tag="sll7089"
                     /db_xref="GeneID:2656015"
     CDS             complement(83905..85017)
                     /locus_tag="sll7089"
                     /note="ORF_ID:sll7089"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942377.1"
                     /db_xref="GI:38505757"
                     /db_xref="GeneID:2656015"
                     /translation="MYWYSLTPLDILLLRDAKPFTPGDRAWAGSIFPPNGHTLAGAVR
                     SLLPQNQTISLIGPLLYHKETLYFPRPLGFVGKTPLLPLPWHDATSPLRSQMLWDKTQ
                     PAPLAPLETVSQTDIKRDEKQARTWLPLDVMMGYLQTGAIKPEDWARPEDEDSQPWTM
                     ESRPHNSIEAGTRQVKESDGYFVENGIRLKENWSLAIAVDPTTHQQLQSLPQPLSMRL
                     GGEGHRVTLVHRPALDQQWQRLQTLSDQNYQQRQKAIAYLMTPGIFERGRDGVSTCRP
                     YPWEWKLTHNQGSFISMATDRAVAISPRIRDRQRNPGHSIPAPQVFAAPPGTVYYLNQ
                     PQGLFADQDNAPKHLQQTRKLGYSHLLWVNLQEVNR"
     misc_feature    complement(83929..85002)
                     /locus_tag="sll7089"
                     /note="CRISPR/Cas system-associated RAMP superfamily
                     protein Cmr3; Region: Cmr3_III-B; cd09748"
                     /db_xref="CDD:187879"
     gene            complement(85199..88138)
                     /locus_tag="sll7090"
                     /db_xref="GeneID:2656016"
     CDS             complement(85199..88138)
                     /locus_tag="sll7090"
                     /note="ORF_ID:sll7090"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942378.1"
                     /db_xref="GI:38505758"
                     /db_xref="GeneID:2656016"
                     /translation="MSEVYWQAKIWGLLHDPALKALHNNSGRGGEGAWQSLGCMQNWV
                     SPKSSTEKKDGELSNSWLDHIGLSDLIASASDRGAIHYIGTPIDYDGKGLELSHLLSG
                     AKLPLKLANHSEIIGQGNRRTYLEQKELELIQQMPAEFLHGTDKAQECFWWLWRCLPE
                     AVAEQFGPESLLMPAETRLPDASIWSHGSMTAALAGALAGYDTNIEDIAKGARNTPKS
                     QAYLAVFTFSPIQELIKASRKIKDFWAGSWILHYLSAKVCWELAQQYGPDCFLYPSLY
                     GQPLIDHWLLEKYGEQGFSQWVPQPGDRQLLTAGFPNVIMLVLPKEKVSAAMQSAKNH
                     LLNAWRNIAHLVFAELQQRHWQKQLNPTDPTWKHWLDAQWQTYWSAMAIGAEGKTLKS
                     VGIPTQTPESKAQRDQWVREQNEAFSASLFAQEELDFIEKSTDLFIQQRNRNYAGSLN
                     VGSWWADIFGQTRFTLSAVKNARNWKIPTAFGPRSTISGLGPVVHPQAPSHQRDWVTE
                     GDTQKYWQRQAGLFDGSEQLNATETVKRGLEKVLPALLGRGAKELKTYYPDLTVGIAG
                     YLKTQPDGLPIFEQACSAISQKILGDRHKVADSVTQDWGIPWVEENMEKKYHPRLLNS
                     GWLVEELEDLDQTELPSYRQALQTEIEKFYPQNNPTSWYVLAAGDGDGMSEWLKGTKM
                     RTYGDYFPQVLTVPEDLQPTFQPFSEQPKRMGPATHNALSRALLDFSNQLVPYLTEQR
                     YAGRLIYSGGDDVLAYTNLWEWDQWLWDIRQAFRGDRDEHREFDSTGHYWHSKTAHKN
                     LPQRPLFTMGDGATISFGITIAHHSVPLAIALEHLWEAEEEAKEHEYGEGEDKKSKDA
                     VQVRVIYGNGNVLTATSKFEVFKTWKDLLDIETIDASTYETAATVLEQHPIPVREAIM
                     PWVNVLVERRDALDKDQQSTLRSRLACFLIQLWQTTSQKNWEKEAKNWLKVAAFMKRN
                     RYIKFPN"
     misc_feature    complement(85643..87478)
                     /locus_tag="sll7090"
                     /note="CRISPR/Cas system-associated protein Cas10; Region:
                     Cas10_III; cd09679"
                     /db_xref="CDD:187810"
     misc_feature    complement(85643..87478)
                     /locus_tag="sll7090"
                     /note="CRISPR-associated protein Cas10/Cmr2, subtype
                     III-B; Region: cas_TM1794_Cmr2; TIGR02577"
                     /db_xref="CDD:233935"
     gene            88262..88630
                     /locus_tag="slr7091"
                     /db_xref="GeneID:2656099"
     CDS             88262..88630
                     /locus_tag="slr7091"
                     /note="slr7091; ORF_ID:slr7091;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942379.1"
                     /db_xref="GI:38505759"
                     /db_xref="GeneID:2656099"
                     /translation="MFKKLHTIFVVGGVKISATFLTVARSMYSPSRLLFARNLVLAIA
                     NGLITLVILLIAPLGLAAVIINTLLVACSTFMLSVFGDVVVRWLLQGTNPHGLPTNAN
                     PNVGITPQTSHQPTQRPDRW"
     gene            88627..89616
                     /locus_tag="slr7092"
                     /db_xref="GeneID:2656100"
     CDS             88627..89616
                     /locus_tag="slr7092"
                     /note="slr7092; ORF_ID:slr7092;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942380.1"
                     /db_xref="GI:38505760"
                     /db_xref="GeneID:2656100"
                     /translation="MKTLYVSQSDCYVSLRKEFLLVKRQDRILAEVQLPFLEQVLIFG
                     KAQVTTQAIHACLSRNIPILYLSRMGFCYGRIIAIERGYRHLSRYQQELGWQQRLITA
                     RTIVAAKIKNARVFLQRQHRKHPTPSLQLAIDGLKHFVELTVKADKLEQLLGYEGTAA
                     NLYFQAWADCIENSNFIFFGRSRRPPGNPVNAMLSFGYQVLWNHLLTLIELQGLDPYQ
                     ACLHQGSERHAALASDLIEEFRVPIVDSLVLYMINRRLIDVGEDFVFQNGGCFLNSSG
                     RRKWLGAFVGRMEEFLSFDQGDFPRWHCLIDQVKKYKAFIYSPSNSYSPFLIR"
     misc_feature    88630..89574
                     /locus_tag="slr7092"
                     /note="CRISPR/Cas system-associated protein Cas1; Region:
                     Cas1_I-II-III; cd09634"
                     /db_xref="CDD:187766"
     gene            89620..89898
                     /locus_tag="ssr7093"
                     /db_xref="GeneID:2656032"
     CDS             89620..89898
                     /locus_tag="ssr7093"
                     /note="ssr7093; ORF_ID:ssr7093;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942381.1"
                     /db_xref="GI:38505761"
                     /db_xref="GeneID:2656032"
                     /translation="MFLYVIAYDIPDDRRRKKMADLLEGYGQRVQYSVFECTLSKSKF
                     NELQKRLRKIYQSEEDSLRFYPLSGHTLTQVDIWGEPPLTKPPGSVIV"
     misc_feature    89629..89865
                     /locus_tag="ssr7093"
                     /note="CRISPR/Cas system-associated protein Cas2; Region:
                     Cas2_I_II_III; cd09725"
                     /db_xref="CDD:187856"
     gene            93265..93654
                     /locus_tag="slr7094"
                     /db_xref="GeneID:2656101"
     CDS             93265..93654
                     /locus_tag="slr7094"
                     /note="slr7094; ORF_ID:slr7094;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942382.1"
                     /db_xref="GI:38505762"
                     /db_xref="GeneID:2656101"
                     /translation="MNSIFTINPYWTGSTWAFDAAEVGLLGEPFVSGADAILSAIVKR
                     ELALETEQGSQFELIFSAEGFPSYHACFERQEPEYGGYWYKVVDAGNDYQDLDFGDRG
                     WLCPATLHFFPGGHPEKLYIQVRAINK"
     gene            93673..94188
                     /locus_tag="slr7095"
                     /db_xref="GeneID:2656102"
     CDS             93673..94188
                     /locus_tag="slr7095"
                     /note="slr7095; ORF_ID:slr7095;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942383.1"
                     /db_xref="GI:38505763"
                     /db_xref="GeneID:2656102"
                     /translation="MTSVFHVLIGCPASGKSTLAAHLHQAIPQSQIISTDQIREDLFG
                     DAATQGVWALINNEISTQITQAIAAGKQIIYDATNAEKAWRSELLGSLKKLDDLKIIG
                     WYLQTPLEVCYQRNKNRLRQVPEDVIETYAIALEQSPPSKDEGFTELHRIPYNQLENI
                     DFSQLRSQWKN"
     misc_feature    93688..94068
                     /locus_tag="slr7095"
                     /note="AAA domain; Region: AAA_33; pfam13671"
                     /db_xref="CDD:257977"
     misc_feature    93691..94185
                     /locus_tag="slr7095"
                     /note="AAA domain; Region: AAA_17; cl19128"
                     /db_xref="CDD:267481"
     gene            94198..94611
                     /locus_tag="slr7096"
                     /db_xref="GeneID:2656103"
     CDS             94198..94611
                     /locus_tag="slr7096"
                     /note="slr7096; ORF_ID:slr7096;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942384.1"
                     /db_xref="GI:38505764"
                     /db_xref="GeneID:2656103"
                     /translation="MRYKNNCRINRIGKDKMTTCINNSLFTIEPYWVGRTWAFDAPNL
                     GVMAEPFVAGTNIVLTQLAKTRLGIEPSDGAKFQLIFSAQKFPGLHLSFRRQEPEFDG
                     YWYISESQDWAWFSSAMTSFFSNGHPEELHLQVLR"
     gene            94718..95344
                     /locus_tag="slr7097"
                     /db_xref="GeneID:2656039"
     CDS             94718..95344
                     /locus_tag="slr7097"
                     /note="slr7097; ORF_ID:slr7097;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942385.1"
                     /db_xref="GI:38505765"
                     /db_xref="GeneID:2656039"
                     /translation="MIKQLSLFDIYPNGSPEEIIISDGHLQLYHSIFSDVEASRYYDR
                     LEKEICWQQDSIILFGKSQPLPRLTAWYGDPERSYTYSGIAMEPTPWIPLLQTIKTKA
                     ETLAKATFNSVLLNFYRTGTDGVSWHADDEPELKKNYPIASVSFGGTRRFLLKHKTDP
                     TIEKVELILTSGSILLMLGTTQEYWLHQVPKTKKFVEPRINLTFRFIQ"
     misc_feature    94793..95332
                     /locus_tag="slr7097"
                     /note="2OG-Fe(II) oxygenase superfamily; Region:
                     2OG-FeII_Oxy_2; pfam13532"
                     /db_xref="CDD:257851"
     gene            95369..96241
                     /locus_tag="slr7098"
                     /db_xref="GeneID:2656040"
     CDS             95369..96241
                     /locus_tag="slr7098"
                     /note="ORF_ID:slr7098"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942386.1"
                     /db_xref="GI:38505766"
                     /db_xref="GeneID:2656040"
                     /translation="MYDALLPIVMDSYGQNSRCMPSFLSGLQPAVKELRQRYRTNNVQ
                     VDYGQPQIQAAYLLTYYPYYVQQTHHNLSLASQHHHVAHLLRQRNLQVTLLGSGPMPE
                     AAALATYRQKLQFASSLKAISYDLNVHQWRSACQITARLMADLAPNITYKYEGHPLNL
                     AQHHALFPAQWNIQNSQLIIIQNCLNEIYRANLGAFKQNMQFLMNNMAPGSALLLSDL
                     DYHQTSRCLQLLKQLADATPGITTVFDHGDRLLKYENSFSLPFSIRRHLLTGQNGLIP
                     KKWIRQFSLCLLKQ"
     gene            96348..96938
                     /locus_tag="slr7099"
                     /db_xref="GeneID:2656041"
     CDS             96348..96938
                     /locus_tag="slr7099"
                     /note="ORF_ID:slr7099"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942387.1"
                     /db_xref="GI:38505767"
                     /db_xref="GeneID:2656041"
                     /translation="MTDFKALIESKLSSLLGKEIKVTDKAKECLQRLAESEQNFYSWH
                     LKLLSIIFDVSPEIWDILKEVDEGFNNFNYAVLDAQVRDYFVKNESTPTVICDQISDF
                     DDFLATLFFKAANTGGLGVVYTSPPPSKAEIIQDTITIDHLVGMLFYVLYAGYYESDL
                     AVALLIMNNFDIAFGRNNRRYLDELENIMTKTELRS"
     gene            97173..98522
                     /locus_tag="slr7100"
                     /db_xref="GeneID:2656042"
     CDS             97173..98522
                     /locus_tag="slr7100"
                     /note="ORF_ID:slr7100"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942388.1"
                     /db_xref="GI:38505768"
                     /db_xref="GeneID:2656042"
                     /translation="MTINTDAILITDGDRQQVRDLIQWLKTNRPDLVEKARNPDILQQ
                     EQDHAQTFRGKIEQLQKLVPGFTYVHPDSLHGHYHVTPDLKKSAKATAVVMTTSNWID
                     TVGNLPVFFFAFKSLTFLPALGMAVLLSIPVLAASNALSTAVAHGHKGRWKLAIAALV
                     FGLIPLNILQTVTTGIGMEVINNQSALAQVAAGDALDNIVEAKQQNLQFAETNLHPDI
                     AKCEEGRQELEAMPRRNAMEEKAFQSRYVRLYGTFSSQSQPMTVPIEQLPLCVRANRI
                     QAEQQDQLQQLGQQLQDFKLERQTLGNDLMFLKQMAPQQYGKTFVEVRPFWGLGGGEP
                     TVEVRNGLELVSLGVNSFQTKFATGQWDQLGISLFFVGISAITSAASVAMGISFPLGK
                     DTQRSYDESHKEKVNRFFQRARMTLTQMHDEQQQELLEPGADDDNLLEDDYEFGRYN"
     gene            98473..99015
                     /locus_tag="slr7101"
                     /db_xref="GeneID:2656043"
     CDS             98473..99015
                     /locus_tag="slr7101"
                     /note="ORF_ID:slr7101"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942389.1"
                     /db_xref="GI:38505769"
                     /db_xref="GeneID:2656043"
                     /translation="MMIICWRMTMSLADITDFSEALALLGLYEREVMTTGVMEYVVPP
                     KVPAKPAPVPDSVASPSPPNEQASSHPPANIPQDTPALPEATPTSSPVNNTTINEGII
                     IVNGVHDSEDGNEPPSQIQKVDASQETLPLPTPGPSELELLLEQQQVEKRLFYLFVEE
                     IEKTGDLGKLPVALQPTGKS"
     gene            99125..100141
                     /locus_tag="slr7102"
                     /db_xref="GeneID:2656044"
     CDS             99125..100141
                     /locus_tag="slr7102"
                     /note="slr7102; ORF_ID:slr7102;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942390.1"
                     /db_xref="GI:38505770"
                     /db_xref="GeneID:2656044"
                     /translation="MKKLLKSLKWPALFVGIILLLAACHRAPTRTAKETDKMKGVWLT
                     DVGTMGLTYSTLLDETLHHISKSDYDRVYFSVYGLRGQLYPTRQRGDLIPKLPFPNAV
                     GSMARESRRQGLKPYAWFEYGLMLPQFDPVAKNNPDWLLTMANGEQVIENHGVPMVWL
                     DPSNPEVEAYILAHIDDILKEKSLAGIQLDDHWAVPRQFGDYRRSLTALTTKVHEHIK
                     TKNPEFELSLSPNPYQFSLNEYNQDWLRWVKQGIVDEVVVQIYRSSPAEVQQAVNNSG
                     IYTASRYVPVGVGLYTGRKIKPFNLQSIKDQINAVEKQNLGHSLFVWEFMVLRVINIH
                     LNIL"
     misc_feature    99125..100096
                     /locus_tag="slr7102"
                     /note="Alpha amylase catalytic domain family; Region:
                     AmyAc_family; cl07893"
                     /db_xref="CDD:263509"
     gene            complement(100246..100632)
                     /locus_tag="sll7103"
                     /db_xref="GeneID:2655998"
     CDS             complement(100246..100632)
                     /locus_tag="sll7103"
                     /note="ORF_ID:sll7103"
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease V alpha chain"
                     /protein_id="NP_942391.1"
                     /db_xref="GI:38505771"
                     /db_xref="GeneID:2655998"
                     /translation="MQLKNDYHREVFNGDQGTITAIEREEQILTITYDDRPVDYDFAD
                     LNEIDLAWAISIHKSQGSEYPVVILPLYMQHFLLLSRNLFYTGLTRAKRLALVIGSQK
                     AIGYAVRQQKERYRYTRLADRLVISP"
     misc_feature    complement(100339..100632)
                     /locus_tag="sll7103"
                     /note="UvrD-like helicase C-terminal domain; Region:
                     UvrD_C_2; pfam13538"
                     /db_xref="CDD:257857"
     gene            100781..101140
                     /locus_tag="slr7104"
                     /db_xref="GeneID:2656045"
     CDS             100781..101140
                     /locus_tag="slr7104"
                     /note="ORF_ID:slr7104"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="NP_942392.1"
                     /db_xref="GI:38505772"
                     /db_xref="GeneID:2656045"
                     /translation="MAYSLDLRQRVVAYIEAGGKITEASKIYKIGKASIYRWLNRVDL
                     SPTKVERRHRKLDWEALKKDVEENPDARLIDRAKKFGVRPSAVYYALKKMKINRKKKN
                     YVIEKETGRNELSTIEC"
     misc_feature    100781..101137
                     /locus_tag="slr7104"
                     /note="Transposase; Region: HTH_Tnp_IS630; pfam01710"
                     /db_xref="CDD:145062"
     misc_feature    100802..>100903
                     /locus_tag="slr7104"
                     /note="Helix-turn-helix domain; Region: HTH_28; pfam13518"
                     /db_xref="CDD:222191"
     gene            101134..101628
                     /locus_tag="slr7105"
                     /db_xref="GeneID:2656046"
     CDS             101134..101628
                     /locus_tag="slr7105"
                     /note="ORF_ID:slr7105"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="NP_942393.1"
                     /db_xref="GI:38505773"
                     /db_xref="GeneID:2656046"
                     /translation="MLRELIKLYGSQAIVYIDESGFEAIQACIYAWSKKGKKVYGDRQ
                     GKRGVRENLVAGRRKGKKDLIAPMVFTGSLNAEGFEGWLKLYLLPSLDIPSILIMDNA
                     PIHRKTAIKELAKEAGHEVLFLPKYSPDLNDIEHDFSALKRARMYAPIDTSLDEIIRS
                     YCGV"
     misc_feature    101173..101589
                     /locus_tag="slr7105"
                     /note="DDE superfamily endonuclease; Region: DDE_3;
                     pfam13358"
                     /db_xref="CDD:222070"
     misc_feature    101314..101619
                     /locus_tag="slr7105"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3335"
                     /db_xref="CDD:225872"
CONTIG      join(AP004311.1:1..103307)
//
DBGET integrated database retrieval system