GenomeNet

Database: RefSeq
Entry: NC_005232
LinkDB: NC_005232
Original site: NC_005232 
LOCUS       NC_005232             106004 bp    DNA     circular CON 19-MAR-2014
DEFINITION  Synechocystis sp. PCC 6803 plasmid pSYSX, complete sequence.
ACCESSION   NC_005232
VERSION     NC_005232.1  GI:38505825
DBLINK      Project: 57659
            BioProject: PRJNA57659
KEYWORDS    RefSeq.
SOURCE      Synechocystis sp. PCC 6803 (Synechocystis PCC 6803)
  ORGANISM  Synechocystis sp. PCC 6803
            Bacteria; Cyanobacteria; Oscillatoriophycideae; Chroococcales;
            Synechocystis.
REFERENCE   1
  AUTHORS   Kaneko,T., Nakamura,Y., Sasamoto,S., Watanabe,A., Kohara,M.,
            Matsumoto,M., Shimpo,S., Yamada,M. and Tabata,S.
  TITLE     Structural analysis of four large plasmids harboring in a
            unicellular cyanobacterium, Synechocystis sp. PCC 6803
  JOURNAL   DNA Res. 10 (5), 221-228 (2003)
   PUBMED   14686584
REFERENCE   2  (bases 1 to 106004)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (25-NOV-2003) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 106004)
  AUTHORS   Kaneko,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-SEP-2003) Takakazu Kaneko, Kazusa DNA Research
            Institute, The First Laboratory for Plant Gene Research; 2-6-7
            Kazusa-kamatari, Kisarazu, Chiba 292-0818, Japan
            (E-mail:kaneko@kazusa.or.jp, URL:http://www.kazusa.or.jp/cyano/,
            Tel:81-438-52-3935(ex.2338), Fax:81-438-52-3934)
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AP006585.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..106004
                     /organism="Synechocystis sp. PCC 6803"
                     /mol_type="genomic DNA"
                     /strain="PCC 6803"
                     /db_xref="taxon:1148"
                     /plasmid="pSYSX"
                     /synonym="Synechocystis PCC 6803"
     gene            join(105009..106004,1..255)
                     /locus_tag="slr6110"
                     /db_xref="GeneID:2656254"
     CDS             join(105009..106004,1..255)
                     /locus_tag="slr6110"
                     /note="slr6110; ORF_ID:slr6110;
                     putative signalling protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942443.1"
                     /db_xref="GI:38505935"
                     /db_xref="GeneID:2656254"
                     /translation="MVVGDLLSLSANIEVAVVEKTKVSRSLLVLDDEKDVAATICMMA
                     ATVSYDTDHVDNADIFLEKVVTWAPTHVVVDLKLADRDGIEVIRKLAEMECNAAVIIM
                     SGLGGRILESSARAAGENGLQLLGTLSKPFSRAELLELLAKDTHETLSIQSSPISPVS
                     DRQIGDALKAEAFVAHFQPKISCLTGGLVGFECLARWPQPDGSMIPPDQFICFAEQKG
                     LIDALTRQVYDYALANLPLCNLRNQLKYALNLSPINLKDATFPHWLRNKCCEHNVKPS
                     QIILEVTETASMENPLVLLEHLTQFRIYGFQLSIDDFGVGYSSLVQLARLPFSELKVD
                     QMFVKTLASSKESQKIVTAVVGLGKSLGLNVVAEGVEDVSALGLLQDLGCDEAQGYFI
                     GRPMDRVSAGNWNGLSGLSQKWVQ"
     misc_feature    105090..105437
                     /locus_tag="slr6110"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(105099..105104,105231..105233,105255..105257,
                     105315..105317,105387..105389,105396..105401)
                     /locus_tag="slr6110"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    105231..105233
                     /locus_tag="slr6110"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(105240..105245,105249..105257)
                     /locus_tag="slr6110"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    105396..105404
                     /locus_tag="slr6110"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    join(105492..106004,1..195)
                     /locus_tag="slr6110"
                     /note="EAL domain. This domain is found in diverse
                     bacterial signaling proteins. It is called EAL after its
                     conserved residues and is also known as domain of unknown
                     function 2 (DUF2).  The EAL domain has been shown to
                     stimulate degradation of a second...; Region: EAL;
                     cd01948"
                     /db_xref="CDD:238923"
     gene            465..3053
                     /locus_tag="slr6001"
                     /db_xref="GeneID:2656200"
     CDS             465..3053
                     /locus_tag="slr6001"
                     /note="ORF_ID:slr6001"
                     /codon_start=1
                     /transl_table=11
                     /product="two-component hybrid sensor and regulator"
                     /protein_id="NP_942444.1"
                     /db_xref="GI:38505826"
                     /db_xref="GeneID:2656200"
                     /translation="MSASLQRVMSLKTADIMGIQRYPIRLSNSTFEEKFWSPVNSPVL
                     DEFGAVEFIMHRVEDVTAIVHENSFAVLTEITKTENRIALQDIILRSRELKQTLSKLQ
                     EHEARIRTAERMLSLGTWEYNPQTGTLNWSRHVFDIYGIPPTQKALDVEEYFAMVHPD
                     DREASIAVYQSFMEENAPRIAFEHRVITRNGGVRCVKGVGERHWTPDGEIVVGCVQDI
                     TSFIRNRDKLTQAEYLLRLAGEKASLGGWRIELDPPVITWTSETAVIHGMPPDYSPPD
                     VGTAVQFYAPEFREFIMEVFERCVQQGEPFDVICQLQVPDGRRPWIRAIGEAERDAQG
                     KVIVVQGAFQDISTLREAQERFQLISKAANDVIWDWNFATNQVWWNDSITDLFGYALL
                     DMEPGLESWTLRIHPDDKERVLHSIYQVIDGEENYWECDYRFMKSDGQYANVIDRGFV
                     TRDGQGKATRMVGSMLDITERMAMEQRLRESQKMEAVGHLTGGVAHDFNNLLTVILGN
                     AEMLAELVTDPDLQSMAEMTLSAAKRGAELTRHLLAFARRQPLDPKPKNINHLVEAMW
                     GLIRRTLPENIELEFAPDPDLGIAEVDANELETALLNLVVNARDAMQDGGKLIIETSS
                     AVLDNDYAALHCEVIPGDYVMICVSDTGIGMSADTVSHAFEPFFTTKPVGKGSGLGLS
                     MVFGFTKQSGGHIKIYSELGEGTSIKLYFPKVKDAQRINYQPAKELIPKSGTEHILVV
                     EDDDLVLRHLEGQLRSLGYRVTAVTCGPNAIEALKAHSDIDLLLTDIIMPGGMNGREL
                     ADLAKATYSKLKVLFTSGYTENAIIHHGRLDPGVDLLSKPYNRLELATKVRRVLDKDL
                     NPITSY"
     misc_feature    807..1118
                     /locus_tag="slr6001"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    849..1097
                     /locus_tag="slr6001"
                     /note="PAS fold; Region: PAS_3; pfam08447"
                     /db_xref="CDD:254805"
     misc_feature    order(855..857,867..869,885..887,930..941,1020..1022,
                     1035..1037)
                     /locus_tag="slr6001"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    order(921..923,933..935,957..959,966..971,1056..1058,
                     1062..1064)
                     /locus_tag="slr6001"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    1227..1487
                     /locus_tag="slr6001"
                     /note="PAS fold; Region: PAS_3; pfam08447"
                     /db_xref="CDD:254805"
     misc_feature    1230..1502
                     /locus_tag="slr6001"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    order(1239..1241,1251..1253,1278..1280,1311..1322,
                     1398..1400,1413..1415)
                     /locus_tag="slr6001"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    order(1302..1304,1314..1316,1338..1340,1347..1352,
                     1434..1436,1440..1442)
                     /locus_tag="slr6001"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    1551..1868
                     /locus_tag="slr6001"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    1590..1859
                     /locus_tag="slr6001"
                     /note="PAS fold; Region: PAS_3; pfam08447"
                     /db_xref="CDD:254805"
     misc_feature    order(1599..1601,1611..1613,1629..1631,1674..1685,
                     1764..1766,1779..1781)
                     /locus_tag="slr6001"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    order(1665..1667,1677..1679,1701..1703,1710..1715,
                     1800..1802,1806..1808)
                     /locus_tag="slr6001"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    1914..2105
                     /locus_tag="slr6001"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    order(1932..1934,1944..1946,1956..1958,1965..1967,
                     1977..1979,1986..1988,2034..2036,2046..2048,2055..2057,
                     2067..2069,2076..2078,2088..2090)
                     /locus_tag="slr6001"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    1950..1952
                     /locus_tag="slr6001"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    2253..2597
                     /locus_tag="slr6001"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(2271..2273,2283..2285,2292..2294,2406..2408,
                     2412..2414,2418..2420,2424..2429,2496..2507,2553..2555,
                     2559..2561,2574..2579,2583..2585)
                     /locus_tag="slr6001"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    2283..2285
                     /locus_tag="slr6001"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(2418..2420,2424..2426,2496..2498,2502..2504)
                     /locus_tag="slr6001"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    2676..3020
                     /locus_tag="slr6001"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(2685..2690,2820..2822,2847..2849,2907..2909,
                     2964..2966,2973..2978)
                     /locus_tag="slr6001"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    2820..2822
                     /locus_tag="slr6001"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(2829..2834,2841..2849)
                     /locus_tag="slr6001"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    2973..2981
                     /locus_tag="slr6001"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            3505..3753
                     /locus_tag="ssr6002"
                     /db_xref="GeneID:2656160"
     CDS             3505..3753
                     /locus_tag="ssr6002"
                     /note="ssr6002; ORF_ID:ssr6002"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942445.1"
                     /db_xref="GI:38505827"
                     /db_xref="GeneID:2656160"
                     /translation="MDFNPNEWPTHKQGEIVRQLILDALDSPKTKEELSSLCNKSVRQ
                     ITRHLHRLSSENKILSTGKGQFVRRIAAGFLLLYVGQI"
     gene            3853..4080
                     /locus_tag="ssr6003"
                     /db_xref="GeneID:2656161"
     CDS             3853..4080
                     /locus_tag="ssr6003"
                     /note="ssr6003; ORF_ID:ssr6003"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942446.1"
                     /db_xref="GI:38505828"
                     /db_xref="GeneID:2656161"
                     /translation="MSIAGKSKGDVVQQLEKSYGVARTTVFNRLKYLGYSLDKVDDLF
                     SLSNEQMAELDKLHRWISDGAKWPIIPNQDN"
     gene            4050..4406
                     /locus_tag="slr6004"
                     /db_xref="GeneID:2656261"
     CDS             4050..4406
                     /locus_tag="slr6004"
                     /note="slr6004; ORF_ID:slr6004"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942447.1"
                     /db_xref="GI:38505829"
                     /db_xref="GeneID:2656261"
                     /translation="MADYPKPGQLTMITDEGELEQYGEVINFDALEGDEELGHAELIR
                     AAQNQAAGILIAQNLLTAEILKNPQHLPADLQAQVEQSKVAIAPKPQNPLVIASQWIT
                     KAKAYQSNQNHGQLAA"
     gene            4463..5251
                     /locus_tag="slr6005"
                     /db_xref="GeneID:2656262"
     CDS             4463..5251
                     /locus_tag="slr6005"
                     /note="slr6005; ORF_ID:slr6005"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942448.1"
                     /db_xref="GI:38505830"
                     /db_xref="GeneID:2656262"
                     /translation="MDGLLHSLYAARSVLVTSGEGMGKTYLVRQVWERLLADGVTCQY
                     FEPATPKTLLMAIAAMAGVDSKNLEGRSKTVEVLKQELIQWFSVNRAVLIFDDAHYLE
                     VKFRLWLKKLKDVGVPMLLAATNPPRTDLFIYVPRIELKPLAEYQIRDLMEKEAISLG
                     SGLKPNQIAKLQSRAGGNPMLAKRAIEEGFLGIQNEAGDHGRYFDITPLLLLVGIVFI
                     CYRFIGLGTGNQSLYILAGIGGAIFLGVARLSYYLPKESRRITN"
     misc_feature    4493..4834
                     /locus_tag="slr6005"
                     /note="AAA domain; Region: AAA_22; pfam13401"
                     /db_xref="CDD:257726"
     gene            5251..6279
                     /locus_tag="slr6006"
                     /db_xref="GeneID:2656226"
     CDS             5251..6279
                     /locus_tag="slr6006"
                     /note="slr6006; ORF_ID:slr6006"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942449.1"
                     /db_xref="GI:38505831"
                     /db_xref="GeneID:2656226"
                     /translation="MLTITHLLVGAASVGMAAQTTNPVPILIGAIASLLPDIDISTSP
                     AGRILPFISRPLEQRFSHRSATHSLLASFTLALVSYALWFAMPVIPLVIVHALNIGYF
                     AGWFLDCFTKSGVEMFYPLGVRCVCPGNRNLRISTGSAAEYWLMVFVVAIAVWTFQLN
                     NTGGLVKNFNALIAAPSGVVELYNRKGGNEIIYAEYEGVWAGNRAPIKEEAPVIATNG
                     QGFLVLRDDQVVKVGTEADSTIIVNRIRGREGEPAVIHTETIYLDDEPPDRLEGYINP
                     MTFISGQLTIDDPTMLRLEQSAFAFAPIRNAGGFVTLDHAPIETAIQLLQDQYVRGSV
                     TIKTIEKR"
     misc_feature    5257..5712
                     /locus_tag="slr6006"
                     /note="Predicted membrane-bound metal-dependent hydrolase
                     (DUF457); Region: DUF457; pfam04307"
                     /db_xref="CDD:252517"
     gene            6397..7470
                     /locus_tag="slr6007"
                     /db_xref="GeneID:2656227"
     CDS             6397..7470
                     /locus_tag="slr6007"
                     /note="slr6007; ORF_ID:slr6007"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942450.1"
                     /db_xref="GI:38505832"
                     /db_xref="GeneID:2656227"
                     /translation="MFASNPKPRPLVNRLAHTQTPSNFPVVNREGVLIGEQIYWNPAT
                     VANPHGCIIGGSGAGKTQTLKAIAWEVSKLVEVAIIDFHGDQELPGEKVYHINMTSNS
                     GINPLVINLDQEGGGPNLRAIELAMLFAKTLRLGSNQQGKLLDAFKHCYFRRGISQES
                     PQSWLKVPPNFSDLEALLEEMAEEDKEAEKLRLKLSTMFEYGIFNKTQPPYERLTRWN
                     LAKLPPQLQAIAGDALASQLMSHHRLLGESTLRTVLFIDEAKELGHSKALDRIAADGR
                     KYGLGLWVASQSSRHISKDVLTNTFTKLILPVDSSELPLTARTFRFSEEAIANLNPLE
                     SLVRFGKNANKVNIVPFYQRNTP"
     misc_feature    6535..7371
                     /locus_tag="slr6007"
                     /note="AAA-like domain; Region: AAA_10; pfam12846"
                     /db_xref="CDD:257344"
     misc_feature    6541..>6807
                     /locus_tag="slr6007"
                     /note="Domain of unknown function DUF87; Region: DUF87;
                     cl19135"
                     /db_xref="CDD:267488"
     misc_feature    7147..>7368
                     /locus_tag="slr6007"
                     /note="TraM recognition site of TraD and TraG; Region:
                     TraG-D_C; cl17375"
                     /db_xref="CDD:266658"
     gene            7565..8596
                     /locus_tag="slr6008"
                     /db_xref="GeneID:2656198"
     CDS             7565..8596
                     /locus_tag="slr6008"
                     /note="slr6008; ORF_ID:slr6008"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942451.1"
                     /db_xref="GI:38505833"
                     /db_xref="GeneID:2656198"
                     /translation="MNWRALLLAVILGTVVFGGLHAQTNTTNTPSNNSSLTTPNRLKI
                     NLTLGDPTELKVREGDTVNRGQVLSDKEAERSRLERDQRERLLAIANVEGQLVPTLQP
                     APALRELPPVSYTVEETAIQLAEIKLAQAQRNLATAIEADPFISAKAKVERSLADVEA
                     AHRAFELQQRKLDAVNGLKGLPPEMLTHETEKLRQVRTALEGKEAEYKFFQAEYFQVE
                     ADRRKELTDLQSKVSIARGELEQAQSRLRAAKENRELAEYNHRITISRRAEEENQVAI
                     NVANQKLDREFKLAQLREQLSAVEEKLNGIVQIKSPYSGTIRRIKFDRQTDGKLAVTL
                     YLDTTNPNP"
     misc_feature    7721..>8530
                     /locus_tag="slr6008"
                     /note="type I secretion membrane fusion protein, HlyD
                     family; Region: type_I_hlyD; TIGR01843"
                     /db_xref="CDD:130902"
     gene            8655..9449
                     /locus_tag="slr6009"
                     /db_xref="GeneID:2656218"
     CDS             8655..9449
                     /locus_tag="slr6009"
                     /note="slr6009; ORF_ID:slr6009"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942452.1"
                     /db_xref="GI:38505834"
                     /db_xref="GeneID:2656218"
                     /translation="MEDPQGQSNPFLAPELDELVDNKISEDVWQQMLGELPCSVTTED
                     CINQLQNVAVQNSRLLADLQEKIDEAQNAVDEARRKNLDSIAIGNFSPFIQTFLYSTL
                     GPVSNGVEPPVNNPFRLILGNTLSAFLGQGLGALFNWSDYAANDSQQQRAIAIGDIQI
                     KIAELQRNKAELTQKLREQVVFEALKLEEIARNFQIEQEIAKRDKQRLEIAKVSYRFG
                     EGDSERYLNQISAYDRQKAATFREWSRLRSQVITVKLLVLGGQDAE"
     gene            complement(9520..10185)
                     /locus_tag="sll6010"
                     /db_xref="GeneID:2656156"
     CDS             complement(9520..10185)
                     /locus_tag="sll6010"
                     /note="sll6010; ORF_ID:sll6010"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942453.1"
                     /db_xref="GI:38505835"
                     /db_xref="GeneID:2656156"
                     /translation="MTLIAIMKYKILSSLALVTLGITAIAPMVNAGMAKDNYTGKIYS
                     TGHAPRDDVYVYYLDAPLTKKVSANECGIVQISLGSIPHTGSTEVTLIGVGPATVSSF
                     PLMAKADAPKCSNGVATNIPAEGKARYVPNAETGNQSLVWTGQTPFTQYDITFPIPKE
                     RKLKSNACGVATISSSSSYPSTGTFRMGASPTVHNFATVTGVNAPPGCKNNTLLLPVG
                     FPN"
     gene            10368..10895
                     /locus_tag="slr6011"
                     /db_xref="GeneID:2656219"
     CDS             10368..10895
                     /locus_tag="slr6011"
                     /note="slr6011; ORF_ID:slr6011;
                     probable nuclease"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942454.1"
                     /db_xref="GI:38505836"
                     /db_xref="GeneID:2656219"
                     /translation="MITACSQEQMQEMASNAMVTQNRTPDKTWRVKPGSVHDGDTFRA
                     VADVTNEEIKVRIACIDAPEIKQAGGIESRDYLRGMLTDNREIILMGAEKDQYGRSVV
                     EVFAMTDTPGLEVGVNGEMVLAGMAHYYEGHKRSCPENAEQYEFLEQEAISNKAGVWA
                     NGDAERPWDWRRRNK"
     misc_feature    10470..10850
                     /locus_tag="slr6011"
                     /note="Staphylococcal nuclease homologues. SNase
                     homologues are found in bacteria, archaea, and eukaryotes.
                     They contain no disufide bonds; Region: SNc; cd00175"
                     /db_xref="CDD:238102"
     misc_feature    10470..10850
                     /locus_tag="slr6011"
                     /note="Staphylococcal nuclease homologues; Region: SNc;
                     smart00318"
                     /db_xref="CDD:214615"
     misc_feature    order(10485..10487,10530..10532,10548..10550,10557..10559,
                     10653..10658,10662..10664)
                     /locus_tag="slr6011"
                     /note="Catalytic site; other site"
                     /db_xref="CDD:238102"
     gene            11315..13507
                     /locus_tag="slr6012"
                     /db_xref="GeneID:2656190"
     CDS             11315..13507
                     /locus_tag="slr6012"
                     /note="slr6012; ORF_ID:slr6012"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942455.1"
                     /db_xref="GI:38505837"
                     /db_xref="GeneID:2656190"
                     /translation="MDSPRQLSSPTLTNVIPLAAGIIVALVGIAAKIQPLQSGIMGFT
                     AGVSGAATASLATKKEREILLLAEQELSKTKINNTLSELQEQKKIIDKDITRLEERRS
                     QSEKIAGELEIRQAKRDSIEAEIKNLQAVQQNLESRVAEINKANPTLENLEIRQKEIS
                     RLQSIIKQLEGELFAYKSKIAEMEQKKAGLEEKEALYLKREIEIKEISEQIQQGQVKL
                     KDLNRQAVELELLRNTYDALEREKQTYESQKEHLYAEVIRLGAEKDRILAEIKELEGR
                     AQESDRLRAEIADLKAKRRIAEDLLRDIQREIEQHEIIKDNLINDIARKDAEINRKKN
                     NVSELEQRIRELKQEISDLEDSARVALQTLEEPIKDLIPVQRQGINEDDFLNQFSNSL
                     KVKGLDFHERIVKAFHTSLKVQDISALVILAGISGTGKSELPQKYADFIGAPLVMLPV
                     QPRWDSPQDLQGFYNYIEKKYKPTQLMHYLYQYQQDRKMHGRIIMVLLDEMNLARVEY
                     YFSDFLSKLETRRSKPTYLSLDVGSLKLPEKQRDILIPEEFLFIGTMNEDETTQSLSD
                     KVLDRANVLTFGRPNELKLRGRKIKYEKAENYLPWNEFVKWTKEPDPDSPMVIEIKDF
                     VDRANAIMEKLGHPFAHRVYQAIAKYVVNYPGAEQDLQIRRQAIADQFGQKLLPKLRG
                     IRIDEASTELDEMKRLIQELDDPALTEAFDRAKQGRYGQFQWKGMLYS"
     misc_feature    11504..11851
                     /locus_tag="slr6012"
                     /note="FlgN protein; Region: FlgN; pfam05130"
                     /db_xref="CDD:253028"
     misc_feature    11561..11986
                     /locus_tag="slr6012"
                     /note="TPR/MLP1/MLP2-like protein; Region: TPR_MLP1_2;
                     pfam07926"
                     /db_xref="CDD:254520"
     misc_feature    11789..>12007
                     /locus_tag="slr6012"
                     /note="TATA element modulatory factor 1 TATA binding;
                     Region: TMF_TATA_bd; pfam12325"
                     /db_xref="CDD:256982"
     misc_feature    11858..13354
                     /locus_tag="slr6012"
                     /note="GTPase subunit of restriction endonuclease [Defense
                     mechanisms]; Region: McrB; COG1401"
                     /db_xref="CDD:224319"
     misc_feature    12572..13027
                     /locus_tag="slr6012"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cl18944"
                     /db_xref="CDD:267297"
     gene            13483..15039
                     /locus_tag="slr6013"
                     /db_xref="GeneID:2656191"
     CDS             13483..15039
                     /locus_tag="slr6013"
                     /note="slr6013; ORF_ID:slr6013"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942456.1"
                     /db_xref="GI:38505838"
                     /db_xref="GeneID:2656191"
                     /translation="MEGDVVQLIMKIYANLGTYLQNEPLQLLDAVLDSADRPILVLDN
                     DEELSQTPGFLIPLEDKNSYEIGFPLVSISDWDSYQILCQKSSLKLQKNNEETSFKIS
                     IKDLILDSTQVNDESTHNRLNNELNNSYDRHTAETIAVFIGLFQGMRSGRRIKQIKFP
                     LLNLPEYFHELSSEDARLPLVVSLDRRYELRHKLESITTKLRSQLNRTVEMIPLARIH
                     EMDAYCLRDYVRRPGRNAIEKAGARQELLGIKRFQNFNTPENRFLKGFCELLHLECQE
                     YSKNREAELLGQSINYFRQNETVQTVKRSVSLLDKPNYVLEQNPIYRSFYQAYLDYVH
                     RLSDKEKLWSYRQRLCSDVIAVLLMTSFLYFQGSYASALSDLSILDNPLFGRYLENDS
                     MPVIQCFLQNYVVSFQLNRSSSIRQGDWLLIIKQQKINSLEVKTLQIPIWIFWYRPSL
                     KLINKNNFKRALYFYLCERPETNNYSQWITKIDHSLMIRLPDLKENNLQTIIIFLNDI
                     FCKYLKEYFS"
     misc_feature    <14047..14469
                     /locus_tag="slr6013"
                     /note="Domain of unknown function (DUF2357); Region:
                     DUF2357; pfam09823"
                     /db_xref="CDD:255586"
     gene            15036..16439
                     /locus_tag="slr6014"
                     /db_xref="GeneID:2656206"
     CDS             15036..16439
                     /locus_tag="slr6014"
                     /note="slr6014; ORF_ID:slr6014"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942457.1"
                     /db_xref="GI:38505839"
                     /db_xref="GeneID:2656206"
                     /translation="MSLPTELIESSCNQSSTYFISRANLNFPCANYTLPLSSAQKEAF
                     DLAISNSPISLISGNPASGKTHVGCFVLEMSVRFQKSILVVARHANTLEAYKNLNVNS
                     LFLEIFNNYSDSIFAWLRHNLAQPKINFMPLHLFPDPLLETLQESKQLNQWIDLAEKG
                     DKKNLQEEMMKVFPQVSKSRLDLLVEKLYKLYPLLKQHQKLKEHYLNLSEEGILQLTE
                     LMSETTKIPILATFQSVLNSDVKFKQFEIVLVEDSHLFSDHDLLLMASMTNKLILLGE
                     NIKSDTFFTRLSECLSPAYRANLSENFRLHPLLSRPIFSTFYYSQPYSSLQNYSYRTF
                     QNRLRWIDIHEDKLITPQLLDFIENSDIDISSIKVGILTFSITAKEMIQSQCPEQWLN
                     QIYVDSCENWYGKECNVLLIVCDGTKPTPDQLRLALTRASDAIVCFGDINQYEMSSFR
                     TLIRDKTLTIEREVSLL"
     misc_feature    <15141..>16124
                     /locus_tag="slr6014"
                     /note="DNA helicase, putative; Region: TIGR00376"
                     /db_xref="CDD:232945"
     misc_feature    15159..>15299
                     /locus_tag="slr6014"
                     /note="Part of AAA domain; Region: AAA_19; pfam13245"
                     /db_xref="CDD:257601"
     misc_feature    15885..16361
                     /locus_tag="slr6014"
                     /note="AAA domain; Region: AAA_12; pfam13087"
                     /db_xref="CDD:257490"
     gene            16436..18091
                     /locus_tag="slr6015"
                     /db_xref="GeneID:2656207"
     CDS             16436..18091
                     /locus_tag="slr6015"
                     /note="slr6015; ORF_ID:slr6015"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942458.1"
                     /db_xref="GI:38505840"
                     /db_xref="GeneID:2656207"
                     /translation="MKIIVKLQGVFERKNVDNNTVRQSSLSDLLNDLRVLATSHNRHH
                     ISYIHQSFGLNFLSQQTLEHLIQKVGGKSSYLSSTFLTPANQNLIQEEFFYSYCFTCP
                     IISLQLSPHDPQLPLWSGQHCDGTYNLDISNDVDNLRLQSIRQEALSIIKQKTSVEII
                     RAALHSPNNFAIPITLSTGEYITIWQKLEELPSELQIAVMALIKNYFPSFLSAEAKSL
                     IDEYKKKYIVFNYQNLLEFTISENEPKGLDFIVGRGLHRKEIEALISSAQRFLLISSF
                     RLEDESIVQLIVKKAKELPEGVWILTDLNNDVLDRIDTNMEGKIDHEDDYAESDRKKK
                     ECLRLLATSGVSIRSGLFHLKCYITEKSSYMGSCNLTGGSLERNGEAGIIWKNVESHQ
                     RLIDHFSHLWDEQSNAVILPTTQGIRSQGLSNYFAISKREGFLTYHSNDLTRTLTEFA
                     RNPTGKISIYTRTFAPTAQQEELLSRLHCHIFYGHRNYSNLDAKQIYNLHAKIIIIGT
                     TAAYMGSQDFAFGRRSNHDLTYKTTDLNEIQAITQLVDALHRG"
     misc_feature    17204..17641
                     /locus_tag="slr6015"
                     /note="Catalytic domain of phospholipase D superfamily
                     proteins; Region: PLDc_SF; cl15239"
                     /db_xref="CDD:265651"
     misc_feature    17213..17641
                     /locus_tag="slr6015"
                     /note="PLD-like domain; Region: PLDc_2; pfam13091"
                     /db_xref="CDD:257494"
     misc_feature    order(17534..17536,17540..17542,17573..17575)
                     /locus_tag="slr6015"
                     /note="putative active site [active]"
                     /db_xref="CDD:197200"
     gene            18098..20500
                     /locus_tag="slr6016"
                     /db_xref="GeneID:2656220"
     CDS             18098..20500
                     /locus_tag="slr6016"
                     /note="slr6016; ORF_ID:slr6016"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942459.1"
                     /db_xref="GI:38505841"
                     /db_xref="GeneID:2656220"
                     /translation="MTRLFNLESYPEICKYTQIFGESLSLNSPNIPFAYRDFLNTYKD
                     RHFISPANLSSYYSNTIVRGEYKPQFLGDQLDDQQEGDLVIVRDIDVLSLQNLDCPYI
                     YASAYRYWNYVTQLQNIAKENKPLVIYDLDSLPCSYYLPISFQSHPNCSYSIPILDIR
                     TPENYESLRLPFDPSNVYDTICEILAQYVIASDPNFVGIESSYLTQYLKKINVFNIIK
                     NCLISNPNQEIVSLLIDFSNVDNTNLYLKAELPLTIVENIVSSVILVPRLKEIVQNNC
                     EYNFVLISQYNCLSNFRLSLESHFSLPDISHSEFSKIWQEKQSQEFPLYGQFLDLITF
                     QLANQISINVPSESERTNICYEGERKFHTFIGQYTIPSGETKSSFRIDKPQVILPIKI
                     NGKLIIKNEIEQVYIINNQFFEQTPSLSVEIHFSLMLGKPLLLEIFEVYSDQKLGHKL
                     NAKLEDRPEIKLGFIPIQNIIEGRKTKENNATTNLCLNLKFISDFSHGLDEIAKALHA
                     YIKQSSKNIKLRTDLKLSKIQSIVRSNYLSFLKNDALQHVSTNSSNEIVSEITNKIIS
                     SEIKLLLQKALFTLGQRHPNTEGKERGQIFNIYNDNLLLIGKQYKIAAIQDFDFLFDY
                     LKNSPCFSEHVKVIARIAYDSNFQQKYFALFETHLPKNNNNNNFYYEYDSYLWGYARI
                     LMWYLDYNLNETNILLFKRHFNLIASHALSDHSRNSYYQDALISLIYLLSFREFDSTF
                     CEIGSLEYNLGIKLCEKLSFHPVLSKQVDINKSLNQIFYEFLNGTATGDDMDNLIKAE
                     FK"
     gene            complement(20559..21329)
                     /locus_tag="sll6017"
                     /db_xref="GeneID:2656201"
     CDS             complement(20559..21329)
                     /locus_tag="sll6017"
                     /note="sll6017; ORF_ID:sll6017;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942460.1"
                     /db_xref="GI:38505842"
                     /db_xref="GeneID:2656201"
                     /translation="MFDNLCKFLAESFSEDYAAWLLGRPIKLTKLSPTELSLEPIRAD
                     SLILEQSEDLVLHLEFQTEPDPTMGFRMLDYRVRVYRRFPQKTMHQFVIYLKHSNNDL
                     VYQDSFQVGETVHRYQAIRLWEQSSDAFLQSPGLLPLAVLTQTSDPTLKLREVATVLE
                     QIEDNRVKANLMAATSVFGGILLSPDIIKTILRSEIMKESAVYQEILEEGKIAGKLEG
                     KLETIPLLKKLGLTIAEIAKELDIDVELVNRFVANQNN"
     misc_feature    complement(20562..21329)
                     /locus_tag="sll6017"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG5464"
                     /db_xref="CDD:227751"
     gene            complement(21554..21769)
                     /locus_tag="ssl6018"
                     /db_xref="GeneID:2656255"
     CDS             complement(21554..21769)
                     /locus_tag="ssl6018"
                     /note="ssl6018; ORF_ID:ssl6018"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942461.1"
                     /db_xref="GI:38505843"
                     /db_xref="GeneID:2656255"
                     /translation="MLKFIGIALLAALVGYAFGVMAGIFIVNNFSTNVQDKPLELAMT
                     SIFFFGPLGALIGFTIAVVYQLLHQYL"
     gene            21838..22035
                     /locus_tag="ssr6019"
                     /db_xref="GeneID:2656162"
     CDS             21838..22035
                     /locus_tag="ssr6019"
                     /note="ssr6019; ORF_ID:ssr6019"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942462.1"
                     /db_xref="GI:38505844"
                     /db_xref="GeneID:2656162"
                     /translation="MVPGTLWSSSLPFFTASPSPRRTKANYQGLEPLTGGPPSGGEKA
                     RRQEAFLIFDDKTRWYGRLEQ"
     gene            22192..22410
                     /locus_tag="ssr6020"
                     /db_xref="GeneID:2656163"
     CDS             22192..22410
                     /locus_tag="ssr6020"
                     /note="ssr6020; ORF_ID:ssr6020"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942463.1"
                     /db_xref="GI:38505845"
                     /db_xref="GeneID:2656163"
                     /translation="MFLFLILRNRRSGNTVFFCNEEFYHIRQNFLVLSHLRKKFYLEY
                     DFYFSWAKKNLVGNGREKREERKGILVY"
     gene            22487..22951
                     /locus_tag="slr6021"
                     /db_xref="GeneID:2656221"
     CDS             22487..22951
                     /locus_tag="slr6021"
                     /note="slr6021; ORF_ID:slr6021"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942464.1"
                     /db_xref="GI:38505846"
                     /db_xref="GeneID:2656221"
                     /translation="MFKKLGEVEKIKFKNWCVDKNNLMVKEKWFGKEVKEDRRMVWFG
                     VGIELGKNEKFKGLEIDNSLKKRCLEFYGENFNSLLLIKYGDGSKLNLHKDRDCFDKK
                     VVIVNSGICVFEYDGERKILEDGKIYEIDGKKSHGVVKVVGERYSLSIRKVL"
     gene            23048..23833
                     /locus_tag="slr6022"
                     /db_xref="GeneID:2656214"
     CDS             23048..23833
                     /locus_tag="slr6022"
                     /note="slr6022; ORF_ID:slr6022"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942465.1"
                     /db_xref="GI:38505847"
                     /db_xref="GeneID:2656214"
                     /translation="MVAPAGHFLLVGSALALTQALSMGWKGVEFQWTGGGVPCFGGWS
                     VGGSAALPWVAFCVLSCYNGLIGCSPGGCTVLSVSALSPCVVCLLSACPAVGFSGSRS
                     LSPLSVAALRSLSAAVPASASVFVGCAAGADAVGRSLFPSASVFSVSSGQWGAGRSAF
                     ARRSVAVVSAVLSAGGPAGLWCFFPSAGCPVGLLPSARSSRCFCGLGSGSWASAAFAL
                     GSGLPLLAFLPPGVSPPPGWGFSSLGGGWWVAHPAAVQLSLFA"
     gene            complement(23898..24110)
                     /locus_tag="ssl6023"
                     /db_xref="GeneID:2656256"
     CDS             complement(23898..24110)
                     /locus_tag="ssl6023"
                     /note="ssl6023; ORF_ID:ssl6023"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942466.1"
                     /db_xref="GI:38505848"
                     /db_xref="GeneID:2656256"
                     /translation="MSGRGRPGGNPDLEKYQFKSPVSESRTAGIYLRITPTDKERLKN
                     VKDWQEKLRQKVKEIIDDSFSKEDKV"
     gene            24263..24442
                     /locus_tag="ssr6024"
                     /db_xref="GeneID:2656164"
     CDS             24263..24442
                     /locus_tag="ssr6024"
                     /note="ssr6024; ORF_ID:ssr6024"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942467.1"
                     /db_xref="GI:38505849"
                     /db_xref="GeneID:2656164"
                     /translation="MTIQEAKEIAAVCSMMRNKLPDGMWEEVRETILDYREGKDGEAF
                     AEELSEICKDWGFSI"
     misc_feature    24356..>24433
                     /locus_tag="ssr6024"
                     /note="non-haem dioxygenase in morphine synthesis
                     N-terminal; Region: DIOX_N; pfam14226"
                     /db_xref="CDD:258418"
     gene            24638..25147
                     /locus_tag="slr6025"
                     /db_xref="GeneID:2656215"
     CDS             24638..25147
                     /locus_tag="slr6025"
                     /note="slr6025; ORF_ID:slr6025;
                     probable antirestriction protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942468.1"
                     /db_xref="GI:38505850"
                     /db_xref="GeneID:2656215"
                     /translation="MLSPEIYVACLASYNNGLLHGEWISANQDEDEIMAEIEAMLKAS
                     PMRDAEEWAIHDYQNFGGIELKEYEDIETIAKLGQALAEHGEAMAAYYKCYDNLENFE
                     DYYLGEYESEQDFVYDYFEQTGQLEAIEKAGLDSFYIDFEKLAHDWFINDFYSAEISY
                     NKVYVFSRH"
     misc_feature    24650..25126
                     /locus_tag="slr6025"
                     /note="Antirestriction protein (ArdA); Region: ArdA;
                     pfam07275"
                     /db_xref="CDD:254136"
     gene            25216..25473
                     /locus_tag="ssr6026"
                     /db_xref="GeneID:2656165"
     CDS             25216..25473
                     /locus_tag="ssr6026"
                     /note="ssr6026; ORF_ID:ssr6026"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942469.1"
                     /db_xref="GI:38505851"
                     /db_xref="GeneID:2656165"
                     /translation="MHHDTKEAISRCLYFIDRENKTQENPIIAVIEKALEFAKNEVSF
                     SDPYDLLAQIESVLTEEELANDDRYYSRQETEDYHRNWLHF"
     gene            25538..25729
                     /locus_tag="ssr6027"
                     /db_xref="GeneID:2656166"
     CDS             25538..25729
                     /locus_tag="ssr6027"
                     /note="ssr6027; ORF_ID:ssr6027"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942470.1"
                     /db_xref="GI:38505852"
                     /db_xref="GeneID:2656166"
                     /translation="MYFDRFDIAEAWFIYLSENHSGQNCPLYLRLCQLQKWFKPSPLL
                     NRSRLNENAQAILENLEEN"
     gene            26096..26653
                     /locus_tag="slr6028"
                     /db_xref="GeneID:2656216"
     CDS             26096..26653
                     /locus_tag="slr6028"
                     /note="slr6028; ORF_ID:slr6028"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942471.1"
                     /db_xref="GI:38505853"
                     /db_xref="GeneID:2656216"
                     /translation="MTTTTKTTGKTPKLWELSDEITNLEDQIADIQDREDLSESEKDQ
                     LMGEILETWLSTGKEFDAKACNVAAYIKHLEAITEARKNEYRRLRDLAEQSENQSQRL
                     RNYLVSNMQKLGKKKVNGVSVNLSLRKKPAKVVLNCPLEDLPAAFMKVEITPRLSELK
                     KHLQSNADCSFAQLADVEEYSVMIK"
     misc_feature    26135..26650
                     /locus_tag="slr6028"
                     /note="Siphovirus Gp157; Region: Sipho_Gp157; pfam05565"
                     /db_xref="CDD:253257"
     gene            26745..27242
                     /locus_tag="slr6029"
                     /db_xref="GeneID:2656153"
     CDS             26745..27242
                     /locus_tag="slr6029"
                     /note="slr6029; ORF_ID:slr6029;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942472.1"
                     /db_xref="GI:38505854"
                     /db_xref="GeneID:2656153"
                     /translation="MLLAEILENLRQPIAPQFISQKKTFKNKKPTGSVDFVAWYDLAD
                     LLDDLCGLGGWEWLIIDTQQIGDRLTLTGSLTIHGDDRSLTRQATGTEDIDCNSYGDP
                     SSNAEAMALRRCCAKFGLGRDLWRKNKPQPLKMGQRQEPEKQTVLAPGTISREEWLKR
                     KQAKS"
     gene            27578..27796
                     /locus_tag="ssr6030"
                     /db_xref="GeneID:2656167"
     CDS             27578..27796
                     /locus_tag="ssr6030"
                     /note="ssr6030; ORF_ID:ssr6030"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942473.1"
                     /db_xref="GI:38505855"
                     /db_xref="GeneID:2656167"
                     /translation="MGLLSYGLELLAFTPGVLLPPYPTKKGNGQKRPIANNKKIVQNP
                     VNLLGGSSVPHSVFRGLKCFSGKVSRIL"
     gene            27957..31322
                     /locus_tag="slr6031"
                     /db_xref="GeneID:2656154"
     CDS             27957..31322
                     /locus_tag="slr6031"
                     /note="slr6031; ORF_ID:slr6031"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942474.1"
                     /db_xref="GI:38505856"
                     /db_xref="GeneID:2656154"
                     /translation="MKHYKTSHGAYSSAFSPLLVNNPNHSSFGQNKLQPTSRHNPCPV
                     CAKTNGNCRTIADGGVLCMTFPDGDGHPDYRYVKPSENGLWGVHYPRKDGDFDRQAWE
                     KRKEERETRNREIERQRLEKCLDPDRRDAEIRGILSQLTLTDGARRYLENRSVPPEII
                     DRCRSVKRWQKLAQPAHVNLAGVSKLGNQLNNGWDGILEVVPDHLGRLIAMRLHDPDH
                     KTTGNPKYVWLSSKKRGITPHLANGENPIGLFWPGGLASTAKPQRIGLCEGLEFKAPA
                     AANRLEFPVIGFSGYQFLQSPETLKEIITNLNPDAQLVLIPDGGSVQDARISRSHGET
                     LATLTNPVTVAWWGQFTKADGDIDEIAGDRLVEFISPEQFLSYCPQRPKSKVEQFADW
                     ITKQVKRVKPQGFGAPVIGGELFTGDRVDALIKQLEKNRYVLDASWTGDGKSHAIVPL
                     AKALLHRLETLHPEQEIKIYLTSHSYRQPTVEALTAIQAMPTRHGDRYFPHGELEEAA
                     NCIRSRQFNQVAEKGYNPHQGGKHNPICHSCPAFNYCGTDPGMFRQQRRLALQHQIIR
                     CHPSQIPAKGENQLTVVIWDEPAEEQPTKTINTNIGELDQEIAYHRRHSQLSSAQKNI
                     LDQIASLLEGLMADAPKLGLDTADVLNHSQELNQELLGELITLLEQRERDLFDIFPAP
                     TLATFKDNQEVFAGLTAKETAKLKGQFRRSNQYAVGEATKITEEKLQELPSNGLIHLL
                     RCLHGQASVQIQLFPQNLLLTIDRRHELAPIRDADYVIALDATNNGADFACLLNLAKD
                     EVKVIKRKTEKPFQNLKVVQIVLPGWGSSRPSDKAMEKAIAVKDALFQAYGPMPVLTY
                     KAQLETLLAEGQWYRDSRGSNQFEGQPQMLSCGLPLPNLGAIKAQFLATGGQIEDFEE
                     HYHRRSQREVLQNFGRQRANRYPRQQFTHFIVTGDPQHNAIHDLSWVKKFGADYVCLH
                     GFEITPHAGDRSQIARWHIVEAIRSGFTTGSAIAEKLGCSRRNVTDVLTNAGATLTKV
                     TKTLLDTTELGSSSYKPPIRLGSHLEDLPPEILALLGIDLPEAIAEVVEIIQIVGWRS
                     FAEDYLPTLPQRLRSTILATFWSFLDTGPPAPV"
     gene            31354..31572
                     /locus_tag="ssr6032"
                     /db_xref="GeneID:2656168"
     CDS             31354..31572
                     /locus_tag="ssr6032"
                     /note="ssr6032; ORF_ID:ssr6032;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942475.1"
                     /db_xref="GI:38505857"
                     /db_xref="GeneID:2656168"
                     /translation="MKRSFSHGTLKHLDLFAGCGGFTLAAEQTRGKIQTTQFVEIDPD
                     CHTILQHHWPQGENKTSMALTRSTPPAI"
     misc_feature    31381..>31515
                     /locus_tag="ssr6032"
                     /note="Cytosine-C5 specific DNA methylases; Methyl
                     transfer reactions play an important role in many aspects
                     of biology. Cytosine-specific DNA methylases are found
                     both in prokaryotes and eukaryotes. DNA methylation, or
                     the covalent addition of a methyl group...; Region:
                     Cyt_C5_DNA_methylase; cl19095"
                     /db_xref="CDD:267448"
     misc_feature    order(31399..31416,31468..31479)
                     /locus_tag="ssr6032"
                     /note="cofactor binding site; other site"
                     /db_xref="CDD:238192"
     gene            31373..31801
                     /locus_tag="slr6033"
                     /db_xref="GeneID:2656155"
     CDS             31373..31801
                     /locus_tag="slr6033"
                     /note="slr6033; ORF_ID:slr6033"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942476.1"
                     /db_xref="GI:38505858"
                     /db_xref="GeneID:2656155"
                     /translation="MEPLNTSTYLPDVGDSPWPQNKPEEKYKQLSLLKLTPTVTPSSS
                     TTGPRVKIKLRWPLPEVRRRRSRGQGSGYIRLYYCEKQTRSGKKSYEQYYYHYELELK
                     GKRVKRSAYIPKDKLDMVQEWDRKKVDVILILQYLGKATD"
     gene            32129..32545
                     /locus_tag="slr6034"
                     /db_xref="GeneID:2656222"
     CDS             32129..32545
                     /locus_tag="slr6034"
                     /EC_number="3.5.4.5"
                     /note="Reclaims exogenous and endogenous cytidine and
                     2'-deoxycytidine molecules for UMP synthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="cytidine deaminase"
                     /protein_id="NP_942477.1"
                     /db_xref="GI:38505859"
                     /db_xref="GeneID:2656222"
                     /translation="MVDICWEQLHRSAIEVRQNAYAPYSHFLVGAAGLVDDGRIVVGC
                     NVENASYGLTLCAECGLVSHLIATGGGRLLAVVCVDSQDNYLAPCGRCRQVLLEHGGK
                     ELQVMTPTGPLSMAELLPWSFGPQDLRRIGGLNTNP"
     misc_feature    32135..32518
                     /locus_tag="slr6034"
                     /note="Cytidine deaminase [Nucleotide transport and
                     metabolism]; Region: Cdd; COG0295"
                     /db_xref="CDD:223372"
     misc_feature    32165..32455
                     /locus_tag="slr6034"
                     /note="Cytidine deaminase zinc-binding domain. These
                     enzymes are Zn dependent. The zinc ion in the active site
                     plays a central role in the proposed catalytic mechanism,
                     activating a water molecule to form a hydroxide ion that
                     performs a nucleophilic attack on...; Region:
                     cytidine_deaminase; cd01283"
                     /db_xref="CDD:238610"
     misc_feature    order(32207..32209,32213..32215,32261..32263,32267..32269,
                     32294..32302,32393..32395,32402..32404)
                     /locus_tag="slr6034"
                     /note="active site"
                     /db_xref="CDD:238610"
     misc_feature    order(32294..32302,32390..32395,32402..32404)
                     /locus_tag="slr6034"
                     /note="catalytic motif [active]"
                     /db_xref="CDD:238610"
     misc_feature    order(32294..32296,32300..32302,32393..32395,32402..32404)
                     /locus_tag="slr6034"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:238610"
     gene            complement(32660..32893)
                     /locus_tag="ssl6035"
                     /db_xref="GeneID:2656257"
     CDS             complement(32660..32893)
                     /locus_tag="ssl6035"
                     /note="ssl6035; ORF_ID:ssl6035"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942478.1"
                     /db_xref="GI:38505860"
                     /db_xref="GeneID:2656257"
                     /translation="MSKFKGILDSHKQTAPTESQRKPKTKGKRSDPDYEQVSAYIRKE
                     TYRNVKIALLQEEEKRDFSDLVEALLSEWLSNQ"
     gene            complement(32890..33495)
                     /locus_tag="sll6036"
                     /db_xref="GeneID:2656202"
     CDS             complement(32890..33495)
                     /locus_tag="sll6036"
                     /note="ORF_ID:sll6036"
                     /codon_start=1
                     /transl_table=11
                     /product="ParA family chromosome partitioning protein"
                     /protein_id="NP_942479.1"
                     /db_xref="GI:38505861"
                     /db_xref="GeneID:2656202"
                     /translation="MIITVASFKGGVGKTTTAVHLSAYLALQGETLLIDGDPNRSATG
                     WGKRGSLPFKVVDERQAAKYAPKYQNIVIDTQARPEDEDLEALADGCDLLVIPSTPDA
                     LALDALMLTIETLQKLGNNRFRILLTIIPPYPSKDGDEARQLLTTAGLPLFKRGIKRY
                     SAFQKASLNGVVVSEVSDSKAGIAWSDYKATGKEIVEEILT"
     misc_feature    complement(32893..33495)
                     /locus_tag="sll6036"
                     /note="ATPases involved in chromosome partitioning [Cell
                     division and chromosome partitioning]; Region: Soj;
                     COG1192"
                     /db_xref="CDD:224113"
     misc_feature    complement(33112..33492)
                     /locus_tag="sll6036"
                     /note="ParA and ParB of Caulobacter crescentus belong to a
                     conserved family of bacterial proteins implicated in
                     chromosome segregation. ParB binds to DNA sequences
                     adjacent to the origin of replication and localizes to
                     opposite cell poles shortly following the...; Region:
                     ParA; cd02042"
                     /db_xref="CDD:238997"
     misc_feature    complement(33451..33471)
                     /locus_tag="sll6036"
                     /note="P-loop; other site"
                     /db_xref="CDD:238997"
     misc_feature    complement(order(33274..33276,33451..33453))
                     /locus_tag="sll6036"
                     /note="Magnesium ion binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238997"
     gene            33889..34311
                     /locus_tag="slr6037"
                     /db_xref="GeneID:2656223"
     CDS             33889..34311
                     /locus_tag="slr6037"
                     /note="ORF_ID:slr6037"
                     /codon_start=1
                     /transl_table=11
                     /product="arsenate reductase"
                     /protein_id="NP_942480.1"
                     /db_xref="GI:38505862"
                     /db_xref="GeneID:2656223"
                     /translation="MIVIYHNPDCGTSRNVLQLIEAAGYLPQVIEYVKEGWTKPQLLG
                     LFAAADLTPRSALRTTKSPAAELNLLEETVTDAQILDAMVEYPILVNRPIVCTPKGVR
                     LCRPSEVVLDLLDHWPSGPFAKEDGELIIDERGNRVYT"
     misc_feature    33892..34227
                     /locus_tag="slr6037"
                     /note="Arsenate Reductase (ArsC) family, ArsC subfamily;
                     arsenic reductases similar to that encoded by arsC on the
                     R733 plasmid of Escherichia coli. E. coli ArsC catalyzes
                     the reduction of arsenate [As(V)] to arsenite [As(III)],
                     the first step in the...; Region: ArsC_ArsC; cd03034"
                     /db_xref="CDD:239332"
     misc_feature    order(33916..33918,34060..34062,34162..34164,34201..34203)
                     /locus_tag="slr6037"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239332"
     gene            34366..34668
                     /locus_tag="slr6038"
                     /db_xref="GeneID:2656224"
     CDS             34366..34668
                     /locus_tag="slr6038"
                     /note="slr6038; ORF_ID:slr6038;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942481.1"
                     /db_xref="GI:38505863"
                     /db_xref="GeneID:2656224"
                     /translation="MELMKDDRYSPDWKNIAITKKQSVHWVCEWCGVQCLKPGEGKGL
                     LKEERYRLRMAVHHCDYDPGNNSPSNLMAVCSPCHLYYHRRQQGNITPGQLKITIN"
     misc_feature    34447..34620
                     /locus_tag="slr6038"
                     /note="HNH nucleases; HNH endonuclease signature which is
                     found in viral, prokaryotic, and eukaryotic proteins. The
                     alignment includes members of the large group of homing
                     endonucleases, yeast intron 1 protein, MutS, as well as
                     bacterial colicins, pyocins, and...; Region: HNHc;
                     cl00083"
                     /db_xref="CDD:260180"
     gene            34784..35374
                     /locus_tag="slr6039"
                     /db_xref="GeneID:2656225"
     CDS             34784..35374
                     /locus_tag="slr6039"
                     /note="slr6039; ORF_ID:slr6039;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942482.1"
                     /db_xref="GI:38505864"
                     /db_xref="GeneID:2656225"
                     /translation="MGNQFWIYGLAGLLLSGSAAGVTAVYRNQSPPQMMAQQGMHMQW
                     TDQSFIEMMTPHHQDAIDMAEMALQKAEHPELKKLARNIIRDQEREIKEMKTWYQQWF
                     KRPVPALSSQGMMGMHQGHGMMAMDLDALATAQNFDREFIRQMIPHHQMAVMMASNLK
                     TNTERPEMDKLMDDIIRSQSAEIKQMKQWYQNWYGQ"
     misc_feature    34784..35371
                     /locus_tag="slr6039"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3544"
                     /db_xref="CDD:226074"
     gene            35381..36079
                     /locus_tag="slr6040"
                     /db_xref="GeneID:2656235"
     CDS             35381..36079
                     /locus_tag="slr6040"
                     /note="ORF_ID:slr6040"
                     /codon_start=1
                     /transl_table=11
                     /product="two-component response regulator"
                     /protein_id="NP_942483.1"
                     /db_xref="GI:38505865"
                     /db_xref="GeneID:2656235"
                     /translation="MRLLLVEDEPDLGMVLEKALRRENYVVDWVQDGNLAWSYLDQGW
                     VNYTLAIFDWMVPGLSGLELCQKLRGQRSSLPILMLTAKDQIADRVEGLDAGADDYLI
                     KPFGMAELLARLRSLQRRSPELQPQQLQVGDWRLDYGTFVVVTPDKQQISLTAKEFQL
                     LEYFMKHPQQILSSEQIKNQLWALSAESTSNVVAAQVRLLRRKLGEYSHGNLIETVYG
                     LGYRFQPHPTHAEQ"
     misc_feature    35381..36061
                     /locus_tag="slr6040"
                     /note="Response regulators consisting of a CheY-like
                     receiver domain and a winged-helix DNA-binding domain
                     [Signal transduction mechanisms / Transcription]; Region:
                     OmpR; COG0745"
                     /db_xref="CDD:223816"
     misc_feature    35390..35731
                     /locus_tag="slr6040"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(35399..35404,35537..35539,35561..35563,35621..35623,
                     35678..35680,35687..35692)
                     /locus_tag="slr6040"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    35537..35539
                     /locus_tag="slr6040"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(35546..35551,35555..35563)
                     /locus_tag="slr6040"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    35687..35695
                     /locus_tag="slr6040"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    35765..36049
                     /locus_tag="slr6040"
                     /note="Effector domain of response regulator. Bacteria and
                     certain eukaryotes like protozoa and higher plants use
                     two-component signal transduction systems to detect and
                     respond to changes in the environment. The system consists
                     of a sensor histidine kinase and...; Region: trans_reg_C;
                     cd00383"
                     /db_xref="CDD:238225"
     misc_feature    order(35840..35842,35897..35902,35954..35956,35963..35965,
                     35987..35992,36023..36025,36038..36040)
                     /locus_tag="slr6040"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     gene            36066..37418
                     /locus_tag="slr6041"
                     /db_xref="GeneID:2656236"
     CDS             36066..37418
                     /locus_tag="slr6041"
                     /note="ORF_ID:slr6041"
                     /codon_start=1
                     /transl_table=11
                     /product="two-component sensor histidine kinase"
                     /protein_id="NP_942484.1"
                     /db_xref="GI:38505866"
                     /db_xref="GeneID:2656236"
                     /translation="MQNNRLFNLSRWRLASYYAGVMGLILGLCGLAVYEMTSQDHWRS
                     LDQELTSLAGTLHDGLEPLLQQPGQLEPSVKQILPNLCLGTVACPRSPQRRHILNATQ
                     QPGYYVRFLDLNGQLLATAGENPPGLAFERETTRQKPLTDQKGNRYHQVSLLLKTTTG
                     EPWGYLKVGRSLVEYDHHLHTIQGFLVWGLPIVMIVVGGASWWLAGLAMEPVYRSYQQ
                     IQQFTADIAHELRTPITAIQATLETTLNAEPNAEETHSTLQTLKRQNYRLSHLIHDLL
                     LLSRMDLTTVNPTQFTLCCLNDLVEDLTEEFASLAIAAGVLLSAKLDNQANIWVRGEE
                     EQLYRLVGNLISNAIHYTPTGGEVTVMLETDKQQAIIKVQDTGIGIASENQSRVFDRF
                     YRVDTARSRQRGGAGLGLAIAQAIAVKHRGSLTVESELGQGSLFTVQLPLVSAPIVQS
                     "
     misc_feature    36714..36905
                     /locus_tag="slr6041"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    order(36729..36731,36741..36743,36753..36755,36762..36764,
                     36774..36776,36783..36785,36834..36836,36846..36848,
                     36855..36857,36867..36869,36876..36878,36888..36890)
                     /locus_tag="slr6041"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    36747..36749
                     /locus_tag="slr6041"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    37074..37385
                     /locus_tag="slr6041"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(37092..37094,37104..37106,37113..37115,37182..37184,
                     37188..37190,37194..37196,37200..37205,37284..37295,
                     37341..37343,37347..37349,37362..37367,37371..37373)
                     /locus_tag="slr6041"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    37104..37106
                     /locus_tag="slr6041"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(37194..37196,37200..37202,37284..37286,37290..37292)
                     /locus_tag="slr6041"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            37482..39119
                     /locus_tag="slr6042"
                     /db_xref="GeneID:2656237"
     CDS             37482..39119
                     /locus_tag="slr6042"
                     /note="slr6042; ORF_ID:slr6042;
                     probable cation efflux system protein, czcB homolog"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942485.1"
                     /db_xref="GI:38505867"
                     /db_xref="GeneID:2656237"
                     /translation="MQNRIIVQGWAFPLLLGLLVMSPQATLAHAGHGDEFHQSESAQS
                     AQGISLDGDTIRRLDIQVEPLQPRYLDTGIRTTGQIETLPQQRVEVTTPVGGKLLELL
                     VNPGESVTAGQPVATMTSAELAELRTTAQDRRSSAIAAVEEAQADLELARENYRQQQQ
                     VAQSEIEEARLAKEFAQERYDRDRELEANGALPRRQFLESEVALAQAQANLVRTQSRL
                     PVSEAQAQIKRAQAALSVAQKQVKLSEENYQTRLQQLGTDARPDGTIVIKAPIDGIVV
                     DPATTPEHEIKVGESRQDAGEPIFTLINSQQVQVSANIYEKDLNKIRRGQGIRGWVSS
                     SPDKTFRGRINQIGSVVEGENRIVAVKATLDNPDGQLKPGLFVELEVLTDRTSTPVLA
                     VPQSAIVKTNDQQNLVFVQNGNVFEPITVTLGQVSGDWVEITDGLFAGDLVVSQRASQ
                     LYAQSLRAKPAEKIEETEESTEITASTFTLPGAPPWLLPLGGTVMAAGLFWAGSLWGK
                     RQQSQQLREPSLTSSPEEPSLEVEKVLIETPSHQDFP"
     misc_feature    37731..38834
                     /locus_tag="slr6042"
                     /note="RND family efflux transporter, MFP subunit; Region:
                     RND_mfp; TIGR01730"
                     /db_xref="CDD:233547"
     misc_feature    37746..>37835
                     /locus_tag="slr6042"
                     /note="Biotinyl_lipoyl_domains are present in
                     biotin-dependent carboxylases/decarboxylases, the
                     dihydrolipoyl acyltransferase component (E2) of 2-oxo acid
                     dehydrogenases, and the H-protein of the glycine cleavage
                     system (GCS). These domains transport CO2, acyl; Region:
                     Biotinyl_lipoyl_domains; cl11404"
                     /db_xref="CDD:264355"
     misc_feature    <37887..38192
                     /locus_tag="slr6042"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     cl19169"
                     /db_xref="CDD:267522"
     misc_feature    38277..38603
                     /locus_tag="slr6042"
                     /note="HlyD family secretion protein; Region: HlyD_3;
                     pfam13437"
                     /db_xref="CDD:257762"
     gene            39171..42311
                     /locus_tag="slr6043"
                     /db_xref="GeneID:2656238"
     CDS             39171..42311
                     /locus_tag="slr6043"
                     /note="slr6043; ORF_ID:slr6043;
                     probable cation efflux system protein, czcA homolog"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942486.1"
                     /db_xref="GI:38505868"
                     /db_xref="GeneID:2656238"
                     /translation="MLNAILKWSIAQRWLVVIGAVLVAILGSYNLTRMPLDVFPPFAP
                     PQVEIQTEAPGLAPEEVETLITLPIESAVNGTPGVEMVRSSSAVGISVVKAIFADNTD
                     IYRARQLVTERLQSARSKLPSGAEEPQISPVSSPISTILMYALTVEESPTNPQSNLME
                     VRRRVDREITNQILAVPGVSQVVAYGGDVKQYQVLVDPARLKGFNISLQQVTKAVEEA
                     NVNAAGGFLLTADQEDVIRGLGRIENLSQLADSVVTARDGTPILLRDVAEVTIGPALM
                     RGDGSVDGQRAVVLVIDKQPQADTPTVTKAVERTMAEVKAALPAGVNLQVTFRQESFI
                     DAAIANVRDSLRDGIIIVAVVMVVFLMNWRTAIITLSAIPLSILIGMMILGWFGQGIN
                     AMTLGGLAVAIGSVVDDSIVDMENCYRGLRKNQALGNPKHPFQVVYDTSVEVRTSVIF
                     STVIIVVVFAPIFSLTGVEGRIFAPMGVAYLLSILASTLVAMTLSPALCALLLAPCRL
                     PSDETWLARISQKIYQPLLKFSTHHPRWIIGAAIAFFIFSLSLVPSMGRVFLPEFQEQ
                     SLVNALLLYPGSSLEATNRVGFALQDALKEDPRFSSVQLRSGRAPGDADAGGVNLGHL
                     DVELSDAGMADREGSIETLRAEFDKIPGVAPNIGGFISHRMDEVLSGVRSAIAVKIFG
                     PDLEQLRTLGKSVETAMAEIPGLVDLQLEPQVPVRQVQIQFDRLAAGRYGLTVGQLSE
                     LVETALNGRVASQILQDQQLFDLLVWLKADARNNLETIGNLLVDTPSGTKIPLAQVAQ
                     ISYGTGPNTINRENVSRLIVASANVKGRDLRSVVNDIQAQVKEKISLPTGYFIQYGGQ
                     FESEERASQNLLLFGLLSIVVITILMYFAVKSLAATLMIMVNLPLALAGGILAIAVTG
                     GVISVASLVGFITLFGVAVRNGLLLVDNYNQKFALALPLAQVVQEGSQERLVAILMTA
                     LTSALGMLPLAIGTGAGKEILQPLAIVILGGLFTSTALTLLVLPALYAQFGRFLRPSA
                     SVTTPASTPINVLTKV"
     misc_feature    39171..42257
                     /locus_tag="slr6043"
                     /note="Putative silver efflux pump [Inorganic ion
                     transport and metabolism]; Region: COG3696"
                     /db_xref="CDD:226220"
     misc_feature    <41769..42245
                     /locus_tag="slr6043"
                     /note="MMPL family; Region: MMPL; cl14618"
                     /db_xref="CDD:265435"
     gene            42326..42805
                     /locus_tag="slr6044"
                     /db_xref="GeneID:2656208"
     CDS             42326..42805
                     /locus_tag="slr6044"
                     /note="slr6044; ORF_ID:slr6044;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942487.1"
                     /db_xref="GI:38505869"
                     /db_xref="GeneID:2656208"
                     /translation="MKFSIPTNPVILLLIVFLLNACGNQTSPTDISVSPTPTPTVSPT
                     ENVEENKTESHGGQGGQVIEMGDYHLELLSIKEAGGFHLDFYLQKGVDHSPITNAIVT
                     GKVQLPDGTQQDINFKYSDQDKHYTALLSTQVPGDYKLAILSDINGEKVNGRFSFSF"
     gene            43066..43374
                     /locus_tag="slr6045"
                     /db_xref="GeneID:2656209"
     CDS             43066..43374
                     /locus_tag="slr6045"
                     /note="slr6045; ORF_ID:slr6045"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942488.1"
                     /db_xref="GI:38505870"
                     /db_xref="GeneID:2656209"
                     /translation="MLLTSMDQNEWVIFAELQRSDFELIVSILSDHFPRLEWGSQCDD
                     WIWIYRRDYKLEIDSFSSMELEVKAQRKAYGLAQEVLSLLPPSVFIDVFECPKLDFTR
                     "
     gene            43486..43689
                     /locus_tag="ssr6046"
                     /db_xref="GeneID:2656169"
     CDS             43486..43689
                     /locus_tag="ssr6046"
                     /note="ssr6046; ORF_ID:ssr6046;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942489.1"
                     /db_xref="GI:38505871"
                     /db_xref="GeneID:2656169"
                     /translation="MESRRLSIRVPDPLLNQLESYLDQQGLTVTEGVLAAIASYVGDN
                     DRLPLVERVSRIEKRLAILEGKG"
     gene            43696..47151
                     /locus_tag="slr6047"
                     /db_xref="GeneID:2656210"
     CDS             43696..47151
                     /locus_tag="slr6047"
                     /note="slr6047; ORF_ID:slr6047;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942490.1"
                     /db_xref="GI:38505872"
                     /db_xref="GeneID:2656210"
                     /translation="MSSIYDNCDFPLLPELKHCLKEGYRSDFCVGYFNLRGWRELEDE
                     VEQFTAGKGQNCRLLVGMQRPPNDELRRSLSITKRANQRMSNEQANKLKKIMAHEFRE
                     QLTYGVPTARDEASLKRLKAQLQAEKLEVKLFLRHLLHAKLYLIHREDKITPRIGYVG
                     SSNLTFSGLSGQGELNVEVTDRDDTKKLEEWFIERWEDNFSLDISQDLIKVIDESWAG
                     KQLPPFYIYLKMAYHLSQEARDGLSRYQAPKNFGLLEFQEQAVRVAMQHIDKRNGVVI
                     GDVVGLGKTLVGTAIAHVCEEEYGTSTLIICPKNLESMWQGYVDRYGLRGKVVPISQV
                     EQRLPEVPARFRLVLIDESHNLRNREGKRYQAIKEYIEQSGSRCILLTATPYNKGYLD
                     LSSQLRLFLRAEADIGIKPEAHIRNLGGEMQFLRKHNATPVRSLMAFEHSDEPEDWQQ
                     LMSRYMVRRTRGFIKKTYAKEDERGYYLEFPNSDRFYFPKRCPRTVKFSTSDEKDPYA
                     RLYGDRVVDIINSLNLPRYGLGNYLIPSPGNQKKKHKKSLGQMSLATGFEHLDVTEAE
                     RKILANLSHAGQRLMGFCRTNLFKRLESSGAAFIQSIDRHILRNYVYLHAIANNLPIP
                     IGTQDAALLDGTTDEDQDSLLGQDWETATDTEDSFDEDRLTPGAEFKQRAVAIYELYQ
                     NQYQRRFKWIRPDLFTPELADNLEQDAKSLINILKISGRWNADEDGKLQSLIRLLTEE
                     HPDEKILIFTQFADTARYLAQALETAGITNIGLATGNSQIDPTILAQRFSPRSNGKAI
                     SQRAVAAEDQLRILVATDVLSEGQNLQDAGIILNYDLPWAIIRLIQRAGRVDRIGQEA
                     DEIFCYSFLPAEGVEQLINLRGRLRDRLKENQEVVGTDEAFFEDDEEREVLLNLYNEK
                     SNILDEDDDEGEVDLTSEALQIWQTAIDANPKLKRIIEDLPDVVFSTRHHGPSVLEPE
                     GVLLYLRTAEGTDALAWVDKQGHSVTQSQMRILRMAGCNLNTPALDRHPEHHNLVQKA
                     AQIVTDQTKKVAGTMGSRRGARARTYDHLMSYCQYVQEKTPILAQGQDWENLVKAIEM
                     IHNYPLKQNAIASLNRELKAGISDEDLAQKVTYLMEHDALCVVTADGEFEGAKVICSL
                     GLFQR"
     misc_feature    43705..44289
                     /locus_tag="slr6047"
                     /note="N-terminal putative catalytic domain of
                     uncharacterized HKD family nucleases fused to putative
                     helicases from the Snf2-like family; Region:
                     PLDc_N_Snf2_like; cd09178"
                     /db_xref="CDD:197275"
     misc_feature    <44020..44283
                     /locus_tag="slr6047"
                     /note="PLD-like domain; Region: PLDc_2; pfam13091"
                     /db_xref="CDD:257494"
     misc_feature    order(44107..44124,44170..44172,44176..44178,44182..44184,
                     44206..44220,44224..44226,44230..44232)
                     /locus_tag="slr6047"
                     /note="putative homodimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:197275"
     misc_feature    order(44113..44115,44119..44121,44176..44178,44182..44184,
                     44215..44217)
                     /locus_tag="slr6047"
                     /note="putative active site [active]"
                     /db_xref="CDD:197275"
     misc_feature    44113..44115
                     /locus_tag="slr6047"
                     /note="catalytic site [active]"
                     /db_xref="CDD:197275"
     misc_feature    44443..44850
                     /locus_tag="slr6047"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cl17251"
                     /db_xref="CDD:266587"
     misc_feature    45844..46287
                     /locus_tag="slr6047"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    order(45946..45957,46015..46020,46138..46146)
                     /locus_tag="slr6047"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    order(46162..46164,46225..46227,46237..46239,46246..46248)
                     /locus_tag="slr6047"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     gene            47182..47409
                     /locus_tag="ssr6048"
                     /db_xref="GeneID:2656170"
     CDS             47182..47409
                     /locus_tag="ssr6048"
                     /note="ssr6048; ORF_ID:ssr6048"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942491.1"
                     /db_xref="GI:38505873"
                     /db_xref="GeneID:2656170"
                     /translation="MTITTQAQIVEMLEQLPDGALDEVKSFLAALQNRYPAKHAPKLS
                     EGMAYIEQVRGKMQCDMTTDEIMALTRGEDD"
     gene            47396..47815
                     /locus_tag="slr6049"
                     /db_xref="GeneID:2656211"
     CDS             47396..47815
                     /locus_tag="slr6049"
                     /note="slr6049; ORF_ID:slr6049;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942492.1"
                     /db_xref="GI:38505874"
                     /db_xref="GeneID:2656211"
                     /translation="MRMIKVLVDSNVLIDVFSDDSTWFTWSHQQIAYFIDRSETYRLV
                     INPVIYAEVSVGIESTEKLDQLLLPKYYDRESLPYEAAFLAGKAFLQYRRSGGTRRSP
                     LPDFYIGAHALTAGYRLLSRDNKRYQTYFPDLDLIAP"
     misc_feature    47414..47806
                     /locus_tag="slr6049"
                     /note="PIN (PilT N terminus) domain: Superfamily; Region:
                     PIN_SF; cl14812"
                     /db_xref="CDD:265458"
     misc_feature    order(47420..47422,47708..47710,47762..47764)
                     /locus_tag="slr6049"
                     /note="putative active site [active]"
                     /db_xref="CDD:189022"
     gene            47827..51129
                     /locus_tag="slr6050"
                     /db_xref="GeneID:2656192"
     CDS             47827..51129
                     /locus_tag="slr6050"
                     /note="slr6050; ORF_ID:slr6050;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942493.1"
                     /db_xref="GI:38505875"
                     /db_xref="REBASE:Ssp6803ORF6050P"
                     /db_xref="GeneID:2656192"
                     /translation="MKLNRTSTQKYLKNFDFESLFIEELGWDTTDPIALPLEIDEAIF
                     EAIAIAQKRGFTAYYCSTTEIPERKVRLALDRQLSDYSKSHLLIFGDEAQTGQVWLWV
                     RQELGKPLAPKFEQYRIGQSPERLLQKLEALAITFEEEECLTLVEVNRRVKKAFDVEK
                     TTKKFYTEFEKQHKQFLKYIDGINNDFDRSWYASLMLNRLMFVYFIQRKGFLNRDIDY
                     LQNRLKLCQEKFGNDEFYSFYRYFLMQIFHEGLGKSDRNQELDKLLGNIPYLNGGFFD
                     VHQLEIKYENIQIPDDAFEQLFVFFGNWDWHLDNRITKNQNEINPDILGYIFEKYINQ
                     KQMGAYYTKEDITEYISKNTIIPFLFDATKKECEVTFRADGEIWSLLKENPNRYIYDA
                     VLKGVDVDLPLEIAAGINDVSQRQDWNQSASDEFALPTETWREHIVRRQRCLDIREKL
                     KSGEMTSINDLITYNLNIRQFAQDVITGCEGSDFLLAFYRVIASVSVLDPTCGSGAFL
                     FAALEILEPLYSGCLGRMRGFVEEDDRRIRGTDHKPRYAEFREILAEVEKHPNKQYFV
                     LKSIMLNNLYGVDIMDEATEICKLRLFLKLVAQVEPNPKAKNLGLEPLPDIDFNIRAG
                     NTLVGFTSRNEVYQSMTRDATGQTKLLFDDSFLKRIEQGAIAVDQEFKRFKFLQTETE
                     VDGRVLAEAKAHLNRCLEELRTELDRYLAEEYELGLSKKEKAFQEWKESHQPFHWFVE
                     FYGIIHSGGFDVIIGNPPYVEYSKIKKEYTIKGYQTESCGNLYAYSMERASSILKLSG
                     HIGFIIPVASVCTDGYLPLRNILVTNGDLVISNFNDRPSKLFDGIEHIRLSIILWKKQ
                     KLTSHSIFTTRYNKWQAVERSILFNCLTYSNTKQFIKDGSISKVATKIEKSILKKVTS
                     QKKYLDLYIDKTGTYQIFYTRKLSGFVQILDFIPEIYDNNNQKRDPSELKNLSFSTKE
                     IRDAFLVLLNSNLFYWFLTIYSDCRNLNKREIASIALDFENLSKSLHQPLSDLSVALM
                     DDFKSNSKLLEMSYKKLGKMKIQCIYPKFSKPIIDEIDRVLAKHYGFTDEELDFIINY
                     DIKYRMGRDLED"
     misc_feature    49879..50241
                     /locus_tag="slr6050"
                     /note="Methyltransferase domain; Region: Methyltransf_26;
                     pfam13659"
                     /db_xref="CDD:257966"
     misc_feature    50074..50397
                     /locus_tag="slr6050"
                     /note="Eco57I restriction-modification methylase; Region:
                     Eco57I; pfam07669"
                     /db_xref="CDD:254345"
     gene            51133..51513
                     /locus_tag="slr6051"
                     /db_xref="GeneID:2656193"
     CDS             51133..51513
                     /locus_tag="slr6051"
                     /note="slr6051; ORF_ID:slr6051;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942494.1"
                     /db_xref="GI:38505876"
                     /db_xref="GeneID:2656193"
                     /translation="MKRDMELIKKILLAVEEKNTFYEPFSSSELGIQGYEDAELVYHL
                     KLAHEAGLIEIMGNKPVQTMGETPQYFVKSLTWEGHEFLEASKNPTVWNKVIKTMQDK
                     GVGMGFDILKGLLLQETIHLVGLK"
     misc_feature    51136..51456
                     /locus_tag="slr6051"
                     /note="Hypothetical protein (DUF2513); Region: DUF2513;
                     pfam10711"
                     /db_xref="CDD:256131"
     gene            complement(51619..52014)
                     /locus_tag="sll6052"
                     /db_xref="GeneID:2656212"
     CDS             complement(51619..52014)
                     /locus_tag="sll6052"
                     /note="sll6052; ORF_ID:sll6052;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942495.1"
                     /db_xref="GI:38505877"
                     /db_xref="GeneID:2656212"
                     /translation="MLNRFWVWFKLVSRHSIMRWFLVKLGFLKKSELTSRMVNFHPAP
                     EEIMSGEVVIVGDRNHKKWACFRCPSGCGELILLSLNKNQHPSWRVDCDWLNRPTLHP
                     SVRQLNHCQCHFWIKRGVTQWCADSRHNK"
     gene            complement(51986..53401)
                     /locus_tag="sll6053"
                     /db_xref="GeneID:2656203"
     CDS             complement(51986..53401)
                     /locus_tag="sll6053"
                     /note="sll6053; ORF_ID:sll6053;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942496.1"
                     /db_xref="GI:38505878"
                     /db_xref="GeneID:2656203"
                     /translation="MNNQISLTLRESHLQELRKSLWHSDGKEKAAYLICGEVSIQADP
                     WTSMPRKKYLSVEVIPIPDNEIVSHSPQHITWSTDSFVRVLKLAQQKNLTVAIIHTHG
                     KNGARFSEQDDVNEPDLVQLAQNRNGQDTKLLSLILTADGDLVGRCWFNPKEYQPLDL
                     IMCVGDRLQLHYPERGNGISSPIFQRQALAFGEALTQDLSTLRIGIVGCGGTGSAVAM
                     LLPKLGVRQIALFDQDIVEFTNLNRLHGATFNDAQEGLPKVEVIRRSLTDLGIGVEVR
                     TYRAWINDPMCQDALKTCDIIFGCTDDHAGRLLLNRFAYYYLTPIFDVGLAIEVDRSE
                     TLRMQALDGRVTTLIPPNTCLLCREIINPEQAFGESLKREQPEEYKRRKEEAYVIGEG
                     NPSPAVVLFTTDVANMAIQELVHRLQGFRGKNGAIANRVKKYHLREDRQLGASADVNC
                     PLCSTDKLWGKGDVEPFLGMV"
     misc_feature    complement(53042..53371)
                     /locus_tag="sll6053"
                     /note="Prokaryotic homologs of the JAB domain; Region:
                     Prok-JAB; pfam14464"
                     /db_xref="CDD:258607"
     misc_feature    complement(52037..52831)
                     /locus_tag="sll6053"
                     /note="Dinucleotide-utilizing enzymes involved in
                     molybdopterin and thiamine biosynthesis family 2 [Coenzyme
                     metabolism]; Region: ThiF; COG0476"
                     /db_xref="CDD:223552"
     misc_feature    complement(52319..52795)
                     /locus_tag="sll6053"
                     /note="Superfamily of activating enzymes (E1) of the
                     ubiquitin-like proteins. This family includes classical
                     ubiquitin-activating enzymes E1, ubiquitin-like (ubl)
                     activating enzymes and other mechanistic homologes, like
                     MoeB, Thif1 and others. The common...; Region:
                     E1_enzyme_family; cd01483"
                     /db_xref="CDD:238760"
     misc_feature    complement(order(52484..52486,52502..52504,52628..52630,
                     52673..52675,52700..52702,52706..52708,52766..52768,
                     52772..52774,52778..52780))
                     /locus_tag="sll6053"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238760"
     misc_feature    complement(order(52370..52372,52388..52390,52427..52429,
                     52481..52483,52766..52768))
                     /locus_tag="sll6053"
                     /note="substrate interface [chemical binding]; other site"
                     /db_xref="CDD:238760"
     gene            complement(53398..53781)
                     /locus_tag="sll6054"
                     /db_xref="GeneID:2656157"
     CDS             complement(53398..53781)
                     /locus_tag="sll6054"
                     /note="sll6054; ORF_ID:sll6054;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942497.1"
                     /db_xref="GI:38505879"
                     /db_xref="GeneID:2656157"
                     /translation="MMTFLPESDRQYLANKDYTYEEITEGSRKGLIFSKFPLPNQKYD
                     VSEVDLLILLPNGYPDIVPDMFYLEPAVKLVQGNRPPRATEARQQFNGRSWQRWSRHE
                     REWRRGVDGIWTMLKRVEHALEVAA"
     misc_feature    complement(53401..53769)
                     /locus_tag="sll6054"
                     /note="Prokaryotic E2 family E; Region: Prok-E2_E;
                     pfam14462"
                     /db_xref="CDD:206627"
     gene            complement(53782..54240)
                     /locus_tag="sll6055"
                     /db_xref="GeneID:2656213"
     CDS             complement(53782..54240)
                     /locus_tag="sll6055"
                     /note="sll6055; ORF_ID:sll6055;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942498.1"
                     /db_xref="GI:38505880"
                     /db_xref="GeneID:2656213"
                     /translation="MVVNAQQFRIQVDQQQLMIPDPVPTGRQILEIAQKRPADEFLVF
                     YLLPSGQLEEIRLDETVDLRQTGIERFITFRSDRSFRFVIDGRRFEWGIPLISGLKLK
                     QLAQVSPQAYGVWLEVRGGEDRPIADHETVNLEAPGVERFFTGKKTTTEG"
     misc_feature    complement(54010..54219)
                     /locus_tag="sll6055"
                     /note="Multiubiquitin; Region: Multi_ubiq; pfam14452"
                     /db_xref="CDD:258602"
     misc_feature    complement(53797..54009)
                     /locus_tag="sll6055"
                     /note="Multiubiquitin; Region: Multi_ubiq; pfam14452"
                     /db_xref="CDD:258602"
     gene            54343..54702
                     /locus_tag="slr6056"
                     /db_xref="GeneID:2656194"
     CDS             54343..54702
                     /locus_tag="slr6056"
                     /note="slr6056; ORF_ID:slr6056;
                     probable transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942499.1"
                     /db_xref="GI:38505881"
                     /db_xref="GeneID:2656194"
                     /translation="MKKVGFDITSFYAALDGQRQSKQLTWKKVAEQSGVSASTLTRMA
                     QGRRPDVDSLAALLNWSGLKAEMFVESNQESQTVSEPLAQITAYLRADPHLTPEGAEA
                     LAAIVKAGYERLRKDSN"
     misc_feature    54370..>54591
                     /locus_tag="slr6056"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: HipB; COG1396"
                     /db_xref="CDD:224314"
     misc_feature    54397..54519
                     /locus_tag="slr6056"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(54397..54399,54472..54474)
                     /locus_tag="slr6056"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(54400..54402,54475..54477)
                     /locus_tag="slr6056"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(54418..54423,54454..54456,54463..54465,54475..54480)
                     /locus_tag="slr6056"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     misc_feature    <54502..>54699
                     /locus_tag="slr6056"
                     /note="Uncharacterized protein conserved in bacteria
                     (DUF2320); Region: DUF2320; cl19246"
                     /db_xref="CDD:267599"
     gene            54708..55295
                     /locus_tag="slr6057"
                     /db_xref="GeneID:2656195"
     CDS             54708..55295
                     /locus_tag="slr6057"
                     /note="slr6057; ORF_ID:slr6057;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942500.1"
                     /db_xref="GI:38505882"
                     /db_xref="GeneID:2656195"
                     /translation="MARRKQPKYRYGFKSEANGYAREFREELGLKPIDPLCPWSLADY
                     LAIPVEPLSAYKDMIPKSVEYYRNGKADGFSAITIIDGYKRLIIHNDAHHPRRQAANI
                     AHELSHGILGHMPQPVLDENGCRHFNQQEEDEAEWLGPALLISEEAALHIVKTGMDIN
                     DAVRHYGVSKNIVQMRINVTGAKNRVARMSDTNPS"
     misc_feature    54894..55241
                     /locus_tag="slr6057"
                     /note="Domain of unknown function (DUF955); Region:
                     DUF955; pfam06114"
                     /db_xref="CDD:253569"
     gene            55646..56236
                     /locus_tag="slr6058"
                     /db_xref="GeneID:2656196"
     CDS             55646..56236
                     /locus_tag="slr6058"
                     /note="slr6058; ORF_ID:slr6058;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942501.1"
                     /db_xref="GI:38505883"
                     /db_xref="GeneID:2656196"
                     /translation="MRRYRYRSPKSKQITTGVFVVVAMILFQGKDSLYYHNGNGGDDW
                     KIGSPQTHVFNAHQTRSLEDLQIQALTLVNRDRQLNNLPLLVADPLITKTAQGHAEDM
                     AKRNFYGHDTPEGKSPTDRYQALGGKGGVGENIVVLPGSPYFSLNYGLVERFQKSWMY
                     SEGHRKNLLTPNYTKFGYGIATNPRTAKVYAVQNFQ"
     misc_feature    <55820..56230
                     /locus_tag="slr6058"
                     /note="Uncharacterized protein with SCP/PR1 domains
                     [Function unknown]; Region: COG2340"
                     /db_xref="CDD:225218"
     misc_feature    55847..56230
                     /locus_tag="slr6058"
                     /note="SCP_bacterial: SCP-like extracellular protein
                     domain, as found in bacteria and archaea. The wider family
                     of SCP containing proteins includes plant
                     pathogenesis-related protein 1 (PR-1), CRISPs, mammalian
                     cysteine-rich secretory proteins, and allergen 5...;
                     Region: SCP_bacterial; cd05379"
                     /db_xref="CDD:240179"
     gene            complement(56265..56831)
                     /locus_tag="sll6059"
                     /db_xref="GeneID:2656205"
     CDS             complement(56265..56831)
                     /locus_tag="sll6059"
                     /note="sll6059; ORF_ID:sll6059;
                     putative integrase/recombinase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942502.1"
                     /db_xref="GI:38505884"
                     /db_xref="GeneID:2656205"
                     /translation="MKINRQGQAKVLTEQELHDLFTIGLLTPRDRLLFGICLYTGCRI
                     GETCSLAWADVTTDAMTFRIEKTKTKSSRTVAISLALQVLFDDYRQAQRSVRFPSSYV
                     FRGKRVGSHLHPSMAHKILKAATDRIGVRGVSTHSFRRTALTMMCRKGINLRVIQKIS
                     GHKNLNVLSHYLEVSEQEKEQALSTISF"
     misc_feature    complement(56316..>56804)
                     /locus_tag="sll6059"
                     /note="Integrase [DNA replication, recombination, and
                     repair]; Region: XerC; COG0582"
                     /db_xref="CDD:223655"
     misc_feature    complement(56316..56753)
                     /locus_tag="sll6059"
                     /note="DNA breaking-rejoining enzymes,
                     intergrase/recombinases, C-terminal catalytic domain. The
                     tyrosine recombinase/integrase family share the same
                     catalytic domain containing six conserved active site
                     residues. The best-studied members of this diverse
                     family...; Region: INT_REC_C; cd01182"
                     /db_xref="CDD:238587"
     misc_feature    complement(order(56319..56321,56424..56429,56628..56630,
                     56700..56705))
                     /locus_tag="sll6059"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238587"
     misc_feature    complement(order(56319..56321,56346..56348,56415..56417,
                     56424..56426,56628..56630,56703..56705))
                     /locus_tag="sll6059"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238587"
     misc_feature    complement(order(56319..56321,56346..56348,56415..56417,
                     56424..56426,56703..56705))
                     /locus_tag="sll6059"
                     /note="active site"
                     /db_xref="CDD:238587"
     misc_feature    complement(order(56319..56321,56415..56417,56703..56705))
                     /locus_tag="sll6059"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238587"
     gene            complement(57133..57666)
                     /locus_tag="sll6060"
                     /db_xref="GeneID:2656217"
     CDS             complement(57133..57666)
                     /locus_tag="sll6060"
                     /note="sll6060; ORF_ID:sll6060;
                     probable acetyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942503.1"
                     /db_xref="GI:38505885"
                     /db_xref="GeneID:2656217"
                     /translation="MTGQEILIRDERKDDAVLITEVTIAAFAPLEISNHTEQFIIEAL
                     RSAGALTLSLVAEVNSRVVGHIAFSPVAISDGTKNWYGLGPVSVLPLYQRRGIGKALI
                     QEGLSQLKGLGAKGCCLVGHPEYYKKFGFKNVAGLALEGVPDEVFFALSFDSHYPQGD
                     VTFHEGFRANSSSNVKL"
     misc_feature    complement(57271..57651)
                     /locus_tag="sll6060"
                     /note="Acetyltransferases [General function prediction
                     only]; Region: RimI; COG0456"
                     /db_xref="CDD:223532"
     misc_feature    complement(57310..57510)
                     /locus_tag="sll6060"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    complement(order(57370..57375,57403..57411))
                     /locus_tag="sll6060"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            complement(57700..57906)
                     /locus_tag="ssl6061"
                     /db_xref="GeneID:2656258"
     CDS             complement(57700..57906)
                     /locus_tag="ssl6061"
                     /note="ssl6061; ORF_ID:ssl6061"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942504.1"
                     /db_xref="GI:38505886"
                     /db_xref="GeneID:2656258"
                     /translation="MGGHPQGKFFTLPFIHSLKIFPLASANSSSGLIVLFRTLIRYPK
                     SRKGEPLTPSIYEQIDRLINNPET"
     gene            58222..58470
                     /locus_tag="ssr6062"
                     /db_xref="GeneID:2656171"
     CDS             58222..58470
                     /locus_tag="ssr6062"
                     /note="ssr6062; ORF_ID:ssr6062"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942505.1"
                     /db_xref="GI:38505887"
                     /db_xref="GeneID:2656171"
                     /translation="MDFNPNEWPTHKQGEVVRQLILEALDSPKTKEELSSLCNKSVRQ
                     ITRHLHRLSSENKILSTGKGQFVRRIAAGFLLLYVGQI"
     gene            58570..59124
                     /locus_tag="slr6063"
                     /db_xref="GeneID:2656197"
     CDS             58570..59124
                     /locus_tag="slr6063"
                     /note="slr6063; ORF_ID:slr6063"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942506.1"
                     /db_xref="GI:38505888"
                     /db_xref="GeneID:2656197"
                     /translation="MSIAGKSKGDVVQQLEKSYGVARTTVFNRLKYLGYSLDKVDDLF
                     SLSNEQMAELDKLHRWISDGGKMADYPKPGQLTMITDEGELEQYGEVINFDALEGDEE
                     LGHAELIRAAQNQAAGILIAQNLLTAEILKNPQHLPADLQAQVEQSKVAIAPKPQNPL
                     VIASQWITKAKAYQSNQNHGQLAA"
     gene            59181..59969
                     /locus_tag="slr6064"
                     /db_xref="GeneID:2656239"
     CDS             59181..59969
                     /locus_tag="slr6064"
                     /note="slr6064; ORF_ID:slr6064"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942507.1"
                     /db_xref="GI:38505889"
                     /db_xref="GeneID:2656239"
                     /translation="MDGLLHSLYAARSVLVTSGEGMGKTYLVRQVWERLLADGVTCQY
                     FEPATPKTLLMAIAAMAGVDSKNLEGRSKTVEVLKQELIQWFSVNRAVLIFDDAHYLE
                     VKFRLWLKKLKDVGVPMLLAATNPPRTDLFIYVPRIELKPLAEYQIRDLMEKEAISLG
                     SGLKPNQIAKLQSRAGGNPMLAKRAIEEGFLGIQNEAGDHGRYFDITPLLLLVGIVFI
                     CYRFIGLGTGNQSLYILAGIGGAIFLGVARLSYYLPKESRRITN"
     misc_feature    59211..59552
                     /locus_tag="slr6064"
                     /note="AAA domain; Region: AAA_22; pfam13401"
                     /db_xref="CDD:257726"
     gene            59969..60997
                     /locus_tag="slr6065"
                     /db_xref="GeneID:2656240"
     CDS             59969..60997
                     /locus_tag="slr6065"
                     /note="slr6065; ORF_ID:slr6065"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942508.1"
                     /db_xref="GI:38505890"
                     /db_xref="GeneID:2656240"
                     /translation="MLTITHLLVGAASVGMAAQTTNPVPILIGAIASLLPDIDISTSP
                     AGRILPFISRPLEQRFSHRSATHSLLASFTLALVSYALWFAMPVIPLVIVHALNIGYF
                     AGWFLDCFTKSGVEMFYPLGVRCVCPGNRNLRISTGSAAEYWLMVFVVAIAVWTFQLN
                     NTGGLVKNFNALIAAPSGVVELYNRKGGNEIIYAEYEGVWAGNRAPIKEEAPVIATNG
                     QGFLVLRDDQVVKVGTEADSTIIVNRIRGREGEPAVIHTETIYLDDEPPDRLEGYINP
                     MTFISGQLTIDDPTMLRLEQSAFAFAPIRNAGGFVTLDHAPIETAIQLLQDQYVRGSV
                     TIKTIEKR"
     misc_feature    59975..60430
                     /locus_tag="slr6065"
                     /note="Predicted membrane-bound metal-dependent hydrolase
                     (DUF457); Region: DUF457; pfam04307"
                     /db_xref="CDD:252517"
     gene            61115..62188
                     /locus_tag="slr6066"
                     /db_xref="GeneID:2656241"
     CDS             61115..62188
                     /locus_tag="slr6066"
                     /note="slr6066; ORF_ID:slr6066"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942509.1"
                     /db_xref="GI:38505891"
                     /db_xref="GeneID:2656241"
                     /translation="MFASNPKPRPLVNRLAHTQTPSNFPVVNREGVLIGEQIYWNPAT
                     VANPHGCIIGGSGAGKTQTLKAIAWEVSKLVEVAIIDFHGDQELPGEKVYHINMTSNS
                     GINPLVINLDQEGGGPNLRAIELAMLFAKTLRLGSNQQGKLLDAFKHCYFRRGISQES
                     PQSWLKVPPNFSDLEALLEEMAEEDKEAEKLRLKLSTMFEYGIFNKTQPPYERLTRWN
                     LAKLPPQLQAIAGDALASQLMSHHRLLGESTLRTVLFIDEAKELGHSKALDRIAADGR
                     KYGLGLWVASQSSRHISKDVLTNTFTKLILPVDSSELPLTARTFRFSEEAIANLNPLE
                     SLVRFGKNANKVNIVPFYQRNTP"
     misc_feature    61253..62089
                     /locus_tag="slr6066"
                     /note="AAA-like domain; Region: AAA_10; pfam12846"
                     /db_xref="CDD:257344"
     misc_feature    61259..>61525
                     /locus_tag="slr6066"
                     /note="Domain of unknown function DUF87; Region: DUF87;
                     cl19135"
                     /db_xref="CDD:267488"
     misc_feature    61865..>62086
                     /locus_tag="slr6066"
                     /note="TraM recognition site of TraD and TraG; Region:
                     TraG-D_C; cl17375"
                     /db_xref="CDD:266658"
     gene            62283..63314
                     /locus_tag="slr6067"
                     /db_xref="GeneID:2656242"
     CDS             62283..63314
                     /locus_tag="slr6067"
                     /note="slr6067; ORF_ID:slr6067"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942510.1"
                     /db_xref="GI:38505892"
                     /db_xref="GeneID:2656242"
                     /translation="MNWRALLLAVILGTVVFGGLHAQTNTTNTPSNNSSLTTPNRLKI
                     NLTLGDPTELKVREGDTVNRGQVLSDKEAERSRLERDQRERLLAIANVEGQLVPTLQP
                     APALRELPPVSYTVEETAIQLAEIKLAQAQRNLATAIEADPFISAKAKVERSLADVEA
                     AHRAFELQQRKLDAVNGLKGLPPEMLTHETEKLRQVRTALEGKEAEYKFFQAEYFQVE
                     ADRRKELTDLQSKVSIARGELEQAQSRLRAAKENRELAEYNHRITISRRAEEENQVAI
                     NVANQKLDREFKLAQLREQLSAVEEKLNGIVQIKSPYSGTIRRIKFDRQTDGKLAVTL
                     YLDTTNPNP"
     misc_feature    62439..>63248
                     /locus_tag="slr6067"
                     /note="type I secretion membrane fusion protein, HlyD
                     family; Region: type_I_hlyD; TIGR01843"
                     /db_xref="CDD:130902"
     gene            63373..64167
                     /locus_tag="slr6068"
                     /db_xref="GeneID:2656243"
     CDS             63373..64167
                     /locus_tag="slr6068"
                     /note="slr6068; ORF_ID:slr6068"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942511.1"
                     /db_xref="GI:38505893"
                     /db_xref="GeneID:2656243"
                     /translation="MEDPQGQSNPFLAPELDELVDNKISEDVWQQMLGELPCSVTTED
                     CINQLQNVAVQNSRLLADLQEKIDEAQNAVDEARRKNLDSIAIGNFSPFIQTFLYSTL
                     GPVSNGVEPPVNNPFRLILGNTLSAFLGQGLGALFNWSDYAANDSQQQRAIAIGDIQI
                     KIAELQRNKAELTQKLREQVVFEALKLEEIARNFQIEQEIAKRDKQRLEIAKVSYRFG
                     EGDSERYLNQISAYDRQKAATFREWSRLRSQVITVKLLVLGGQDAE"
     gene            complement(64238..64903)
                     /locus_tag="sll6069"
                     /db_xref="GeneID:2656245"
     CDS             complement(64238..64903)
                     /locus_tag="sll6069"
                     /note="sll6069; ORF_ID:sll6069"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942512.1"
                     /db_xref="GI:38505894"
                     /db_xref="GeneID:2656245"
                     /translation="MTLIAIMKYKILSSLALVTLGITAIAPMVNAGMAKDNYTGKIYS
                     TGHAPRDDVYVYYLDAPLTKKVSANECGIVQISLGSIPHTGSTEVTLIGVGPATVSSF
                     PLMAKADAPKCSNGVATNIPAEGKARYVPNAETGNQSLVWTGQTPFTQYDITFPIPKE
                     RKLKSNACGVATISSSSSYPSTGTFRMGASPTVHNFATVTGVNAPPGCKNNTLLLPVG
                     FPN"
     gene            65086..65613
                     /locus_tag="slr6070"
                     /db_xref="GeneID:2656244"
     CDS             65086..65613
                     /locus_tag="slr6070"
                     /note="slr6070; ORF_ID:slr6070;
                     probable nuclease"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942513.1"
                     /db_xref="GI:38505895"
                     /db_xref="GeneID:2656244"
                     /translation="MITACSQEQMQEMASNAMVTQNRTPDKTWRVKPGSVHDGDTFRA
                     VADVTNEEIKVRIACIDAPEIKQAGGIESRDYLRGMLTDNREIILMGAEKDQYGRSVV
                     EVFAMTDTPGLEVGVNGEMVLAGMAHYYEGHKRSCPENAEQYEFLEQEAISNKAGVWA
                     NGDAERPWDWRRRNK"
     misc_feature    65188..65568
                     /locus_tag="slr6070"
                     /note="Staphylococcal nuclease homologues. SNase
                     homologues are found in bacteria, archaea, and eukaryotes.
                     They contain no disufide bonds; Region: SNc; cd00175"
                     /db_xref="CDD:238102"
     misc_feature    65188..65568
                     /locus_tag="slr6070"
                     /note="Staphylococcal nuclease homologues; Region: SNc;
                     smart00318"
                     /db_xref="CDD:214615"
     misc_feature    order(65203..65205,65248..65250,65266..65268,65275..65277,
                     65371..65376,65380..65382)
                     /locus_tag="slr6070"
                     /note="Catalytic site; other site"
                     /db_xref="CDD:238102"
     gene            66033..68225
                     /locus_tag="slr6071"
                     /db_xref="GeneID:2656228"
     CDS             66033..68225
                     /locus_tag="slr6071"
                     /note="slr6071; ORF_ID:slr6071"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942514.1"
                     /db_xref="GI:38505896"
                     /db_xref="GeneID:2656228"
                     /translation="MDSPRQLSSPTLTNVIPLAAGIIVALVGIAAKIQPLQSGIMGFT
                     AGVSGAATASLATKKEREILLLAEQELSKTKINNTLSELQEQKKIIDKDITRLEERRS
                     QSEKIAGELEIRQAKRDSIEAEIKNLQAVQQNLESRVAEINKANPTLENLEIRQKEIS
                     RLQSIIKQLEGELFAYKSKIAEMEQKKAGLEEKEALYLKREIEIKEISEQIQQGQVKL
                     KDLNRQAVELELLRNTYDALEREKQTYESQKEHLYAEVIRLGAEKDRILAEIKELEGR
                     AQESDRLRAEIADLKAKRRIAEDLLRDIQREIEQHEIIKDNLINDIARKDAEINRKKN
                     NVSELEQRIRELKQEISDLEDSARVALQTLEEPIKDLIPVQRQGINEDDFLNQFSNSL
                     KVKGLDFHERIVKAFHTSLKVQDISALVILAGISGTGKSELPQKYADFIGAPLVMLPV
                     QPRWDSPQDLQGFYNYIEKKYKPTQLMHYLYQYQQDRKMHGRIIMVLLDEMNLARVEY
                     YFSDFLSKLETRRSKPTYLSLDVGSLKLPEKQRDILIPEEFLFIGTMNEDETTQSLSD
                     KVLDRANVLTFGRPNELKLRGRKIKYEKAENYLPWNEFVKWTKEPDPDSPMVIEIKDF
                     VDRANAIMEKLGHPFAHRVYQAIAKYVVNYPGAEQDLQIRRQAIADQFGQKLLPKLRG
                     IRIDEASTELDEMKRLIQELDDPALTEAFDRAKQGRYGQFQWKGMLYS"
     misc_feature    66222..66569
                     /locus_tag="slr6071"
                     /note="FlgN protein; Region: FlgN; pfam05130"
                     /db_xref="CDD:253028"
     misc_feature    66279..66704
                     /locus_tag="slr6071"
                     /note="TPR/MLP1/MLP2-like protein; Region: TPR_MLP1_2;
                     pfam07926"
                     /db_xref="CDD:254520"
     misc_feature    66507..>66725
                     /locus_tag="slr6071"
                     /note="TATA element modulatory factor 1 TATA binding;
                     Region: TMF_TATA_bd; pfam12325"
                     /db_xref="CDD:256982"
     misc_feature    66576..68072
                     /locus_tag="slr6071"
                     /note="GTPase subunit of restriction endonuclease [Defense
                     mechanisms]; Region: McrB; COG1401"
                     /db_xref="CDD:224319"
     misc_feature    67290..67745
                     /locus_tag="slr6071"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cl18944"
                     /db_xref="CDD:267297"
     gene            68201..69757
                     /locus_tag="slr6072"
                     /db_xref="GeneID:2656229"
     CDS             68201..69757
                     /locus_tag="slr6072"
                     /note="slr6072; ORF_ID:slr6072"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942515.1"
                     /db_xref="GI:38505897"
                     /db_xref="GeneID:2656229"
                     /translation="MEGDVVQLIMKIYANLGTYLQNEPLQLLDAVLDSADRPILVLDN
                     DEELSQTPGFLIPLEDKNSYEIGFPLVSISDWDSYQILCQKSSLKLQKNNEETSFKIS
                     IKDLILDSTQVNDESTHNRLNNELNNSYDRHTAETIAVFIGLFQGMRSGRRIKQIKFP
                     LLNLPEYFHELSSEDARLPLVVSLDRRYELRHKLESITTKLRSQLNRTVEMIPLARIH
                     EMDAYCLRDYVRRPGRNAIEKAGARQELLGIKRFQNFNTPENRFLKGFCELLHLECQE
                     YSKNREAELLGQSINYFRQNETVQTVKRSVSLLDKPNYVLEQNPIYRSFYQAYLDYVH
                     RLSDKEKLWSYRQRLCSDVIAVLLMTSFLYFQGSYASALSDLSILDNPLFGRYLENDS
                     MPVIQCFLQNYVVSFQLNRSSSIRQGDWLLIIKQQKINSLEVKTLQIPIWIFWYRPSL
                     KLINKNNFKRALYFYLCERPETNNYSQWITKIDHSLMIRLPDLKENNLQTIIIFLNDI
                     FCKYLKEYFS"
     misc_feature    <68765..69187
                     /locus_tag="slr6072"
                     /note="Domain of unknown function (DUF2357); Region:
                     DUF2357; pfam09823"
                     /db_xref="CDD:255586"
     gene            69754..71157
                     /locus_tag="slr6073"
                     /db_xref="GeneID:2656230"
     CDS             69754..71157
                     /locus_tag="slr6073"
                     /note="slr6073; ORF_ID:slr6073"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942516.1"
                     /db_xref="GI:38505898"
                     /db_xref="GeneID:2656230"
                     /translation="MSLPTELIESSCNQSSTYFISRANLNFPCANYTLPLSSAQKEAF
                     DLAISNSPISLISGNPASGKTHVGCFVLEMSVRFQKSILVVARHANTLEAYKNLNVNS
                     LFLEIFNNYSDSIFAWLRHNLAQPKINFMPLHLFPDPLLETLQESKQLNQWIDLAEKG
                     DKKNLQEEMMKVFPQVSKSRLDLLVEKLYKLYPLLKQHQKLKEHYLNLSEEGILQLTE
                     LMSETTKIPILATFQSVLNSDVKFKQFEIVLVEDSHLFSDHDLLLMASMTNKLILLGE
                     NIKSDTFFTRLSECLSPAYRANLSENFRLHPLLSRPIFSTFYYSQPYSSLQNYSYRTF
                     QNRLRWIDIHEDKLITPQLLDFIENSDIDISSIKVGILTFSITAKEMIQSQCPEQWLN
                     QIYVDSCENWYGKECNVLLIVCDGTKPTPDQLRLALTRASDAIVCFGDINQYEMSSFR
                     TLIRDKTLTIEREVSLL"
     misc_feature    <69859..>70842
                     /locus_tag="slr6073"
                     /note="DNA helicase, putative; Region: TIGR00376"
                     /db_xref="CDD:232945"
     misc_feature    69877..>70017
                     /locus_tag="slr6073"
                     /note="Part of AAA domain; Region: AAA_19; pfam13245"
                     /db_xref="CDD:257601"
     misc_feature    70603..71079
                     /locus_tag="slr6073"
                     /note="AAA domain; Region: AAA_12; pfam13087"
                     /db_xref="CDD:257490"
     gene            71154..72809
                     /locus_tag="slr6074"
                     /db_xref="GeneID:2656231"
     CDS             71154..72809
                     /locus_tag="slr6074"
                     /note="slr6074; ORF_ID:slr6074"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942517.1"
                     /db_xref="GI:38505899"
                     /db_xref="GeneID:2656231"
                     /translation="MKIIVKLQGVFERKNVDNNTVRQSSLSDLLNDLRVLATSHNRHH
                     ISYIHQSFGLNFLSQQTLEHLIQKVGGKSSYLSSTFLTPANQNLIQEEFFYSYCFTCP
                     IISLQLSPHDPQLPLWSGQHCDGTYNLDISNDVDNLRLQSIRQEALSIIKQKTSVEII
                     RAALHSPNNFAIPITLSTGEYITIWQKLEELPSELQIAVMALIKNYFPSFLSAEAKSL
                     IDEYKKKYIVFNYQNLLEFTISENEPKGLDFIVGRGLHRKEIEALISSAQRFLLISSF
                     RLEDESIVQLIVKKAKELPEGVWILTDLNNDVLDRIDTNMEGKIDHEDDYAESDRKKK
                     ECLRLLATSGVSIRSGLFHLKCYITEKSSYMGSCNLTGGSLERNGEAGIIWKNVESHQ
                     RLIDHFSHLWDEQSNAVILPTTQGIRSQGLSNYFAISKREGFLTYHSNDLTRTLTEFA
                     RNPTGKISIYTRTFAPTAQQEELLSRLHCHIFYGHRNYSNLDAKQIYNLHAKIIIIGT
                     TAAYMGSQDFAFGRRSNHDLTYKTTDLNEIQAITQLVDALHRG"
     misc_feature    71922..72359
                     /locus_tag="slr6074"
                     /note="Catalytic domain of phospholipase D superfamily
                     proteins; Region: PLDc_SF; cl15239"
                     /db_xref="CDD:265651"
     misc_feature    71931..72359
                     /locus_tag="slr6074"
                     /note="PLD-like domain; Region: PLDc_2; pfam13091"
                     /db_xref="CDD:257494"
     misc_feature    order(72252..72254,72258..72260,72291..72293)
                     /locus_tag="slr6074"
                     /note="putative active site [active]"
                     /db_xref="CDD:197200"
     gene            72816..75218
                     /locus_tag="slr6075"
                     /db_xref="GeneID:2656232"
     CDS             72816..75218
                     /locus_tag="slr6075"
                     /note="slr6075; ORF_ID:slr6075"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942518.1"
                     /db_xref="GI:38505900"
                     /db_xref="GeneID:2656232"
                     /translation="MTRLFNLESYPEICKYTQIFGESLSLNSPNIPFAYRDFLNTYKD
                     RHFISPANLSSYYSNTIVRGEYKPQFLGDQLDDQQEGDLVIVRDIDVLSLQNLDCPYI
                     YASAYRYWNYVTQLQNIAKENKPLVIYDLDSLPCSYYLPISFQSHPNCSYSIPILDIR
                     TPENYESLRLPFDPSNVYDTICEILAQYVIASDPNFVGIESSYLTQYLKKINVFNIIK
                     NCLISNPNQEIVSLLIDFSNVDNTNLYLKAELPLTIVENIVSSVILVPRLKEIVQNNC
                     EYNFVLISQYNCLSNFRLSLESHFSLPDISHSEFSKIWQEKQSQEFPLYGQFLDLITF
                     QLANQISINVPSESERTNICYEGERKFHTFIGQYTIPSGETKSSFRIDKPQVILPIKI
                     NGKLIIKNEIEQVYIINNQFFEQTPSLSVEIHFSLMLGKPLLLEIFEVYSDQKLGHKL
                     NAKLEDRPEIKLGFIPIQNIIEGRKTKENNATTNLCLNLKFISDFSHGLDEIAKALHA
                     YIKQSSKNIKLRTDLKLSKIQSIVRSNYLSFLKNDALQHVSTNSSNEIVSEITNKIIS
                     SEIKLLLQKALFTLGQRHPNTEGKERGQIFNIYNDNLLLIGKQYKIAAIQDFDFLFDY
                     LKNSPCFSEHVKVIARIAYDSNFQQKYFALFETHLPKNNNNNNFYYEYDSYLWGYARI
                     LMWYLDYNLNETNILLFKRHFNLIASHALSDHSRNSYYQDALISLIYLLSFREFDSTF
                     CEIGSLEYNLGIKLCEKLSFHPVLSKQVDINKSLNQIFYEFLNGTATGDDMDNLIKAE
                     FK"
     gene            complement(75277..76047)
                     /locus_tag="sll6076"
                     /db_xref="GeneID:2656246"
     CDS             complement(75277..76047)
                     /locus_tag="sll6076"
                     /note="sll6076; ORF_ID:sll6076;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942519.1"
                     /db_xref="GI:38505901"
                     /db_xref="GeneID:2656246"
                     /translation="MFDNLCKFLAESFSEDYAAWLLGRPIKLTKLSPTELSLEPIRAD
                     SLILEQSEDLVLHLEFQTEPDPTMGFRMLDYRVRVYRRFPQKTMHQFVIYLKHSNNDL
                     VYQDSFQVGETVHRYQAIRLWEQSSDAFLQSPGLLPLAVLTQTSDPTLKLREVATVLE
                     QIEDNRVKANLMAATSVFGGILLSPDIIKTILRSEIMKESAVYQEILEEGKIAGKLEG
                     KLETIPLLKKLGLTIAEIAKELDIDVELVNRFVANQNN"
     misc_feature    complement(75280..76047)
                     /locus_tag="sll6076"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG5464"
                     /db_xref="CDD:227751"
     gene            complement(76272..76487)
                     /locus_tag="ssl6077"
                     /db_xref="GeneID:2656259"
     CDS             complement(76272..76487)
                     /locus_tag="ssl6077"
                     /note="ssl6077; ORF_ID:ssl6077"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942520.1"
                     /db_xref="GI:38505902"
                     /db_xref="GeneID:2656259"
                     /translation="MLKFIGIALLAALVGYAFGVMAGIFIVNNFSTNVQDKPLELAMT
                     SIFFFGPLGALIGFTIAVVYQLLHQYL"
     gene            76556..76753
                     /locus_tag="ssr6078"
                     /db_xref="GeneID:2656172"
     CDS             76556..76753
                     /locus_tag="ssr6078"
                     /note="ssr6078; ORF_ID:ssr6078"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942521.1"
                     /db_xref="GI:38505903"
                     /db_xref="GeneID:2656172"
                     /translation="MVPGTLWSSSLPFFTASPSPRRTKANYQGLEPLTGGPPSGGEKA
                     RRQEAFLIFDDKTRWYGRLEQ"
     gene            76910..77128
                     /locus_tag="ssr6079"
                     /db_xref="GeneID:2656173"
     CDS             76910..77128
                     /locus_tag="ssr6079"
                     /note="ssr6079; ORF_ID:ssr6079"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942522.1"
                     /db_xref="GI:38505904"
                     /db_xref="GeneID:2656173"
                     /translation="MFLFLILRNRRSGNTVFFCNEEFYHIRQNFLVLSHLRKKFYLEY
                     DFYFSWAKKNLVGNGREKREERKGILVY"
     gene            77205..77669
                     /locus_tag="slr6080"
                     /db_xref="GeneID:2656233"
     CDS             77205..77669
                     /locus_tag="slr6080"
                     /note="slr6080; ORF_ID:slr6080"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942523.1"
                     /db_xref="GI:38505905"
                     /db_xref="GeneID:2656233"
                     /translation="MFKKLGEVEKIKFKNWCVDKNNLMVKEKWFGKEVKEDRRMVWFG
                     VGIELGKNEKFKGLEIDNSLKKRCLEFYGENFNSLLLIKYGDGSKLNLHKDRDCFDKK
                     VVIVNSGICVFEYDGERKILEDGKIYEIDGKKSHGVVKVVGERYSLSIRKVL"
     gene            77766..78551
                     /locus_tag="slr6081"
                     /db_xref="GeneID:2656234"
     CDS             77766..78551
                     /locus_tag="slr6081"
                     /note="slr6081; ORF_ID:slr6081"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942524.1"
                     /db_xref="GI:38505906"
                     /db_xref="GeneID:2656234"
                     /translation="MVAPAGHFLLVGSALALTQALSMGWKGVEFQWTGGGVPCFGGWS
                     VGGSAALPWVAFCVLSCYNGLIGCSPGGCTVLSVSALSPCVVCLLSACPAVGFSGSRS
                     LSPLSVAALRSLSAAVPASASVFVGCAAGADAVGRSLFPSASVFSVSSGQWGAGRSAF
                     ARRSVAVVSAVLSAGGPAGLWCFFPSAGCPVGLLPSARSSRCFCGLGSGSWASAAFAL
                     GSGLPLLAFLPPGVSPPPGWGFSSLGGGWWVAHPAAVQLSLFA"
     gene            complement(78616..78828)
                     /locus_tag="ssl6082"
                     /db_xref="GeneID:2656260"
     CDS             complement(78616..78828)
                     /locus_tag="ssl6082"
                     /note="ssl6082; ORF_ID:ssl6082"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942525.1"
                     /db_xref="GI:38505907"
                     /db_xref="GeneID:2656260"
                     /translation="MSGRGRPGGNPDLEKYQFKSPVSESRTAGIYLRITPTDKERLKN
                     VKDWQEKLRQKVKEIIDDSFSKEDKV"
     gene            78981..79160
                     /locus_tag="ssr6083"
                     /db_xref="GeneID:2656174"
     CDS             78981..79160
                     /locus_tag="ssr6083"
                     /note="ssr6083; ORF_ID:ssr6083"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942526.1"
                     /db_xref="GI:38505908"
                     /db_xref="GeneID:2656174"
                     /translation="MTIQEAKEIAAVCSMMRNKLPDGMWEEVRETILDYREGKDGEAF
                     AEELSEICKDWGFSI"
     misc_feature    79074..>79151
                     /locus_tag="ssr6083"
                     /note="non-haem dioxygenase in morphine synthesis
                     N-terminal; Region: DIOX_N; pfam14226"
                     /db_xref="CDD:258418"
     gene            79356..79865
                     /locus_tag="slr6084"
                     /db_xref="GeneID:2656247"
     CDS             79356..79865
                     /locus_tag="slr6084"
                     /note="slr6084; ORF_ID:slr6084;
                     probable antirestriction protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942527.1"
                     /db_xref="GI:38505909"
                     /db_xref="GeneID:2656247"
                     /translation="MLSPEIYVACLASYNNGLLHGEWISANQDEDEIMAEIEAMLKAS
                     PMRDAEEWAIHDYQNFGGIELKEYEDIETIAKLGQALAEHGEAMAAYYKCYDNLENFE
                     DYYLGEYESEQDFVYDYFEQTGQLEAIEKAGLDSFYIDFEKLAHDWFINDFYSAEISY
                     NKVYVFSRH"
     misc_feature    79368..79844
                     /locus_tag="slr6084"
                     /note="Antirestriction protein (ArdA); Region: ArdA;
                     pfam07275"
                     /db_xref="CDD:254136"
     gene            79934..80191
                     /locus_tag="ssr6085"
                     /db_xref="GeneID:2656175"
     CDS             79934..80191
                     /locus_tag="ssr6085"
                     /note="ssr6085; ORF_ID:ssr6085"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942528.1"
                     /db_xref="GI:38505910"
                     /db_xref="GeneID:2656175"
                     /translation="MHHDTKEAISRCLYFIDRENKTQENPIIAVIEKALEFAKNEVSF
                     SDPYDLLAQIESVLTEEELANDDRYYSRQETEDYHRNWLHF"
     gene            80256..80447
                     /locus_tag="ssr6086"
                     /db_xref="GeneID:2656176"
     CDS             80256..80447
                     /locus_tag="ssr6086"
                     /note="ssr6086; ORF_ID:ssr6086"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942529.1"
                     /db_xref="GI:38505911"
                     /db_xref="GeneID:2656176"
                     /translation="MYFDRFDIAEAWFIYLSENHSGQNCPLYLRLCQLQKWFKPSPLL
                     NRSRLNENAQAILENLEEN"
     gene            80814..81371
                     /locus_tag="slr6087"
                     /db_xref="GeneID:2656248"
     CDS             80814..81371
                     /locus_tag="slr6087"
                     /note="slr6087; ORF_ID:slr6087"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942530.1"
                     /db_xref="GI:38505912"
                     /db_xref="GeneID:2656248"
                     /translation="MTTTTKTTGKTPKLWELSDEITNLEDQIADIQDREDLSESEKDQ
                     LMGEILETWLSTGKEFDAKACNVAAYIKHLEAITEARKNEYRRLRDLAEQSENQSQRL
                     RNYLVSNMQKLGKKKVNGVSVNLSLRKKPAKVVLNCPLEDLPAAFMKVEITPRLSELK
                     KHLQSNADCSFAQLADVEEYSVMIK"
     misc_feature    80853..81368
                     /locus_tag="slr6087"
                     /note="Siphovirus Gp157; Region: Sipho_Gp157; pfam05565"
                     /db_xref="CDD:253257"
     gene            81463..81960
                     /locus_tag="slr6088"
                     /db_xref="GeneID:2656249"
     CDS             81463..81960
                     /locus_tag="slr6088"
                     /note="slr6088; ORF_ID:slr6088;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942531.1"
                     /db_xref="GI:38505913"
                     /db_xref="GeneID:2656249"
                     /translation="MLLAEILENLRQPIAPQFISQKKTFKNKKPTGSVDFVAWYDLAD
                     LLDDLCGLGGWEWLIIDTQQIGDRLTLTGSLTIHGDDRSLTRQATGTEDIDCNSYGDP
                     SSNAEAMALRRCCAKFGLGRDLWRKNKPQPLKMGQRQEPEKQTVLAPGTISREEWLKR
                     KQAKS"
     gene            82296..82514
                     /locus_tag="ssr6089"
                     /db_xref="GeneID:2656177"
     CDS             82296..82514
                     /locus_tag="ssr6089"
                     /note="ssr6089; ORF_ID:ssr6089"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942532.1"
                     /db_xref="GI:38505914"
                     /db_xref="GeneID:2656177"
                     /translation="MGLLSYGLELLAFTPGVLLPPYPTKKGNGQKRPIANNKKIVQNP
                     VNLLGGSTVPHSVFRGLKCFSGKVSRIL"
     gene            82675..86385
                     /locus_tag="slr6090"
                     /db_xref="GeneID:2656250"
     CDS             82675..86385
                     /locus_tag="slr6090"
                     /note="slr6090; ORF_ID:slr6090"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942533.1"
                     /db_xref="GI:38505915"
                     /db_xref="GeneID:2656250"
                     /translation="MKHYKTSHGSYSSAFSPLLVNNPNHSSFGENKLQPTSRHNPCPV
                     CAKTNGNCRTIADGGVLCMTFPDGDGHPDHRYVKPSENGLWGVHYPRKDGDFDRQAWE
                     KRKEERETRNQEIERQSREKCLSPEQRDRGYKAILDQLTLTDEDRSYLEGRGILPEVI
                     ARCRSVKKWQKLSHTAHVNLPGVNRYGSGLNNPADGILIAIPGIGGYLTNLRLNVPLD
                     LNRKYSAISSANRGLKPNLEDGGTPFGIFFPENWTDFTHIGICEGPEYKAPSAAQRLN
                     FPVVGFEGAAGMTTIKRYPARLKQIEDYVKEQLCKLTKNEYLKLSSVWQSTMMSFATF
                     LTGQTTKDTQTEYSFPVQISAQFAFKILGVCLFPTMNGQKIGTIFTESKKLLKEWSTP
                     SSFGTKEPTPTELSDTLPPSHSRKFSSPFRFCLIPDAGMEKNSSVMGFYTKTLKAIES
                     QGYLVDVADWGQGHDKSVGDIDEISPEQIAAIQLVSPEEAFADVPGLQSTVAEFKDWV
                     SKQVKRIKPQGFGAPVIAGELFTGDRVDALIKQLEKNRYVLDASWTGDGKSHAIVPLA
                     KVLAHRLETLHPEQEIKIYLISHSYRQPTVEALTAIQAMPTRHGDRYFPHGELEEAAN
                     CIRSKQFNQVAEKGYNPHQGGKHNPICHSCPAFNYCGTDPGMFRQQRRLALQHQIIRC
                     HPSQIPAKGENQLTVVIWDEPAEEQPTKTINTNIGELDQEIAYHRRHSQLSDAQKDIL
                     DEMASLLERLMAGAPKLGLDTAEVLNQVKDLNQDLLGELITLLEQKERDLFDIFPAPT
                     LATFKDNQDAFAGLTAKETAKLKGQFRRSNQYAVGEATKMTEEKLQELPSNGLIHLLR
                     CLQGQASVQIQLFPQNLLLTIDRRQELAPIRNADYVVALDATNNGADFACLLNVEKDK
                     VKVIKRKTEKPFQNLKVVQIVLPGWGSSRPSDRAMEKAIAVKDALFQAYGPMPVLTYK
                     AQLETLLAAGQWYRDSRGSNQFEGQPQMLSCGLPLPNLGAIKAQFLATGGQPADFEEH
                     YHRRSQREVLQNFGRQRANRYPRQQFTHFIITGDPQHNTIHDLGWVKEFGADYVCLHG
                     FEITPHAGDRSQIARWHIVEAIRSGFTTGSAIAEKLGCSRRNVTDVLTNGGATLTKVT
                     KALLDTTELGSSSYKSPIRLGSHLEDLPSEILALLGINLPEAIAEVVEIIQAVGWRSF
                     AEDYLPTLPQRLRSTILATFWSFLDLVAPAPV"
     gene            86436..86870
                     /locus_tag="slr6091"
                     /db_xref="GeneID:2656179"
     CDS             86436..86870
                     /locus_tag="slr6091"
                     /note="slr6091; ORF_ID:slr6091"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942534.1"
                     /db_xref="GI:38505916"
                     /db_xref="GeneID:2656179"
                     /translation="MENFDTSTYLPDVRDSRWQGNDWGKSKQLSLLKSIPTVTPSSST
                     TGPRVKIKLRWPLPEVRPRRSRGQGSGYIRLHYCEKQTRSGKKSYEQYYYHYELWENG
                     IRQHKGSKYIPKDKLDVVQEWDRKKVDVVLILQYLGKDCTNL"
     gene            complement(87011..87274)
                     /locus_tag="ssl6092"
                     /db_xref="GeneID:2656159"
     CDS             complement(87011..87274)
                     /locus_tag="ssl6092"
                     /note="ssl6092; ORF_ID:ssl6092"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942535.1"
                     /db_xref="GI:38505917"
                     /db_xref="GeneID:2656159"
                     /translation="MKFMAKEKNRFAGFENFVQAESTSSESVKTKSEAAIAKSKDPNF
                     KKTTLYISKATHLKLRTHTLSTEQDMSELVEELLVAYFKRLDS"
     gene            complement(87258..87854)
                     /locus_tag="sll6093"
                     /db_xref="GeneID:2656204"
     CDS             complement(87258..87854)
                     /locus_tag="sll6093"
                     /note="ORF_ID:sll6093"
                     /codon_start=1
                     /transl_table=11
                     /product="ParA family chromosome partitioning protein"
                     /protein_id="NP_942536.1"
                     /db_xref="GI:38505918"
                     /db_xref="GeneID:2656204"
                     /translation="MIITVTAFKGGVGKTTSSIHLAAYLNNKAPTILIDGDLNRSALL
                     WASHEKLDFPVVDEREGLKAARNYEHIVVDTPARPEIEEIRSLARGCDLMILPTSPDA
                     LSMGALQANIQTFKQLNIPNFRILMTIVPPKPSTAGTEAKEYLQSLGLPVFKRMITRY
                     AAFPKAALEGCVVRDVKGDRYAGAGWNDYKTVGGEIYG"
     misc_feature    complement(87309..87854)
                     /locus_tag="sll6093"
                     /note="ATPases involved in chromosome partitioning [Cell
                     division and chromosome partitioning]; Region: Soj;
                     COG1192"
                     /db_xref="CDD:224113"
     misc_feature    complement(87471..87851)
                     /locus_tag="sll6093"
                     /note="ParA and ParB of Caulobacter crescentus belong to a
                     conserved family of bacterial proteins implicated in
                     chromosome segregation. ParB binds to DNA sequences
                     adjacent to the origin of replication and localizes to
                     opposite cell poles shortly following the...; Region:
                     ParA; cd02042"
                     /db_xref="CDD:238997"
     misc_feature    complement(87810..87830)
                     /locus_tag="sll6093"
                     /note="P-loop; other site"
                     /db_xref="CDD:238997"
     misc_feature    complement(order(87633..87635,87810..87812))
                     /locus_tag="sll6093"
                     /note="Magnesium ion binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238997"
     gene            88094..88417
                     /locus_tag="slr6094"
                     /db_xref="GeneID:2656180"
     CDS             88094..88417
                     /locus_tag="slr6094"
                     /note="slr6094; ORF_ID:slr6094;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942537.1"
                     /db_xref="GI:38505919"
                     /db_xref="GeneID:2656180"
                     /translation="MKDNRYSPDWPQLALQKKQAVGWVCERCGVQCLKPGEGKGLLKE
                     ERYRLRMAVHHCDYDPSNNSPSNLMALCSPCHLHYHQRQRGNVTPGQLSLGFVYRSCL
                     VCAQQ"
     misc_feature    <88160..>88342
                     /locus_tag="slr6094"
                     /note="HNH nucleases; HNH endonuclease signature which is
                     found in viral, prokaryotic, and eukaryotic proteins. The
                     alignment includes members of the large group of homing
                     endonucleases, yeast intron 1 protein, MutS, as well as
                     bacterial colicins, pyocins, and...; Region: HNHc;
                     cl00083"
                     /db_xref="CDD:260180"
     gene            88430..89968
                     /locus_tag="slr6095"
                     /db_xref="GeneID:2656181"
     CDS             88430..89968
                     /locus_tag="slr6095"
                     /note="slr6095; ORF_ID:slr6095;
                     type I restriction-modification system, M subunit
                     (fragment)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942538.2"
                     /db_xref="GI:304569843"
                     /db_xref="GeneID:2656181"
                     /translation="MPKLTLPQLERHLFKAADILRGKMDASEFKEYIFGMLFLKRASD
                     VFEQQYQQIIRDNLAKGRSEEEAKQRAERASSYQDFFVPERARWATIRDELHDNVGNG
                     LNKALAALEESNVALSGVLGHIDFNRKVGKTTLSDTKLRELIFHFNKYRLLNEDFVFP
                     DLLGAAYEYLIAEFADSAGKKGGEFYTPRDVVQLMVRLVKPAAGMSIYDPCVGSGGML
                     IQAKQYIEECGGDSRNLSLCGQDNNGGVWAICKINMLLHGIKDARIENEDTLQNPRHI
                     VDGELERFDRVLSNPPFSQNYEKTNLEFKNRFNHGWCPESGKKADLMFAQHMLSVLKV
                     GGIVATVMPHGVLFRGGDEQKIRKSLIEKDQIEAIIGLPPNLFYGTGIPACILVMRRA
                     GEKLPERRGKVLFINADAEFYAGRAQNYLKPEHIEKIVNAFEAFVDIPGYAAVVSREI
                     LAAEENDFNCNIRRYADNAPPPEPQDVTAHLLGGIPFDEIEAQRNLMGSHGFDPLRIL
                     VEKA"
     misc_feature    88454..89914
                     /locus_tag="slr6095"
                     /note="Type I restriction-modification system
                     methyltransferase subunit [Defense mechanisms]; Region:
                     HsdM; COG0286"
                     /db_xref="CDD:223363"
     misc_feature    88454..88870
                     /locus_tag="slr6095"
                     /note="HsdM N-terminal domain; Region: HsdM_N; pfam12161"
                     /db_xref="CDD:256881"
     misc_feature    89039..89461
                     /locus_tag="slr6095"
                     /note="Methyltransferase domain; Region: Methyltransf_26;
                     pfam13659"
                     /db_xref="CDD:257966"
     gene            89982..91103
                     /locus_tag="slr6096"
                     /db_xref="GeneID:2656182"
     CDS             89982..91103
                     /locus_tag="slr6096"
                     /note="slr6096; ORF_ID:slr6096;
                     type I restriction-modification system, M subunit
                     (fragment)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942539.1"
                     /db_xref="GI:38505921"
                     /db_xref="GeneID:2656182"
                     /translation="MQYFDFLPEITEKSQIKDFVANDAGVKTQEARLYGAFDEWWWLH
                     SPMLNQLPESKGLMELRTAFFESFIASLEPVGLLDRFKVTGVIATWWDEVRYELRTLA
                     ESGFSGLVDSWIDTIRDALEDDDDDQPKGKEQFDPLSHKLVVQLLADYLEEIEAAEGL
                     VADLEQQKVAFEQGDDDAEESDDDEEETVKNVAKALDDRRKDLKNDIKDALKRIKVLK
                     SGATVKGQNSIAAQRKLGNDTTALERELVELEGFVAPVLAEIGEIEARLEPYNEIKAS
                     LAEARKALRGLKDQLIGRLVAARAELGEEGCEKLVLAAFYEGLKSHLDRYGAAHFQQV
                     VAAVENWWDKYRVTLRDIVSERDTAAAKLDQFLEGLGYV"
     misc_feature    <90438..>90959
                     /locus_tag="slr6096"
                     /note="Chromosome segregation ATPases [Cell division and
                     chromosome partitioning]; Region: Smc; COG1196"
                     /db_xref="CDD:224117"
     gene            91096..92280
                     /locus_tag="slr6097"
                     /db_xref="GeneID:2656183"
     CDS             91096..92280
                     /locus_tag="slr6097"
                     /note="ORF_ID:slr6097"
                     /codon_start=1
                     /transl_table=11
                     /product="type I site-specific deoxyribonuclease"
                     /protein_id="NP_942540.1"
                     /db_xref="GI:38505922"
                     /db_xref="REBASE:Ssp6803ORF6097P"
                     /db_xref="GeneID:2656183"
                     /translation="MSNNWNILNFGNLIILEYGNTLTEENRSGGDYPVYGSNGIIGFH
                     KAYLLDSPNIIVGRKGSVGEVVWANKNCWAIDTTYYVTLKQDNSLRFIYWLLKSFDLR
                     KLDSSTGVPGLNRNDVYRIKCNLPSLPEQEKIAEILDTMDEAIAKTEECIAKLKKIKA
                     GLVHDLLTRGIDENGELRDPVRHPEQFKQSAIGLIPKEWDIKELSQLATVDRGKFTHR
                     PRNDPNFYGGQYPFIQTGDIAQNLGQVIRSYTQTLNENGAKVSREFPVGTIAVTIAAN
                     IADTAILGIPMFFPDSIVGVTVFPQFNHRLVELCIRFAKHKLDAKATQSAQKNINLED
                     LRPLLIPFPRNPKEQDRMSSVYEKFDERLKKEEAYLEKLKLHKKGLMHDLLTGKVRVN
                     HL"
     misc_feature    91096..92259
                     /locus_tag="slr6097"
                     /note="Restriction endonuclease S subunits [Defense
                     mechanisms]; Region: HsdS; COG0732"
                     /db_xref="CDD:223804"
     misc_feature    91105..91566
                     /locus_tag="slr6097"
                     /note="Type I restriction modification DNA specificity
                     domain; Region: Methylase_S; pfam01420"
                     /db_xref="CDD:250605"
     misc_feature    91681..92220
                     /locus_tag="slr6097"
                     /note="Type I restriction modification DNA specificity
                     domain; Region: Methylase_S; pfam01420"
                     /db_xref="CDD:250605"
     gene            complement(92267..93343)
                     /locus_tag="sll6098"
                     /db_xref="GeneID:2656158"
     CDS             complement(92267..93343)
                     /locus_tag="sll6098"
                     /note="sll6098; ORF_ID:sll6098;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942541.1"
                     /db_xref="GI:38505923"
                     /db_xref="GeneID:2656158"
                     /translation="MAIASRAGQYVQQVEGYRAFIPKPLPPNPAVEMDQEMWNLLSKA
                     DRALGRLDGSTDALPNPNLFVFMYVRKEAVLSSQIEGTQASLIDVLEFESQTLDPDNP
                     QDVAEVVNYIAAVNYGLKRLQSLPISLRLIREIHEKLMQGVRGAERSPGEFRRTQNWI
                     GASGCGLQDASYVPPLIKIGLAHAQFETIHPFLDGNGRVGRLLITFLLCEQQILQRPL
                     LYISYYFKKYRTRYYDLLQGVRDAGDWESWLKFFLRGIAETANEAARTARQIVQLKEE
                     HRILLLDQMGRKSGNAIALLETLYFKPIFTVEHAMEVTGLSYPNANKLVKDLCDVGLL
                     EEITGQKRNRAFCYAPYLAVFKDG"
     misc_feature    complement(92300..93295)
                     /locus_tag="sll6098"
                     /note="Fic family protein [Function unknown]; Region:
                     COG3177"
                     /db_xref="CDD:225718"
     misc_feature    complement(92981..93235)
                     /locus_tag="sll6098"
                     /note="Fic/DOC family N-terminal; Region: Fic_N;
                     pfam13784"
                     /db_xref="CDD:258068"
     misc_feature    complement(92720..92968)
                     /locus_tag="sll6098"
                     /note="Fic/DOC family; Region: Fic; pfam02661"
                     /db_xref="CDD:251453"
     gene            93525..93761
                     /locus_tag="ssr6099"
                     /db_xref="GeneID:2656178"
     CDS             93525..93761
                     /locus_tag="ssr6099"
                     /note="ssr6099; ORF_ID:ssr6099"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942542.1"
                     /db_xref="GI:38505924"
                     /db_xref="GeneID:2656178"
                     /translation="MDLDARFECDITPLRSTFITYNQGRAQPRGSRRTAARAATGLKV
                     AVFVFYRTLKNLISTFPGRDHCQKLRKTLRFDCG"
     gene            93820..94140
                     /locus_tag="slr6100"
                     /db_xref="GeneID:2656184"
     CDS             93820..94140
                     /locus_tag="slr6100"
                     /note="slr6100; ORF_ID:slr6100;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942543.1"
                     /db_xref="GI:38505925"
                     /db_xref="GeneID:2656184"
                     /translation="MHIISKTALKQFWEKHPNAKASLTAWYKIASHSQWKHLDDVRQT
                     FPHADPVGQLTVFNIGGNNYRLITKIVFPTNESNIGRVYIRDVLTHADYSKGNWKKDS
                     WFKS"
     misc_feature    93871..94110
                     /locus_tag="slr6100"
                     /note="Uncharacterized protein conserved in bacteria
                     (DUF2136); Region: DUF2136; pfam09907"
                     /db_xref="CDD:150566"
     gene            94281..94700
                     /locus_tag="slr6101"
                     /db_xref="GeneID:2656185"
     CDS             94281..94700
                     /locus_tag="slr6101"
                     /note="slr6101; ORF_ID:slr6101;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942544.1"
                     /db_xref="GI:38505926"
                     /db_xref="GeneID:2656185"
                     /translation="MSCTYLELIKSFPPRPIRSPEDFGATQAVVNNLLDKEVLTADEE
                     DYLEVLGTLIYEYEQQQGDIIPDIHGTELLQILIEEYELKQKDLVPIFKTESIVSEVL
                     KGKRQLTTRHIQELATFFHVSPAVFFPANSSGDLLAA"
     misc_feature    94320..94661
                     /locus_tag="slr6101"
                     /note="Predicted transcription regulator containing HTH
                     domain [Transcription]; Region: COG5499"
                     /db_xref="CDD:227786"
     gene            94710..97901
                     /locus_tag="slr6102"
                     /db_xref="GeneID:2656186"
     CDS             94710..97901
                     /locus_tag="slr6102"
                     /note="ORF_ID:slr6102"
                     /codon_start=1
                     /transl_table=11
                     /product="type I restriction-modification system R
                     subunit"
                     /protein_id="NP_942545.1"
                     /db_xref="GI:38505927"
                     /db_xref="REBASE:Ssp6803ORF6095P"
                     /db_xref="GeneID:2656186"
                     /translation="MSRIMKSSPEYLYSEKPTLDELKKLGWQYVPGCLEDQPVPTDPL
                     ITERESFKQILIKPRLQQALKRINLTDDGEPWLDDYQIESAISQLERAVTTEKLIEAN
                     QLITELLWNGVTVFVPNGKDEIVQFIDFENIEQNDFLAINQYRVDPPSSNGKHFSIPD
                     IVLFVNGIPLVVMECKSPTLQNPLTDAIEDLLKYSNQRNSEQPEGIEKLFHYNLMMVA
                     MSQNRAVVGAVCAKHDEYLAWKDVYPATPESIAQIFAVEKLIGDRQTLVAGLLKPDIV
                     LDVLRNFTMFSTHTGKLEKVLPRYLQYRAILKAIDRLQNNSTRQDHSDDRRGGIVWHT
                     QGSGKSLSMVYLIRKIRRTPNLKRFKIVIVTDRTDLEKQLSATVKLTKEPLQIAKNVK
                     QLEHYLAQPGAGLVFGMVQKFRGEDEEPQDIEEYIPEHLNDSPEILVMIDEAHRSHAS
                     ALHMNLMKALPNCAKIGFTGTPIVAAKKKKTAEIFGGWIDKYTIKESQEDGVTLRIMY
                     EGLEARATVANGETLDQLFEVIFRDKSEEERGKIKQKYATRGEVGEAKELIVAKAKDM
                     LQHYIRHILPNGFKAQVVASSRRAAIRYHEAFSLALQEVIQKVENQRAILQSLDDEAI
                     ASLDQETQYLAYCSRHLEILRTLETAVVISGDKEDPQDWQCWTSQSNQDQFIERFKKP
                     LAEDGLAFLIVKSMLLTGFNAPIEQAMYIDRNMVEHELLQAIARVNRTYDGKDYGLIV
                     DYHGIRIDEALAMYDVEDLIDSHFDISTELPKLEDQCRRVLSIFEESQTDISDVEACL
                     QLLDDERLRVQFIESLKVFLETLDLILPRPAAAPYIPIAKKLGLIRKSLADLYRDEHL
                     DLVGARAKVRELIDSYIQTQGIDPKTPPVDILSLEFQQQVNQRQSTRTQAAEMEHAAR
                     HHISVHFDEDPVYYKNLSEHLEEILQKYSDNWDERAAALEKYTQNIQNGRQENGTGLD
                     PQREQPFFDLLQQQTNIDQAPLIEVTREILTHIIATISRINFWNNPVAQNNLKTWIVN
                     YLDDQDIVSFEQQEAIADQLVQLAKKRHQWLVR"
     misc_feature    94746..96983
                     /locus_tag="slr6102"
                     /note="type I site-specific deoxyribonuclease, HsdR
                     family; Region: hsdR; TIGR00348"
                     /db_xref="CDD:232933"
     misc_feature    94971..95348
                     /locus_tag="slr6102"
                     /note="Type I restriction enzyme R protein N terminus
                     (HSDR_N); Region: HSDR_N; pfam04313"
                     /db_xref="CDD:252519"
     misc_feature    95688..96125
                     /locus_tag="slr6102"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    95715..95729
                     /locus_tag="slr6102"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    96033..96044
                     /locus_tag="slr6102"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    97047..>97352
                     /locus_tag="slr6102"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     gene            97886..98596
                     /locus_tag="slr6103"
                     /db_xref="GeneID:2656187"
     CDS             97886..98596
                     /locus_tag="slr6103"
                     /note="slr6103; ORF_ID:slr6103;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942546.1"
                     /db_xref="GI:38505928"
                     /db_xref="GeneID:2656187"
                     /translation="MVSTMNIIAYKDLTLEVRRSSRRRTVGITVERDGSLILSAPEQT
                     PESKLQEIVHQRSQWIYKHLIRKEILNPSVPEKEYVSGEGFPYLGRNYRLQVIADDAS
                     QEKLKYYRGRFQLQQSSQHQGRELFIEWYKSHLKAHLQSKVEQFKHRVEVNPNSIQIR
                     ELGNRWGSCSTKGDLYFHWRVAMLPSNIVNYVVVHEMAHLKERRHNQTFWETIECILP
                     DYQDSKQWLATQGIYYDL"
     misc_feature    97958..98566
                     /locus_tag="slr6103"
                     /note="Protein of unknown function DUF45; Region: DUF45;
                     pfam01863"
                     /db_xref="CDD:145171"
     gene            98943..99497
                     /locus_tag="slr6104"
                     /db_xref="GeneID:2656188"
     CDS             98943..99497
                     /locus_tag="slr6104"
                     /note="slr6104; ORF_ID:slr6104;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942547.1"
                     /db_xref="GI:38505929"
                     /db_xref="GeneID:2656188"
                     /translation="MKNIIISNLVDKFKQVESLSQDLQESEIFEHFSNYCIVSNEYQE
                     EFNILNIRVAGGNDLGIDGIAIIVNGSLINDVEELEDLITRNKLIEATLIFIQAKSGE
                     NFEGSEFSNFVFGIKNFFDFQSKLNINDELKHKQSLIKKIYDDPLLFKRGSPQLKYYY
                     VYTGIWSDAEVLNDSYKEKKSPLK"
     gene            99535..100551
                     /locus_tag="slr6105"
                     /db_xref="GeneID:2656189"
     CDS             99535..100551
                     /locus_tag="slr6105"
                     /note="ORF_ID:slr6105"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="NP_942548.1"
                     /db_xref="GI:38505930"
                     /db_xref="GeneID:2656189"
                     /translation="MISNFGHIVKTYLSNFPKDDYPVLDTFKFVSIWLGLVLDQSQTS
                     MRSMFKRLNLRGETVDISTFSKASKKRDVGVFREIIFSLKKELSKRKEIKQGELEIFP
                     LDSTIVSITSKLMWNLGFHQVKVFSGINLSTGIPGGIVIHFGQGHDNKYGNETIEETP
                     ENGVAVMDRGFCDLQRIKRLQKENNKYHVLRIKNNIKLEKLANDNYMVGTGKNKIESR
                     VVIFTHDNSEFRLVTNLPIESKEIEGVSDEKIAEIYKKRWQIELLWKFLKMHLKLNRL
                     IAKNENAIGIQIYTCIIAYLILKLLVIPKEAGTTMLDKLRYLQAFMCEKISYVHWLRE
                     LALR"
     misc_feature    99670..100548
                     /locus_tag="slr6105"
                     /note="FOG: Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3385"
                     /db_xref="CDD:225920"
     misc_feature    99820..100425
                     /locus_tag="slr6105"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     gene            100603..101829
                     /locus_tag="slr6106"
                     /db_xref="GeneID:2656251"
     CDS             100603..101829
                     /locus_tag="slr6106"
                     /note="slr6106; ORF_ID:slr6106;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942549.1"
                     /db_xref="GI:38505931"
                     /db_xref="GeneID:2656251"
                     /translation="MRFNDSGSDDDNSLERIKIEDKNISDLNLFNSVSSFVVDNKEIQ
                     EKIRYATNSISKTIEFEKRISLPTIENIQQSFLGIISAEELIKLITDSSNNILRGIFY
                     DNVRDFQGDNEVNTEISNTIQSSFQDLFVLLNNGITIVAEHASQISSKLTIEGFQVVN
                     GCQTCHVLYNNKNLINDKIYISLKIIVSDDNDVKTRIIKATNQQTVVKKEELIAITDF
                     QKELESYYEAQPEEYRLYYERRSKQYASLTNIEKVRIITIPLQIKAFSSMFLDYAHLA
                     GRYHANLLTSVNDNIFINTHQKIAYYVSAYASYKIDYLLRNKQIDKKYNPFKYIILMG
                     INLYLSEHKKTNNISSKKFASYCEIIKENLWDDDKLTTMISQIINNINHITQTDLDRS
                     YAKTRSFIDTFKDKFK"
     misc_feature    100903..101706
                     /locus_tag="slr6106"
                     /note="AIPR protein; Region: AIPR; pfam10592"
                     /db_xref="CDD:256077"
     gene            102151..102672
                     /locus_tag="slr6107"
                     /db_xref="GeneID:2656252"
     CDS             102151..102672
                     /locus_tag="slr6107"
                     /note="slr6107; ORF_ID:slr6107;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942550.1"
                     /db_xref="GI:38505932"
                     /db_xref="GeneID:2656252"
                     /translation="MILFQGKDSLYYHNGNGGDNWKIGSPQTHIFNAHQTRSLEDLQI
                     QALTLVNRDRQLNNLAPLVADPLITKTAQGHAEDMAKRNFYGHDTPEGKSPTDRYQAL
                     GGKGGVGENIVVLPGSPHFSLNYGLVERFQKSWMYSEGHRKNLLTPNYTKFGYGIATN
                     PNTAKVYAVQNFQ"
     misc_feature    <102256..102666
                     /locus_tag="slr6107"
                     /note="Uncharacterized protein with SCP/PR1 domains
                     [Function unknown]; Region: COG2340"
                     /db_xref="CDD:225218"
     misc_feature    102283..102666
                     /locus_tag="slr6107"
                     /note="SCP_bacterial: SCP-like extracellular protein
                     domain, as found in bacteria and archaea. The wider family
                     of SCP containing proteins includes plant
                     pathogenesis-related protein 1 (PR-1), CRISPs, mammalian
                     cysteine-rich secretory proteins, and allergen 5...;
                     Region: SCP_bacterial; cd05379"
                     /db_xref="CDD:240179"
     gene            102911..103720
                     /locus_tag="slr6108"
                     /db_xref="GeneID:2656253"
     CDS             102911..103720
                     /locus_tag="slr6108"
                     /note="slr6108; ORF_ID:slr6108;
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942551.1"
                     /db_xref="GI:38505933"
                     /db_xref="GeneID:2656253"
                     /translation="MLDFSAISEALDIFDGVRNEIVGAVGESIFNQAAKKYLSDDYIL
                     INDIVLKSSSGTTQIDQVIVSKFGLFVIEIKNYKGWIWGDVNSQYWAQTLSKGSKNKF
                     QNPIRQNYKHIKALECLLKCQPNYLKSLVVFSSFCQFKTSLPSNVVQGEAAYINYIKE
                     HKESLISDDEVKEITQKVLGARLDASEHRKHIQKVKNQYQNADENTAPECPKCGKNMV
                     LRKSKSGPNVGRSFWGCSSYPQCRGIVNIKTAEEKAADDINKMHKLFKRLF"
     misc_feature    102977..103312
                     /locus_tag="slr6108"
                     /note="Nuclease-related domain; Region: NERD; pfam08378"
                     /db_xref="CDD:254764"
     misc_feature    103382..>103678
                     /locus_tag="slr6108"
                     /note="Zn-finger domain associated with topoisomerase type
                     I [DNA replication, recombination, and repair]; Region:
                     TopA; COG0551"
                     /db_xref="CDD:223625"
     misc_feature    103535..103654
                     /locus_tag="slr6108"
                     /note="Topoisomerase DNA binding C4 zinc finger; Region:
                     zf-C4_Topoisom; pfam01396"
                     /db_xref="CDD:110400"
     gene            complement(103764..104327)
                     /locus_tag="sll6109"
                     /db_xref="GeneID:2656199"
     CDS             complement(103764..104327)
                     /locus_tag="sll6109"
                     /note="sll6109; ORF_ID:sll6109;
                     putative integrase/recombinase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_942552.1"
                     /db_xref="GI:38505934"
                     /db_xref="GeneID:2656199"
                     /translation="MKINRQGQAKVLTEQELHDLFTIGLLTPRDRLLFGICLYTGCRI
                     GEACSLAWADVTTDAMTFRIEKTKTKSSRTVAISPALQVLFDEYRQQQCFRFSSSYVF
                     RGKRVGSHFHPSMAHKILKAATDRIEVRGVSTHSFRRTALTMMCRKGINLRVIQKISG
                     HKNLNVLSHYLEVSEQEKEQALSTISF"
     misc_feature    complement(103815..>104300)
                     /locus_tag="sll6109"
                     /note="Integrase [DNA replication, recombination, and
                     repair]; Region: XerC; COG0582"
                     /db_xref="CDD:223655"
     misc_feature    complement(103815..104249)
                     /locus_tag="sll6109"
                     /note="DNA breaking-rejoining enzymes,
                     intergrase/recombinases, C-terminal catalytic domain. The
                     tyrosine recombinase/integrase family share the same
                     catalytic domain containing six conserved active site
                     residues. The best-studied members of this diverse
                     family...; Region: INT_REC_C; cd01182"
                     /db_xref="CDD:238587"
     misc_feature    complement(order(103818..103820,103923..103928,
                     104124..104126,104196..104201))
                     /locus_tag="sll6109"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238587"
     misc_feature    complement(order(103818..103820,103845..103847,
                     103914..103916,103923..103925,104124..104126,
                     104199..104201))
                     /locus_tag="sll6109"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238587"
     misc_feature    complement(order(103818..103820,103845..103847,
                     103914..103916,103923..103925,104199..104201))
                     /locus_tag="sll6109"
                     /note="active site"
                     /db_xref="CDD:238587"
     misc_feature    complement(order(103818..103820,103914..103916,
                     104199..104201))
                     /locus_tag="sll6109"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238587"
CONTIG      join(AP006585.1:1..106004)
//
DBGET integrated database retrieval system