GenomeNet

Database: RefSeq
Entry: NC_005231
LinkDB: NC_005231
Original site: NC_005231 
LOCUS       NC_005231              44343 bp    DNA     circular CON 17-AUG-2015
DEFINITION  Synechocystis sp. PCC 6803 plasmid pSYSG DNA, complete genome.
ACCESSION   NC_005231
VERSION     NC_005231.1  GI:38505775
DBLINK      BioProject: PRJNA224116
            Assembly: GCF_000009725.1
KEYWORDS    RefSeq.
SOURCE      Synechocystis sp. PCC 6803
  ORGANISM  Synechocystis sp. PCC 6803
            Bacteria; Cyanobacteria; Oscillatoriophycideae; Chroococcales;
            Synechocystis.
REFERENCE   1
  AUTHORS   Kaneko,T., Nakamura,Y., Sasamoto,S., Watanabe,A., Kohara,M.,
            Matsumoto,M., Shimpo,S., Yamada,M. and Tabata,S.
  TITLE     Structural analysis of four large plasmids harboring in a
            unicellular cyanobacterium, Synechocystis sp. PCC 6803
  JOURNAL   DNA Res. 10 (5), 221-228 (2003)
   PUBMED   14686584
REFERENCE   2  (bases 1 to 44343)
  AUTHORS   Sato,S. and Kaneko,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-NOV-2001) Contact:Shusei Sato Kazusa DNA Research
            Institute, Department of Plant Genome Research; 2-6-7
            Kazusa-kamatari, Kisarazu, Chiba 292-0812, Japan URL
            :http://www.kazusa.or.jp/rhizobase/
COMMENT     REFSEQ INFORMATION: The reference sequence was derived from
            AP004312.
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider                    :: NCBI
            Annotation Date                        :: 08/17/2015 19:20:20
            Annotation Pipeline                    :: NCBI Prokaryotic Genome
                                                      Annotation Pipeline
            Annotation Method                      :: Best-placed reference
                                                      protein set; GeneMarkS+
            Annotation Software revision           :: 3.0
            Features Annotated                     :: Gene; CDS; rRNA; tRNA;
                                                      ncRNA; repeat_region
            Genes                                  :: 3,673
            CDS                                       3,602
            Pseudo Genes                           :: 23
            CRISPR Arrays                          :: 3
            rRNAs                                  :: 2, 2, 2 (5S, 16S, 23S)
            complete rRNAs                         :: 2, 2, 2 (5S, 16S, 23S)
            tRNAs                                  :: 41
            ncRNA                                  :: 1
            Frameshifted Genes                     :: 13
            Frameshifted Genes On Monomer Runs     :: 3
            Frameshifted Genes Not On Monomer Runs :: 2
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..44343
                     /organism="Synechocystis sp. PCC 6803"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:1148"
                     /plasmid="pSYSG"
     gene            complement(join(43288..44343,1..1914))
                     /locus_tag="SGL_RS01125"
                     /old_locus_tag="sll8049"
     CDS             complement(join(43288..44343,1..1914))
                     /locus_tag="SGL_RS01125"
                     /old_locus_tag="sll8049"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153818.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/DEAH box helicase"
                     /protein_id="WP_011153818.1"
                     /db_xref="GI:499467178"
                     /translation="MKTTDTSEKGLETIIVNSLVNEAGYVLGDPKDYDREHAVDLVKL
                     LEFLETTQPDTYGVLGINREGPKRTQFLHRLQGEIAKRGVVDALQTGIRHGPAHVELF
                     YGTPTPGNVKAVERFSNNIFSVTRQLRYSSVETALSLDMAVFINGLPIATFELKNRLT
                     KQTVLDAVEQYQRDRDPKELLLQFGRCAVHFAVDDHEVRFCTHLTGKGSWFLPFNKGH
                     NDGAGNPPNPNGIATDYLWKEVLTKEGLTDILENYAQIVEEKDEKTCRKKLKQVFPRY
                     HQLTVVRQLLATAKQDGVGKRYLIQHSAGSGKSNSIAWLAHQLVGLEQDGKALFDSII
                     VVTDRQVLDRQIRNTIKQFAQVSATVGHAERSGDLRQFIKDGKKVIITTVQKFPFILN
                     EIGDEHRQSKFAIVIDEAHSSQGGKTTAAMNRVLEGTASYNVANEEEEETTEDKINRI
                     LEGRKMVTNASYFAFTATPKNKTLEIFGQPAPQPDGTVKHYPFHSYTMKQAIQEGFIL
                     DVLKSYTPVESYYRLAKTVEDDPLFDAKKAQKKLRRYVESHQHAIREKTEIMVDHFHT
                     QVINHGKIGGQARAMVITNGIGQAIQYFYAFKDYLRERKSPYQAIVAFSGEYDYGGQK
                     VTEATLNGFPSSQITDKIEEDPYRFLIVADKYQTGYDQPLLHTMYVDKALSGIKAVQT
                     LSRLNRAHPQKYDTFVLDFYNDSGTIQSSFDPYYRTTILSNETDPNKLHDLKADLDSH
                     QVYTQEQIQYLVELYLNGADRDRLDPVLDACVAAYNADLDEDGQVDFKGKAKAFVRTY
                     GFLASILPYSNADWEKLSIFLNFLIPKLPAPKEEDLSRGILEAIDMDSYRVELKTSLK
                     IDLADEDAEIKPVPTAGGGSKPEADLDQLSNIIKAFNDQFGNINWKDNDKIRRVIAEE
                     IPAKVAADVAYQNAMRNNDKRTARIEHDAALQRVMIELLADHTELFKQFSDNQSFKKW
                     LGDTIFGATYRENWEAG"
     gene            complement(1920..2966)
                     /locus_tag="SGL_RS01130"
                     /old_locus_tag="sll8001"
     CDS             complement(1920..2966)
                     /locus_tag="SGL_RS01130"
                     /old_locus_tag="sll8001"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153772.1"
                     /note="sll8001; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Appr-1-p processing protein"
                     /protein_id="WP_011153772.1"
                     /db_xref="GI:499467132"
                     /translation="MFECKSGNILTEDTEALVNTVNCVGVMGRGIALQFKKAFPENFK
                     AYAQACKEEKVKPGEMFVFQTGQLVNPRFIINFPTKRHWRTHSRIDDIENGLKALKCT
                     IQKYKIRSIAIPPLGCGLGGLDWAEVKTRIEVILKPLDNVQIILYEPHGELSQAKTVQ
                     SLRAPKMTPGRAVLVELVSRYLQGLLDPFITLLEIHKLMYFMQESGEFLQLRYAKAPY
                     GPYAENLRHVLNVIEGHLITGYADGGDQPNKPIALLPNAIEKATTFLQDYPETHTRFE
                     KVTDLVEGFESPFGLELLSTVHWIVKNEPVNSLSDVIDRTYAWNQRKQQFTQRQIELA
                     VNVLNKKGWINRPY"
     gene            complement(2983..3621)
                     /locus_tag="SGL_RS01135"
                     /old_locus_tag="sll8002"
     CDS             complement(2983..3621)
                     /locus_tag="SGL_RS01135"
                     /old_locus_tag="sll8002"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153773.1"
                     /note="sll8002; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153773.1"
                     /db_xref="GI:499467133"
                     /translation="MTVPAQPKIYHIVHVDRLPSIIADGCLWCDAAISQRNPAGTTIG
                     MNKIKQRRLKELTLTSHPSLYVGQCVPFYFCPRSIMLFLIHKKNTELTYQGGQEPIIH
                     LEGDLIQAVNWADQNNLRWAFTLSNAGSSYFEDRNSLAQLHEIDWAAVQATNWQTCKE
                     GKQAEFLVESTFPWHLVERIGVKSRVIYDQVIKALPTGGHHPQVEVRPDWYY"
     gene            complement(3660..3839)
                     /locus_tag="SGL_RS01140"
                     /old_locus_tag="ssl8003"
     CDS             complement(3660..3839)
                     /locus_tag="SGL_RS01140"
                     /old_locus_tag="ssl8003"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153774.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153774.1"
                     /db_xref="GI:499467134"
                     /translation="MTNQQGNVNARNREEDPDILGSEKALRRAAQRARERAKQAGIGV
                     IILKDGEIVEELPDS"
     gene            complement(3836..4372)
                     /locus_tag="SGL_RS01145"
                     /old_locus_tag="sll8004"
     CDS             complement(3836..4372)
                     /locus_tag="SGL_RS01145"
                     /old_locus_tag="sll8004"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153775.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Zeta toxin family protein"
                     /protein_id="WP_041428288.1"
                     /db_xref="GI:752788432"
                     /translation="MSEPASPEKKVIIIAGPNGAGKTTFAEEFLPQEAQCLTFINADL
                     IAAGLAPFEPEQAAFRAGRLMLEEIYNHAQRGQNFAFETTLSGRSYARLIPTWQAQSY
                     IVKLFFLQLLSPELAIARVAQRVRAGGHHVPEAIIRRRFAAGLHNLETLYKLIVDEWV
                     CYDNSGNEPVLINKGGKL"
     gene            complement(4365..4655)
                     /locus_tag="SGL_RS01150"
                     /old_locus_tag="ssl8005"
     CDS             complement(4365..4655)
                     /locus_tag="SGL_RS01150"
                     /old_locus_tag="ssl8005"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153776.1"
                     /note="ssl8005; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase subunit beta"
                     /protein_id="WP_011153776.1"
                     /db_xref="GI:499467136"
                     /translation="MKRQSVLQLLSQSKADLQARFGVTRLALFGSTARDEAGPHSDVD
                     ILVGFDGPATSHRYFGVQFYLEDLLGCAVDLVTEKALRPELHPYVERERIYV"
     gene            complement(4652..6046)
                     /locus_tag="SGL_RS01155"
                     /old_locus_tag="sll8006"
     CDS             complement(4652..6046)
                     /locus_tag="SGL_RS01155"
                     /old_locus_tag="sll8006"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153777.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type I restriction-modification system S
                     subunit"
                     /protein_id="WP_011153777.1"
                     /db_xref="GI:499467137"
                     /translation="MKLKPYPEYKDSGVSWLGQIPAHWDIKPGFAFLSERKEKNTGMK
                     ESTVLSLSYGQIVVKPPEKLHGLVPESFETYQIAEPGNIIIRGTDLQNDKVSLRVGKV
                     RNRGIITSAYLCLETKEKFNPDYAHLLLHGYDLMKIYYGMGSGLRQNLSFSDFKRLPL
                     LAPPESEQSKINKYLQSIQVQINKFIRNKRRLIELLKEQKQNIINQAVTRGLDPNVKL
                     KPSGVKWIGDIPEYWSFLKLKRIACVKTGYAFKSDHYKSVGIPLIRIGDLKHSGLVDI
                     KQAVKLQESDLTHFSCFKIQYGDLLMAMTGATIGKVAKYQHQTEALLNQRVCSFRSFE
                     SKCFQDYLLFILSSEVYLKQVTIFCYGGAQPNISDSTLMSFKIPVPPISEQQAILSYV
                     QEQTKTTDSAVSRAEREIELIQEYYTRLMSDVVTGQVDVRDIEVPEITEEDLLTLEDK
                     SEVVDDDLVQEEDE"
     gene            complement(6043..6393)
                     /locus_tag="SGL_RS01160"
                     /old_locus_tag="sll8007"
     CDS             complement(6043..6393)
                     /locus_tag="SGL_RS01160"
                     /old_locus_tag="sll8007"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153778.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153778.1"
                     /db_xref="GI:499467138"
                     /translation="MRILLDECAPRPLKRELADYEIRTVTEMGWSGKKNGALLRLMNQ
                     EGFTVLLTTDQNLRYQQNLEQMDVAVIVLIAPSNRLADLVPLIPGVRDVLRTITSGQV
                     VEVGAEQNVGEVER"
     gene            complement(6377..6601)
                     /locus_tag="SGL_RS01165"
                     /old_locus_tag="ssl8008"
     CDS             complement(6377..6601)
                     /locus_tag="SGL_RS01165"
                     /old_locus_tag="ssl8008"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153779.1"
                     /note="ssl8008; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153779.1"
                     /db_xref="GI:499467139"
                     /translation="MVTTARVMHSDPDILGGVPVFVGTRVPIKTLLDYLEAGDPLDEF
                     LDHFPSVQRQQAIAILELAKQMLTAYANPA"
     gene            complement(6652..8151)
                     /locus_tag="SGL_RS01170"
                     /old_locus_tag="sll8009"
     CDS             complement(6652..8151)
                     /locus_tag="SGL_RS01170"
                     /old_locus_tag="sll8009"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153780.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type I restriction-modification system M
                     subunit"
                     /protein_id="WP_011153780.1"
                     /db_xref="GI:499467140"
                     /translation="MQDIDGNEVLSALDNHSMGTIFEELIRRFNEENNDEAGEHFTPR
                     DVVKLMADLIFLSIGDLIESGTYLVYDGACGTGGMLTVAEERLAELAQNQGKEVSIHL
                     FGQEVQPETYAISKADLLLKGEGAEAENMKYGSTLSSDAFPSQEFDFMLSNPPYGKSW
                     KTDLERLGGKGDIKDPRFVTRHGDEADYKMITRSSDGQLMFLVNKLAKMKHNTRLGSR
                     IAEVHNGSSLFTGDAGQGESNIRRWIIENDWLETIIALPENIFYNTGIATYIWLLSNR
                     KNEERRGKVQLIDGTEWYVPLRRNLGKKNCELSEEQIQTIVDLVVNPRETEKSKIFPN
                     QAFGYWKVTVDRPLRVEGADPQRVYKAAEIKAFKSEGRVTEEGVPIIKKIHKKGTRPD
                     PIHGLFEVEIGGKPCVVEYEPDSNLRDSEQIPLLEDGGIEAFFRREVLPYTPDAWIEA
                     SKTQIGYEVSFTRHFYKPVPMRTLDEIKADIYALEQETEGLLEQIVGNA"
     gene            complement(8440..8619)
                     /locus_tag="SGL_RS01175"
                     /old_locus_tag="ssl8010"
     CDS             complement(8440..8619)
                     /locus_tag="SGL_RS01175"
                     /old_locus_tag="ssl8010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153781.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="restriction endonuclease subunit M"
                     /protein_id="WP_011153781.1"
                     /db_xref="GI:499467141"
                     /translation="MNPVSHNNIVNFIWGIADDVLRDVYVRGKYRDVILPMTVIRRLD
                     AVLEPSKEKVLTMKG"
     gene            complement(8821..9195)
                     /locus_tag="SGL_RS01180"
                     /old_locus_tag="sll8011"
     CDS             complement(8821..9195)
                     /locus_tag="SGL_RS01180"
                     /old_locus_tag="sll8011"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153782.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153782.1"
                     /db_xref="GI:499467142"
                     /translation="MLGFLLDEHISPVVAQQVISKAPDIEIYPLLTWQGGLYLGFPDE
                     VILEAATTAQLVLVTYDQKTIPPILWTWGEQGQSHSGIIFVDYQSMPPQDFGSLVQAL
                     LKLWKDERERGWTDRLLYLKCS"
     gene            complement(9205..9621)
                     /locus_tag="SGL_RS01185"
                     /old_locus_tag="sll8012"
     CDS             complement(9205..9621)
                     /locus_tag="SGL_RS01185"
                     /old_locus_tag="sll8012"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153783.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153783.1"
                     /db_xref="GI:499467143"
                     /translation="MSIVVSTRLPDLTHERLQRFARCLGKTPSETTALLVEESLRQQD
                     FPYIEFRQTPLGRHAHLKNSTLAVWEVVRIAQGYALDPEKTAQHFQRPLPWVKSALLY
                     AEAYPEEINIAITDAGAVNETTLTRLLPQLEVQGQS"
     gene            9713..9940
                     /locus_tag="SGL_RS01190"
                     /old_locus_tag="ssr8013"
     CDS             9713..9940
                     /locus_tag="SGL_RS01190"
                     /old_locus_tag="ssr8013"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153784.1"
                     /note="ssr8013; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153784.1"
                     /db_xref="GI:499467144"
                     /translation="MTAQEKLYQLIQTLPEKEVSEILNFAESLWPKVSSPKIPAGTLT
                     GLRGIAKPTGPVPSDAELQRQYTDYLKEKYL"
     gene            9948..10373
                     /locus_tag="SGL_RS01195"
                     /old_locus_tag="slr8014"
     CDS             9948..10373
                     /locus_tag="SGL_RS01195"
                     /old_locus_tag="slr8014"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153785.1"
                     /note="slr8014; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_011153785.1"
                     /db_xref="GI:499467145"
                     /translation="MKVLLDTNIVLDLLLEREPFIEETIAIFEEIEQGNIEAYIAATT
                     VTNIFYIIRKNKSREVALIAVKRLLIGLQLCPVNLQVIEVALDINLRDFEDSVQLACA
                     TVNQLTAIITRDTKDFVESPLPIYSPAECLYRVKTNKLD"
     gene            10395..10994
                     /locus_tag="SGL_RS01200"
                     /old_locus_tag="slr8015"
     CDS             10395..10994
                     /locus_tag="SGL_RS01200"
                     /old_locus_tag="slr8015"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153786.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning protein ParA"
                     /protein_id="WP_011153786.1"
                     /db_xref="GI:499467146"
                     /translation="MSKTIAIVSRKGGVGKSTLCANLAVVARDATILDCDDQASLADW
                     GDRRGNNSPLVIAVPPKRAISTLEKATTDWNFIDTPGTLDAGIIEVMQASDFVLVVLR
                     YGQFDLDSVSTTLSAVRLSQKPAAIVLNLLHPNTKSQDLITNLEDAQLGYPISPHAVC
                     SRADFQQAAAQGRGVTELEQSSKASYEIRALWHWLQQQV"
     gene            10998..11867
                     /locus_tag="SGL_RS01205"
                     /old_locus_tag="slr8016"
     CDS             10998..11867
                     /locus_tag="SGL_RS01205"
                     /old_locus_tag="slr8016"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153787.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid partitioning protein"
                     /protein_id="WP_011153787.1"
                     /db_xref="GI:499467147"
                     /translation="MAKRQSLDISKAQARSATSEAAEETLQRQQMKEGLVPLDKIGDR
                     PEGDTRQINAKHVKELVESIQVLGLITPLTVDRHYRLLAGGHRKAALEKLAAESPETF
                     TAFFGEGVPVNIMDIDAETATLTALQVEVEENTQRKNYTPSEIREAARKLKEAGYEKL
                     KGRPSKGQKSINRELMSVFGASRRYITKILNDPEDEQQKQKSAHMCALFSKIKRYHEQ
                     TEAFKDYISKNSPKDAINPELNVIRLSLIEKLKETQALLEGLHIVEQLQTKATSPSIA
                     GENHSTQEEKLEV"
     gene            11947..12192
                     /locus_tag="SGL_RS01210"
     CDS             11947..12192
                     /locus_tag="SGL_RS01210"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041428291.1"
                     /db_xref="GI:752788435"
                     /translation="MPILQTMSDILDRKFINLETTRSTLKQKILRDRARGLDFGYYEL
                     SVRPLYIKAWHLYCSFFIMHSEMEKYSYTDRSRVELE"
     gene            complement(12618..13151)
                     /locus_tag="SGL_RS01215"
                     /old_locus_tag="sll8017"
     CDS             complement(12618..13151)
                     /locus_tag="SGL_RS01215"
                     /old_locus_tag="sll8017"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153788.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153788.1"
                     /db_xref="GI:499467148"
                     /translation="MTELAQEAGVSVRTVQTWAKAGYFSKQGSNAYDILGYYRWYTRS
                     LRQDLDEHKAKVARSDWDTKWREGRARKSLAEASLVELQMQSKVKQVVPIDLVISEID
                     KVLSSSIRLFRDLPSYFSAPHCYQSSSEVAAALEQAVSLALKDFQSQLVSLSLGAELV
                     EKSKVFHDSFSSSDTSS"
     gene            complement(13695..15287)
                     /locus_tag="SGL_RS01220"
                     /old_locus_tag="sll8018"
     CDS             complement(13695..15287)
                     /locus_tag="SGL_RS01220"
                     /old_locus_tag="sll8018"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153789.1"
                     /note="sll8018; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153789.1"
                     /db_xref="GI:499467149"
                     /translation="MVMGIIKNHLSPRAHSKRKTKTASDHELLGVRINGFPVAVGIRK
                     GAGPKAQLHSIQGDHRILTYKKATYFAVPIKGKVKSESVEVPQSEPNPAIKEFYPRQV
                     KEDFQRLFSHPFKAILKNDQGQWFTCKYSLNKNRIWNYWKSPSTTIGLGFGKSTSWAA
                     LDLDADGRYHNSESLAGIREALEELAIVSSQLVQSSDSGGWHLFMFFDRPVKTFPLAC
                     LLTETLTSAGFSIEPGHLEVFPNRKQWKAEGSIYNRIRLPLQSGTGSLMLTNDGELDS
                     TGWPDSLELFLKRAKAIARKNDTERIEELGEEAKKRFATARKAQDHGPFLPTRSSKWL
                     KEINTVLEVGFTAHHQSNEILRAVAAKGRVFLGLGGEALASYIEQTVTELPGYGQWCR
                     HQPEIAAWCIRWARSAEKKLYPFRGKPKVDKALTSAGPNNQTRAREAQERIARTVAQL
                     TAENCWPEGAKARLKHIIKGAKCSAKTAYKYSQLWHPVCAPTALLPTCPGPRLPAPLH
                     LCDRLTPAAPASPMCSLPHGSS"
     gene            complement(15590..17317)
                     /locus_tag="SGL_RS01225"
                     /old_locus_tag="sll8019"
     CDS             complement(15590..17317)
                     /locus_tag="SGL_RS01225"
                     /old_locus_tag="sll8019"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153790.1"
                     /note="sll8019; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153790.1"
                     /db_xref="GI:499467150"
                     /translation="MLTTKHLPQSYTGQRFCRFFKHRFNFIKSSYSSTPEWITISDYP
                     IEHRNLWSVYQDPERLIGLSFGTTTHYAVLDIDCSSPYHPGNSESQYRELLGAYEEVG
                     INSVVTLQSSNSGGLHVYFVFPKALPTFKLAHMLRLTAIKAGYEVKDGKLEIFPNTKT
                     YSKHSKTSYKAVRLPLQRGSWLLDKDFVPYSNDIEVFLEQGEGAAEEQDIELIETAIE
                     SASHIKQFRRVKGEGDACSFAQDLREQIGEGWTSFGQTNDLLRIIGTYGRVFKGLEGQ
                     ALADYIVRTAETSPGYQQYCQHKHNIQRRSKDWGRCIEKYYYPYGSEPTRSGTFKDMQ
                     RTGNRQARQVKENVVNRTRQEEAVARIKQGMDYVRQTMAVLPVKVGAMKDLLLEAIYH
                     LFGKRTSDSTLSRYREYWHPDYVSVTSPPVGESSSTIIDNDDNDSASIDAIESEIDLD
                     VENIESSSKNSCHTPYESLSSTQDKKDISKPLSEETFSLSATPPSYMKVYVLNSFASG
                     LVSRMVFGKESSSKLYSIQPASLVTLCSGAIHSLHPYLVYVKPLEGAEDWISGIAVLF
                     SSLTLVNDS"
     gene            complement(17687..18385)
                     /locus_tag="SGL_RS01230"
                     /old_locus_tag="sll8020"
     CDS             complement(17687..18385)
                     /locus_tag="SGL_RS01230"
                     /old_locus_tag="sll8020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153791.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cyclic nucleotide-binding protein"
                     /protein_id="WP_041428295.1"
                     /db_xref="GI:752788439"
                     /translation="MQIDVQQLQYISLFKELEPLLLGQLAEHSSLKTYESDEVVFYEG
                     DALPACLYLLVTGSLRLTKISESGKETILRLLRADEVFAAPALFGNGVAPATATALEP
                     IKVLTIEREALLNGFREAPEMALHMLGIFNQRLQHLHSRVHCLVSERAIVRLIHYLKY
                     FADSGGTETVPEGQRLRARLTYYQIARSIGITYEECARVFKQLKGSVTYQRGGKITIL
                     DTNQLTAIVQQNSN"
     gene            18529..19311
                     /locus_tag="SGL_RS01235"
                     /old_locus_tag="slr8021"
     CDS             18529..19311
                     /locus_tag="SGL_RS01235"
                     /old_locus_tag="slr8021"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153792.1"
                     /note="slr8021; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="WP_011153792.1"
                     /db_xref="GI:499467152"
                     /translation="MTVTPLNLKTASGHQVLAAAGKKILRPGGRKATEILFTWVNFQP
                     GETVLELAASFGYSAIALAQRYGVKVVGIEKNPDSVARARANVEAAGLSAQVDIREGD
                     FFHLERIPGQFDYVLGEAILSMQSAPAKAKILQGVGARLKPGGQYLSHEMLAQGAHIE
                     DIYRELATTIRVNTAPLNELDWQGTYEQANLTVQQHRTGPMALLNPLTIAQEEGLGTL
                     LSLGWNLLVHPPMRQRILAMRRVFTKYGDDLGYIILRAQKPS"
     gene            19356..19691
                     /locus_tag="SGL_RS01240"
                     /old_locus_tag="slr8022"
     CDS             19356..19691
                     /locus_tag="SGL_RS01240"
                     /old_locus_tag="slr8022"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153793.1"
                     /note="slr8022; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cupin"
                     /protein_id="WP_011153793.1"
                     /db_xref="GI:499467153"
                     /translation="MKTPILSFQATFTRLQEHIEYPQAGVLSKTLLQDKTCQYTLFCL
                     AANTEISEHTSTRNAVVQGIEGTGILTLEGKDISLDPGVFIVMPAHAPHALKAISNLS
                     FLLTLSQPN"
     gene            19938..21278
                     /locus_tag="SGL_RS01245"
                     /old_locus_tag="slr8023"
     CDS             19938..21278
                     /locus_tag="SGL_RS01245"
                     /old_locus_tag="slr8023"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153794.1"
                     /note="slr8023; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153794.1"
                     /db_xref="GI:499467154"
                     /translation="MKASFGTERNSFEVQVSGGRLIGSVSEGLGSFLGIPYAAPPVGA
                     LRWKPPVADIGWDGARSATSFGNPCTQYLDTIPVITERQRTPSEDCLYLNVWTPAPGD
                     SAKLPVMVWFHGGAFVIGSGSATEFDGANLARHGVVVVTVNYRLGPFGFLSHPELADE
                     SSHGASGNYGLLDQLCALQWVAENIAAFGGDPGCVTLFGESAGGISISCHLASPLSRG
                     LFSRAIMQSGTWFTIPHGLPQASTDPEQAAANASKFAASLRCSTQGKVIEELRKRTDG
                     ELLAATERRMLFCPVVDGWFLPEDPELIFATAKATPVPTILGFNADEGTRFTHTAPGS
                     PEAEELSLRIAVEPTRRMAALMTAPSYCYRFSRVPNTELASRFGAYHGIEVPYVFGNL
                     DARLGYEEEDFALSERMIRYWTTFASSACPDPVGAMTWLRYNKDDENILNLGEG"
     gene            complement(21810..22325)
                     /locus_tag="SGL_RS01250"
                     /old_locus_tag="sll8025"
     CDS             complement(21810..22325)
                     /locus_tag="SGL_RS01250"
                     /old_locus_tag="sll8025"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153796.1"
                     /note="sll8025; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153796.1"
                     /db_xref="GI:499467156"
                     /translation="MRLKISKRSWLLSLHIATGGVWFGTALCSVALALSILLLKPGEA
                     IHGINLARNVLGQYIIIPAAVFSVITGVLLCGFTNWGFFKHYWVMVKQLVTLVLIMLG
                     SVWLGPMTKEMTALSEAGRSQVLQNPDYLTLQTTATLVGALQTLALLTVIIVSTLKPW
                     GKRRAVQSSTK"
     gene            22461..22985
                     /locus_tag="SGL_RS01255"
                     /old_locus_tag="slr8026"
     CDS             22461..22985
                     /locus_tag="SGL_RS01255"
                     /old_locus_tag="slr8026"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153797.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_011153797.1"
                     /db_xref="GI:499467157"
                     /translation="MQIFPRREAFHELECDFSSFDLEAVGTCLAFLDTTGEVYAAFDK
                     HFERFGLSAGKFTILMQLYTAKRGLSPSEFANRANVTRATITGLLDRLEREGLVERKA
                     HSNDRRMLTITLTEQGKKLVERVLPEHFCRTKGLMTNLTSTEKKTFIKLLDKLRSGIP
                     ALSDPSWDHNNLTS"
     gene            complement(23434..23859)
                     /locus_tag="SGL_RS01260"
                     /old_locus_tag="sll8027"
     CDS             complement(23434..23859)
                     /locus_tag="SGL_RS01260"
                     /old_locus_tag="sll8027"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153798.1"
                     /note="sll8027; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="twitching motility protein PilT"
                     /protein_id="WP_011153798.1"
                     /db_xref="GI:499467158"
                     /translation="MKASPRVVIDTNLLVSALIFGGVTGKLRGIWQSGGCIPLVSKVT
                     VTELMRVLAYPKFRLSPTEREDLLADYLPFCETVRIPNPPPATPPCRDPFDVPFLVLA
                     LVGQADYLITGDKDLLELEVEDSFPCSIVLLEQFLLDVA"
     gene            complement(23856..24077)
                     /locus_tag="SGL_RS01265"
                     /old_locus_tag="ssl8028"
     CDS             complement(23856..24077)
                     /locus_tag="SGL_RS01265"
                     /old_locus_tag="ssl8028"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153799.1"
                     /note="ssl8028; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AbrB family transcriptional regulator"
                     /protein_id="WP_011153799.1"
                     /db_xref="GI:499467159"
                     /translation="MLAKLTSKNQLTLPKSVTQQIGSAEYFEVTVQGGQIILTPVRIQ
                     RADAVRAKLAALNITEEDITNAVDWARQS"
     gene            24295..24861
                     /locus_tag="SGL_RS01270"
                     /old_locus_tag="slr8029"
     CDS             24295..24861
                     /locus_tag="SGL_RS01270"
                     /old_locus_tag="slr8029"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153800.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="resolvase"
                     /protein_id="WP_011153800.1"
                     /db_xref="GI:499467160"
                     /translation="MAIVGYARVSSVGQNLDVQLEKLSHCDKVFKEKQSGSSHQRPVL
                     QECLRYLREGDTLVVTRLDRLARSTLHLCQIAAELEGKQVVLQVLDQNIHTGDATGRL
                     LFNMLGAIAQFETEIRAERQMDGIQNAKARGVRLGREKQLTEQQVLELRQRREQGTLI
                     KILMKDYKLSKASIYRYLNGTKVVELAH"
     gene            25147..27345
                     /locus_tag="SGL_RS01275"
                     /old_locus_tag="slr8030"
     CDS             25147..27345
                     /locus_tag="SGL_RS01275"
                     /old_locus_tag="slr8030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153801.1"
                     /note="slr8030; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153801.1"
                     /db_xref="GI:499467161"
                     /translation="MVWSRRNFLAVMGLGAGAALFNPRQYPLTAAIPKIGDRHGDLSF
                     QPIDYPIPLATDGLTPAQQKTAFATFAVQDELVLPSDFFYTVLGQWGDPVGDHWFGFN
                     NDYLGLVETDENTAYLLINFEYISFIPWRQGYEMAIGKSLPIETVLTAAEAQGGKINA
                     FALAADNPVKIDIEALCEAALVDQGMGVIRLERNGQGDWQRSPNATDRRITGLSGLTD
                     SHYLTATGPAIAIFTNPTKQGYDDGLGEKIIGTFGNCAGGTTPWGTVLSAEENFQSQV
                     PEAVYADGSAVDPAQCPLKISTNGLSGQGNVFGLAGNKYGWMVEIDPANANDYGVKHT
                     ALGRFRHEAVAVRATANQPLAVYSGCDRTSGHLYKFVSADTVKSPTDKGNSRLFTAGT
                     LYGAKFNADGTGEWIALTPDTVVNPVRPSDIAVDSSTTGIVYLPHPDRNQAGAIAIDT
                     DHAVAEYQTQFATLADLYPIESDRQQGAILVDAHLAANAAGVTPTARPEDTEILPDGS
                     VLIAFTSGWPSQGDGGCDRHIFQGPQGEVPCNSGWIMRLQETGDRCDALTFGWAMIAA
                     GGEPSQGGLGFANPDNLAIDGRGNLWMVTDMSTSKHNRKFEREADTTSLDSVGVFGNN
                     SLWYLPLHGPNAGQIFPFAIGPMDSELTGPVFSQDQKTLFLAVQHPGELNGLRQTEIV
                     TMPLTTTNGEPFLQTRTVPLQSHWPNSGDMLSRPAVVTIQRRTRQPFHSS"
     gene            complement(27353..28012)
                     /locus_tag="SGL_RS01280"
                     /old_locus_tag="ndhK2"
     CDS             complement(27353..28012)
                     /locus_tag="SGL_RS01280"
                     /old_locus_tag="ndhK2"
                     /EC_number="1.6.5.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P17062.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)H-quinone oxidoreductase subunit K 2"
                     /protein_id="WP_011153802.1"
                     /db_xref="GI:499467162"
                     /translation="MSTSTHALTLQNPIQAPQVTKELSENVILTCLDDIYNWARLSTL
                     YPMMFGTACCFMEFMAAFGPRFDLERFGSIPRATPRQADLMITAGTITMKYAPALVQL
                     YEQIPEPKYVIAMGACTITAGMFSADSPTAVRGVDKLIPVDVYIPGCPPRPEAVIDGI
                     IKLRKKVAGESRQDYTEDLQTHRFHAVRHRMKPVSPILTGQYLRHHEDLTPHHDPLLI
                     K"
     gene            complement(28120..28461)
                     /locus_tag="SGL_RS01285"
                     /old_locus_tag="sll8032"
     CDS             complement(28120..28461)
                     /locus_tag="SGL_RS01285"
                     /old_locus_tag="sll8032"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153803.1"
                     /note="sll8032; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153803.1"
                     /db_xref="GI:499467163"
                     /translation="MSNLILQINVTYDCSQAELENVFSHAVGAIAAFPGLTWKIWIIN
                     DGTKEAGGLYCFDSETALTAYVNSPIITALKANPLLPTVQIKAFEAITALTTQTRGPV
                     PALALQSSVGA"
     gene            complement(28521..28919)
                     /locus_tag="SGL_RS01290"
                     /old_locus_tag="sll8033"
     CDS             complement(28521..28919)
                     /locus_tag="SGL_RS01290"
                     /old_locus_tag="sll8033"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153804.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153804.1"
                     /db_xref="GI:499467164"
                     /translation="MRALPSFPTTTSIALAIRPLQPPRLLNFQENSMNNFTHNAQTLL
                     EQQRPNLEITLQENTRPTVDQPARLRHFFGRLGNTLVQWLTQKSTLRIHRSTQGETEV
                     WEVYDPRDHRTHFFTHENEVRIWLEECYYR"
     gene            complement(29006..30040)
                     /locus_tag="SGL_RS01295"
                     /old_locus_tag="sll8034"
     CDS             complement(29006..30040)
                     /locus_tag="SGL_RS01295"
                     /old_locus_tag="sll8034"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153805.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-nitropropane dioxygenase"
                     /protein_id="WP_011153805.1"
                     /db_xref="GI:499467165"
                     /translation="MLTTQITQTYHLTTPIISAGMAFVATPKLAAAVSNAGGMGTFSA
                     FMSPPEELRALIRQTRSLSDRPFGIDFITAAANDDHIAICMAERVPVVIFFWSFPPLD
                     WVTQLQNAGVKVWMQVGSLAEATQAKAQGFDAIIAQGQEGGGHNRSEASIFSLLPAIC
                     REVAPIPVIAAGGIIDGRGLVAALALGAEAVWCGTRFLASEEAYAHPEYKARVVTATV
                     GDTTRTTLFGPEMPGQLMRVLRNLAVNQWGDRVADATKHGPTQPAIGSTILGGQALPM
                     PKFSAILPTPDTSGDFEEMCLTAGESSGNITAIKSARDILWEMENEALDLLTYRLQAI
                     TKEQNLMAAG"
     gene            complement(30084..30587)
                     /locus_tag="SGL_RS01300"
                     /old_locus_tag="sll8035"
     CDS             complement(30084..30587)
                     /locus_tag="SGL_RS01300"
                     /old_locus_tag="sll8035"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153806.1"
                     /note="sll8035; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153806.1"
                     /db_xref="GI:499467166"
                     /translation="MFANVIATLFRMDDQTWRGHANPWCVWTRLTVAPLLLLSVWSRV
                     WLGWWSLIPIAIALLWNWYNARLFSPPQSTDNWASKGVLGERVWINRHQVSIPTHHYT
                     FPHFLAGLAAVGSVIAICGLWALNLPLTLLGLLLLYMGKLWFFDRMVWLYEDMKTATP
                     EYTSWLY"
     gene            30678..31376
                     /locus_tag="SGL_RS01305"
                     /old_locus_tag="slr8036"
     CDS             30678..31376
                     /locus_tag="SGL_RS01305"
                     /old_locus_tag="slr8036"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153807.1"
                     /note="slr8036; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153807.1"
                     /db_xref="GI:499467167"
                     /translation="MLSLGQIYGISVYGKLWHLPAPFSIQVLCPNIVVIRSPFKLAFH
                     RWSDHVRIMPILPTGDTIRLATAADLPWLLPIERQAAQRFLTCLDQTGLTAAILEQTK
                     AIADFEQACRSEHLWVAVSPTRQLVGFAFVRMLDGYAHLEELDVLPDHGKRGIGRALV
                     AAVYDWAQGAGHPGVTLRTFREVPWNAPFYQRCGFRIVDSAQLSPQHGELEKAEQRLG
                     LRTDLRVSMVYRCD"
     gene            31993..32598
                     /locus_tag="SGL_RS01310"
     CDS             31993..32598
                     /locus_tag="SGL_RS01310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015172208.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Cro/Cl family transcriptional regulator"
                     /protein_id="WP_041428296.1"
                     /db_xref="GI:752788440"
                     /translation="MNAYLCKTEVINWQHPDIQALAQQLAAGHETPVVIAQACFEWVR
                     DAIRHSVDYQMNPVTWRASDVLQHKTGYCFAKSHLLAALLRANQIPAGFCYQRLSIDD
                     RGTPYSLHGFNAVYLPITGWHRVDPRGNKPGIDTKFSPPIEHLAYQPKLDEEADFSAI
                     LAEPLAIVVTALQTHATWDALLHHLPDMTPNTATTIGLYCY"
     gene            32698..36411
                     /locus_tag="SGL_RS01315"
                     /old_locus_tag="slr8038"
     CDS             32698..36411
                     /locus_tag="SGL_RS01315"
                     /old_locus_tag="slr8038"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153809.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="WD repeat-containing protein"
                     /protein_id="WP_011153809.1"
                     /db_xref="GI:499467169"
                     /translation="MPFEDALAIVNAAMQTLLGRQLSDIETLIFEGSWQSKTYPQIAD
                     GAGYSINYLTTDVGPKFWKVLSQALGEPVNKKNFKAAIRRYCVVQSGGEWESEGFQTQ
                     LPSYPSILSWGEAPDVSQFYGREEEQALLQRWIEAERCRLIAVLGMGGIDKSTLTTKV
                     VQGFVQGDGVEEWEGDNINIKKIQNPLQEGQSPTKFKIQHLPSSPATPFTHIIWRSLR
                     NAPPLEALLAELIDLLSEHQETVGDRARLLHWLRKTRCLIVLDNLETILQAGDHAGYY
                     RDGYGDYGELIQLLGETPHQSCVLLTSREKPAEIAVLEGLDGNTRTLQLSGSVATAIA
                     IIQQKGLQGTEEQQQVLCDRYSYNPLALKIVSTTIQDLFDGDISAFLTEDAVIFNSIR
                     RLLDAQFQRLTELEQAIIIWLAINRDWTAIAELAADLVPPVPKVKLLEALESLRWRGL
                     IETQDKRYTLQPVVMEYVTERFIEQINQELEMGQPQYWQQFALLKLTVRDHITETQRR
                     LIVHSTAAQFGDCFPSPELQRQQLQTVLTAIRESVIAGYGVGNLINLSNALDLDLAGF
                     DFSQLTIRQADLRHRLFQHLNFAQANFRDSAFKQTFGSIFSLSYSPAGDYLITGDDVG
                     VVRLWKSAEMQPMQSYPLHRSYVWDLRPSADGRWLATCSEDQTVKITNLATGQLQATL
                     VVAPTIARAIVWIGPDCLAIGGIDGHIRLWYPFTEQAPVLVTAHTDIVNSLSWDANSN
                     LLASSSSDSTVKLWDVETGICHRIWREAVPVRWATWSPDGHTLAISREDGGIVLWNPH
                     SDQAPRYLNGHPETVWSLDWNPDGAWLASSSHDATVRLWDVVTGRCRRILRSHQNWVW
                     YARWHPHQPRIISGGHDGTLKLWDTGTGQCLKSLTGHMANIRAIAPAPDGQTLALGCD
                     DTIVRLCGADSPPSFIHAFGHSHLISDLCWNPTGENLASASHDCNLRVWQRSPLRCTQ
                     VLKGHTNWVWSVDWHPTQDLLASGSVDSTIRLWYPTQSTPVKTLMAQTSWILSVRWHP
                     TGRWLASAAGDFTIGLWNSKTWECTHLLTGHTHWIWCLAWSPNGQYLASGGYDNTVFI
                     WKVEKEVTSLRTLEHPTILSAIAWHPDGELLATSCHDGNIRLWHWQTGQCVTRISGHQ
                     GEILTLKFSPDGKRLYSSSQDETWKTWDWQTGTCLASDRLDRPYEGMNISEVRGLTEV
                     RKAALRALGATEGSQPPGDLVRWLRKTEQGRKL"
     gene            complement(37299..38048)
                     /locus_tag="SGL_RS01320"
                     /old_locus_tag="sll8040"
     CDS             complement(37299..38048)
                     /locus_tag="SGL_RS01320"
                     /old_locus_tag="sll8040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153811.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153811.1"
                     /db_xref="GI:499467171"
                     /translation="MEILTRYNSTPHTEPQHINSDETKNKRSLPPVFKAQKSKKKQLR
                     HCKHGSISALSKVINHATVFTKINFFTWKQTKDGYLYLERDDARSLFNLLDETGIFDF
                     HVTNIQKKIIYQHQVSKFLSNGWRLYANGYFARKGEVEIHHLDANKQNNDPRNLRYVS
                     PGLNYLCARAIKHEYTGEDIPDSVIESYEEAEYLVKLTFKRYLKRLGYSMSKSERDFL
                     LSLKWNIAREILQSWQPPAQVTELIEKLVQK"
     repeat_region   38538..39490
     gene            complement(38568..39062)
                     /locus_tag="SGL_RS01325"
                     /old_locus_tag="sll8042"
     CDS             complement(38568..39062)
                     /locus_tag="SGL_RS01325"
                     /old_locus_tag="sll8042"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010871314.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_011153813.1"
                     /db_xref="GI:499467173"
                     /translation="MLRELIKLYSSQAIVYIDESGFEAIQACIYAWSKKGKKVYGDRQ
                     GKRGVRENLVAGRRKGKKDLIAPMVFTGSLNAEGFEGWLKLYLLPSLDIPSILIMDNA
                     PIHRKTAIKELAKEAGHEVLFLPKYSPDLNDIEHDFSALKRARMYAPIDTSLDEIIRS
                     YCGV"
     gene            complement(39056..39415)
                     /locus_tag="SGL_RS01330"
                     /old_locus_tag="sll8043"
     CDS             complement(39056..39415)
                     /locus_tag="SGL_RS01330"
                     /old_locus_tag="sll8043"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010872427.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_011153814.1"
                     /db_xref="GI:499467174"
                     /translation="MAYSLDLRQRVVAYIEAGGKITEASKICKIGKASIYRWLNRVDL
                     SPIKVERRHRKLDWEALKKDVEENPDARLIDRAKKFGVRPSAVYYALKKMKINRKKKN
                     YVIEKETGRNELSTIEC"
     gene            39491..40969
                     /locus_tag="SGL_RS01335"
                     /old_locus_tag="slr8044"
     CDS             39491..40969
                     /locus_tag="SGL_RS01335"
                     /old_locus_tag="slr8044"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153815.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153815.1"
                     /db_xref="GI:499467175"
                     /translation="MGSMTAEEALKRTVAKVLLGGPMSNEAAEQLATAAKSLFDVAIN
                     EYAIETTDGRYSFNEQQSRSASLLAFYLKAAEDVLTDIKVEGRMNTKALSELGYVDHL
                     DRLQNLDLTGGLAYINEIEQNVRQSAILGEEDSLAVWTIMDELKQGYTQVKSGAVSPD
                     SLEGMLSTAKEQLGQLGANTNMLTSTIDLYLENEDVALRYKEAGRAANIILPTAEELE
                     QASGTEYEQMREQLKLSLYNLYSFGQLNKYLQTQMDPGLNRVTVATGMQDTTRLEAHY
                     AQLLTQAELDLYTVSTKDKEAYASIQETLITLGSMLEENLGYMNQAKVRSTYALQHMS
                     VLQLGALSSDNLGINWGGVDPDNNLTEQQRRAIEVDTLASQLTFEFSQGYSSSTAKTL
                     PRVLTGRQNKGLLSASPAYNFFKGFFDAYASGRPEDFENLQENAAYMRDVKRVSSQVM
                     RNGYDSVDSRVNILVDDYVRQLISPESPISSQARFLVSDLST"
     repeat_region   40981..41933
     gene            41056..41415
                     /locus_tag="SGL_RS01340"
                     /old_locus_tag="slr8045"
     CDS             41056..41415
                     /locus_tag="SGL_RS01340"
                     /old_locus_tag="slr8045"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010872427.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_011153814.1"
                     /db_xref="GI:499467174"
                     /translation="MAYSLDLRQRVVAYIEAGGKITEASKICKIGKASIYRWLNRVDL
                     SPIKVERRHRKLDWEALKKDVEENPDARLIDRAKKFGVRPSAVYYALKKMKINRKKKN
                     YVIEKETGRNELSTIEC"
     gene            41409..41903
                     /locus_tag="SGL_RS01345"
                     /old_locus_tag="slr8046"
     CDS             41409..41903
                     /locus_tag="SGL_RS01345"
                     /old_locus_tag="slr8046"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010871314.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_011153813.1"
                     /db_xref="GI:499467173"
                     /translation="MLRELIKLYSSQAIVYIDESGFEAIQACIYAWSKKGKKVYGDRQ
                     GKRGVRENLVAGRRKGKKDLIAPMVFTGSLNAEGFEGWLKLYLLPSLDIPSILIMDNA
                     PIHRKTAIKELAKEAGHEVLFLPKYSPDLNDIEHDFSALKRARMYAPIDTSLDEIIRS
                     YCGV"
     gene            41994..42194
                     /locus_tag="SGL_RS01350"
                     /old_locus_tag="ssr8047"
     CDS             41994..42194
                     /locus_tag="SGL_RS01350"
                     /old_locus_tag="ssr8047"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153816.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153816.1"
                     /db_xref="GI:499467176"
                     /translation="MSLDRQLNLLSTVKSINAKSKDILDSDPEEITLKEFENIISIYL
                     KVIMFNRGLLYEEEFGDIDIDS"
     gene            complement(42203..42913)
                     /locus_tag="SGL_RS01355"
                     /old_locus_tag="sll8048"
     CDS             complement(42203..42913)
                     /locus_tag="SGL_RS01355"
                     /old_locus_tag="sll8048"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153817.1"
                     /note="sll8048; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metal-dependent hydrolase"
                     /protein_id="WP_011153817.1"
                     /db_xref="GI:499467177"
                     /translation="MNTSITTTLHLGELTVAITYKGIKNVHLTVHPPQGEVRVSAPLT
                     MNPDTVRVFIISKLAWIRQQRRRILAQEREAPREYVNRESHLVWGQRYLLKVVEHQAP
                     PKVNLAPKTLDLYVRPHTPQEKRHQVISEWYRQQIKDVVPGLIAKYETVMGVEVREFG
                     VKRMKTRWGTCNPRAQRIWLNLELAKKPPACLEYVVVHEMTHLLEPKHNDRFWGFIDS
                     FYPQWQHYRDELNRLPLG"
     gene            complement(42903..43241)
                     /locus_tag="SGL_RS01360"
     CDS             complement(42903..43241)
                     /locus_tag="SGL_RS01360"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041428293.1"
                     /db_xref="GI:752788437"
                     /translation="MDEIIRQRKQNALNYEAYLQELATLVRKVATGQSDDTPKAIDTP
                     AKRALYNNLGQDEILTLKVHQAVMSSKSDGFRGNQAKENLIKQALYQVLNDVDRVEQI
                     FNIVKQQDEY"
CONTIG      join(AP004312.1:1..44343)
//
DBGET integrated database retrieval system