GenomeNet

Database: RefSeq
Entry: NC_005231
LinkDB: NC_005231
Original site: NC_005231 
LOCUS       NC_005231              44343 bp    DNA     circular CON 15-MAY-2014
DEFINITION  Synechocystis sp. PCC 6803 plasmid pSYSG, complete sequence.
ACCESSION   NC_005231
VERSION     NC_005231.1  GI:38505775
DBLINK      Project: 57659
            BioProject: PRJNA57659
KEYWORDS    RefSeq.
SOURCE      Synechocystis sp. PCC 6803 (Synechocystis PCC6803)
  ORGANISM  Synechocystis sp. PCC 6803
            Bacteria; Cyanobacteria; Oscillatoriophycideae; Chroococcales;
            Synechocystis.
REFERENCE   1
  AUTHORS   Kaneko,T., Nakamura,Y., Sasamoto,S., Watanabe,A., Kohara,M.,
            Matsumoto,M., Shimpo,S., Yamada,M. and Tabata,S.
  TITLE     Structural analysis of four large plasmids harboring in a
            unicellular cyanobacterium, Synechocystis sp. PCC 6803
  JOURNAL   DNA Res. 10 (5), 221-228 (2003)
   PUBMED   14686584
REFERENCE   2  (bases 1 to 44343)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (25-NOV-2003) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 44343)
  AUTHORS   Kaneko,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-NOV-2001) Kazusa DNA Research Institute, The First
            Laboratory for Plant Gene Research; 2-6-7 Kazusa-kamatari,
            Kisarazu, Chiba 292-0818, Japan
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AP004312.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..44343
                     /organism="Synechocystis sp. PCC 6803"
                     /mol_type="genomic DNA"
                     /strain="PCC 6803"
                     /db_xref="taxon:1148"
                     /plasmid="pSYSG"
                     /synonym="Synechocystis PCC6803"
     gene            complement(join(43288..44343,1..1914))
                     /locus_tag="sll8049"
                     /db_xref="GeneID:2656122"
     CDS             complement(join(43288..44343,1..1914))
                     /locus_tag="sll8049"
                     /note="ORF_ID:sll8049"
                     /codon_start=1
                     /transl_table=11
                     /product="type I site-specific deoxyribonuclease chain R"
                     /protein_id="NP_942394.1"
                     /db_xref="GI:38505824"
                     /db_xref="REBASE:Ssp6803ORF8009P"
                     /db_xref="GeneID:2656122"
                     /translation="MKTTDTSEKGLETIIVNSLVNEAGYVLGDPKDYDREHAVDLVKL
                     LEFLETTQPDTYGVLGINREGPKRTQFLHRLQGEIAKRGVVDALQTGIRHGPAHVELF
                     YGTPTPGNVKAVERFSNNIFSVTRQLRYSSVETALSLDMAVFINGLPIATFELKNRLT
                     KQTVLDAVEQYQRDRDPKELLLQFGRCAVHFAVDDHEVRFCTHLTGKGSWFLPFNKGH
                     NDGAGNPPNPNGIATDYLWKEVLTKEGLTDILENYAQIVEEKDEKTCRKKLKQVFPRY
                     HQLTVVRQLLATAKQDGVGKRYLIQHSAGSGKSNSIAWLAHQLVGLEQDGKALFDSII
                     VVTDRQVLDRQIRNTIKQFAQVSATVGHAERSGDLRQFIKDGKKVIITTVQKFPFILN
                     EIGDEHRQSKFAIVIDEAHSSQGGKTTAAMNRVLEGTASYNVANEEEEETTEDKINRI
                     LEGRKMVTNASYFAFTATPKNKTLEIFGQPAPQPDGTVKHYPFHSYTMKQAIQEGFIL
                     DVLKSYTPVESYYRLAKTVEDDPLFDAKKAQKKLRRYVESHQHAIREKTEIMVDHFHT
                     QVINHGKIGGQARAMVITNGIGQAIQYFYAFKDYLRERKSPYQAIVAFSGEYDYGGQK
                     VTEATLNGFPSSQITDKIEEDPYRFLIVADKYQTGYDQPLLHTMYVDKALSGIKAVQT
                     LSRLNRAHPQKYDTFVLDFYNDSGTIQSSFDPYYRTTILSNETDPNKLHDLKADLDSH
                     QVYTQEQIQYLVELYLNGADRDRLDPVLDACVAAYNADLDEDGQVDFKGKAKAFVRTY
                     GFLASILPYSNADWEKLSIFLNFLIPKLPAPKEEDLSRGILEAIDMDSYRVELKTSLK
                     IDLADEDAEIKPVPTAGGGSKPEADLDQLSNIIKAFNDQFGNINWKDNDKIRRVIAEE
                     IPAKVAADVAYQNAMRNNDKRTARIEHDAALQRVMIELLADHTELFKQFSDNQSFKKW
                     LGDTIFGATYRENWEAG"
     misc_feature    complement(join(43303..44343,1..1899))
                     /locus_tag="sll8049"
                     /note="Type I site-specific restriction-modification
                     system, R (restriction) subunit and related helicases
                     [Defense mechanisms]; Region: COG0610"
                     /db_xref="CDD:223683"
     misc_feature    complement(1294..>1572)
                     /locus_tag="sll8049"
                     /note="Type I restriction enzyme R protein N terminus
                     (HSDR_N); Region: HSDR_N; pfam04313"
                     /db_xref="CDD:252519"
     misc_feature    complement(<682..1020)
                     /locus_tag="sll8049"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    complement(988..1002)
                     /locus_tag="sll8049"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    complement(682..693)
                     /locus_tag="sll8049"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     gene            complement(1920..2966)
                     /locus_tag="sll8001"
                     /db_xref="GeneID:2656138"
     CDS             complement(1920..2966)
                     /locus_tag="sll8001"
                     /note="sll8001; ORF_ID:sll8001;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942395.1"
                     /db_xref="GI:38505776"
                     /db_xref="GeneID:2656138"
                     /translation="MFECKSGNILTEDTEALVNTVNCVGVMGRGIALQFKKAFPENFK
                     AYAQACKEEKVKPGEMFVFQTGQLVNPRFIINFPTKRHWRTHSRIDDIENGLKALKCT
                     IQKYKIRSIAIPPLGCGLGGLDWAEVKTRIEVILKPLDNVQIILYEPHGELSQAKTVQ
                     SLRAPKMTPGRAVLVELVSRYLQGLLDPFITLLEIHKLMYFMQESGEFLQLRYAKAPY
                     GPYAENLRHVLNVIEGHLITGYADGGDQPNKPIALLPNAIEKATTFLQDYPETHTRFE
                     KVTDLVEGFESPFGLELLSTVHWIVKNEPVNSLSDVIDRTYAWNQRKQQFTQRQIELA
                     VNVLNKKGWINRPY"
     misc_feature    complement(2550..2966)
                     /locus_tag="sll8001"
                     /note="Macro domain, Poa1p_like family. The macro domain
                     is a high-affinity ADP-ribose binding module found in a
                     variety of proteins as a stand-alone domain or in
                     combination with other domains like in histone macroH2A
                     and some PARPs (poly ADP-ribose...; Region:
                     Macro_Poa1p_like; cd02901"
                     /db_xref="CDD:239230"
     misc_feature    complement(order(2604..2612,2616..2618,2871..2876,
                     2880..2882,2901..2903,2940..2945))
                     /locus_tag="sll8001"
                     /note="ADP-ribose binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239230"
     gene            complement(2983..3621)
                     /locus_tag="sll8002"
                     /db_xref="GeneID:2656139"
     CDS             complement(2983..3621)
                     /locus_tag="sll8002"
                     /note="sll8002; ORF_ID:sll8002;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942396.1"
                     /db_xref="GI:38505777"
                     /db_xref="GeneID:2656139"
                     /translation="MTVPAQPKIYHIVHVDRLPSIIADGCLWCDAAISQRNPAGTTIG
                     MNKIKQRRLKELTLTSHPSLYVGQCVPFYFCPRSIMLFLIHKKNTELTYQGGQEPIIH
                     LEGDLIQAVNWADQNNLRWAFTLSNAGSSYFEDRNSLAQLHEIDWAAVQATNWQTCKE
                     GKQAEFLVESTFPWHLVERIGVKSRVIYDQVIKALPTGGHHPQVEVRPDWYY"
     misc_feature    complement(2986..3594)
                     /locus_tag="sll8002"
                     /note="Domain of unknown function (DUF4433); Region:
                     DUF4433; pfam14487"
                     /db_xref="CDD:258627"
     gene            complement(3660..3839)
                     /locus_tag="ssl8003"
                     /db_xref="GeneID:2656118"
     CDS             complement(3660..3839)
                     /locus_tag="ssl8003"
                     /note="ORF_ID:ssl8003"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942397.1"
                     /db_xref="GI:38505778"
                     /db_xref="GeneID:2656118"
                     /translation="MTNQQGNVNARNREEDPDILGSEKALRRAAQRARERAKQAGIGV
                     IILKDGEIVEELPDS"
     gene            complement(3836..4393)
                     /locus_tag="sll8004"
                     /db_xref="GeneID:2656111"
     CDS             complement(3836..4393)
                     /locus_tag="sll8004"
                     /note="sll8004; ORF_ID:sll8004;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942398.1"
                     /db_xref="GI:38505779"
                     /db_xref="GeneID:2656111"
                     /translation="MWNGREYMSEPASPEKKVIIIAGPNGAGKTTFAEEFLPQEAQCL
                     TFINADLIAAGLAPFEPEQAAFRAGRLMLEEIYNHAQRGQNFAFETTLSGRSYARLIP
                     TWQAQSYIVKLFFLQLLSPELAIARVAQRVRAGGHHVPEAIIRRRFAAGLHNLETLYK
                     LIVDEWVCYDNSGNEPVLINKGGKL"
     misc_feature    complement(3857..4348)
                     /locus_tag="sll8004"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4185"
                     /db_xref="CDD:226648"
     misc_feature    complement(3956..4342)
                     /locus_tag="sll8004"
                     /note="AAA domain; Region: AAA_33; pfam13671"
                     /db_xref="CDD:257977"
     gene            complement(4365..4655)
                     /locus_tag="ssl8005"
                     /db_xref="GeneID:2656119"
     CDS             complement(4365..4655)
                     /locus_tag="ssl8005"
                     /note="ssl8005; ORF_ID:ssl8005;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942399.1"
                     /db_xref="GI:38505780"
                     /db_xref="GeneID:2656119"
                     /translation="MKRQSVLQLLSQSKADLQARFGVTRLALFGSTARDEAGPHSDVD
                     ILVGFDGPATSHRYFGVQFYLEDLLGCAVDLVTEKALRPELHPYVERERIYV"
     misc_feature    complement(4368..4592)
                     /locus_tag="ssl8005"
                     /note="Nucleotidyltransferase (NT) domain of
                     Staphylococcus aureus kanamycin nucleotidyltransferase,
                     and similar proteins; Region: NT_KNTase_like; cd05403"
                     /db_xref="CDD:143393"
     misc_feature    complement(order(4434..4436,4440..4442,4524..4526,
                     4530..4535,4554..4556,4563..4571))
                     /locus_tag="ssl8005"
                     /note="active site"
                     /db_xref="CDD:143393"
     misc_feature    complement(order(4524..4526,4530..4535,4554..4556,
                     4563..4571))
                     /locus_tag="ssl8005"
                     /note="NTP binding site [chemical binding]; other site"
                     /db_xref="CDD:143393"
     misc_feature    complement(order(4434..4436,4524..4526,4530..4532))
                     /locus_tag="ssl8005"
                     /note="metal binding triad [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143393"
     misc_feature    complement(order(4434..4436,4440..4442))
                     /locus_tag="ssl8005"
                     /note="antibiotic binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:143393"
     gene            complement(4652..6046)
                     /locus_tag="sll8006"
                     /db_xref="GeneID:2656112"
     CDS             complement(4652..6046)
                     /locus_tag="sll8006"
                     /note="ORF_ID:sll8006"
                     /codon_start=1
                     /transl_table=11
                     /product="type I restriction-modification system S
                     subunit"
                     /protein_id="NP_942400.1"
                     /db_xref="GI:38505781"
                     /db_xref="GeneID:2656112"
                     /translation="MKLKPYPEYKDSGVSWLGQIPAHWDIKPGFAFLSERKEKNTGMK
                     ESTVLSLSYGQIVVKPPEKLHGLVPESFETYQIAEPGNIIIRGTDLQNDKVSLRVGKV
                     RNRGIITSAYLCLETKEKFNPDYAHLLLHGYDLMKIYYGMGSGLRQNLSFSDFKRLPL
                     LAPPESEQSKINKYLQSIQVQINKFIRNKRRLIELLKEQKQNIINQAVTRGLDPNVKL
                     KPSGVKWIGDIPEYWSFLKLKRIACVKTGYAFKSDHYKSVGIPLIRIGDLKHSGLVDI
                     KQAVKLQESDLTHFSCFKIQYGDLLMAMTGATIGKVAKYQHQTEALLNQRVCSFRSFE
                     SKCFQDYLLFILSSEVYLKQVTIFCYGGAQPNISDSTLMSFKIPVPPISEQQAILSYV
                     QEQTKTTDSAVSRAEREIELIQEYYTRLMSDVVTGQVDVRDIEVPEITEEDLLTLEDK
                     SEVVDDDLVQEEDE"
     misc_feature    complement(4766..5881)
                     /locus_tag="sll8006"
                     /note="Restriction endonuclease S subunits [Defense
                     mechanisms]; Region: HsdS; COG0732"
                     /db_xref="CDD:223804"
     misc_feature    complement(5456..>5710)
                     /locus_tag="sll8006"
                     /note="Type I restriction modification DNA specificity
                     domain; Region: Methylase_S; pfam01420"
                     /db_xref="CDD:250605"
     misc_feature    complement(4847..5359)
                     /locus_tag="sll8006"
                     /note="Type I restriction modification DNA specificity
                     domain; Region: Methylase_S; pfam01420"
                     /db_xref="CDD:250605"
     gene            complement(6043..6393)
                     /locus_tag="sll8007"
                     /db_xref="GeneID:2656113"
     CDS             complement(6043..6393)
                     /locus_tag="sll8007"
                     /note="ORF_ID:sll8007"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942401.1"
                     /db_xref="GI:38505782"
                     /db_xref="GeneID:2656113"
                     /translation="MRILLDECAPRPLKRELADYEIRTVTEMGWSGKKNGALLRLMNQ
                     EGFTVLLTTDQNLRYQQNLEQMDVAVIVLIAPSNRLADLVPLIPGVRDVLRTITSGQV
                     VEVGAEQNVGEVER"
     gene            complement(6377..6601)
                     /locus_tag="ssl8008"
                     /db_xref="GeneID:2656120"
     CDS             complement(6377..6601)
                     /locus_tag="ssl8008"
                     /note="ssl8008; ORF_ID:ssl8008;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942402.1"
                     /db_xref="GI:38505783"
                     /db_xref="GeneID:2656120"
                     /translation="MVTTARVMHSDPDILGGVPVFVGTRVPIKTLLDYLEAGDPLDEF
                     LDHFPSVQRQQAIAILELAKQMLTAYANPA"
     misc_feature    complement(6413..6577)
                     /locus_tag="ssl8008"
                     /note="Protein of unknown function (DUF433); Region:
                     DUF433; pfam04255"
                     /db_xref="CDD:252484"
     gene            complement(6652..8151)
                     /locus_tag="sll8009"
                     /db_xref="GeneID:2656140"
     CDS             complement(6652..8151)
                     /locus_tag="sll8009"
                     /note="ORF_ID:sll8009"
                     /codon_start=1
                     /transl_table=11
                     /product="type I restriction-modification system M
                     subunit"
                     /protein_id="NP_942403.1"
                     /db_xref="GI:38505784"
                     /db_xref="GeneID:2656140"
                     /translation="MQDIDGNEVLSALDNHSMGTIFEELIRRFNEENNDEAGEHFTPR
                     DVVKLMADLIFLSIGDLIESGTYLVYDGACGTGGMLTVAEERLAELAQNQGKEVSIHL
                     FGQEVQPETYAISKADLLLKGEGAEAENMKYGSTLSSDAFPSQEFDFMLSNPPYGKSW
                     KTDLERLGGKGDIKDPRFVTRHGDEADYKMITRSSDGQLMFLVNKLAKMKHNTRLGSR
                     IAEVHNGSSLFTGDAGQGESNIRRWIIENDWLETIIALPENIFYNTGIATYIWLLSNR
                     KNEERRGKVQLIDGTEWYVPLRRNLGKKNCELSEEQIQTIVDLVVNPRETEKSKIFPN
                     QAFGYWKVTVDRPLRVEGADPQRVYKAAEIKAFKSEGRVTEEGVPIIKKIHKKGTRPD
                     PIHGLFEVEIGGKPCVVEYEPDSNLRDSEQIPLLEDGGIEAFFRREVLPYTPDAWIEA
                     SKTQIGYEVSFTRHFYKPVPMRTLDEIKADIYALEQETEGLLEQIVGNA"
     misc_feature    complement(7192..>8124)
                     /locus_tag="sll8009"
                     /note="Type I restriction-modification system
                     methyltransferase subunit [Defense mechanisms]; Region:
                     HsdM; COG0286"
                     /db_xref="CDD:223363"
     misc_feature    complement(<7663..7947)
                     /locus_tag="sll8009"
                     /note="Methyltransferase domain; Region: Methyltransf_26;
                     pfam13659"
                     /db_xref="CDD:257966"
     gene            complement(8440..8619)
                     /locus_tag="ssl8010"
                     /db_xref="GeneID:2656121"
     CDS             complement(8440..8619)
                     /locus_tag="ssl8010"
                     /note="ORF_ID:ssl8010"
                     /codon_start=1
                     /transl_table=11
                     /product="type I restriction-modification system M
                     subunit"
                     /protein_id="NP_942404.1"
                     /db_xref="GI:38505785"
                     /db_xref="GeneID:2656121"
                     /translation="MNPVSHNNIVNFIWGIADDVLRDVYVRGKYRDVILPMTVIRRLD
                     AVLEPSKEKVLTMKG"
     misc_feature    complement(<8455..8604)
                     /locus_tag="ssl8010"
                     /note="Type I restriction-modification system
                     methyltransferase subunit [Defense mechanisms]; Region:
                     HsdM; COG0286"
                     /db_xref="CDD:223363"
     misc_feature    complement(<8443..8595)
                     /locus_tag="ssl8010"
                     /note="HsdM N-terminal domain; Region: HsdM_N; pfam12161"
                     /db_xref="CDD:256881"
     gene            complement(8821..9195)
                     /locus_tag="sll8011"
                     /db_xref="GeneID:2656141"
     CDS             complement(8821..9195)
                     /locus_tag="sll8011"
                     /note="ORF_ID:sll8011"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942405.1"
                     /db_xref="GI:38505786"
                     /db_xref="GeneID:2656141"
                     /translation="MLGFLLDEHISPVVAQQVISKAPDIEIYPLLTWQGGLYLGFPDE
                     VILEAATTAQLVLVTYDQKTIPPILWTWGEQGQSHSGIIFVDYQSMPPQDFGSLVQAL
                     LKLWKDERERGWTDRLLYLKCS"
     gene            complement(9205..9621)
                     /locus_tag="sll8012"
                     /db_xref="GeneID:2656142"
     CDS             complement(9205..9621)
                     /locus_tag="sll8012"
                     /note="ORF_ID:sll8012"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942406.1"
                     /db_xref="GI:38505787"
                     /db_xref="GeneID:2656142"
                     /translation="MSIVVSTRLPDLTHERLQRFARCLGKTPSETTALLVEESLRQQD
                     FPYIEFRQTPLGRHAHLKNSTLAVWEVVRIAQGYALDPEKTAQHFQRPLPWVKSALLY
                     AEAYPEEINIAITDAGAVNETTLTRLLPQLEVQGQS"
     misc_feature    complement(9313..>9432)
                     /locus_tag="sll8012"
                     /note="Aldo-keto reductases (AKRs) are a superfamily of
                     soluble NAD(P)(H) oxidoreductases whose chief purpose is
                     to reduce aldehydes and ketones to primary and secondary
                     alcohols. AKRs are present in all phyla and are of
                     importance to both health and industrial...; Region:
                     Aldo_ket_red; cl00470"
                     /db_xref="CDD:260445"
     gene            9713..9940
                     /locus_tag="ssr8013"
                     /db_xref="GeneID:2656151"
     CDS             9713..9940
                     /locus_tag="ssr8013"
                     /note="ssr8013; ORF_ID:ssr8013;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942407.1"
                     /db_xref="GI:38505788"
                     /db_xref="GeneID:2656151"
                     /translation="MTAQEKLYQLIQTLPEKEVSEILNFAESLWPKVSSPKIPAGTLT
                     GLRGIAKPTGPVPSDAELQRQYTDYLKEKYL"
     misc_feature    9719..9913
                     /locus_tag="ssr8013"
                     /note="Protein of unknown function (DUF2281); Region:
                     DUF2281; pfam10047"
                     /db_xref="CDD:255720"
     gene            9948..10373
                     /locus_tag="slr8014"
                     /db_xref="GeneID:2656123"
     CDS             9948..10373
                     /locus_tag="slr8014"
                     /note="slr8014; ORF_ID:slr8014;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942408.1"
                     /db_xref="GI:38505789"
                     /db_xref="GeneID:2656123"
                     /translation="MKVLLDTNIVLDLLLEREPFIEETIAIFEEIEQGNIEAYIAATT
                     VTNIFYIIRKNKSREVALIAVKRLLIGLQLCPVNLQVIEVALDINLRDFEDSVQLACA
                     TVNQLTAIITRDTKDFVESPLPIYSPAECLYRVKTNKLD"
     misc_feature    9951..10295
                     /locus_tag="slr8014"
                     /note="PIN domain; Region: PIN_3; pfam13470"
                     /db_xref="CDD:257794"
     gene            10395..10994
                     /locus_tag="slr8015"
                     /db_xref="GeneID:2656124"
     CDS             10395..10994
                     /locus_tag="slr8015"
                     /note="ORF_ID:slr8015"
                     /codon_start=1
                     /transl_table=11
                     /product="ParA family plasmid partitioning protein"
                     /protein_id="NP_942409.1"
                     /db_xref="GI:38505790"
                     /db_xref="GeneID:2656124"
                     /translation="MSKTIAIVSRKGGVGKSTLCANLAVVARDATILDCDDQASLADW
                     GDRRGNNSPLVIAVPPKRAISTLEKATTDWNFIDTPGTLDAGIIEVMQASDFVLVVLR
                     YGQFDLDSVSTTLSAVRLSQKPAAIVLNLLHPNTKSQDLITNLEDAQLGYPISPHAVC
                     SRADFQQAAAQGRGVTELEQSSKASYEIRALWHWLQQQV"
     misc_feature    10395..10979
                     /locus_tag="slr8015"
                     /note="ATPases involved in chromosome partitioning [Cell
                     division and chromosome partitioning]; Region: Soj;
                     COG1192"
                     /db_xref="CDD:224113"
     misc_feature    10404..10784
                     /locus_tag="slr8015"
                     /note="ParA and ParB of Caulobacter crescentus belong to a
                     conserved family of bacterial proteins implicated in
                     chromosome segregation. ParB binds to DNA sequences
                     adjacent to the origin of replication and localizes to
                     opposite cell poles shortly following the...; Region:
                     ParA; cd02042"
                     /db_xref="CDD:238997"
     misc_feature    10425..10445
                     /locus_tag="slr8015"
                     /note="P-loop; other site"
                     /db_xref="CDD:238997"
     misc_feature    order(10443..10445,10626..10628)
                     /locus_tag="slr8015"
                     /note="Magnesium ion binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238997"
     gene            10998..11867
                     /locus_tag="slr8016"
                     /db_xref="GeneID:2656125"
     CDS             10998..11867
                     /locus_tag="slr8016"
                     /note="ORF_ID:slr8016"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid partitioning protein"
                     /protein_id="NP_942410.1"
                     /db_xref="GI:38505791"
                     /db_xref="GeneID:2656125"
                     /translation="MAKRQSLDISKAQARSATSEAAEETLQRQQMKEGLVPLDKIGDR
                     PEGDTRQINAKHVKELVESIQVLGLITPLTVDRHYRLLAGGHRKAALEKLAAESPETF
                     TAFFGEGVPVNIMDIDAETATLTALQVEVEENTQRKNYTPSEIREAARKLKEAGYEKL
                     KGRPSKGQKSINRELMSVFGASRRYITKILNDPEDEQQKQKSAHMCALFSKIKRYHEQ
                     TEAFKDYISKNSPKDAINPELNVIRLSLIEKLKETQALLEGLHIVEQLQTKATSPSIA
                     GENHSTQEEKLEV"
     misc_feature    11103..>11567
                     /locus_tag="slr8016"
                     /note="Stage 0 sporulation protein J (antagonist of Soj)
                     containing ParB-like nuclease domain [Transcription];
                     Region: Spo0J; COG1475"
                     /db_xref="CDD:224392"
     misc_feature    11103..11399
                     /locus_tag="slr8016"
                     /note="ParB-like nuclease domain; Region: ParBc;
                     pfam02195"
                     /db_xref="CDD:251149"
     gene            complement(12618..13151)
                     /locus_tag="sll8017"
                     /db_xref="GeneID:2656143"
     CDS             complement(12618..13151)
                     /locus_tag="sll8017"
                     /note="ORF_ID:sll8017"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942411.1"
                     /db_xref="GI:38505792"
                     /db_xref="GeneID:2656143"
                     /translation="MTELAQEAGVSVRTVQTWAKAGYFSKQGSNAYDILGYYRWYTRS
                     LRQDLDEHKAKVARSDWDTKWREGRARKSLAEASLVELQMQSKVKQVVPIDLVISEID
                     KVLSSSIRLFRDLPSYFSAPHCYQSSSEVAAALEQAVSLALKDFQSQLVSLSLGAELV
                     EKSKVFHDSFSSSDTSS"
     misc_feature    complement(12807..13142)
                     /locus_tag="sll8017"
                     /note="Phage DNA packaging protein Nu1; Region: Phage_Nu1;
                     cl01720"
                     /db_xref="CDD:242667"
     gene            complement(13695..15287)
                     /locus_tag="sll8018"
                     /db_xref="GeneID:2656134"
     CDS             complement(13695..15287)
                     /locus_tag="sll8018"
                     /note="sll8018; ORF_ID:sll8018;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942412.1"
                     /db_xref="GI:38505793"
                     /db_xref="GeneID:2656134"
                     /translation="MVMGIIKNHLSPRAHSKRKTKTASDHELLGVRINGFPVAVGIRK
                     GAGPKAQLHSIQGDHRILTYKKATYFAVPIKGKVKSESVEVPQSEPNPAIKEFYPRQV
                     KEDFQRLFSHPFKAILKNDQGQWFTCKYSLNKNRIWNYWKSPSTTIGLGFGKSTSWAA
                     LDLDADGRYHNSESLAGIREALEELAIVSSQLVQSSDSGGWHLFMFFDRPVKTFPLAC
                     LLTETLTSAGFSIEPGHLEVFPNRKQWKAEGSIYNRIRLPLQSGTGSLMLTNDGELDS
                     TGWPDSLELFLKRAKAIARKNDTERIEELGEEAKKRFATARKAQDHGPFLPTRSSKWL
                     KEINTVLEVGFTAHHQSNEILRAVAAKGRVFLGLGGEALASYIEQTVTELPGYGQWCR
                     HQPEIAAWCIRWARSAEKKLYPFRGKPKVDKALTSAGPNNQTRAREAQERIARTVAQL
                     TAENCWPEGAKARLKHIIKGAKCSAKTAYKYSQLWHPVCAPTALLPTCPGPRLPAPLH
                     LCDRLTPAAPASPMCSLPHGSS"
     misc_feature    complement(14487..14807)
                     /locus_tag="sll8018"
                     /note="Eukaryotic and archaeal DNA primase small subunit;
                     Region: DNA_primase_S; pfam01896"
                     /db_xref="CDD:250949"
     gene            complement(15590..17317)
                     /locus_tag="sll8019"
                     /db_xref="GeneID:2656135"
     CDS             complement(15590..17317)
                     /locus_tag="sll8019"
                     /note="sll8019; ORF_ID:sll8019;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942413.1"
                     /db_xref="GI:38505794"
                     /db_xref="GeneID:2656135"
                     /translation="MLTTKHLPQSYTGQRFCRFFKHRFNFIKSSYSSTPEWITISDYP
                     IEHRNLWSVYQDPERLIGLSFGTTTHYAVLDIDCSSPYHPGNSESQYRELLGAYEEVG
                     INSVVTLQSSNSGGLHVYFVFPKALPTFKLAHMLRLTAIKAGYEVKDGKLEIFPNTKT
                     YSKHSKTSYKAVRLPLQRGSWLLDKDFVPYSNDIEVFLEQGEGAAEEQDIELIETAIE
                     SASHIKQFRRVKGEGDACSFAQDLREQIGEGWTSFGQTNDLLRIIGTYGRVFKGLEGQ
                     ALADYIVRTAETSPGYQQYCQHKHNIQRRSKDWGRCIEKYYYPYGSEPTRSGTFKDMQ
                     RTGNRQARQVKENVVNRTRQEEAVARIKQGMDYVRQTMAVLPVKVGAMKDLLLEAIYH
                     LFGKRTSDSTLSRYREYWHPDYVSVTSPPVGESSSTIIDNDDNDSASIDAIESEIDLD
                     VENIESSSKNSCHTPYESLSSTQDKKDISKPLSEETFSLSATPPSYMKVYVLNSFASG
                     LVSRMVFGKESSSKLYSIQPASLVTLCSGAIHSLHPYLVYVKPLEGAEDWISGIAVLF
                     SSLTLVNDS"
     gene            complement(17687..18409)
                     /locus_tag="sll8020"
                     /db_xref="GeneID:2656136"
     CDS             complement(17687..18409)
                     /locus_tag="sll8020"
                     /note="sll8020; ORF_ID:sll8020;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942414.1"
                     /db_xref="GI:38505795"
                     /db_xref="GeneID:2656136"
                     /translation="MSLPDNVTMQIDVQQLQYISLFKELEPLLLGQLAEHSSLKTYES
                     DEVVFYEGDALPACLYLLVTGSLRLTKISESGKETILRLLRADEVFAAPALFGNGVAP
                     ATATALEPIKVLTIEREALLNGFREAPEMALHMLGIFNQRLQHLHSRVHCLVSERAIV
                     RLIHYLKYFADSGGTETVPEGQRLRARLTYYQIARSIGITYEECARVFKQLKGSVTYQ
                     RGGKITILDTNQLTAIVQQNSN"
     misc_feature    complement(17729..18364)
                     /locus_tag="sll8020"
                     /note="cAMP-binding proteins - catabolite gene activator
                     and regulatory subunit of cAMP-dependent protein kinases
                     [Signal transduction mechanisms]; Region: Crp; COG0664"
                     /db_xref="CDD:223736"
     misc_feature    complement(18002..18349)
                     /locus_tag="sll8020"
                     /note="effector domain of the CAP family of transcription
                     factors; members include CAP (or cAMP receptor protein
                     (CRP)), which binds cAMP, FNR (fumarate and nitrate
                     reduction), which uses an iron-sulfur cluster to sense
                     oxygen) and CooA, a heme containing CO...; Region: CAP_ED;
                     cd00038"
                     /db_xref="CDD:237999"
     misc_feature    complement(order(18101..18109,18134..18139))
                     /locus_tag="sll8020"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:237999"
     misc_feature    complement(order(18017..18025,18035..18043))
                     /locus_tag="sll8020"
                     /note="flexible hinge region; other site"
                     /db_xref="CDD:237999"
     misc_feature    complement(17708..17929)
                     /locus_tag="sll8020"
                     /note="helix_turn_helix, cAMP Regulatory protein
                     C-terminus; DNA binding domain of prokaryotic regulatory
                     proteins belonging to the catabolite activator protein
                     family; Region: HTH_CRP; cl17320"
                     /db_xref="CDD:266626"
     gene            18529..19311
                     /locus_tag="slr8021"
                     /db_xref="GeneID:2656126"
     CDS             18529..19311
                     /locus_tag="slr8021"
                     /note="slr8021; ORF_ID:slr8021;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942415.1"
                     /db_xref="GI:38505796"
                     /db_xref="GeneID:2656126"
                     /translation="MTVTPLNLKTASGHQVLAAAGKKILRPGGRKATEILFTWVNFQP
                     GETVLELAASFGYSAIALAQRYGVKVVGIEKNPDSVARARANVEAAGLSAQVDIREGD
                     FFHLERIPGQFDYVLGEAILSMQSAPAKAKILQGVGARLKPGGQYLSHEMLAQGAHIE
                     DIYRELATTIRVNTAPLNELDWQGTYEQANLTVQQHRTGPMALLNPLTIAQEEGLGTL
                     LSLGWNLLVHPPMRQRILAMRRVFTKYGDDLGYIILRAQKPS"
     misc_feature    18652..19098
                     /locus_tag="slr8021"
                     /note="Methyltransferase domain; Region: Methyltransf_31;
                     pfam13847"
                     /db_xref="CDD:258120"
     misc_feature    18667..18972
                     /locus_tag="slr8021"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(18679..18699,18748..18753,18829..18837,18889..18891)
                     /locus_tag="slr8021"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            19356..19691
                     /locus_tag="slr8022"
                     /db_xref="GeneID:2656127"
     CDS             19356..19691
                     /locus_tag="slr8022"
                     /note="slr8022; ORF_ID:slr8022;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942416.1"
                     /db_xref="GI:38505797"
                     /db_xref="GeneID:2656127"
                     /translation="MKTPILSFQATFTRLQEHIEYPQAGVLSKTLLQDKTCQYTLFCL
                     AANTEISEHTSTRNAVVQGIEGTGILTLEGKDISLDPGVFIVMPAHAPHALKAISNLS
                     FLLTLSQPN"
     misc_feature    <19446..19685
                     /locus_tag="slr8022"
                     /note="Uncharacterized conserved protein, contains
                     double-stranded beta-helix domain [Function unknown];
                     Region: COG1917"
                     /db_xref="CDD:224829"
     gene            19938..21278
                     /locus_tag="slr8023"
                     /db_xref="GeneID:2656128"
     CDS             19938..21278
                     /locus_tag="slr8023"
                     /note="slr8023; ORF_ID:slr8023;
                     probable esterase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942417.1"
                     /db_xref="GI:38505798"
                     /db_xref="GeneID:2656128"
                     /translation="MKASFGTERNSFEVQVSGGRLIGSVSEGLGSFLGIPYAAPPVGA
                     LRWKPPVADIGWDGARSATSFGNPCTQYLDTIPVITERQRTPSEDCLYLNVWTPAPGD
                     SAKLPVMVWFHGGAFVIGSGSATEFDGANLARHGVVVVTVNYRLGPFGFLSHPELADE
                     SSHGASGNYGLLDQLCALQWVAENIAAFGGDPGCVTLFGESAGGISISCHLASPLSRG
                     LFSRAIMQSGTWFTIPHGLPQASTDPEQAAANASKFAASLRCSTQGKVIEELRKRTDG
                     ELLAATERRMLFCPVVDGWFLPEDPELIFATAKATPVPTILGFNADEGTRFTHTAPGS
                     PEAEELSLRIAVEPTRRMAALMTAPSYCYRFSRVPNTELASRFGAYHGIEVPYVFGNL
                     DARLGYEEEDFALSERMIRYWTTFASSACPDPVGAMTWLRYNKDDENILNLGEG"
     misc_feature    19974..21266
                     /locus_tag="slr8023"
                     /note="Carboxylesterase family; Region: COesterase;
                     pfam00135"
                     /db_xref="CDD:249618"
     misc_feature    <20220..>20573
                     /locus_tag="slr8023"
                     /note="Esterase/lipase [Lipid metabolism]; Region: Aes;
                     COG0657"
                     /db_xref="CDD:223730"
     misc_feature    order(20277..20285,20535..20543,20550..20552,20925..20927,
                     21003..21005,21081..21083,21090..21092)
                     /locus_tag="slr8023"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238191"
     misc_feature    order(20538..20540,20904..20906,21078..21080)
                     /locus_tag="slr8023"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238191"
     gene            complement(21321..21512)
                     /locus_tag="ssl8024"
                     /db_xref="GeneID:2656147"
     CDS             complement(21321..21512)
                     /locus_tag="ssl8024"
                     /note="ORF_ID:ssl8024"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942418.1"
                     /db_xref="GI:38505799"
                     /db_xref="GeneID:2656147"
                     /translation="MQHHICYCSFPGSWNSSILTRSAATPEPTANPQQNQSLTTPITS
                     STTMGGAHWEQGGSWSFQM"
     gene            complement(21810..22325)
                     /locus_tag="sll8025"
                     /db_xref="GeneID:2656137"
     CDS             complement(21810..22325)
                     /locus_tag="sll8025"
                     /note="sll8025; ORF_ID:sll8025;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942419.1"
                     /db_xref="GI:38505800"
                     /db_xref="GeneID:2656137"
                     /translation="MRLKISKRSWLLSLHIATGGVWFGTALCSVALALSILLLKPGEA
                     IHGINLARNVLGQYIIIPAAVFSVITGVLLCGFTNWGFFKHYWVMVKQLVTLVLIMLG
                     SVWLGPMTKEMTALSEAGRSQVLQNPDYLTLQTTATLVGALQTLALLTVIIVSTLKPW
                     GKRRAVQSSTK"
     gene            22461..22985
                     /locus_tag="slr8026"
                     /db_xref="GeneID:2656129"
     CDS             22461..22985
                     /locus_tag="slr8026"
                     /note="ORF_ID:slr8026"
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="NP_942420.1"
                     /db_xref="GI:38505801"
                     /db_xref="GeneID:2656129"
                     /translation="MQIFPRREAFHELECDFSSFDLEAVGTCLAFLDTTGEVYAAFDK
                     HFERFGLSAGKFTILMQLYTAKRGLSPSEFANRANVTRATITGLLDRLEREGLVERKA
                     HSNDRRMLTITLTEQGKKLVERVLPEHFCRTKGLMTNLTSTEKKTFIKLLDKLRSGIP
                     ALSDPSWDHNNLTS"
     misc_feature    22590..22928
                     /locus_tag="slr8026"
                     /note="Transcriptional regulators [Transcription]; Region:
                     MarR; COG1846"
                     /db_xref="CDD:224759"
     misc_feature    22632..22838
                     /locus_tag="slr8026"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    order(22638..22643,22656..22658,22746..22748,22809..22814,
                     22818..22826,22830..22838)
                     /locus_tag="slr8026"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    order(22668..22670,22677..22679,22809..22811)
                     /locus_tag="slr8026"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    order(22668..22676,22701..22712,22716..22721,22728..22733,
                     22737..22742,22758..22766,22782..22790)
                     /locus_tag="slr8026"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     gene            complement(23434..23859)
                     /locus_tag="sll8027"
                     /db_xref="GeneID:2656144"
     CDS             complement(23434..23859)
                     /locus_tag="sll8027"
                     /note="sll8027; ORF_ID:sll8027;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942421.1"
                     /db_xref="GI:38505802"
                     /db_xref="GeneID:2656144"
                     /translation="MKASPRVVIDTNLLVSALIFGGVTGKLRGIWQSGGCIPLVSKVT
                     VTELMRVLAYPKFRLSPTEREDLLADYLPFCETVRIPNPPPATPPCRDPFDVPFLVLA
                     LVGQADYLITGDKDLLELEVEDSFPCSIVLLEQFLLDVA"
     misc_feature    complement(23488..23844)
                     /locus_tag="sll8027"
                     /note="PIN domain; Region: PIN_3; cl17397"
                     /db_xref="CDD:266665"
     gene            complement(23856..24077)
                     /locus_tag="ssl8028"
                     /db_xref="GeneID:2656148"
     CDS             complement(23856..24077)
                     /locus_tag="ssl8028"
                     /note="ssl8028; ORF_ID:ssl8028;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942422.1"
                     /db_xref="GI:38505803"
                     /db_xref="GeneID:2656148"
                     /translation="MLAKLTSKNQLTLPKSVTQQIGSAEYFEVTVQGGQIILTPVRIQ
                     RADAVRAKLAALNITEEDITNAVDWARQS"
     misc_feature    complement(23952..24071)
                     /locus_tag="ssl8028"
                     /note="SpoVT / AbrB like domain; Region: SpoVT_AbrB;
                     smart00966"
                     /db_xref="CDD:198034"
     gene            24295..24861
                     /locus_tag="slr8029"
                     /db_xref="GeneID:2656130"
     CDS             24295..24861
                     /locus_tag="slr8029"
                     /note="ORF_ID:slr8029"
                     /codon_start=1
                     /transl_table=11
                     /product="resolvase"
                     /protein_id="NP_942423.1"
                     /db_xref="GI:38505804"
                     /db_xref="GeneID:2656130"
                     /translation="MAIVGYARVSSVGQNLDVQLEKLSHCDKVFKEKQSGSSHQRPVL
                     QECLRYLREGDTLVVTRLDRLARSTLHLCQIAAELEGKQVVLQVLDQNIHTGDATGRL
                     LFNMLGAIAQFETEIRAERQMDGIQNAKARGVRLGREKQLTEQQVLELRQRREQGTLI
                     KILMKDYKLSKASIYRYLNGTKVVELAH"
     misc_feature    24301..24843
                     /locus_tag="slr8029"
                     /note="multiple promoter invertase; Provisional; Region:
                     mpi; PRK13413"
                     /db_xref="CDD:184041"
     misc_feature    24301..24669
                     /locus_tag="slr8029"
                     /note="Serine Recombinase (SR) family, Resolvase and
                     Invertase subfamily, catalytic domain; members contain a
                     C-terminal DNA binding domain. Serine recombinases
                     catalyze site-specific recombination of DNA molecules by a
                     concerted, four-strand cleavage and...; Region: SR_ResInv;
                     cd03768"
                     /db_xref="CDD:239737"
     misc_feature    order(24316..24318,24322..24324,24481..24486,24493..24495)
                     /locus_tag="slr8029"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239737"
     misc_feature    24322..24324
                     /locus_tag="slr8029"
                     /note="catalytic nucleophile [active]"
                     /db_xref="CDD:239737"
     misc_feature    order(24478..24480,24610..24615,24619..24624,24634..24636)
                     /locus_tag="slr8029"
                     /note="Presynaptic Site I dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    order(24496..24498,24511..24516,24598..24600,24607..24612,
                     24619..24624,24631..24633,24640..24642)
                     /locus_tag="slr8029"
                     /note="Synaptic Antiparallel dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    order(24565..24573,24598..24603,24610..24615,24622..24624,
                     24634..24636,24643..24645,24655..24657)
                     /locus_tag="slr8029"
                     /note="Synaptic Flat tetramer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    order(24565..24567,24613..24615,24622..24624,24634..24636,
                     24643..24645,24655..24657)
                     /locus_tag="slr8029"
                     /note="Synaptic Site I dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    order(24637..24639,24655..24660)
                     /locus_tag="slr8029"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:239737"
     misc_feature    24703..24828
                     /locus_tag="slr8029"
                     /note="Helix-turn-helix domain of Hin and related
                     proteins; Region: HTH_Hin_like; cl17393"
                     /db_xref="CDD:266662"
     misc_feature    order(24706..24714,24808..24813,24817..24825)
                     /locus_tag="slr8029"
                     /note="DNA-binding interface [nucleotide binding]; DNA
                     binding site"
                     /db_xref="CDD:259851"
     gene            25147..27345
                     /locus_tag="slr8030"
                     /db_xref="GeneID:2656131"
     CDS             25147..27345
                     /locus_tag="slr8030"
                     /note="slr8030; ORF_ID:slr8030;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942424.1"
                     /db_xref="GI:38505805"
                     /db_xref="GeneID:2656131"
                     /translation="MVWSRRNFLAVMGLGAGAALFNPRQYPLTAAIPKIGDRHGDLSF
                     QPIDYPIPLATDGLTPAQQKTAFATFAVQDELVLPSDFFYTVLGQWGDPVGDHWFGFN
                     NDYLGLVETDENTAYLLINFEYISFIPWRQGYEMAIGKSLPIETVLTAAEAQGGKINA
                     FALAADNPVKIDIEALCEAALVDQGMGVIRLERNGQGDWQRSPNATDRRITGLSGLTD
                     SHYLTATGPAIAIFTNPTKQGYDDGLGEKIIGTFGNCAGGTTPWGTVLSAEENFQSQV
                     PEAVYADGSAVDPAQCPLKISTNGLSGQGNVFGLAGNKYGWMVEIDPANANDYGVKHT
                     ALGRFRHEAVAVRATANQPLAVYSGCDRTSGHLYKFVSADTVKSPTDKGNSRLFTAGT
                     LYGAKFNADGTGEWIALTPDTVVNPVRPSDIAVDSSTTGIVYLPHPDRNQAGAIAIDT
                     DHAVAEYQTQFATLADLYPIESDRQQGAILVDAHLAANAAGVTPTARPEDTEILPDGS
                     VLIAFTSGWPSQGDGGCDRHIFQGPQGEVPCNSGWIMRLQETGDRCDALTFGWAMIAA
                     GGEPSQGGLGFANPDNLAIDGRGNLWMVTDMSTSKHNRKFEREADTTSLDSVGVFGNN
                     SLWYLPLHGPNAGQIFPFAIGPMDSELTGPVFSQDQKTLFLAVQHPGELNGLRQTEIV
                     TMPLTTTNGEPFLQTRTVPLQSHWPNSGDMLSRPAVVTIQRRTRQPFHSS"
     misc_feature    25147..27315
                     /locus_tag="slr8030"
                     /note="Predicted phosphatase [General function prediction
                     only]; Region: PhoX; COG3211"
                     /db_xref="CDD:225752"
     misc_feature    25366..27159
                     /locus_tag="slr8030"
                     /note="Bacterial protein of unknown function (DUF839);
                     Region: DUF839; pfam05787"
                     /db_xref="CDD:253386"
     gene            complement(27353..28012)
                     /locus_tag="ndhK2"
                     /db_xref="GeneID:2656104"
     CDS             complement(27353..28012)
                     /locus_tag="ndhK2"
                     /EC_number="1.6.5.3"
                     /note="The point of entry for the majority of electrons
                     that traverse the respiratory chain eventually resulting
                     in the reduction of oxygen"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase subunit B"
                     /protein_id="NP_942425.1"
                     /db_xref="GI:38505806"
                     /db_xref="GeneID:2656104"
                     /translation="MSTSTHALTLQNPIQAPQVTKELSENVILTCLDDIYNWARLSTL
                     YPMMFGTACCFMEFMAAFGPRFDLERFGSIPRATPRQADLMITAGTITMKYAPALVQL
                     YEQIPEPKYVIAMGACTITAGMFSADSPTAVRGVDKLIPVDVYIPGCPPRPEAVIDGI
                     IKLRKKVAGESRQDYTEDLQTHRFHAVRHRMKPVSPILTGQYLRHHEDLTPHHDPLLI
                     K"
     misc_feature    complement(27473..27982)
                     /locus_tag="ndhK2"
                     /note="NADH dehydrogenase subunit B; Validated; Region:
                     PRK06411"
                     /db_xref="CDD:235797"
     gene            complement(28120..28461)
                     /locus_tag="sll8032"
                     /db_xref="GeneID:2656145"
     CDS             complement(28120..28461)
                     /locus_tag="sll8032"
                     /note="sll8032; ORF_ID:sll8032;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942426.1"
                     /db_xref="GI:38505807"
                     /db_xref="GeneID:2656145"
                     /translation="MSNLILQINVTYDCSQAELENVFSHAVGAIAAFPGLTWKIWIIN
                     DGTKEAGGLYCFDSETALTAYVNSPIITALKANPLLPTVQIKAFEAITALTTQTRGPV
                     PALALQSSVGA"
     misc_feature    complement(28156..28449)
                     /locus_tag="sll8032"
                     /note="Putative mono-oxygenase ydhR; Region: ydhR;
                     cl07420"
                     /db_xref="CDD:186696"
     gene            complement(28521..28919)
                     /locus_tag="sll8033"
                     /db_xref="GeneID:2656146"
     CDS             complement(28521..28919)
                     /locus_tag="sll8033"
                     /note="ORF_ID:sll8033"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942427.1"
                     /db_xref="GI:38505808"
                     /db_xref="GeneID:2656146"
                     /translation="MRALPSFPTTTSIALAIRPLQPPRLLNFQENSMNNFTHNAQTLL
                     EQQRPNLEITLQENTRPTVDQPARLRHFFGRLGNTLVQWLTQKSTLRIHRSTQGETEV
                     WEVYDPRDHRTHFFTHENEVRIWLEECYYR"
     gene            complement(29006..30040)
                     /locus_tag="sll8034"
                     /db_xref="GeneID:2656105"
     CDS             complement(29006..30040)
                     /locus_tag="sll8034"
                     /note="ORF_ID:sll8034"
                     /codon_start=1
                     /transl_table=11
                     /product="2-nitropropane dioxygenase"
                     /protein_id="NP_942428.1"
                     /db_xref="GI:38505809"
                     /db_xref="GeneID:2656105"
                     /translation="MLTTQITQTYHLTTPIISAGMAFVATPKLAAAVSNAGGMGTFSA
                     FMSPPEELRALIRQTRSLSDRPFGIDFITAAANDDHIAICMAERVPVVIFFWSFPPLD
                     WVTQLQNAGVKVWMQVGSLAEATQAKAQGFDAIIAQGQEGGGHNRSEASIFSLLPAIC
                     REVAPIPVIAAGGIIDGRGLVAALALGAEAVWCGTRFLASEEAYAHPEYKARVVTATV
                     GDTTRTTLFGPEMPGQLMRVLRNLAVNQWGDRVADATKHGPTQPAIGSTILGGQALPM
                     PKFSAILPTPDTSGDFEEMCLTAGESSGNITAIKSARDILWEMENEALDLLTYRLQAI
                     TKEQNLMAAG"
     misc_feature    complement(29057..30040)
                     /locus_tag="sll8034"
                     /note="Dioxygenases related to 2-nitropropane dioxygenase
                     [General function prediction only]; Region: COG2070"
                     /db_xref="CDD:224981"
     misc_feature    complement(29303..30007)
                     /locus_tag="sll8034"
                     /note="2-Nitropropane dioxygenase (NPD), one of the
                     nitroalkane oxidizing enzyme families, catalyzes oxidative
                     denitrification of nitroalkanes to their corresponding
                     carbonyl compounds and nitrites. NDP is a member of the
                     NAD(P)H-dependent flavin oxidoreductase...; Region:
                     NPD_like; cd04730"
                     /db_xref="CDD:240081"
     misc_feature    complement(order(29456..29467,29522..29530,29612..29617,
                     29627..29629,29690..29692,29756..29758,29825..29827,
                     29978..29983))
                     /locus_tag="sll8034"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:240081"
     misc_feature    complement(order(29312..29314,29606..29611))
                     /locus_tag="sll8034"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:240081"
     misc_feature    complement(29606..29608)
                     /locus_tag="sll8034"
                     /note="putative catalytic residue [active]"
                     /db_xref="CDD:240081"
     gene            complement(30084..30587)
                     /locus_tag="sll8035"
                     /db_xref="GeneID:2656106"
     CDS             complement(30084..30587)
                     /locus_tag="sll8035"
                     /note="sll8035; ORF_ID:sll8035;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942429.1"
                     /db_xref="GI:38505810"
                     /db_xref="GeneID:2656106"
                     /translation="MFANVIATLFRMDDQTWRGHANPWCVWTRLTVAPLLLLSVWSRV
                     WLGWWSLIPIAIALLWNWYNARLFSPPQSTDNWASKGVLGERVWINRHQVSIPTHHYT
                     FPHFLAGLAAVGSVIAICGLWALNLPLTLLGLLLLYMGKLWFFDRMVWLYEDMKTATP
                     EYTSWLY"
     gene            30678..31376
                     /locus_tag="slr8036"
                     /db_xref="GeneID:2656132"
     CDS             30678..31376
                     /locus_tag="slr8036"
                     /note="slr8036; ORF_ID:slr8036;
                     probable acetyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942430.1"
                     /db_xref="GI:38505811"
                     /db_xref="GeneID:2656132"
                     /translation="MLSLGQIYGISVYGKLWHLPAPFSIQVLCPNIVVIRSPFKLAFH
                     RWSDHVRIMPILPTGDTIRLATAADLPWLLPIERQAAQRFLTCLDQTGLTAAILEQTK
                     AIADFEQACRSEHLWVAVSPTRQLVGFAFVRMLDGYAHLEELDVLPDHGKRGIGRALV
                     AAVYDWAQGAGHPGVTLRTFREVPWNAPFYQRCGFRIVDSAQLSPQHGELEKAEQRLG
                     LRTDLRVSMVYRCD"
     misc_feature    31050..31208
                     /locus_tag="slr8036"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    order(31107..31115,31143..31148)
                     /locus_tag="slr8036"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            31348..32598
                     /locus_tag="slr8037"
                     /db_xref="GeneID:2656133"
     CDS             31348..32598
                     /locus_tag="slr8037"
                     /note="slr8037; ORF_ID:slr8037;
                     probable acetyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942431.1"
                     /db_xref="GI:38505812"
                     /db_xref="GeneID:2656133"
                     /translation="MFRWFIAAIEDVYLPVPVMHLLTSNFAPFPWQHLDYTVVQLTKQ
                     DSNCLQALFERCTDFFNLTTGQPPASTAAEAEFVDVPAGKTPEDLHVFGLHHPQKGLI
                     GTIIAVQDYPEAATWWIGTMLIDPVYRSQGVGSAFYQAFERWLAAQGVTGIELCAIAS
                     NTSGRAFWQRMGFEEIRQTPSRSFGQRHHIAHVYRRCLILLTRRAEFESYDPLNSLNA
                     YLCKTEVINWQHPDIQALAQQLAAGHETPVVIAQACFEWVRDAIRHSVDYQMNPVTWR
                     ASDVLQHKTGYCFAKSHLLAALLRANQIPAGFCYQRLSIDDRGTPYSLHGFNAVYLPI
                     TGWHRVDPRGNKPGIDTKFSPPIEHLAYQPKLDEEADFSAILAEPLAIVVTALQTHAT
                     WDALLHHLPDMTPNTATTIGLYCY"
     misc_feature    31648..31815
                     /locus_tag="slr8037"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    order(31711..31719,31747..31752)
                     /locus_tag="slr8037"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     misc_feature    <31993..32556
                     /locus_tag="slr8037"
                     /note="Transglutaminase-like enzymes, putative cysteine
                     proteases [Amino acid transport and metabolism]; Region:
                     COG1305"
                     /db_xref="CDD:224224"
     misc_feature    32047..32373
                     /locus_tag="slr8037"
                     /note="Transglutaminase-like superfamily; Region:
                     Transglut_core; pfam01841"
                     /db_xref="CDD:250908"
     gene            32698..36411
                     /locus_tag="slr8038"
                     /db_xref="GeneID:2656114"
     CDS             32698..36411
                     /locus_tag="slr8038"
                     /note="ORF_ID:slr8038"
                     /codon_start=1
                     /transl_table=11
                     /product="WD repeat-containing protein"
                     /protein_id="NP_942432.1"
                     /db_xref="GI:38505813"
                     /db_xref="GeneID:2656114"
                     /translation="MPFEDALAIVNAAMQTLLGRQLSDIETLIFEGSWQSKTYPQIAD
                     GAGYSINYLTTDVGPKFWKVLSQALGEPVNKKNFKAAIRRYCVVQSGGEWESEGFQTQ
                     LPSYPSILSWGEAPDVSQFYGREEEQALLQRWIEAERCRLIAVLGMGGIDKSTLTTKV
                     VQGFVQGDGVEEWEGDNINIKKIQNPLQEGQSPTKFKIQHLPSSPATPFTHIIWRSLR
                     NAPPLEALLAELIDLLSEHQETVGDRARLLHWLRKTRCLIVLDNLETILQAGDHAGYY
                     RDGYGDYGELIQLLGETPHQSCVLLTSREKPAEIAVLEGLDGNTRTLQLSGSVATAIA
                     IIQQKGLQGTEEQQQVLCDRYSYNPLALKIVSTTIQDLFDGDISAFLTEDAVIFNSIR
                     RLLDAQFQRLTELEQAIIIWLAINRDWTAIAELAADLVPPVPKVKLLEALESLRWRGL
                     IETQDKRYTLQPVVMEYVTERFIEQINQELEMGQPQYWQQFALLKLTVRDHITETQRR
                     LIVHSTAAQFGDCFPSPELQRQQLQTVLTAIRESVIAGYGVGNLINLSNALDLDLAGF
                     DFSQLTIRQADLRHRLFQHLNFAQANFRDSAFKQTFGSIFSLSYSPAGDYLITGDDVG
                     VVRLWKSAEMQPMQSYPLHRSYVWDLRPSADGRWLATCSEDQTVKITNLATGQLQATL
                     VVAPTIARAIVWIGPDCLAIGGIDGHIRLWYPFTEQAPVLVTAHTDIVNSLSWDANSN
                     LLASSSSDSTVKLWDVETGICHRIWREAVPVRWATWSPDGHTLAISREDGGIVLWNPH
                     SDQAPRYLNGHPETVWSLDWNPDGAWLASSSHDATVRLWDVVTGRCRRILRSHQNWVW
                     YARWHPHQPRIISGGHDGTLKLWDTGTGQCLKSLTGHMANIRAIAPAPDGQTLALGCD
                     DTIVRLCGADSPPSFIHAFGHSHLISDLCWNPTGENLASASHDCNLRVWQRSPLRCTQ
                     VLKGHTNWVWSVDWHPTQDLLASGSVDSTIRLWYPTQSTPVKTLMAQTSWILSVRWHP
                     TGRWLASAAGDFTIGLWNSKTWECTHLLTGHTHWIWCLAWSPNGQYLASGGYDNTVFI
                     WKVEKEVTSLRTLEHPTILSAIAWHPDGELLATSCHDGNIRLWHWQTGQCVTRISGHQ
                     GEILTLKFSPDGKRLYSSSQDETWKTWDWQTGTCLASDRLDRPYEGMNISEVRGLTEV
                     RKAALRALGATEGSQPPGDLVRWLRKTEQGRKL"
     misc_feature    33055..33489
                     /locus_tag="slr8038"
                     /note="AAA ATPase domain; Region: AAA_16; pfam13191"
                     /db_xref="CDD:257559"
     misc_feature    <34408..34722
                     /locus_tag="slr8038"
                     /note="FOG: WD40 repeat [General function prediction
                     only]; Region: COG2319"
                     /db_xref="CDD:225201"
     misc_feature    34504..35337
                     /locus_tag="slr8038"
                     /note="WD40 domain, found in a number of eukaryotic
                     proteins that cover a wide variety of functions including
                     adaptor/regulatory modules in signal transduction,
                     pre-mRNA processing and cytoskeleton assembly; typically
                     contains a GH dipeptide 11-24 residues from...; Region:
                     WD40; cd00200"
                     /db_xref="CDD:238121"
     misc_feature    order(34552..34554,34564..34566,34582..34587,34621..34626,
                     34678..34680,34690..34692,34708..34713,34747..34752,
                     34798..34800,34813..34815,34831..34836,34873..34875,
                     34924..34926,34939..34941,34957..34962,34993..34998,
                     35050..35052,35062..35064,35080..35085,35119..35124,
                     35173..35175,35188..35190,35206..35211,35245..35250,
                     35302..35304,35314..35316,35332..35337)
                     /locus_tag="slr8038"
                     /note="structural tetrad; other site"
                     /db_xref="CDD:238121"
     misc_feature    34756..36081
                     /locus_tag="slr8038"
                     /note="FOG: WD40 repeat [General function prediction
                     only]; Region: COG2319"
                     /db_xref="CDD:225201"
     misc_feature    35107..36090
                     /locus_tag="slr8038"
                     /note="WD40 domain, found in a number of eukaryotic
                     proteins that cover a wide variety of functions including
                     adaptor/regulatory modules in signal transduction,
                     pre-mRNA processing and cytoskeleton assembly; typically
                     contains a GH dipeptide 11-24 residues from...; Region:
                     WD40; cd00200"
                     /db_xref="CDD:238121"
     misc_feature    order(35122..35124,35176..35178,35188..35190,35206..35211,
                     35245..35250,35302..35304,35314..35316,35332..35337,
                     35371..35376,35551..35553,35566..35568,35584..35589,
                     35626..35628,35677..35679,35692..35694,35710..35715,
                     35749..35754,35806..35808,35818..35820,35836..35841,
                     35875..35880,35929..35931,35944..35946,35962..35967,
                     36001..36006,36058..36060,36070..36072,36088..36090)
                     /locus_tag="slr8038"
                     /note="structural tetrad; other site"
                     /db_xref="CDD:238121"
     misc_feature    35347..35457
                     /locus_tag="slr8038"
                     /note="WD domain, G-beta repeat; Region: WD40; pfam00400"
                     /db_xref="CDD:249832"
     misc_feature    36100..36219
                     /locus_tag="slr8038"
                     /note="WD40 repeats; Region: WD40; smart00320"
                     /db_xref="CDD:197651"
     gene            complement(36860..37141)
                     /locus_tag="ssl8039"
                     /db_xref="GeneID:2656149"
     CDS             complement(36860..37141)
                     /locus_tag="ssl8039"
                     /note="ORF_ID:ssl8039"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942433.1"
                     /db_xref="GI:38505814"
                     /db_xref="GeneID:2656149"
                     /translation="MEGLQEESMSFPLVTVGSSGYESSLSSLINGTAAAQQPRLINCP
                     ALLEVQEAIRYASECILLFYPRLYPRYPKARCDGLCSSAGGRNFGDRQS"
     gene            complement(37299..38048)
                     /locus_tag="sll8040"
                     /db_xref="GeneID:2656107"
     CDS             complement(37299..38048)
                     /locus_tag="sll8040"
                     /note="ORF_ID:sll8040"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942434.1"
                     /db_xref="GI:38505815"
                     /db_xref="GeneID:2656107"
                     /translation="MEILTRYNSTPHTEPQHINSDETKNKRSLPPVFKAQKSKKKQLR
                     HCKHGSISALSKVINHATVFTKINFFTWKQTKDGYLYLERDDARSLFNLLDETGIFDF
                     HVTNIQKKIIYQHQVSKFLSNGWRLYANGYFARKGEVEIHHLDANKQNNDPRNLRYVS
                     PGLNYLCARAIKHEYTGEDIPDSVIESYEEAEYLVKLTFKRYLKRLGYSMSKSERDFL
                     LSLKWNIAREILQSWQPPAQVTELIEKLVQK"
     misc_feature    complement(37557..>37631)
                     /locus_tag="sll8040"
                     /note="HNH endonuclease; Region: HNH_3; pfam13392"
                     /db_xref="CDD:257717"
     gene            complement(38396..38599)
                     /locus_tag="ssl8041"
                     /db_xref="GeneID:2656150"
     CDS             complement(38396..38599)
                     /locus_tag="ssl8041"
                     /note="ORF_ID:ssl8041"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="NP_942435.1"
                     /db_xref="GI:38505816"
                     /db_xref="GeneID:2656150"
                     /translation="MKLSVLTVAFSVSALFETTIIVVDQARQPLIDGYGALEFVFGGF
                     AVADVTHYCGCNAVRRFIHKQRF"
     gene            complement(38568..39062)
                     /locus_tag="sll8042"
                     /db_xref="GeneID:2656108"
     CDS             complement(38568..39062)
                     /locus_tag="sll8042"
                     /note="ORF_ID:sll8042"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="NP_942436.1"
                     /db_xref="GI:38505817"
                     /db_xref="GeneID:2656108"
                     /translation="MLRELIKLYSSQAIVYIDESGFEAIQACIYAWSKKGKKVYGDRQ
                     GKRGVRENLVAGRRKGKKDLIAPMVFTGSLNAEGFEGWLKLYLLPSLDIPSILIMDNA
                     PIHRKTAIKELAKEAGHEVLFLPKYSPDLNDIEHDFSALKRARMYAPIDTSLDEIIRS
                     YCGV"
     misc_feature    complement(38607..39023)
                     /locus_tag="sll8042"
                     /note="DDE superfamily endonuclease; Region: DDE_3;
                     pfam13358"
                     /db_xref="CDD:257686"
     gene            complement(39056..39415)
                     /locus_tag="sll8043"
                     /db_xref="GeneID:2656109"
     CDS             complement(39056..39415)
                     /locus_tag="sll8043"
                     /note="ORF_ID:sll8043"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="NP_942437.1"
                     /db_xref="GI:38505818"
                     /db_xref="GeneID:2656109"
                     /translation="MAYSLDLRQRVVAYIEAGGKITEASKICKIGKASIYRWLNRVDL
                     SPIKVERRHRKLDWEALKKDVEENPDARLIDRAKKFGVRPSAVYYALKKMKINRKKKN
                     YVIEKETGRNELSTIEC"
     misc_feature    complement(39059..39415)
                     /locus_tag="sll8043"
                     /note="Transposase; Region: HTH_Tnp_IS630; pfam01710"
                     /db_xref="CDD:145062"
     gene            39491..40969
                     /locus_tag="slr8044"
                     /db_xref="GeneID:2656115"
     CDS             39491..40969
                     /locus_tag="slr8044"
                     /note="ORF_ID:slr8044"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942438.1"
                     /db_xref="GI:38505819"
                     /db_xref="GeneID:2656115"
                     /translation="MGSMTAEEALKRTVAKVLLGGPMSNEAAEQLATAAKSLFDVAIN
                     EYAIETTDGRYSFNEQQSRSASLLAFYLKAAEDVLTDIKVEGRMNTKALSELGYVDHL
                     DRLQNLDLTGGLAYINEIEQNVRQSAILGEEDSLAVWTIMDELKQGYTQVKSGAVSPD
                     SLEGMLSTAKEQLGQLGANTNMLTSTIDLYLENEDVALRYKEAGRAANIILPTAEELE
                     QASGTEYEQMREQLKLSLYNLYSFGQLNKYLQTQMDPGLNRVTVATGMQDTTRLEAHY
                     AQLLTQAELDLYTVSTKDKEAYASIQETLITLGSMLEENLGYMNQAKVRSTYALQHMS
                     VLQLGALSSDNLGINWGGVDPDNNLTEQQRRAIEVDTLASQLTFEFSQGYSSSTAKTL
                     PRVLTGRQNKGLLSASPAYNFFKGFFDAYASGRPEDFENLQENAAYMRDVKRVSSQVM
                     RNGYDSVDSRVNILVDDYVRQLISPESPISSQARFLVSDLST"
     gene            41056..41415
                     /locus_tag="slr8045"
                     /db_xref="GeneID:2656116"
     CDS             41056..41415
                     /locus_tag="slr8045"
                     /note="ORF_ID:slr8045"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="NP_942439.1"
                     /db_xref="GI:38505820"
                     /db_xref="GeneID:2656116"
                     /translation="MAYSLDLRQRVVAYIEAGGKITEASKICKIGKASIYRWLNRVDL
                     SPIKVERRHRKLDWEALKKDVEENPDARLIDRAKKFGVRPSAVYYALKKMKINRKKKN
                     YVIEKETGRNELSTIEC"
     misc_feature    41056..41412
                     /locus_tag="slr8045"
                     /note="Transposase; Region: HTH_Tnp_IS630; pfam01710"
                     /db_xref="CDD:145062"
     gene            41409..41903
                     /locus_tag="slr8046"
                     /db_xref="GeneID:2656117"
     CDS             41409..41903
                     /locus_tag="slr8046"
                     /note="ORF_ID:slr8046"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="NP_942440.1"
                     /db_xref="GI:38505821"
                     /db_xref="GeneID:2656117"
                     /translation="MLRELIKLYSSQAIVYIDESGFEAIQACIYAWSKKGKKVYGDRQ
                     GKRGVRENLVAGRRKGKKDLIAPMVFTGSLNAEGFEGWLKLYLLPSLDIPSILIMDNA
                     PIHRKTAIKELAKEAGHEVLFLPKYSPDLNDIEHDFSALKRARMYAPIDTSLDEIIRS
                     YCGV"
     misc_feature    41448..41864
                     /locus_tag="slr8046"
                     /note="DDE superfamily endonuclease; Region: DDE_3;
                     pfam13358"
                     /db_xref="CDD:257686"
     gene            41994..42194
                     /locus_tag="ssr8047"
                     /db_xref="GeneID:2656152"
     CDS             41994..42194
                     /locus_tag="ssr8047"
                     /note="ORF_ID:ssr8047"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942441.1"
                     /db_xref="GI:38505822"
                     /db_xref="GeneID:2656152"
                     /translation="MSLDRQLNLLSTVKSINAKSKDILDSDPEEITLKEFENIISIYL
                     KVIMFNRGLLYEEEFGDIDIDS"
     gene            complement(42203..42913)
                     /locus_tag="sll8048"
                     /db_xref="GeneID:2656110"
     CDS             complement(42203..42913)
                     /locus_tag="sll8048"
                     /note="sll8048; ORF_ID:sll8048;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942442.1"
                     /db_xref="GI:38505823"
                     /db_xref="GeneID:2656110"
                     /translation="MNTSITTTLHLGELTVAITYKGIKNVHLTVHPPQGEVRVSAPLT
                     MNPDTVRVFIISKLAWIRQQRRRILAQEREAPREYVNRESHLVWGQRYLLKVVEHQAP
                     PKVNLAPKTLDLYVRPHTPQEKRHQVISEWYRQQIKDVVPGLIAKYETVMGVEVREFG
                     VKRMKTRWGTCNPRAQRIWLNLELAKKPPACLEYVVVHEMTHLLEPKHNDRFWGFIDS
                     FYPQWQHYRDELNRLPLG"
     misc_feature    complement(42218..42844)
                     /locus_tag="sll8048"
                     /note="Protein of unknown function DUF45; Region: DUF45;
                     pfam01863"
                     /db_xref="CDD:145171"
CONTIG      join(AP004312.1:1..44343)
//
DBGET integrated database retrieval system