GenomeNet

Database: RefSeq
Entry: NC_005232
LinkDB: NC_005232
Original site: NC_005232 
LOCUS       NC_005232             106004 bp    DNA     circular CON 17-AUG-2015
DEFINITION  Synechocystis sp. PCC 6803 plasmid pSYSX DNA, complete sequence.
ACCESSION   NC_005232
VERSION     NC_005232.1  GI:38505825
DBLINK      BioProject: PRJNA224116
            Assembly: GCF_000009725.1
KEYWORDS    RefSeq.
SOURCE      Synechocystis sp. PCC 6803
  ORGANISM  Synechocystis sp. PCC 6803
            Bacteria; Cyanobacteria; Oscillatoriophycideae; Chroococcales;
            Synechocystis.
REFERENCE   1
  AUTHORS   Kaneko,T., Nakamura,Y., Sasamoto,S., Watanabe,A., Kohara,M.,
            Matsumoto,M., Shimpo,S., Yamada,M. and Tabata,S.
  TITLE     Structural analysis of four large plasmids harboring in a
            unicellular cyanobacterium, Synechocystis sp. PCC 6803
  JOURNAL   DNA Res. 10 (5), 221-228 (2003)
   PUBMED   14686584
REFERENCE   2  (bases 1 to 106004)
  AUTHORS   Sato,S. and Kaneko,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-SEP-2003) Contact:Shusei Sato Kazusa DNA Research
            Institute, Department of Plant Genome Research; 2-6-7
            Kazusa-kamatari, Kisarazu, Chiba 292-0812, Japan URL
            :http://www.kazusa.or.jp/rhizobase/
COMMENT     REFSEQ INFORMATION: The reference sequence was derived from
            AP006585.
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider                    :: NCBI
            Annotation Date                        :: 08/17/2015 19:20:20
            Annotation Pipeline                    :: NCBI Prokaryotic Genome
                                                      Annotation Pipeline
            Annotation Method                      :: Best-placed reference
                                                      protein set; GeneMarkS+
            Annotation Software revision           :: 3.0
            Features Annotated                     :: Gene; CDS; rRNA; tRNA;
                                                      ncRNA; repeat_region
            Genes                                  :: 3,673
            CDS                                       3,602
            Pseudo Genes                           :: 23
            CRISPR Arrays                          :: 3
            rRNAs                                  :: 2, 2, 2 (5S, 16S, 23S)
            complete rRNAs                         :: 2, 2, 2 (5S, 16S, 23S)
            tRNAs                                  :: 41
            ncRNA                                  :: 1
            Frameshifted Genes                     :: 13
            Frameshifted Genes On Monomer Runs     :: 3
            Frameshifted Genes Not On Monomer Runs :: 2
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..106004
                     /organism="Synechocystis sp. PCC 6803"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:1148"
                     /plasmid="pSYSX"
     gene            join(105009..106004,1..255)
                     /locus_tag="SGL_RS01365"
                     /old_locus_tag="slr6110"
     CDS             join(105009..106004,1..255)
                     /locus_tag="SGL_RS01365"
                     /old_locus_tag="slr6110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153819.1"
                     /note="slr6110; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate phosphodiesterase"
                     /protein_id="WP_011153819.1"
                     /db_xref="GI:499467179"
                     /translation="MVVGDLLSLSANIEVAVVEKTKVSRSLLVLDDEKDVAATICMMA
                     ATVSYDTDHVDNADIFLEKVVTWAPTHVVVDLKLADRDGIEVIRKLAEMECNAAVIIM
                     SGLGGRILESSARAAGENGLQLLGTLSKPFSRAELLELLAKDTHETLSIQSSPISPVS
                     DRQIGDALKAEAFVAHFQPKISCLTGGLVGFECLARWPQPDGSMIPPDQFICFAEQKG
                     LIDALTRQVYDYALANLPLCNLRNQLKYALNLSPINLKDATFPHWLRNKCCEHNVKPS
                     QIILEVTETASMENPLVLLEHLTQFRIYGFQLSIDDFGVGYSSLVQLARLPFSELKVD
                     QMFVKTLASSKESQKIVTAVVGLGKSLGLNVVAEGVEDVSALGLLQDLGCDEAQGYFI
                     GRPMDRVSAGNWNGLSGLSQKWVQ"
     gene            465..3053
                     /locus_tag="SGL_RS01370"
                     /old_locus_tag="slr6001"
     CDS             465..3053
                     /locus_tag="SGL_RS01370"
                     /old_locus_tag="slr6001"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153820.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase/response regulator"
                     /protein_id="WP_011153820.1"
                     /db_xref="GI:499467180"
                     /translation="MSASLQRVMSLKTADIMGIQRYPIRLSNSTFEEKFWSPVNSPVL
                     DEFGAVEFIMHRVEDVTAIVHENSFAVLTEITKTENRIALQDIILRSRELKQTLSKLQ
                     EHEARIRTAERMLSLGTWEYNPQTGTLNWSRHVFDIYGIPPTQKALDVEEYFAMVHPD
                     DREASIAVYQSFMEENAPRIAFEHRVITRNGGVRCVKGVGERHWTPDGEIVVGCVQDI
                     TSFIRNRDKLTQAEYLLRLAGEKASLGGWRIELDPPVITWTSETAVIHGMPPDYSPPD
                     VGTAVQFYAPEFREFIMEVFERCVQQGEPFDVICQLQVPDGRRPWIRAIGEAERDAQG
                     KVIVVQGAFQDISTLREAQERFQLISKAANDVIWDWNFATNQVWWNDSITDLFGYALL
                     DMEPGLESWTLRIHPDDKERVLHSIYQVIDGEENYWECDYRFMKSDGQYANVIDRGFV
                     TRDGQGKATRMVGSMLDITERMAMEQRLRESQKMEAVGHLTGGVAHDFNNLLTVILGN
                     AEMLAELVTDPDLQSMAEMTLSAAKRGAELTRHLLAFARRQPLDPKPKNINHLVEAMW
                     GLIRRTLPENIELEFAPDPDLGIAEVDANELETALLNLVVNARDAMQDGGKLIIETSS
                     AVLDNDYAALHCEVIPGDYVMICVSDTGIGMSADTVSHAFEPFFTTKPVGKGSGLGLS
                     MVFGFTKQSGGHIKIYSELGEGTSIKLYFPKVKDAQRINYQPAKELIPKSGTEHILVV
                     EDDDLVLRHLEGQLRSLGYRVTAVTCGPNAIEALKAHSDIDLLLTDIIMPGGMNGREL
                     ADLAKATYSKLKVLFTSGYTENAIIHHGRLDPGVDLLSKPYNRLELATKVRRVLDKDL
                     NPITSY"
     repeat_region   3240..28310
     gene            3505..3753
                     /locus_tag="SGL_RS01375"
                     /old_locus_tag="ssr6002"
     CDS             3505..3753
                     /locus_tag="SGL_RS01375"
                     /old_locus_tag="ssr6002"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153628.1"
                     /note="ssr6002; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153821.1"
                     /db_xref="GI:499467181"
                     /translation="MDFNPNEWPTHKQGEIVRQLILDALDSPKTKEELSSLCNKSVRQ
                     ITRHLHRLSSENKILSTGKGQFVRRIAAGFLLLYVGQI"
     gene            3853..4080
                     /locus_tag="SGL_RS01380"
                     /old_locus_tag="ssr6003"
     CDS             3853..4080
                     /locus_tag="SGL_RS01380"
                     /old_locus_tag="ssr6003"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153822.1"
                     /note="ssr6003; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153822.1"
                     /db_xref="GI:499467182"
                     /translation="MSIAGKSKGDVVQQLEKSYGVARTTVFNRLKYLGYSLDKVDDLF
                     SLSNEQMAELDKLHRWISDGAKWPIIPNQDN"
     gene            4083..4406
                     /locus_tag="SGL_RS01385"
                     /old_locus_tag="slr6004"
     CDS             4083..4406
                     /locus_tag="SGL_RS01385"
                     /old_locus_tag="slr6004"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153882.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041428297.1"
                     /db_xref="GI:752788441"
                     /translation="MITDEGELEQYGEVINFDALEGDEELGHAELIRAAQNQAAGILI
                     AQNLLTAEILKNPQHLPADLQAQVEQSKVAIAPKPQNPLVIASQWITKAKAYQSNQNH
                     GQLAA"
     gene            4463..5251
                     /locus_tag="SGL_RS01390"
                     /old_locus_tag="slr6005"
     CDS             4463..5251
                     /locus_tag="SGL_RS01390"
                     /old_locus_tag="slr6005"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153824.1"
                     /note="slr6005; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153824.1"
                     /db_xref="GI:499467184"
                     /translation="MDGLLHSLYAARSVLVTSGEGMGKTYLVRQVWERLLADGVTCQY
                     FEPATPKTLLMAIAAMAGVDSKNLEGRSKTVEVLKQELIQWFSVNRAVLIFDDAHYLE
                     VKFRLWLKKLKDVGVPMLLAATNPPRTDLFIYVPRIELKPLAEYQIRDLMEKEAISLG
                     SGLKPNQIAKLQSRAGGNPMLAKRAIEEGFLGIQNEAGDHGRYFDITPLLLLVGIVFI
                     CYRFIGLGTGNQSLYILAGIGGAIFLGVARLSYYLPKESRRITN"
     gene            5251..6279
                     /locus_tag="SGL_RS01395"
                     /old_locus_tag="slr6006"
     CDS             5251..6279
                     /locus_tag="SGL_RS01395"
                     /old_locus_tag="slr6006"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153825.1"
                     /note="slr6006; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153825.1"
                     /db_xref="GI:499467185"
                     /translation="MLTITHLLVGAASVGMAAQTTNPVPILIGAIASLLPDIDISTSP
                     AGRILPFISRPLEQRFSHRSATHSLLASFTLALVSYALWFAMPVIPLVIVHALNIGYF
                     AGWFLDCFTKSGVEMFYPLGVRCVCPGNRNLRISTGSAAEYWLMVFVVAIAVWTFQLN
                     NTGGLVKNFNALIAAPSGVVELYNRKGGNEIIYAEYEGVWAGNRAPIKEEAPVIATNG
                     QGFLVLRDDQVVKVGTEADSTIIVNRIRGREGEPAVIHTETIYLDDEPPDRLEGYINP
                     MTFISGQLTIDDPTMLRLEQSAFAFAPIRNAGGFVTLDHAPIETAIQLLQDQYVRGSV
                     TIKTIEKR"
     gene            6397..7470
                     /locus_tag="SGL_RS01400"
                     /old_locus_tag="slr6007"
     CDS             6397..7470
                     /locus_tag="SGL_RS01400"
                     /old_locus_tag="slr6007"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153826.1"
                     /note="slr6007; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153826.1"
                     /db_xref="GI:499467186"
                     /translation="MFASNPKPRPLVNRLAHTQTPSNFPVVNREGVLIGEQIYWNPAT
                     VANPHGCIIGGSGAGKTQTLKAIAWEVSKLVEVAIIDFHGDQELPGEKVYHINMTSNS
                     GINPLVINLDQEGGGPNLRAIELAMLFAKTLRLGSNQQGKLLDAFKHCYFRRGISQES
                     PQSWLKVPPNFSDLEALLEEMAEEDKEAEKLRLKLSTMFEYGIFNKTQPPYERLTRWN
                     LAKLPPQLQAIAGDALASQLMSHHRLLGESTLRTVLFIDEAKELGHSKALDRIAADGR
                     KYGLGLWVASQSSRHISKDVLTNTFTKLILPVDSSELPLTARTFRFSEEAIANLNPLE
                     SLVRFGKNANKVNIVPFYQRNTP"
     gene            7565..8596
                     /locus_tag="SGL_RS01405"
                     /old_locus_tag="slr6008"
     CDS             7565..8596
                     /locus_tag="SGL_RS01405"
                     /old_locus_tag="slr6008"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153827.1"
                     /note="slr6008; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153827.1"
                     /db_xref="GI:499467187"
                     /translation="MNWRALLLAVILGTVVFGGLHAQTNTTNTPSNNSSLTTPNRLKI
                     NLTLGDPTELKVREGDTVNRGQVLSDKEAERSRLERDQRERLLAIANVEGQLVPTLQP
                     APALRELPPVSYTVEETAIQLAEIKLAQAQRNLATAIEADPFISAKAKVERSLADVEA
                     AHRAFELQQRKLDAVNGLKGLPPEMLTHETEKLRQVRTALEGKEAEYKFFQAEYFQVE
                     ADRRKELTDLQSKVSIARGELEQAQSRLRAAKENRELAEYNHRITISRRAEEENQVAI
                     NVANQKLDREFKLAQLREQLSAVEEKLNGIVQIKSPYSGTIRRIKFDRQTDGKLAVTL
                     YLDTTNPNP"
     gene            8655..9449
                     /locus_tag="SGL_RS01410"
                     /old_locus_tag="slr6009"
     CDS             8655..9449
                     /locus_tag="SGL_RS01410"
                     /old_locus_tag="slr6009"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153828.1"
                     /note="slr6009; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153828.1"
                     /db_xref="GI:499467188"
                     /translation="MEDPQGQSNPFLAPELDELVDNKISEDVWQQMLGELPCSVTTED
                     CINQLQNVAVQNSRLLADLQEKIDEAQNAVDEARRKNLDSIAIGNFSPFIQTFLYSTL
                     GPVSNGVEPPVNNPFRLILGNTLSAFLGQGLGALFNWSDYAANDSQQQRAIAIGDIQI
                     KIAELQRNKAELTQKLREQVVFEALKLEEIARNFQIEQEIAKRDKQRLEIAKVSYRFG
                     EGDSERYLNQISAYDRQKAATFREWSRLRSQVITVKLLVLGGQDAE"
     gene            complement(9520..10185)
                     /locus_tag="SGL_RS01415"
                     /old_locus_tag="sll6010"
     CDS             complement(9520..10185)
                     /locus_tag="SGL_RS01415"
                     /old_locus_tag="sll6010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153829.1"
                     /note="sll6010; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153829.1"
                     /db_xref="GI:499467189"
                     /translation="MTLIAIMKYKILSSLALVTLGITAIAPMVNAGMAKDNYTGKIYS
                     TGHAPRDDVYVYYLDAPLTKKVSANECGIVQISLGSIPHTGSTEVTLIGVGPATVSSF
                     PLMAKADAPKCSNGVATNIPAEGKARYVPNAETGNQSLVWTGQTPFTQYDITFPIPKE
                     RKLKSNACGVATISSSSSYPSTGTFRMGASPTVHNFATVTGVNAPPGCKNNTLLLPVG
                     FPN"
     gene            10368..10895
                     /locus_tag="SGL_RS01420"
                     /old_locus_tag="slr6011"
     CDS             10368..10895
                     /locus_tag="SGL_RS01420"
                     /old_locus_tag="slr6011"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153830.1"
                     /note="slr6011; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153830.1"
                     /db_xref="GI:499467190"
                     /translation="MITACSQEQMQEMASNAMVTQNRTPDKTWRVKPGSVHDGDTFRA
                     VADVTNEEIKVRIACIDAPEIKQAGGIESRDYLRGMLTDNREIILMGAEKDQYGRSVV
                     EVFAMTDTPGLEVGVNGEMVLAGMAHYYEGHKRSCPENAEQYEFLEQEAISNKAGVWA
                     NGDAERPWDWRRRNK"
     gene            11315..13507
                     /locus_tag="SGL_RS01425"
                     /old_locus_tag="slr6012"
     CDS             11315..13507
                     /locus_tag="SGL_RS01425"
                     /old_locus_tag="slr6012"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153831.1"
                     /note="slr6012; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153831.1"
                     /db_xref="GI:499467191"
                     /translation="MDSPRQLSSPTLTNVIPLAAGIIVALVGIAAKIQPLQSGIMGFT
                     AGVSGAATASLATKKEREILLLAEQELSKTKINNTLSELQEQKKIIDKDITRLEERRS
                     QSEKIAGELEIRQAKRDSIEAEIKNLQAVQQNLESRVAEINKANPTLENLEIRQKEIS
                     RLQSIIKQLEGELFAYKSKIAEMEQKKAGLEEKEALYLKREIEIKEISEQIQQGQVKL
                     KDLNRQAVELELLRNTYDALEREKQTYESQKEHLYAEVIRLGAEKDRILAEIKELEGR
                     AQESDRLRAEIADLKAKRRIAEDLLRDIQREIEQHEIIKDNLINDIARKDAEINRKKN
                     NVSELEQRIRELKQEISDLEDSARVALQTLEEPIKDLIPVQRQGINEDDFLNQFSNSL
                     KVKGLDFHERIVKAFHTSLKVQDISALVILAGISGTGKSELPQKYADFIGAPLVMLPV
                     QPRWDSPQDLQGFYNYIEKKYKPTQLMHYLYQYQQDRKMHGRIIMVLLDEMNLARVEY
                     YFSDFLSKLETRRSKPTYLSLDVGSLKLPEKQRDILIPEEFLFIGTMNEDETTQSLSD
                     KVLDRANVLTFGRPNELKLRGRKIKYEKAENYLPWNEFVKWTKEPDPDSPMVIEIKDF
                     VDRANAIMEKLGHPFAHRVYQAIAKYVVNYPGAEQDLQIRRQAIADQFGQKLLPKLRG
                     IRIDEASTELDEMKRLIQELDDPALTEAFDRAKQGRYGQFQWKGMLYS"
     gene            13483..15039
                     /locus_tag="SGL_RS01430"
                     /old_locus_tag="slr6013"
     CDS             13483..15039
                     /locus_tag="SGL_RS01430"
                     /old_locus_tag="slr6013"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153832.1"
                     /note="slr6013; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153832.1"
                     /db_xref="GI:499467192"
                     /translation="MEGDVVQLIMKIYANLGTYLQNEPLQLLDAVLDSADRPILVLDN
                     DEELSQTPGFLIPLEDKNSYEIGFPLVSISDWDSYQILCQKSSLKLQKNNEETSFKIS
                     IKDLILDSTQVNDESTHNRLNNELNNSYDRHTAETIAVFIGLFQGMRSGRRIKQIKFP
                     LLNLPEYFHELSSEDARLPLVVSLDRRYELRHKLESITTKLRSQLNRTVEMIPLARIH
                     EMDAYCLRDYVRRPGRNAIEKAGARQELLGIKRFQNFNTPENRFLKGFCELLHLECQE
                     YSKNREAELLGQSINYFRQNETVQTVKRSVSLLDKPNYVLEQNPIYRSFYQAYLDYVH
                     RLSDKEKLWSYRQRLCSDVIAVLLMTSFLYFQGSYASALSDLSILDNPLFGRYLENDS
                     MPVIQCFLQNYVVSFQLNRSSSIRQGDWLLIIKQQKINSLEVKTLQIPIWIFWYRPSL
                     KLINKNNFKRALYFYLCERPETNNYSQWITKIDHSLMIRLPDLKENNLQTIIIFLNDI
                     FCKYLKEYFS"
     gene            15036..16439
                     /locus_tag="SGL_RS01435"
                     /old_locus_tag="slr6014"
     CDS             15036..16439
                     /locus_tag="SGL_RS01435"
                     /old_locus_tag="slr6014"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153833.1"
                     /note="slr6014; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153833.1"
                     /db_xref="GI:499467193"
                     /translation="MSLPTELIESSCNQSSTYFISRANLNFPCANYTLPLSSAQKEAF
                     DLAISNSPISLISGNPASGKTHVGCFVLEMSVRFQKSILVVARHANTLEAYKNLNVNS
                     LFLEIFNNYSDSIFAWLRHNLAQPKINFMPLHLFPDPLLETLQESKQLNQWIDLAEKG
                     DKKNLQEEMMKVFPQVSKSRLDLLVEKLYKLYPLLKQHQKLKEHYLNLSEEGILQLTE
                     LMSETTKIPILATFQSVLNSDVKFKQFEIVLVEDSHLFSDHDLLLMASMTNKLILLGE
                     NIKSDTFFTRLSECLSPAYRANLSENFRLHPLLSRPIFSTFYYSQPYSSLQNYSYRTF
                     QNRLRWIDIHEDKLITPQLLDFIENSDIDISSIKVGILTFSITAKEMIQSQCPEQWLN
                     QIYVDSCENWYGKECNVLLIVCDGTKPTPDQLRLALTRASDAIVCFGDINQYEMSSFR
                     TLIRDKTLTIEREVSLL"
     gene            16436..18091
                     /locus_tag="SGL_RS01440"
                     /old_locus_tag="slr6015"
     CDS             16436..18091
                     /locus_tag="SGL_RS01440"
                     /old_locus_tag="slr6015"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153834.1"
                     /note="slr6015; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153834.1"
                     /db_xref="GI:499467194"
                     /translation="MKIIVKLQGVFERKNVDNNTVRQSSLSDLLNDLRVLATSHNRHH
                     ISYIHQSFGLNFLSQQTLEHLIQKVGGKSSYLSSTFLTPANQNLIQEEFFYSYCFTCP
                     IISLQLSPHDPQLPLWSGQHCDGTYNLDISNDVDNLRLQSIRQEALSIIKQKTSVEII
                     RAALHSPNNFAIPITLSTGEYITIWQKLEELPSELQIAVMALIKNYFPSFLSAEAKSL
                     IDEYKKKYIVFNYQNLLEFTISENEPKGLDFIVGRGLHRKEIEALISSAQRFLLISSF
                     RLEDESIVQLIVKKAKELPEGVWILTDLNNDVLDRIDTNMEGKIDHEDDYAESDRKKK
                     ECLRLLATSGVSIRSGLFHLKCYITEKSSYMGSCNLTGGSLERNGEAGIIWKNVESHQ
                     RLIDHFSHLWDEQSNAVILPTTQGIRSQGLSNYFAISKREGFLTYHSNDLTRTLTEFA
                     RNPTGKISIYTRTFAPTAQQEELLSRLHCHIFYGHRNYSNLDAKQIYNLHAKIIIIGT
                     TAAYMGSQDFAFGRRSNHDLTYKTTDLNEIQAITQLVDALHRG"
     gene            18098..20500
                     /locus_tag="SGL_RS01445"
                     /old_locus_tag="slr6016"
     CDS             18098..20500
                     /locus_tag="SGL_RS01445"
                     /old_locus_tag="slr6016"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153835.1"
                     /note="slr6016; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153835.1"
                     /db_xref="GI:499467195"
                     /translation="MTRLFNLESYPEICKYTQIFGESLSLNSPNIPFAYRDFLNTYKD
                     RHFISPANLSSYYSNTIVRGEYKPQFLGDQLDDQQEGDLVIVRDIDVLSLQNLDCPYI
                     YASAYRYWNYVTQLQNIAKENKPLVIYDLDSLPCSYYLPISFQSHPNCSYSIPILDIR
                     TPENYESLRLPFDPSNVYDTICEILAQYVIASDPNFVGIESSYLTQYLKKINVFNIIK
                     NCLISNPNQEIVSLLIDFSNVDNTNLYLKAELPLTIVENIVSSVILVPRLKEIVQNNC
                     EYNFVLISQYNCLSNFRLSLESHFSLPDISHSEFSKIWQEKQSQEFPLYGQFLDLITF
                     QLANQISINVPSESERTNICYEGERKFHTFIGQYTIPSGETKSSFRIDKPQVILPIKI
                     NGKLIIKNEIEQVYIINNQFFEQTPSLSVEIHFSLMLGKPLLLEIFEVYSDQKLGHKL
                     NAKLEDRPEIKLGFIPIQNIIEGRKTKENNATTNLCLNLKFISDFSHGLDEIAKALHA
                     YIKQSSKNIKLRTDLKLSKIQSIVRSNYLSFLKNDALQHVSTNSSNEIVSEITNKIIS
                     SEIKLLLQKALFTLGQRHPNTEGKERGQIFNIYNDNLLLIGKQYKIAAIQDFDFLFDY
                     LKNSPCFSEHVKVIARIAYDSNFQQKYFALFETHLPKNNNNNNFYYEYDSYLWGYARI
                     LMWYLDYNLNETNILLFKRHFNLIASHALSDHSRNSYYQDALISLIYLLSFREFDSTF
                     CEIGSLEYNLGIKLCEKLSFHPVLSKQVDINKSLNQIFYEFLNGTATGDDMDNLIKAE
                     FK"
     gene            complement(20559..21329)
                     /locus_tag="SGL_RS01450"
                     /old_locus_tag="sll6017"
     CDS             complement(20559..21329)
                     /locus_tag="SGL_RS01450"
                     /old_locus_tag="sll6017"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153836.1"
                     /note="sll6017; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153836.1"
                     /db_xref="GI:499467196"
                     /translation="MFDNLCKFLAESFSEDYAAWLLGRPIKLTKLSPTELSLEPIRAD
                     SLILEQSEDLVLHLEFQTEPDPTMGFRMLDYRVRVYRRFPQKTMHQFVIYLKHSNNDL
                     VYQDSFQVGETVHRYQAIRLWEQSSDAFLQSPGLLPLAVLTQTSDPTLKLREVATVLE
                     QIEDNRVKANLMAATSVFGGILLSPDIIKTILRSEIMKESAVYQEILEEGKIAGKLEG
                     KLETIPLLKKLGLTIAEIAKELDIDVELVNRFVANQNN"
     gene            complement(21554..21769)
                     /locus_tag="SGL_RS01455"
                     /old_locus_tag="ssl6018"
     CDS             complement(21554..21769)
                     /locus_tag="SGL_RS01455"
                     /old_locus_tag="ssl6018"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153837.1"
                     /note="ssl6018; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153837.1"
                     /db_xref="GI:499467197"
                     /translation="MLKFIGIALLAALVGYAFGVMAGIFIVNNFSTNVQDKPLELAMT
                     SIFFFGPLGALIGFTIAVVYQLLHQYL"
     gene            22192..22410
                     /locus_tag="SGL_RS01460"
                     /old_locus_tag="ssr6020"
     CDS             22192..22410
                     /locus_tag="SGL_RS01460"
                     /old_locus_tag="ssr6020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153839.1"
                     /note="ssr6020; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153839.1"
                     /db_xref="GI:499467199"
                     /translation="MFLFLILRNRRSGNTVFFCNEEFYHIRQNFLVLSHLRKKFYLEY
                     DFYFSWAKKNLVGNGREKREERKGILVY"
     gene            22487..22951
                     /locus_tag="SGL_RS01465"
                     /old_locus_tag="slr6021"
     CDS             22487..22951
                     /locus_tag="SGL_RS01465"
                     /old_locus_tag="slr6021"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153840.1"
                     /note="slr6021; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153840.1"
                     /db_xref="GI:499467200"
                     /translation="MFKKLGEVEKIKFKNWCVDKNNLMVKEKWFGKEVKEDRRMVWFG
                     VGIELGKNEKFKGLEIDNSLKKRCLEFYGENFNSLLLIKYGDGSKLNLHKDRDCFDKK
                     VVIVNSGICVFEYDGERKILEDGKIYEIDGKKSHGVVKVVGERYSLSIRKVL"
     gene            23048..23833
                     /locus_tag="SGL_RS01470"
                     /old_locus_tag="slr6022"
     CDS             23048..23833
                     /locus_tag="SGL_RS01470"
                     /old_locus_tag="slr6022"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153841.1"
                     /note="slr6022; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153841.1"
                     /db_xref="GI:499467201"
                     /translation="MVAPAGHFLLVGSALALTQALSMGWKGVEFQWTGGGVPCFGGWS
                     VGGSAALPWVAFCVLSCYNGLIGCSPGGCTVLSVSALSPCVVCLLSACPAVGFSGSRS
                     LSPLSVAALRSLSAAVPASASVFVGCAAGADAVGRSLFPSASVFSVSSGQWGAGRSAF
                     ARRSVAVVSAVLSAGGPAGLWCFFPSAGCPVGLLPSARSSRCFCGLGSGSWASAAFAL
                     GSGLPLLAFLPPGVSPPPGWGFSSLGGGWWVAHPAAVQLSLFA"
     gene            complement(23898..24110)
                     /locus_tag="SGL_RS01475"
                     /old_locus_tag="ssl6023"
     CDS             complement(23898..24110)
                     /locus_tag="SGL_RS01475"
                     /old_locus_tag="ssl6023"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153842.1"
                     /note="ssl6023; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153842.1"
                     /db_xref="GI:499467202"
                     /translation="MSGRGRPGGNPDLEKYQFKSPVSESRTAGIYLRITPTDKERLKN
                     VKDWQEKLRQKVKEIIDDSFSKEDKV"
     gene            24263..24442
                     /locus_tag="SGL_RS01480"
                     /old_locus_tag="ssr6024"
     CDS             24263..24442
                     /locus_tag="SGL_RS01480"
                     /old_locus_tag="ssr6024"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153843.1"
                     /note="ssr6024; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153843.1"
                     /db_xref="GI:499467203"
                     /translation="MTIQEAKEIAAVCSMMRNKLPDGMWEEVRETILDYREGKDGEAF
                     AEELSEICKDWGFSI"
     gene            24638..25147
                     /locus_tag="SGL_RS01485"
                     /old_locus_tag="slr6025"
     CDS             24638..25147
                     /locus_tag="SGL_RS01485"
                     /old_locus_tag="slr6025"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153844.1"
                     /note="slr6025; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153844.1"
                     /db_xref="GI:499467204"
                     /translation="MLSPEIYVACLASYNNGLLHGEWISANQDEDEIMAEIEAMLKAS
                     PMRDAEEWAIHDYQNFGGIELKEYEDIETIAKLGQALAEHGEAMAAYYKCYDNLENFE
                     DYYLGEYESEQDFVYDYFEQTGQLEAIEKAGLDSFYIDFEKLAHDWFINDFYSAEISY
                     NKVYVFSRH"
     gene            25216..25473
                     /locus_tag="SGL_RS01490"
                     /old_locus_tag="ssr6026"
     CDS             25216..25473
                     /locus_tag="SGL_RS01490"
                     /old_locus_tag="ssr6026"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153845.1"
                     /note="ssr6026; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153845.1"
                     /db_xref="GI:499467205"
                     /translation="MHHDTKEAISRCLYFIDRENKTQENPIIAVIEKALEFAKNEVSF
                     SDPYDLLAQIESVLTEEELANDDRYYSRQETEDYHRNWLHF"
     gene            25538..25729
                     /locus_tag="SGL_RS01495"
                     /old_locus_tag="ssr6027"
     CDS             25538..25729
                     /locus_tag="SGL_RS01495"
                     /old_locus_tag="ssr6027"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153846.1"
                     /note="ssr6027; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153846.1"
                     /db_xref="GI:499467206"
                     /translation="MYFDRFDIAEAWFIYLSENHSGQNCPLYLRLCQLQKWFKPSPLL
                     NRSRLNENAQAILENLEEN"
     gene            26096..26653
                     /locus_tag="SGL_RS01500"
                     /old_locus_tag="slr6028"
     CDS             26096..26653
                     /locus_tag="SGL_RS01500"
                     /old_locus_tag="slr6028"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153847.1"
                     /note="slr6028; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153847.1"
                     /db_xref="GI:499467207"
                     /translation="MTTTTKTTGKTPKLWELSDEITNLEDQIADIQDREDLSESEKDQ
                     LMGEILETWLSTGKEFDAKACNVAAYIKHLEAITEARKNEYRRLRDLAEQSENQSQRL
                     RNYLVSNMQKLGKKKVNGVSVNLSLRKKPAKVVLNCPLEDLPAAFMKVEITPRLSELK
                     KHLQSNADCSFAQLADVEEYSVMIK"
     gene            26745..27242
                     /locus_tag="SGL_RS01505"
                     /old_locus_tag="slr6029"
     CDS             26745..27242
                     /locus_tag="SGL_RS01505"
                     /old_locus_tag="slr6029"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153848.1"
                     /note="slr6029; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153848.1"
                     /db_xref="GI:499467208"
                     /translation="MLLAEILENLRQPIAPQFISQKKTFKNKKPTGSVDFVAWYDLAD
                     LLDDLCGLGGWEWLIIDTQQIGDRLTLTGSLTIHGDDRSLTRQATGTEDIDCNSYGDP
                     SSNAEAMALRRCCAKFGLGRDLWRKNKPQPLKMGQRQEPEKQTVLAPGTISREEWLKR
                     KQAKS"
     gene            27578..27796
                     /locus_tag="SGL_RS01510"
                     /old_locus_tag="ssr6030"
     CDS             27578..27796
                     /locus_tag="SGL_RS01510"
                     /old_locus_tag="ssr6030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153883.1"
                     /note="ssr6030; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153849.1"
                     /db_xref="GI:499467209"
                     /translation="MGLLSYGLELLAFTPGVLLPPYPTKKGNGQKRPIANNKKIVQNP
                     VNLLGGSSVPHSVFRGLKCFSGKVSRIL"
     gene            27957..31322
                     /locus_tag="SGL_RS01515"
                     /old_locus_tag="slr6031"
     CDS             27957..31322
                     /locus_tag="SGL_RS01515"
                     /old_locus_tag="slr6031"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153850.1"
                     /note="slr6031; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153850.1"
                     /db_xref="GI:499467210"
                     /translation="MKHYKTSHGAYSSAFSPLLVNNPNHSSFGQNKLQPTSRHNPCPV
                     CAKTNGNCRTIADGGVLCMTFPDGDGHPDYRYVKPSENGLWGVHYPRKDGDFDRQAWE
                     KRKEERETRNREIERQRLEKCLDPDRRDAEIRGILSQLTLTDGARRYLENRSVPPEII
                     DRCRSVKRWQKLAQPAHVNLAGVSKLGNQLNNGWDGILEVVPDHLGRLIAMRLHDPDH
                     KTTGNPKYVWLSSKKRGITPHLANGENPIGLFWPGGLASTAKPQRIGLCEGLEFKAPA
                     AANRLEFPVIGFSGYQFLQSPETLKEIITNLNPDAQLVLIPDGGSVQDARISRSHGET
                     LATLTNPVTVAWWGQFTKADGDIDEIAGDRLVEFISPEQFLSYCPQRPKSKVEQFADW
                     ITKQVKRVKPQGFGAPVIGGELFTGDRVDALIKQLEKNRYVLDASWTGDGKSHAIVPL
                     AKALLHRLETLHPEQEIKIYLTSHSYRQPTVEALTAIQAMPTRHGDRYFPHGELEEAA
                     NCIRSRQFNQVAEKGYNPHQGGKHNPICHSCPAFNYCGTDPGMFRQQRRLALQHQIIR
                     CHPSQIPAKGENQLTVVIWDEPAEEQPTKTINTNIGELDQEIAYHRRHSQLSSAQKNI
                     LDQIASLLEGLMADAPKLGLDTADVLNHSQELNQELLGELITLLEQRERDLFDIFPAP
                     TLATFKDNQEVFAGLTAKETAKLKGQFRRSNQYAVGEATKITEEKLQELPSNGLIHLL
                     RCLHGQASVQIQLFPQNLLLTIDRRHELAPIRDADYVIALDATNNGADFACLLNLAKD
                     EVKVIKRKTEKPFQNLKVVQIVLPGWGSSRPSDKAMEKAIAVKDALFQAYGPMPVLTY
                     KAQLETLLAEGQWYRDSRGSNQFEGQPQMLSCGLPLPNLGAIKAQFLATGGQIEDFEE
                     HYHRRSQREVLQNFGRQRANRYPRQQFTHFIVTGDPQHNAIHDLSWVKKFGADYVCLH
                     GFEITPHAGDRSQIARWHIVEAIRSGFTTGSAIAEKLGCSRRNVTDVLTNAGATLTKV
                     TKTLLDTTELGSSSYKPPIRLGSHLEDLPPEILALLGIDLPEAIAEVVEIIQIVGWRS
                     FAEDYLPTLPQRLRSTILATFWSFLDTGPPAPV"
     gene            31373..31801
                     /locus_tag="SGL_RS01520"
                     /old_locus_tag="slr6033"
     CDS             31373..31801
                     /locus_tag="SGL_RS01520"
                     /old_locus_tag="slr6033"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153852.1"
                     /note="slr6033; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153852.1"
                     /db_xref="GI:499467212"
                     /translation="MEPLNTSTYLPDVGDSPWPQNKPEEKYKQLSLLKLTPTVTPSSS
                     TTGPRVKIKLRWPLPEVRRRRSRGQGSGYIRLYYCEKQTRSGKKSYEQYYYHYELELK
                     GKRVKRSAYIPKDKLDMVQEWDRKKVDVILILQYLGKATD"
     gene            32129..32545
                     /locus_tag="SGL_RS01525"
                     /old_locus_tag="slr6034"
     CDS             32129..32545
                     /locus_tag="SGL_RS01525"
                     /old_locus_tag="slr6034"
                     /EC_number="3.5.4.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153853.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytidine deaminase"
                     /protein_id="WP_011153853.1"
                     /db_xref="GI:499467213"
                     /translation="MVDICWEQLHRSAIEVRQNAYAPYSHFLVGAAGLVDDGRIVVGC
                     NVENASYGLTLCAECGLVSHLIATGGGRLLAVVCVDSQDNYLAPCGRCRQVLLEHGGK
                     ELQVMTPTGPLSMAELLPWSFGPQDLRRIGGLNTNP"
     gene            complement(32660..32893)
                     /locus_tag="SGL_RS01530"
                     /old_locus_tag="ssl6035"
     CDS             complement(32660..32893)
                     /locus_tag="SGL_RS01530"
                     /old_locus_tag="ssl6035"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153854.1"
                     /note="ssl6035; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153854.1"
                     /db_xref="GI:499467214"
                     /translation="MSKFKGILDSHKQTAPTESQRKPKTKGKRSDPDYEQVSAYIRKE
                     TYRNVKIALLQEEEKRDFSDLVEALLSEWLSNQ"
     gene            complement(32890..33495)
                     /locus_tag="SGL_RS01535"
                     /old_locus_tag="sll6036"
     CDS             complement(32890..33495)
                     /locus_tag="SGL_RS01535"
                     /old_locus_tag="sll6036"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153855.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning protein ParA"
                     /protein_id="WP_011153855.1"
                     /db_xref="GI:499467215"
                     /translation="MIITVASFKGGVGKTTTAVHLSAYLALQGETLLIDGDPNRSATG
                     WGKRGSLPFKVVDERQAAKYAPKYQNIVIDTQARPEDEDLEALADGCDLLVIPSTPDA
                     LALDALMLTIETLQKLGNNRFRILLTIIPPYPSKDGDEARQLLTTAGLPLFKRGIKRY
                     SAFQKASLNGVVVSEVSDSKAGIAWSDYKATGKEIVEEILT"
     gene            33889..34311
                     /locus_tag="SGL_RS01540"
                     /old_locus_tag="slr6037"
     CDS             33889..34311
                     /locus_tag="SGL_RS01540"
                     /old_locus_tag="slr6037"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153856.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arsenate reductase ArsI2"
                     /protein_id="WP_011153856.1"
                     /db_xref="GI:499467216"
                     /translation="MIVIYHNPDCGTSRNVLQLIEAAGYLPQVIEYVKEGWTKPQLLG
                     LFAAADLTPRSALRTTKSPAAELNLLEETVTDAQILDAMVEYPILVNRPIVCTPKGVR
                     LCRPSEVVLDLLDHWPSGPFAKEDGELIIDERGNRVYT"
     gene            34784..35374
                     /locus_tag="SGL_RS01545"
                     /old_locus_tag="slr6039"
     CDS             34784..35374
                     /locus_tag="SGL_RS01545"
                     /old_locus_tag="slr6039"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153858.1"
                     /note="slr6039; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153858.1"
                     /db_xref="GI:499467218"
                     /translation="MGNQFWIYGLAGLLLSGSAAGVTAVYRNQSPPQMMAQQGMHMQW
                     TDQSFIEMMTPHHQDAIDMAEMALQKAEHPELKKLARNIIRDQEREIKEMKTWYQQWF
                     KRPVPALSSQGMMGMHQGHGMMAMDLDALATAQNFDREFIRQMIPHHQMAVMMASNLK
                     TNTERPEMDKLMDDIIRSQSAEIKQMKQWYQNWYGQ"
     gene            35381..36079
                     /locus_tag="SGL_RS01550"
                     /old_locus_tag="slr6040"
     CDS             35381..36079
                     /locus_tag="SGL_RS01550"
                     /old_locus_tag="slr6040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153859.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PhoB family transcriptional regulator"
                     /protein_id="WP_011153859.1"
                     /db_xref="GI:499467219"
                     /translation="MRLLLVEDEPDLGMVLEKALRRENYVVDWVQDGNLAWSYLDQGW
                     VNYTLAIFDWMVPGLSGLELCQKLRGQRSSLPILMLTAKDQIADRVEGLDAGADDYLI
                     KPFGMAELLARLRSLQRRSPELQPQQLQVGDWRLDYGTFVVVTPDKQQISLTAKEFQL
                     LEYFMKHPQQILSSEQIKNQLWALSAESTSNVVAAQVRLLRRKLGEYSHGNLIETVYG
                     LGYRFQPHPTHAEQ"
     gene            36066..37418
                     /locus_tag="SGL_RS01555"
                     /old_locus_tag="slr6041"
     CDS             36066..37418
                     /locus_tag="SGL_RS01555"
                     /old_locus_tag="slr6041"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153860.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="WP_011153860.1"
                     /db_xref="GI:499467220"
                     /translation="MQNNRLFNLSRWRLASYYAGVMGLILGLCGLAVYEMTSQDHWRS
                     LDQELTSLAGTLHDGLEPLLQQPGQLEPSVKQILPNLCLGTVACPRSPQRRHILNATQ
                     QPGYYVRFLDLNGQLLATAGENPPGLAFERETTRQKPLTDQKGNRYHQVSLLLKTTTG
                     EPWGYLKVGRSLVEYDHHLHTIQGFLVWGLPIVMIVVGGASWWLAGLAMEPVYRSYQQ
                     IQQFTADIAHELRTPITAIQATLETTLNAEPNAEETHSTLQTLKRQNYRLSHLIHDLL
                     LLSRMDLTTVNPTQFTLCCLNDLVEDLTEEFASLAIAAGVLLSAKLDNQANIWVRGEE
                     EQLYRLVGNLISNAIHYTPTGGEVTVMLETDKQQAIIKVQDTGIGIASENQSRVFDRF
                     YRVDTARSRQRGGAGLGLAIAQAIAVKHRGSLTVESELGQGSLFTVQLPLVSAPIVQS
                     "
     gene            37482..39119
                     /locus_tag="SGL_RS01560"
                     /old_locus_tag="slr6042"
     CDS             37482..39119
                     /locus_tag="SGL_RS01560"
                     /old_locus_tag="slr6042"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153861.1"
                     /note="slr6042; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RND transporter"
                     /protein_id="WP_011153861.1"
                     /db_xref="GI:499467221"
                     /translation="MQNRIIVQGWAFPLLLGLLVMSPQATLAHAGHGDEFHQSESAQS
                     AQGISLDGDTIRRLDIQVEPLQPRYLDTGIRTTGQIETLPQQRVEVTTPVGGKLLELL
                     VNPGESVTAGQPVATMTSAELAELRTTAQDRRSSAIAAVEEAQADLELARENYRQQQQ
                     VAQSEIEEARLAKEFAQERYDRDRELEANGALPRRQFLESEVALAQAQANLVRTQSRL
                     PVSEAQAQIKRAQAALSVAQKQVKLSEENYQTRLQQLGTDARPDGTIVIKAPIDGIVV
                     DPATTPEHEIKVGESRQDAGEPIFTLINSQQVQVSANIYEKDLNKIRRGQGIRGWVSS
                     SPDKTFRGRINQIGSVVEGENRIVAVKATLDNPDGQLKPGLFVELEVLTDRTSTPVLA
                     VPQSAIVKTNDQQNLVFVQNGNVFEPITVTLGQVSGDWVEITDGLFAGDLVVSQRASQ
                     LYAQSLRAKPAEKIEETEESTEITASTFTLPGAPPWLLPLGGTVMAAGLFWAGSLWGK
                     RQQSQQLREPSLTSSPEEPSLEVEKVLIETPSHQDFP"
     gene            39171..42311
                     /locus_tag="SGL_RS01565"
                     /old_locus_tag="slr6043"
     CDS             39171..42311
                     /locus_tag="SGL_RS01565"
                     /old_locus_tag="slr6043"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153862.1"
                     /note="slr6043; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation transporter"
                     /protein_id="WP_011153862.1"
                     /db_xref="GI:499467222"
                     /translation="MLNAILKWSIAQRWLVVIGAVLVAILGSYNLTRMPLDVFPPFAP
                     PQVEIQTEAPGLAPEEVETLITLPIESAVNGTPGVEMVRSSSAVGISVVKAIFADNTD
                     IYRARQLVTERLQSARSKLPSGAEEPQISPVSSPISTILMYALTVEESPTNPQSNLME
                     VRRRVDREITNQILAVPGVSQVVAYGGDVKQYQVLVDPARLKGFNISLQQVTKAVEEA
                     NVNAAGGFLLTADQEDVIRGLGRIENLSQLADSVVTARDGTPILLRDVAEVTIGPALM
                     RGDGSVDGQRAVVLVIDKQPQADTPTVTKAVERTMAEVKAALPAGVNLQVTFRQESFI
                     DAAIANVRDSLRDGIIIVAVVMVVFLMNWRTAIITLSAIPLSILIGMMILGWFGQGIN
                     AMTLGGLAVAIGSVVDDSIVDMENCYRGLRKNQALGNPKHPFQVVYDTSVEVRTSVIF
                     STVIIVVVFAPIFSLTGVEGRIFAPMGVAYLLSILASTLVAMTLSPALCALLLAPCRL
                     PSDETWLARISQKIYQPLLKFSTHHPRWIIGAAIAFFIFSLSLVPSMGRVFLPEFQEQ
                     SLVNALLLYPGSSLEATNRVGFALQDALKEDPRFSSVQLRSGRAPGDADAGGVNLGHL
                     DVELSDAGMADREGSIETLRAEFDKIPGVAPNIGGFISHRMDEVLSGVRSAIAVKIFG
                     PDLEQLRTLGKSVETAMAEIPGLVDLQLEPQVPVRQVQIQFDRLAAGRYGLTVGQLSE
                     LVETALNGRVASQILQDQQLFDLLVWLKADARNNLETIGNLLVDTPSGTKIPLAQVAQ
                     ISYGTGPNTINRENVSRLIVASANVKGRDLRSVVNDIQAQVKEKISLPTGYFIQYGGQ
                     FESEERASQNLLLFGLLSIVVITILMYFAVKSLAATLMIMVNLPLALAGGILAIAVTG
                     GVISVASLVGFITLFGVAVRNGLLLVDNYNQKFALALPLAQVVQEGSQERLVAILMTA
                     LTSALGMLPLAIGTGAGKEILQPLAIVILGGLFTSTALTLLVLPALYAQFGRFLRPSA
                     SVTTPASTPINVLTKV"
     gene            42326..42805
                     /locus_tag="SGL_RS01570"
                     /old_locus_tag="slr6044"
     CDS             42326..42805
                     /locus_tag="SGL_RS01570"
                     /old_locus_tag="slr6044"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153863.1"
                     /note="slr6044; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153863.1"
                     /db_xref="GI:499467223"
                     /translation="MKFSIPTNPVILLLIVFLLNACGNQTSPTDISVSPTPTPTVSPT
                     ENVEENKTESHGGQGGQVIEMGDYHLELLSIKEAGGFHLDFYLQKGVDHSPITNAIVT
                     GKVQLPDGTQQDINFKYSDQDKHYTALLSTQVPGDYKLAILSDINGEKVNGRFSFSF"
     gene            43066..43374
                     /locus_tag="SGL_RS01575"
                     /old_locus_tag="slr6045"
     CDS             43066..43374
                     /locus_tag="SGL_RS01575"
                     /old_locus_tag="slr6045"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153864.1"
                     /note="slr6045; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153864.1"
                     /db_xref="GI:499467224"
                     /translation="MLLTSMDQNEWVIFAELQRSDFELIVSILSDHFPRLEWGSQCDD
                     WIWIYRRDYKLEIDSFSSMELEVKAQRKAYGLAQEVLSLLPPSVFIDVFECPKLDFTR
                     "
     gene            43486..43689
                     /locus_tag="SGL_RS01580"
                     /old_locus_tag="ssr6046"
     CDS             43486..43689
                     /locus_tag="SGL_RS01580"
                     /old_locus_tag="ssr6046"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153865.1"
                     /note="ssr6046; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153865.1"
                     /db_xref="GI:499467225"
                     /translation="MESRRLSIRVPDPLLNQLESYLDQQGLTVTEGVLAAIASYVGDN
                     DRLPLVERVSRIEKRLAILEGKG"
     gene            43696..47151
                     /locus_tag="SGL_RS01585"
                     /old_locus_tag="slr6047"
     CDS             43696..47151
                     /locus_tag="SGL_RS01585"
                     /old_locus_tag="slr6047"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153866.1"
                     /note="slr6047; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helicase"
                     /protein_id="WP_011153866.1"
                     /db_xref="GI:499467226"
                     /translation="MSSIYDNCDFPLLPELKHCLKEGYRSDFCVGYFNLRGWRELEDE
                     VEQFTAGKGQNCRLLVGMQRPPNDELRRSLSITKRANQRMSNEQANKLKKIMAHEFRE
                     QLTYGVPTARDEASLKRLKAQLQAEKLEVKLFLRHLLHAKLYLIHREDKITPRIGYVG
                     SSNLTFSGLSGQGELNVEVTDRDDTKKLEEWFIERWEDNFSLDISQDLIKVIDESWAG
                     KQLPPFYIYLKMAYHLSQEARDGLSRYQAPKNFGLLEFQEQAVRVAMQHIDKRNGVVI
                     GDVVGLGKTLVGTAIAHVCEEEYGTSTLIICPKNLESMWQGYVDRYGLRGKVVPISQV
                     EQRLPEVPARFRLVLIDESHNLRNREGKRYQAIKEYIEQSGSRCILLTATPYNKGYLD
                     LSSQLRLFLRAEADIGIKPEAHIRNLGGEMQFLRKHNATPVRSLMAFEHSDEPEDWQQ
                     LMSRYMVRRTRGFIKKTYAKEDERGYYLEFPNSDRFYFPKRCPRTVKFSTSDEKDPYA
                     RLYGDRVVDIINSLNLPRYGLGNYLIPSPGNQKKKHKKSLGQMSLATGFEHLDVTEAE
                     RKILANLSHAGQRLMGFCRTNLFKRLESSGAAFIQSIDRHILRNYVYLHAIANNLPIP
                     IGTQDAALLDGTTDEDQDSLLGQDWETATDTEDSFDEDRLTPGAEFKQRAVAIYELYQ
                     NQYQRRFKWIRPDLFTPELADNLEQDAKSLINILKISGRWNADEDGKLQSLIRLLTEE
                     HPDEKILIFTQFADTARYLAQALETAGITNIGLATGNSQIDPTILAQRFSPRSNGKAI
                     SQRAVAAEDQLRILVATDVLSEGQNLQDAGIILNYDLPWAIIRLIQRAGRVDRIGQEA
                     DEIFCYSFLPAEGVEQLINLRGRLRDRLKENQEVVGTDEAFFEDDEEREVLLNLYNEK
                     SNILDEDDDEGEVDLTSEALQIWQTAIDANPKLKRIIEDLPDVVFSTRHHGPSVLEPE
                     GVLLYLRTAEGTDALAWVDKQGHSVTQSQMRILRMAGCNLNTPALDRHPEHHNLVQKA
                     AQIVTDQTKKVAGTMGSRRGARARTYDHLMSYCQYVQEKTPILAQGQDWENLVKAIEM
                     IHNYPLKQNAIASLNRELKAGISDEDLAQKVTYLMEHDALCVVTADGEFEGAKVICSL
                     GLFQR"
     gene            47182..47409
                     /locus_tag="SGL_RS01590"
                     /old_locus_tag="ssr6048"
     CDS             47182..47409
                     /locus_tag="SGL_RS01590"
                     /old_locus_tag="ssr6048"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153867.1"
                     /note="ssr6048; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153867.1"
                     /db_xref="GI:499467227"
                     /translation="MTITTQAQIVEMLEQLPDGALDEVKSFLAALQNRYPAKHAPKLS
                     EGMAYIEQVRGKMQCDMTTDEIMALTRGEDD"
     gene            47402..47815
                     /locus_tag="SGL_RS01595"
                     /old_locus_tag="slr6049"
     CDS             47402..47815
                     /locus_tag="SGL_RS01595"
                     /old_locus_tag="slr6049"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153868.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_041428298.1"
                     /db_xref="GI:752788442"
                     /translation="MIKVLVDSNVLIDVFSDDSTWFTWSHQQIAYFIDRSETYRLVIN
                     PVIYAEVSVGIESTEKLDQLLLPKYYDRESLPYEAAFLAGKAFLQYRRSGGTRRSPLP
                     DFYIGAHALTAGYRLLSRDNKRYQTYFPDLDLIAP"
     gene            47827..51129
                     /locus_tag="SGL_RS01600"
                     /old_locus_tag="slr6050"
     CDS             47827..51129
                     /locus_tag="SGL_RS01600"
                     /old_locus_tag="slr6050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153869.1"
                     /note="slr6050; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153869.1"
                     /db_xref="GI:499467229"
                     /translation="MKLNRTSTQKYLKNFDFESLFIEELGWDTTDPIALPLEIDEAIF
                     EAIAIAQKRGFTAYYCSTTEIPERKVRLALDRQLSDYSKSHLLIFGDEAQTGQVWLWV
                     RQELGKPLAPKFEQYRIGQSPERLLQKLEALAITFEEEECLTLVEVNRRVKKAFDVEK
                     TTKKFYTEFEKQHKQFLKYIDGINNDFDRSWYASLMLNRLMFVYFIQRKGFLNRDIDY
                     LQNRLKLCQEKFGNDEFYSFYRYFLMQIFHEGLGKSDRNQELDKLLGNIPYLNGGFFD
                     VHQLEIKYENIQIPDDAFEQLFVFFGNWDWHLDNRITKNQNEINPDILGYIFEKYINQ
                     KQMGAYYTKEDITEYISKNTIIPFLFDATKKECEVTFRADGEIWSLLKENPNRYIYDA
                     VLKGVDVDLPLEIAAGINDVSQRQDWNQSASDEFALPTETWREHIVRRQRCLDIREKL
                     KSGEMTSINDLITYNLNIRQFAQDVITGCEGSDFLLAFYRVIASVSVLDPTCGSGAFL
                     FAALEILEPLYSGCLGRMRGFVEEDDRRIRGTDHKPRYAEFREILAEVEKHPNKQYFV
                     LKSIMLNNLYGVDIMDEATEICKLRLFLKLVAQVEPNPKAKNLGLEPLPDIDFNIRAG
                     NTLVGFTSRNEVYQSMTRDATGQTKLLFDDSFLKRIEQGAIAVDQEFKRFKFLQTETE
                     VDGRVLAEAKAHLNRCLEELRTELDRYLAEEYELGLSKKEKAFQEWKESHQPFHWFVE
                     FYGIIHSGGFDVIIGNPPYVEYSKIKKEYTIKGYQTESCGNLYAYSMERASSILKLSG
                     HIGFIIPVASVCTDGYLPLRNILVTNGDLVISNFNDRPSKLFDGIEHIRLSIILWKKQ
                     KLTSHSIFTTRYNKWQAVERSILFNCLTYSNTKQFIKDGSISKVATKIEKSILKKVTS
                     QKKYLDLYIDKTGTYQIFYTRKLSGFVQILDFIPEIYDNNNQKRDPSELKNLSFSTKE
                     IRDAFLVLLNSNLFYWFLTIYSDCRNLNKREIASIALDFENLSKSLHQPLSDLSVALM
                     DDFKSNSKLLEMSYKKLGKMKIQCIYPKFSKPIIDEIDRVLAKHYGFTDEELDFIINY
                     DIKYRMGRDLED"
     gene            51133..51513
                     /locus_tag="SGL_RS01605"
                     /old_locus_tag="slr6051"
     CDS             51133..51513
                     /locus_tag="SGL_RS01605"
                     /old_locus_tag="slr6051"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153870.1"
                     /note="slr6051; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153870.1"
                     /db_xref="GI:499467230"
                     /translation="MKRDMELIKKILLAVEEKNTFYEPFSSSELGIQGYEDAELVYHL
                     KLAHEAGLIEIMGNKPVQTMGETPQYFVKSLTWEGHEFLEASKNPTVWNKVIKTMQDK
                     GVGMGFDILKGLLLQETIHLVGLK"
     gene            complement(51986..53401)
                     /locus_tag="SGL_RS01610"
                     /old_locus_tag="sll6053"
     CDS             complement(51986..53401)
                     /locus_tag="SGL_RS01610"
                     /old_locus_tag="sll6053"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153872.1"
                     /note="sll6053; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153872.1"
                     /db_xref="GI:499467232"
                     /translation="MNNQISLTLRESHLQELRKSLWHSDGKEKAAYLICGEVSIQADP
                     WTSMPRKKYLSVEVIPIPDNEIVSHSPQHITWSTDSFVRVLKLAQQKNLTVAIIHTHG
                     KNGARFSEQDDVNEPDLVQLAQNRNGQDTKLLSLILTADGDLVGRCWFNPKEYQPLDL
                     IMCVGDRLQLHYPERGNGISSPIFQRQALAFGEALTQDLSTLRIGIVGCGGTGSAVAM
                     LLPKLGVRQIALFDQDIVEFTNLNRLHGATFNDAQEGLPKVEVIRRSLTDLGIGVEVR
                     TYRAWINDPMCQDALKTCDIIFGCTDDHAGRLLLNRFAYYYLTPIFDVGLAIEVDRSE
                     TLRMQALDGRVTTLIPPNTCLLCREIINPEQAFGESLKREQPEEYKRRKEEAYVIGEG
                     NPSPAVVLFTTDVANMAIQELVHRLQGFRGKNGAIANRVKKYHLREDRQLGASADVNC
                     PLCSTDKLWGKGDVEPFLGMV"
     gene            complement(53398..53778)
                     /locus_tag="SGL_RS01615"
                     /old_locus_tag="sll6054"
     CDS             complement(53398..53778)
                     /locus_tag="SGL_RS01615"
                     /old_locus_tag="sll6054"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153873.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041428303.1"
                     /db_xref="GI:752788447"
                     /translation="MTFLPESDRQYLANKDYTYEEITEGSRKGLIFSKFPLPNQKYDV
                     SEVDLLILLPNGYPDIVPDMFYLEPAVKLVQGNRPPRATEARQQFNGRSWQRWSRHER
                     EWRRGVDGIWTMLKRVEHALEVAA"
     gene            complement(53782..54240)
                     /locus_tag="SGL_RS01620"
                     /old_locus_tag="sll6055"
     CDS             complement(53782..54240)
                     /locus_tag="SGL_RS01620"
                     /old_locus_tag="sll6055"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153874.1"
                     /note="sll6055; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153874.1"
                     /db_xref="GI:499467234"
                     /translation="MVVNAQQFRIQVDQQQLMIPDPVPTGRQILEIAQKRPADEFLVF
                     YLLPSGQLEEIRLDETVDLRQTGIERFITFRSDRSFRFVIDGRRFEWGIPLISGLKLK
                     QLAQVSPQAYGVWLEVRGGEDRPIADHETVNLEAPGVERFFTGKKTTTEG"
     gene            54343..54702
                     /locus_tag="SGL_RS01625"
                     /old_locus_tag="slr6056"
     CDS             54343..54702
                     /locus_tag="SGL_RS01625"
                     /old_locus_tag="slr6056"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153875.1"
                     /note="slr6056; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="WP_011153875.1"
                     /db_xref="GI:499467235"
                     /translation="MKKVGFDITSFYAALDGQRQSKQLTWKKVAEQSGVSASTLTRMA
                     QGRRPDVDSLAALLNWSGLKAEMFVESNQESQTVSEPLAQITAYLRADPHLTPEGAEA
                     LAAIVKAGYERLRKDSN"
     gene            54708..55295
                     /locus_tag="SGL_RS01630"
                     /old_locus_tag="slr6057"
     CDS             54708..55295
                     /locus_tag="SGL_RS01630"
                     /old_locus_tag="slr6057"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153876.1"
                     /note="slr6057; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153876.1"
                     /db_xref="GI:499467236"
                     /translation="MARRKQPKYRYGFKSEANGYAREFREELGLKPIDPLCPWSLADY
                     LAIPVEPLSAYKDMIPKSVEYYRNGKADGFSAITIIDGYKRLIIHNDAHHPRRQAANI
                     AHELSHGILGHMPQPVLDENGCRHFNQQEEDEAEWLGPALLISEEAALHIVKTGMDIN
                     DAVRHYGVSKNIVQMRINVTGAKNRVARMSDTNPS"
     gene            55646..56236
                     /locus_tag="SGL_RS01635"
                     /old_locus_tag="slr6058"
     CDS             55646..56236
                     /locus_tag="SGL_RS01635"
                     /old_locus_tag="slr6058"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153877.1"
                     /note="slr6058; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153877.1"
                     /db_xref="GI:499467237"
                     /translation="MRRYRYRSPKSKQITTGVFVVVAMILFQGKDSLYYHNGNGGDDW
                     KIGSPQTHVFNAHQTRSLEDLQIQALTLVNRDRQLNNLPLLVADPLITKTAQGHAEDM
                     AKRNFYGHDTPEGKSPTDRYQALGGKGGVGENIVVLPGSPYFSLNYGLVERFQKSWMY
                     SEGHRKNLLTPNYTKFGYGIATNPRTAKVYAVQNFQ"
     gene            complement(56265..56831)
                     /locus_tag="SGL_RS01640"
                     /old_locus_tag="sll6059"
     CDS             complement(56265..56831)
                     /locus_tag="SGL_RS01640"
                     /old_locus_tag="sll6059"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153878.1"
                     /note="sll6059; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153878.1"
                     /db_xref="GI:499467238"
                     /translation="MKINRQGQAKVLTEQELHDLFTIGLLTPRDRLLFGICLYTGCRI
                     GETCSLAWADVTTDAMTFRIEKTKTKSSRTVAISLALQVLFDDYRQAQRSVRFPSSYV
                     FRGKRVGSHLHPSMAHKILKAATDRIGVRGVSTHSFRRTALTMMCRKGINLRVIQKIS
                     GHKNLNVLSHYLEVSEQEKEQALSTISF"
     gene            complement(57133..57666)
                     /locus_tag="SGL_RS01645"
                     /old_locus_tag="sll6060"
     CDS             complement(57133..57666)
                     /locus_tag="SGL_RS01645"
                     /old_locus_tag="sll6060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153879.1"
                     /note="sll6060; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase GCN5"
                     /protein_id="WP_011153879.1"
                     /db_xref="GI:499467239"
                     /translation="MTGQEILIRDERKDDAVLITEVTIAAFAPLEISNHTEQFIIEAL
                     RSAGALTLSLVAEVNSRVVGHIAFSPVAISDGTKNWYGLGPVSVLPLYQRRGIGKALI
                     QEGLSQLKGLGAKGCCLVGHPEYYKKFGFKNVAGLALEGVPDEVFFALSFDSHYPQGD
                     VTFHEGFRANSSSNVKL"
     repeat_region   57957..83028
     gene            58222..58470
                     /locus_tag="SGL_RS01650"
                     /old_locus_tag="ssr6062"
     CDS             58222..58470
                     /locus_tag="SGL_RS01650"
                     /old_locus_tag="ssr6062"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153628.1"
                     /note="ssr6062; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153881.1"
                     /db_xref="GI:499467241"
                     /translation="MDFNPNEWPTHKQGEVVRQLILEALDSPKTKEELSSLCNKSVRQ
                     ITRHLHRLSSENKILSTGKGQFVRRIAAGFLLLYVGQI"
     gene            58570..59124
                     /locus_tag="SGL_RS01655"
                     /old_locus_tag="slr6063"
     CDS             58570..59124
                     /locus_tag="SGL_RS01655"
                     /old_locus_tag="slr6063"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153882.1"
                     /note="slr6063; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153882.1"
                     /db_xref="GI:499467242"
                     /translation="MSIAGKSKGDVVQQLEKSYGVARTTVFNRLKYLGYSLDKVDDLF
                     SLSNEQMAELDKLHRWISDGGKMADYPKPGQLTMITDEGELEQYGEVINFDALEGDEE
                     LGHAELIRAAQNQAAGILIAQNLLTAEILKNPQHLPADLQAQVEQSKVAIAPKPQNPL
                     VIASQWITKAKAYQSNQNHGQLAA"
     gene            59181..59969
                     /locus_tag="SGL_RS01660"
                     /old_locus_tag="slr6064"
     CDS             59181..59969
                     /locus_tag="SGL_RS01660"
                     /old_locus_tag="slr6064"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153824.1"
                     /note="slr6005; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153824.1"
                     /db_xref="GI:499467184"
                     /translation="MDGLLHSLYAARSVLVTSGEGMGKTYLVRQVWERLLADGVTCQY
                     FEPATPKTLLMAIAAMAGVDSKNLEGRSKTVEVLKQELIQWFSVNRAVLIFDDAHYLE
                     VKFRLWLKKLKDVGVPMLLAATNPPRTDLFIYVPRIELKPLAEYQIRDLMEKEAISLG
                     SGLKPNQIAKLQSRAGGNPMLAKRAIEEGFLGIQNEAGDHGRYFDITPLLLLVGIVFI
                     CYRFIGLGTGNQSLYILAGIGGAIFLGVARLSYYLPKESRRITN"
     gene            59969..60997
                     /locus_tag="SGL_RS01665"
                     /old_locus_tag="slr6065"
     CDS             59969..60997
                     /locus_tag="SGL_RS01665"
                     /old_locus_tag="slr6065"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153825.1"
                     /note="slr6006; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153825.1"
                     /db_xref="GI:499467185"
                     /translation="MLTITHLLVGAASVGMAAQTTNPVPILIGAIASLLPDIDISTSP
                     AGRILPFISRPLEQRFSHRSATHSLLASFTLALVSYALWFAMPVIPLVIVHALNIGYF
                     AGWFLDCFTKSGVEMFYPLGVRCVCPGNRNLRISTGSAAEYWLMVFVVAIAVWTFQLN
                     NTGGLVKNFNALIAAPSGVVELYNRKGGNEIIYAEYEGVWAGNRAPIKEEAPVIATNG
                     QGFLVLRDDQVVKVGTEADSTIIVNRIRGREGEPAVIHTETIYLDDEPPDRLEGYINP
                     MTFISGQLTIDDPTMLRLEQSAFAFAPIRNAGGFVTLDHAPIETAIQLLQDQYVRGSV
                     TIKTIEKR"
     gene            61115..62188
                     /locus_tag="SGL_RS01670"
                     /old_locus_tag="slr6066"
     CDS             61115..62188
                     /locus_tag="SGL_RS01670"
                     /old_locus_tag="slr6066"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153826.1"
                     /note="slr6007; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153826.1"
                     /db_xref="GI:499467186"
                     /translation="MFASNPKPRPLVNRLAHTQTPSNFPVVNREGVLIGEQIYWNPAT
                     VANPHGCIIGGSGAGKTQTLKAIAWEVSKLVEVAIIDFHGDQELPGEKVYHINMTSNS
                     GINPLVINLDQEGGGPNLRAIELAMLFAKTLRLGSNQQGKLLDAFKHCYFRRGISQES
                     PQSWLKVPPNFSDLEALLEEMAEEDKEAEKLRLKLSTMFEYGIFNKTQPPYERLTRWN
                     LAKLPPQLQAIAGDALASQLMSHHRLLGESTLRTVLFIDEAKELGHSKALDRIAADGR
                     KYGLGLWVASQSSRHISKDVLTNTFTKLILPVDSSELPLTARTFRFSEEAIANLNPLE
                     SLVRFGKNANKVNIVPFYQRNTP"
     gene            62283..63314
                     /locus_tag="SGL_RS01675"
                     /old_locus_tag="slr6067"
     CDS             62283..63314
                     /locus_tag="SGL_RS01675"
                     /old_locus_tag="slr6067"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153827.1"
                     /note="slr6008; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153827.1"
                     /db_xref="GI:499467187"
                     /translation="MNWRALLLAVILGTVVFGGLHAQTNTTNTPSNNSSLTTPNRLKI
                     NLTLGDPTELKVREGDTVNRGQVLSDKEAERSRLERDQRERLLAIANVEGQLVPTLQP
                     APALRELPPVSYTVEETAIQLAEIKLAQAQRNLATAIEADPFISAKAKVERSLADVEA
                     AHRAFELQQRKLDAVNGLKGLPPEMLTHETEKLRQVRTALEGKEAEYKFFQAEYFQVE
                     ADRRKELTDLQSKVSIARGELEQAQSRLRAAKENRELAEYNHRITISRRAEEENQVAI
                     NVANQKLDREFKLAQLREQLSAVEEKLNGIVQIKSPYSGTIRRIKFDRQTDGKLAVTL
                     YLDTTNPNP"
     gene            63373..64167
                     /locus_tag="SGL_RS01680"
                     /old_locus_tag="slr6068"
     CDS             63373..64167
                     /locus_tag="SGL_RS01680"
                     /old_locus_tag="slr6068"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153828.1"
                     /note="slr6009; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153828.1"
                     /db_xref="GI:499467188"
                     /translation="MEDPQGQSNPFLAPELDELVDNKISEDVWQQMLGELPCSVTTED
                     CINQLQNVAVQNSRLLADLQEKIDEAQNAVDEARRKNLDSIAIGNFSPFIQTFLYSTL
                     GPVSNGVEPPVNNPFRLILGNTLSAFLGQGLGALFNWSDYAANDSQQQRAIAIGDIQI
                     KIAELQRNKAELTQKLREQVVFEALKLEEIARNFQIEQEIAKRDKQRLEIAKVSYRFG
                     EGDSERYLNQISAYDRQKAATFREWSRLRSQVITVKLLVLGGQDAE"
     gene            complement(64238..64903)
                     /locus_tag="SGL_RS01685"
                     /old_locus_tag="sll6069"
     CDS             complement(64238..64903)
                     /locus_tag="SGL_RS01685"
                     /old_locus_tag="sll6069"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153829.1"
                     /note="sll6010; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153829.1"
                     /db_xref="GI:499467189"
                     /translation="MTLIAIMKYKILSSLALVTLGITAIAPMVNAGMAKDNYTGKIYS
                     TGHAPRDDVYVYYLDAPLTKKVSANECGIVQISLGSIPHTGSTEVTLIGVGPATVSSF
                     PLMAKADAPKCSNGVATNIPAEGKARYVPNAETGNQSLVWTGQTPFTQYDITFPIPKE
                     RKLKSNACGVATISSSSSYPSTGTFRMGASPTVHNFATVTGVNAPPGCKNNTLLLPVG
                     FPN"
     gene            65086..65613
                     /locus_tag="SGL_RS01690"
                     /old_locus_tag="slr6070"
     CDS             65086..65613
                     /locus_tag="SGL_RS01690"
                     /old_locus_tag="slr6070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153830.1"
                     /note="slr6011; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153830.1"
                     /db_xref="GI:499467190"
                     /translation="MITACSQEQMQEMASNAMVTQNRTPDKTWRVKPGSVHDGDTFRA
                     VADVTNEEIKVRIACIDAPEIKQAGGIESRDYLRGMLTDNREIILMGAEKDQYGRSVV
                     EVFAMTDTPGLEVGVNGEMVLAGMAHYYEGHKRSCPENAEQYEFLEQEAISNKAGVWA
                     NGDAERPWDWRRRNK"
     gene            66033..68225
                     /locus_tag="SGL_RS01695"
                     /old_locus_tag="slr6071"
     CDS             66033..68225
                     /locus_tag="SGL_RS01695"
                     /old_locus_tag="slr6071"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153831.1"
                     /note="slr6012; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153831.1"
                     /db_xref="GI:499467191"
                     /translation="MDSPRQLSSPTLTNVIPLAAGIIVALVGIAAKIQPLQSGIMGFT
                     AGVSGAATASLATKKEREILLLAEQELSKTKINNTLSELQEQKKIIDKDITRLEERRS
                     QSEKIAGELEIRQAKRDSIEAEIKNLQAVQQNLESRVAEINKANPTLENLEIRQKEIS
                     RLQSIIKQLEGELFAYKSKIAEMEQKKAGLEEKEALYLKREIEIKEISEQIQQGQVKL
                     KDLNRQAVELELLRNTYDALEREKQTYESQKEHLYAEVIRLGAEKDRILAEIKELEGR
                     AQESDRLRAEIADLKAKRRIAEDLLRDIQREIEQHEIIKDNLINDIARKDAEINRKKN
                     NVSELEQRIRELKQEISDLEDSARVALQTLEEPIKDLIPVQRQGINEDDFLNQFSNSL
                     KVKGLDFHERIVKAFHTSLKVQDISALVILAGISGTGKSELPQKYADFIGAPLVMLPV
                     QPRWDSPQDLQGFYNYIEKKYKPTQLMHYLYQYQQDRKMHGRIIMVLLDEMNLARVEY
                     YFSDFLSKLETRRSKPTYLSLDVGSLKLPEKQRDILIPEEFLFIGTMNEDETTQSLSD
                     KVLDRANVLTFGRPNELKLRGRKIKYEKAENYLPWNEFVKWTKEPDPDSPMVIEIKDF
                     VDRANAIMEKLGHPFAHRVYQAIAKYVVNYPGAEQDLQIRRQAIADQFGQKLLPKLRG
                     IRIDEASTELDEMKRLIQELDDPALTEAFDRAKQGRYGQFQWKGMLYS"
     gene            68201..69757
                     /locus_tag="SGL_RS01700"
                     /old_locus_tag="slr6072"
     CDS             68201..69757
                     /locus_tag="SGL_RS01700"
                     /old_locus_tag="slr6072"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153832.1"
                     /note="slr6013; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153832.1"
                     /db_xref="GI:499467192"
                     /translation="MEGDVVQLIMKIYANLGTYLQNEPLQLLDAVLDSADRPILVLDN
                     DEELSQTPGFLIPLEDKNSYEIGFPLVSISDWDSYQILCQKSSLKLQKNNEETSFKIS
                     IKDLILDSTQVNDESTHNRLNNELNNSYDRHTAETIAVFIGLFQGMRSGRRIKQIKFP
                     LLNLPEYFHELSSEDARLPLVVSLDRRYELRHKLESITTKLRSQLNRTVEMIPLARIH
                     EMDAYCLRDYVRRPGRNAIEKAGARQELLGIKRFQNFNTPENRFLKGFCELLHLECQE
                     YSKNREAELLGQSINYFRQNETVQTVKRSVSLLDKPNYVLEQNPIYRSFYQAYLDYVH
                     RLSDKEKLWSYRQRLCSDVIAVLLMTSFLYFQGSYASALSDLSILDNPLFGRYLENDS
                     MPVIQCFLQNYVVSFQLNRSSSIRQGDWLLIIKQQKINSLEVKTLQIPIWIFWYRPSL
                     KLINKNNFKRALYFYLCERPETNNYSQWITKIDHSLMIRLPDLKENNLQTIIIFLNDI
                     FCKYLKEYFS"
     gene            69754..71157
                     /locus_tag="SGL_RS01705"
                     /old_locus_tag="slr6073"
     CDS             69754..71157
                     /locus_tag="SGL_RS01705"
                     /old_locus_tag="slr6073"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153833.1"
                     /note="slr6014; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153833.1"
                     /db_xref="GI:499467193"
                     /translation="MSLPTELIESSCNQSSTYFISRANLNFPCANYTLPLSSAQKEAF
                     DLAISNSPISLISGNPASGKTHVGCFVLEMSVRFQKSILVVARHANTLEAYKNLNVNS
                     LFLEIFNNYSDSIFAWLRHNLAQPKINFMPLHLFPDPLLETLQESKQLNQWIDLAEKG
                     DKKNLQEEMMKVFPQVSKSRLDLLVEKLYKLYPLLKQHQKLKEHYLNLSEEGILQLTE
                     LMSETTKIPILATFQSVLNSDVKFKQFEIVLVEDSHLFSDHDLLLMASMTNKLILLGE
                     NIKSDTFFTRLSECLSPAYRANLSENFRLHPLLSRPIFSTFYYSQPYSSLQNYSYRTF
                     QNRLRWIDIHEDKLITPQLLDFIENSDIDISSIKVGILTFSITAKEMIQSQCPEQWLN
                     QIYVDSCENWYGKECNVLLIVCDGTKPTPDQLRLALTRASDAIVCFGDINQYEMSSFR
                     TLIRDKTLTIEREVSLL"
     gene            71154..72809
                     /locus_tag="SGL_RS01710"
                     /old_locus_tag="slr6074"
     CDS             71154..72809
                     /locus_tag="SGL_RS01710"
                     /old_locus_tag="slr6074"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153834.1"
                     /note="slr6015; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153834.1"
                     /db_xref="GI:499467194"
                     /translation="MKIIVKLQGVFERKNVDNNTVRQSSLSDLLNDLRVLATSHNRHH
                     ISYIHQSFGLNFLSQQTLEHLIQKVGGKSSYLSSTFLTPANQNLIQEEFFYSYCFTCP
                     IISLQLSPHDPQLPLWSGQHCDGTYNLDISNDVDNLRLQSIRQEALSIIKQKTSVEII
                     RAALHSPNNFAIPITLSTGEYITIWQKLEELPSELQIAVMALIKNYFPSFLSAEAKSL
                     IDEYKKKYIVFNYQNLLEFTISENEPKGLDFIVGRGLHRKEIEALISSAQRFLLISSF
                     RLEDESIVQLIVKKAKELPEGVWILTDLNNDVLDRIDTNMEGKIDHEDDYAESDRKKK
                     ECLRLLATSGVSIRSGLFHLKCYITEKSSYMGSCNLTGGSLERNGEAGIIWKNVESHQ
                     RLIDHFSHLWDEQSNAVILPTTQGIRSQGLSNYFAISKREGFLTYHSNDLTRTLTEFA
                     RNPTGKISIYTRTFAPTAQQEELLSRLHCHIFYGHRNYSNLDAKQIYNLHAKIIIIGT
                     TAAYMGSQDFAFGRRSNHDLTYKTTDLNEIQAITQLVDALHRG"
     gene            72816..75218
                     /locus_tag="SGL_RS01715"
                     /old_locus_tag="slr6075"
     CDS             72816..75218
                     /locus_tag="SGL_RS01715"
                     /old_locus_tag="slr6075"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153835.1"
                     /note="slr6016; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153835.1"
                     /db_xref="GI:499467195"
                     /translation="MTRLFNLESYPEICKYTQIFGESLSLNSPNIPFAYRDFLNTYKD
                     RHFISPANLSSYYSNTIVRGEYKPQFLGDQLDDQQEGDLVIVRDIDVLSLQNLDCPYI
                     YASAYRYWNYVTQLQNIAKENKPLVIYDLDSLPCSYYLPISFQSHPNCSYSIPILDIR
                     TPENYESLRLPFDPSNVYDTICEILAQYVIASDPNFVGIESSYLTQYLKKINVFNIIK
                     NCLISNPNQEIVSLLIDFSNVDNTNLYLKAELPLTIVENIVSSVILVPRLKEIVQNNC
                     EYNFVLISQYNCLSNFRLSLESHFSLPDISHSEFSKIWQEKQSQEFPLYGQFLDLITF
                     QLANQISINVPSESERTNICYEGERKFHTFIGQYTIPSGETKSSFRIDKPQVILPIKI
                     NGKLIIKNEIEQVYIINNQFFEQTPSLSVEIHFSLMLGKPLLLEIFEVYSDQKLGHKL
                     NAKLEDRPEIKLGFIPIQNIIEGRKTKENNATTNLCLNLKFISDFSHGLDEIAKALHA
                     YIKQSSKNIKLRTDLKLSKIQSIVRSNYLSFLKNDALQHVSTNSSNEIVSEITNKIIS
                     SEIKLLLQKALFTLGQRHPNTEGKERGQIFNIYNDNLLLIGKQYKIAAIQDFDFLFDY
                     LKNSPCFSEHVKVIARIAYDSNFQQKYFALFETHLPKNNNNNNFYYEYDSYLWGYARI
                     LMWYLDYNLNETNILLFKRHFNLIASHALSDHSRNSYYQDALISLIYLLSFREFDSTF
                     CEIGSLEYNLGIKLCEKLSFHPVLSKQVDINKSLNQIFYEFLNGTATGDDMDNLIKAE
                     FK"
     gene            complement(75277..76047)
                     /locus_tag="SGL_RS01720"
                     /old_locus_tag="sll6076"
     CDS             complement(75277..76047)
                     /locus_tag="SGL_RS01720"
                     /old_locus_tag="sll6076"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153836.1"
                     /note="sll6017; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153836.1"
                     /db_xref="GI:499467196"
                     /translation="MFDNLCKFLAESFSEDYAAWLLGRPIKLTKLSPTELSLEPIRAD
                     SLILEQSEDLVLHLEFQTEPDPTMGFRMLDYRVRVYRRFPQKTMHQFVIYLKHSNNDL
                     VYQDSFQVGETVHRYQAIRLWEQSSDAFLQSPGLLPLAVLTQTSDPTLKLREVATVLE
                     QIEDNRVKANLMAATSVFGGILLSPDIIKTILRSEIMKESAVYQEILEEGKIAGKLEG
                     KLETIPLLKKLGLTIAEIAKELDIDVELVNRFVANQNN"
     gene            complement(76272..76487)
                     /locus_tag="SGL_RS01725"
                     /old_locus_tag="ssl6077"
     CDS             complement(76272..76487)
                     /locus_tag="SGL_RS01725"
                     /old_locus_tag="ssl6077"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153837.1"
                     /note="ssl6018; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153837.1"
                     /db_xref="GI:499467197"
                     /translation="MLKFIGIALLAALVGYAFGVMAGIFIVNNFSTNVQDKPLELAMT
                     SIFFFGPLGALIGFTIAVVYQLLHQYL"
     gene            76910..77128
                     /locus_tag="SGL_RS01730"
                     /old_locus_tag="ssr6079"
     CDS             76910..77128
                     /locus_tag="SGL_RS01730"
                     /old_locus_tag="ssr6079"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153839.1"
                     /note="ssr6020; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153839.1"
                     /db_xref="GI:499467199"
                     /translation="MFLFLILRNRRSGNTVFFCNEEFYHIRQNFLVLSHLRKKFYLEY
                     DFYFSWAKKNLVGNGREKREERKGILVY"
     gene            77205..77669
                     /locus_tag="SGL_RS01735"
                     /old_locus_tag="slr6080"
     CDS             77205..77669
                     /locus_tag="SGL_RS01735"
                     /old_locus_tag="slr6080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153840.1"
                     /note="slr6021; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153840.1"
                     /db_xref="GI:499467200"
                     /translation="MFKKLGEVEKIKFKNWCVDKNNLMVKEKWFGKEVKEDRRMVWFG
                     VGIELGKNEKFKGLEIDNSLKKRCLEFYGENFNSLLLIKYGDGSKLNLHKDRDCFDKK
                     VVIVNSGICVFEYDGERKILEDGKIYEIDGKKSHGVVKVVGERYSLSIRKVL"
     gene            77766..78551
                     /locus_tag="SGL_RS01740"
                     /old_locus_tag="slr6081"
     CDS             77766..78551
                     /locus_tag="SGL_RS01740"
                     /old_locus_tag="slr6081"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153841.1"
                     /note="slr6022; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153841.1"
                     /db_xref="GI:499467201"
                     /translation="MVAPAGHFLLVGSALALTQALSMGWKGVEFQWTGGGVPCFGGWS
                     VGGSAALPWVAFCVLSCYNGLIGCSPGGCTVLSVSALSPCVVCLLSACPAVGFSGSRS
                     LSPLSVAALRSLSAAVPASASVFVGCAAGADAVGRSLFPSASVFSVSSGQWGAGRSAF
                     ARRSVAVVSAVLSAGGPAGLWCFFPSAGCPVGLLPSARSSRCFCGLGSGSWASAAFAL
                     GSGLPLLAFLPPGVSPPPGWGFSSLGGGWWVAHPAAVQLSLFA"
     gene            complement(78616..78828)
                     /locus_tag="SGL_RS01745"
                     /old_locus_tag="ssl6082"
     CDS             complement(78616..78828)
                     /locus_tag="SGL_RS01745"
                     /old_locus_tag="ssl6082"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153842.1"
                     /note="ssl6023; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153842.1"
                     /db_xref="GI:499467202"
                     /translation="MSGRGRPGGNPDLEKYQFKSPVSESRTAGIYLRITPTDKERLKN
                     VKDWQEKLRQKVKEIIDDSFSKEDKV"
     gene            78981..79160
                     /locus_tag="SGL_RS01750"
                     /old_locus_tag="ssr6083"
     CDS             78981..79160
                     /locus_tag="SGL_RS01750"
                     /old_locus_tag="ssr6083"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153843.1"
                     /note="ssr6024; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153843.1"
                     /db_xref="GI:499467203"
                     /translation="MTIQEAKEIAAVCSMMRNKLPDGMWEEVRETILDYREGKDGEAF
                     AEELSEICKDWGFSI"
     gene            79356..79865
                     /locus_tag="SGL_RS01755"
                     /old_locus_tag="slr6084"
     CDS             79356..79865
                     /locus_tag="SGL_RS01755"
                     /old_locus_tag="slr6084"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153844.1"
                     /note="slr6025; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153844.1"
                     /db_xref="GI:499467204"
                     /translation="MLSPEIYVACLASYNNGLLHGEWISANQDEDEIMAEIEAMLKAS
                     PMRDAEEWAIHDYQNFGGIELKEYEDIETIAKLGQALAEHGEAMAAYYKCYDNLENFE
                     DYYLGEYESEQDFVYDYFEQTGQLEAIEKAGLDSFYIDFEKLAHDWFINDFYSAEISY
                     NKVYVFSRH"
     gene            79934..80191
                     /locus_tag="SGL_RS01760"
                     /old_locus_tag="ssr6085"
     CDS             79934..80191
                     /locus_tag="SGL_RS01760"
                     /old_locus_tag="ssr6085"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153845.1"
                     /note="ssr6026; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153845.1"
                     /db_xref="GI:499467205"
                     /translation="MHHDTKEAISRCLYFIDRENKTQENPIIAVIEKALEFAKNEVSF
                     SDPYDLLAQIESVLTEEELANDDRYYSRQETEDYHRNWLHF"
     gene            80256..80447
                     /locus_tag="SGL_RS01765"
                     /old_locus_tag="ssr6086"
     CDS             80256..80447
                     /locus_tag="SGL_RS01765"
                     /old_locus_tag="ssr6086"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153846.1"
                     /note="ssr6027; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153846.1"
                     /db_xref="GI:499467206"
                     /translation="MYFDRFDIAEAWFIYLSENHSGQNCPLYLRLCQLQKWFKPSPLL
                     NRSRLNENAQAILENLEEN"
     gene            80814..81371
                     /locus_tag="SGL_RS01770"
                     /old_locus_tag="slr6087"
     CDS             80814..81371
                     /locus_tag="SGL_RS01770"
                     /old_locus_tag="slr6087"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153847.1"
                     /note="slr6028; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153847.1"
                     /db_xref="GI:499467207"
                     /translation="MTTTTKTTGKTPKLWELSDEITNLEDQIADIQDREDLSESEKDQ
                     LMGEILETWLSTGKEFDAKACNVAAYIKHLEAITEARKNEYRRLRDLAEQSENQSQRL
                     RNYLVSNMQKLGKKKVNGVSVNLSLRKKPAKVVLNCPLEDLPAAFMKVEITPRLSELK
                     KHLQSNADCSFAQLADVEEYSVMIK"
     gene            81463..81960
                     /locus_tag="SGL_RS01775"
                     /old_locus_tag="slr6088"
     CDS             81463..81960
                     /locus_tag="SGL_RS01775"
                     /old_locus_tag="slr6088"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153848.1"
                     /note="slr6029; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153848.1"
                     /db_xref="GI:499467208"
                     /translation="MLLAEILENLRQPIAPQFISQKKTFKNKKPTGSVDFVAWYDLAD
                     LLDDLCGLGGWEWLIIDTQQIGDRLTLTGSLTIHGDDRSLTRQATGTEDIDCNSYGDP
                     SSNAEAMALRRCCAKFGLGRDLWRKNKPQPLKMGQRQEPEKQTVLAPGTISREEWLKR
                     KQAKS"
     gene            82296..82514
                     /locus_tag="SGL_RS01780"
                     /old_locus_tag="ssr6089"
     CDS             82296..82514
                     /locus_tag="SGL_RS01780"
                     /old_locus_tag="ssr6089"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153883.1"
                     /note="ssr6089; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153883.1"
                     /db_xref="GI:499467243"
                     /translation="MGLLSYGLELLAFTPGVLLPPYPTKKGNGQKRPIANNKKIVQNP
                     VNLLGGSTVPHSVFRGLKCFSGKVSRIL"
     gene            82675..86385
                     /locus_tag="SGL_RS01785"
                     /old_locus_tag="slr6090"
     CDS             82675..86385
                     /locus_tag="SGL_RS01785"
                     /old_locus_tag="slr6090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153884.1"
                     /note="slr6090; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153884.1"
                     /db_xref="GI:499467244"
                     /translation="MKHYKTSHGSYSSAFSPLLVNNPNHSSFGENKLQPTSRHNPCPV
                     CAKTNGNCRTIADGGVLCMTFPDGDGHPDHRYVKPSENGLWGVHYPRKDGDFDRQAWE
                     KRKEERETRNQEIERQSREKCLSPEQRDRGYKAILDQLTLTDEDRSYLEGRGILPEVI
                     ARCRSVKKWQKLSHTAHVNLPGVNRYGSGLNNPADGILIAIPGIGGYLTNLRLNVPLD
                     LNRKYSAISSANRGLKPNLEDGGTPFGIFFPENWTDFTHIGICEGPEYKAPSAAQRLN
                     FPVVGFEGAAGMTTIKRYPARLKQIEDYVKEQLCKLTKNEYLKLSSVWQSTMMSFATF
                     LTGQTTKDTQTEYSFPVQISAQFAFKILGVCLFPTMNGQKIGTIFTESKKLLKEWSTP
                     SSFGTKEPTPTELSDTLPPSHSRKFSSPFRFCLIPDAGMEKNSSVMGFYTKTLKAIES
                     QGYLVDVADWGQGHDKSVGDIDEISPEQIAAIQLVSPEEAFADVPGLQSTVAEFKDWV
                     SKQVKRIKPQGFGAPVIAGELFTGDRVDALIKQLEKNRYVLDASWTGDGKSHAIVPLA
                     KVLAHRLETLHPEQEIKIYLISHSYRQPTVEALTAIQAMPTRHGDRYFPHGELEEAAN
                     CIRSKQFNQVAEKGYNPHQGGKHNPICHSCPAFNYCGTDPGMFRQQRRLALQHQIIRC
                     HPSQIPAKGENQLTVVIWDEPAEEQPTKTINTNIGELDQEIAYHRRHSQLSDAQKDIL
                     DEMASLLERLMAGAPKLGLDTAEVLNQVKDLNQDLLGELITLLEQKERDLFDIFPAPT
                     LATFKDNQDAFAGLTAKETAKLKGQFRRSNQYAVGEATKMTEEKLQELPSNGLIHLLR
                     CLQGQASVQIQLFPQNLLLTIDRRQELAPIRNADYVVALDATNNGADFACLLNVEKDK
                     VKVIKRKTEKPFQNLKVVQIVLPGWGSSRPSDRAMEKAIAVKDALFQAYGPMPVLTYK
                     AQLETLLAAGQWYRDSRGSNQFEGQPQMLSCGLPLPNLGAIKAQFLATGGQPADFEEH
                     YHRRSQREVLQNFGRQRANRYPRQQFTHFIITGDPQHNTIHDLGWVKEFGADYVCLHG
                     FEITPHAGDRSQIARWHIVEAIRSGFTTGSAIAEKLGCSRRNVTDVLTNGGATLTKVT
                     KALLDTTELGSSSYKSPIRLGSHLEDLPSEILALLGINLPEAIAEVVEIIQAVGWRSF
                     AEDYLPTLPQRLRSTILATFWSFLDLVAPAPV"
     gene            86436..86870
                     /locus_tag="SGL_RS01790"
                     /old_locus_tag="slr6091"
     CDS             86436..86870
                     /locus_tag="SGL_RS01790"
                     /old_locus_tag="slr6091"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153885.1"
                     /note="slr6091; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153885.1"
                     /db_xref="GI:499467245"
                     /translation="MENFDTSTYLPDVRDSRWQGNDWGKSKQLSLLKSIPTVTPSSST
                     TGPRVKIKLRWPLPEVRPRRSRGQGSGYIRLHYCEKQTRSGKKSYEQYYYHYELWENG
                     IRQHKGSKYIPKDKLDVVQEWDRKKVDVVLILQYLGKDCTNL"
     gene            complement(87011..87274)
                     /locus_tag="SGL_RS01795"
                     /old_locus_tag="ssl6092"
     CDS             complement(87011..87274)
                     /locus_tag="SGL_RS01795"
                     /old_locus_tag="ssl6092"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153886.1"
                     /note="ssl6092; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153886.1"
                     /db_xref="GI:499467246"
                     /translation="MKFMAKEKNRFAGFENFVQAESTSSESVKTKSEAAIAKSKDPNF
                     KKTTLYISKATHLKLRTHTLSTEQDMSELVEELLVAYFKRLDS"
     gene            complement(87258..87854)
                     /locus_tag="SGL_RS01800"
                     /old_locus_tag="sll6093"
     CDS             complement(87258..87854)
                     /locus_tag="SGL_RS01800"
                     /old_locus_tag="sll6093"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153887.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning protein ParA"
                     /protein_id="WP_011153887.1"
                     /db_xref="GI:499467247"
                     /translation="MIITVTAFKGGVGKTTSSIHLAAYLNNKAPTILIDGDLNRSALL
                     WASHEKLDFPVVDEREGLKAARNYEHIVVDTPARPEIEEIRSLARGCDLMILPTSPDA
                     LSMGALQANIQTFKQLNIPNFRILMTIVPPKPSTAGTEAKEYLQSLGLPVFKRMITRY
                     AAFPKAALEGCVVRDVKGDRYAGAGWNDYKTVGGEIYG"
     gene            88430..89968
                     /locus_tag="SGL_RS01805"
                     /old_locus_tag="slr6095"
     CDS             88430..89968
                     /locus_tag="SGL_RS01805"
                     /old_locus_tag="slr6095"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153889.1"
                     /note="slr6095; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153889.1"
                     /db_xref="GI:499467249"
                     /translation="MPKLTLPQLERHLFKAADILRGKMDASEFKEYIFGMLFLKRASD
                     VFEQQYQQIIRDNLAKGRSEEEAKQRAERASSYQDFFVPERARWATIRDELHDNVGNG
                     LNKALAALEESNVALSGVLGHIDFNRKVGKTTLSDTKLRELIFHFNKYRLLNEDFVFP
                     DLLGAAYEYLIAEFADSAGKKGGEFYTPRDVVQLMVRLVKPAAGMSIYDPCVGSGGML
                     IQAKQYIEECGGDSRNLSLCGQDNNGGVWAICKINMLLHGIKDARIENEDTLQNPRHI
                     VDGELERFDRVLSNPPFSQNYEKTNLEFKNRFNHGWCPESGKKADLMFAQHMLSVLKV
                     GGIVATVMPHGVLFRGGDEQKIRKSLIEKDQIEAIIGLPPNLFYGTGIPACILVMRRA
                     GEKLPERRGKVLFINADAEFYAGRAQNYLKPEHIEKIVNAFEAFVDIPGYAAVVSREI
                     LAAEENDFNCNIRRYADNAPPPEPQDVTAHLLGGIPFDEIEAQRNLMGSHGFDPLRIL
                     VEKA"
     gene            89982..91103
                     /locus_tag="SGL_RS01810"
                     /old_locus_tag="slr6096"
     CDS             89982..91103
                     /locus_tag="SGL_RS01810"
                     /old_locus_tag="slr6096"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153890.1"
                     /note="slr6096; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153890.1"
                     /db_xref="GI:499467250"
                     /translation="MQYFDFLPEITEKSQIKDFVANDAGVKTQEARLYGAFDEWWWLH
                     SPMLNQLPESKGLMELRTAFFESFIASLEPVGLLDRFKVTGVIATWWDEVRYELRTLA
                     ESGFSGLVDSWIDTIRDALEDDDDDQPKGKEQFDPLSHKLVVQLLADYLEEIEAAEGL
                     VADLEQQKVAFEQGDDDAEESDDDEEETVKNVAKALDDRRKDLKNDIKDALKRIKVLK
                     SGATVKGQNSIAAQRKLGNDTTALERELVELEGFVAPVLAEIGEIEARLEPYNEIKAS
                     LAEARKALRGLKDQLIGRLVAARAELGEEGCEKLVLAAFYEGLKSHLDRYGAAHFQQV
                     VAAVENWWDKYRVTLRDIVSERDTAAAKLDQFLEGLGYV"
     gene            91096..92280
                     /locus_tag="SGL_RS01815"
                     /old_locus_tag="slr6097"
     CDS             91096..92280
                     /locus_tag="SGL_RS01815"
                     /old_locus_tag="slr6097"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153891.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type I site-specific deoxyribonuclease"
                     /protein_id="WP_011153891.1"
                     /db_xref="GI:499467251"
                     /translation="MSNNWNILNFGNLIILEYGNTLTEENRSGGDYPVYGSNGIIGFH
                     KAYLLDSPNIIVGRKGSVGEVVWANKNCWAIDTTYYVTLKQDNSLRFIYWLLKSFDLR
                     KLDSSTGVPGLNRNDVYRIKCNLPSLPEQEKIAEILDTMDEAIAKTEECIAKLKKIKA
                     GLVHDLLTRGIDENGELRDPVRHPEQFKQSAIGLIPKEWDIKELSQLATVDRGKFTHR
                     PRNDPNFYGGQYPFIQTGDIAQNLGQVIRSYTQTLNENGAKVSREFPVGTIAVTIAAN
                     IADTAILGIPMFFPDSIVGVTVFPQFNHRLVELCIRFAKHKLDAKATQSAQKNINLED
                     LRPLLIPFPRNPKEQDRMSSVYEKFDERLKKEEAYLEKLKLHKKGLMHDLLTGKVRVN
                     HL"
     gene            complement(92267..93343)
                     /locus_tag="SGL_RS01820"
                     /old_locus_tag="sll6098"
     CDS             complement(92267..93343)
                     /locus_tag="SGL_RS01820"
                     /old_locus_tag="sll6098"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153892.1"
                     /note="sll6098; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein Fic"
                     /protein_id="WP_011153892.1"
                     /db_xref="GI:499467252"
                     /translation="MAIASRAGQYVQQVEGYRAFIPKPLPPNPAVEMDQEMWNLLSKA
                     DRALGRLDGSTDALPNPNLFVFMYVRKEAVLSSQIEGTQASLIDVLEFESQTLDPDNP
                     QDVAEVVNYIAAVNYGLKRLQSLPISLRLIREIHEKLMQGVRGAERSPGEFRRTQNWI
                     GASGCGLQDASYVPPLIKIGLAHAQFETIHPFLDGNGRVGRLLITFLLCEQQILQRPL
                     LYISYYFKKYRTRYYDLLQGVRDAGDWESWLKFFLRGIAETANEAARTARQIVQLKEE
                     HRILLLDQMGRKSGNAIALLETLYFKPIFTVEHAMEVTGLSYPNANKLVKDLCDVGLL
                     EEITGQKRNRAFCYAPYLAVFKDG"
     gene            93820..94140
                     /locus_tag="SGL_RS01825"
                     /old_locus_tag="slr6100"
     CDS             93820..94140
                     /locus_tag="SGL_RS01825"
                     /old_locus_tag="slr6100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153894.1"
                     /note="slr6100; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153894.1"
                     /db_xref="GI:499467254"
                     /translation="MHIISKTALKQFWEKHPNAKASLTAWYKIASHSQWKHLDDVRQT
                     FPHADPVGQLTVFNIGGNNYRLITKIVFPTNESNIGRVYIRDVLTHADYSKGNWKKDS
                     WFKS"
     gene            94281..94700
                     /locus_tag="SGL_RS01830"
                     /old_locus_tag="slr6101"
     CDS             94281..94700
                     /locus_tag="SGL_RS01830"
                     /old_locus_tag="slr6101"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153895.1"
                     /note="slr6101; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_011153895.1"
                     /db_xref="GI:499467255"
                     /translation="MSCTYLELIKSFPPRPIRSPEDFGATQAVVNNLLDKEVLTADEE
                     DYLEVLGTLIYEYEQQQGDIIPDIHGTELLQILIEEYELKQKDLVPIFKTESIVSEVL
                     KGKRQLTTRHIQELATFFHVSPAVFFPANSSGDLLAA"
     gene            94710..97901
                     /locus_tag="SGL_RS01835"
                     /old_locus_tag="slr6102"
     CDS             94710..97901
                     /locus_tag="SGL_RS01835"
                     /old_locus_tag="slr6102"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153896.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type I restriction-modification system R
                     subunit"
                     /protein_id="WP_011153896.1"
                     /db_xref="GI:499467256"
                     /translation="MSRIMKSSPEYLYSEKPTLDELKKLGWQYVPGCLEDQPVPTDPL
                     ITERESFKQILIKPRLQQALKRINLTDDGEPWLDDYQIESAISQLERAVTTEKLIEAN
                     QLITELLWNGVTVFVPNGKDEIVQFIDFENIEQNDFLAINQYRVDPPSSNGKHFSIPD
                     IVLFVNGIPLVVMECKSPTLQNPLTDAIEDLLKYSNQRNSEQPEGIEKLFHYNLMMVA
                     MSQNRAVVGAVCAKHDEYLAWKDVYPATPESIAQIFAVEKLIGDRQTLVAGLLKPDIV
                     LDVLRNFTMFSTHTGKLEKVLPRYLQYRAILKAIDRLQNNSTRQDHSDDRRGGIVWHT
                     QGSGKSLSMVYLIRKIRRTPNLKRFKIVIVTDRTDLEKQLSATVKLTKEPLQIAKNVK
                     QLEHYLAQPGAGLVFGMVQKFRGEDEEPQDIEEYIPEHLNDSPEILVMIDEAHRSHAS
                     ALHMNLMKALPNCAKIGFTGTPIVAAKKKKTAEIFGGWIDKYTIKESQEDGVTLRIMY
                     EGLEARATVANGETLDQLFEVIFRDKSEEERGKIKQKYATRGEVGEAKELIVAKAKDM
                     LQHYIRHILPNGFKAQVVASSRRAAIRYHEAFSLALQEVIQKVENQRAILQSLDDEAI
                     ASLDQETQYLAYCSRHLEILRTLETAVVISGDKEDPQDWQCWTSQSNQDQFIERFKKP
                     LAEDGLAFLIVKSMLLTGFNAPIEQAMYIDRNMVEHELLQAIARVNRTYDGKDYGLIV
                     DYHGIRIDEALAMYDVEDLIDSHFDISTELPKLEDQCRRVLSIFEESQTDISDVEACL
                     QLLDDERLRVQFIESLKVFLETLDLILPRPAAAPYIPIAKKLGLIRKSLADLYRDEHL
                     DLVGARAKVRELIDSYIQTQGIDPKTPPVDILSLEFQQQVNQRQSTRTQAAEMEHAAR
                     HHISVHFDEDPVYYKNLSEHLEEILQKYSDNWDERAAALEKYTQNIQNGRQENGTGLD
                     PQREQPFFDLLQQQTNIDQAPLIEVTREILTHIIATISRINFWNNPVAQNNLKTWIVN
                     YLDDQDIVSFEQQEAIADQLVQLAKKRHQWLVR"
     gene            97886..98596
                     /locus_tag="SGL_RS01840"
                     /old_locus_tag="slr6103"
     CDS             97886..98596
                     /locus_tag="SGL_RS01840"
                     /old_locus_tag="slr6103"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153897.1"
                     /note="slr6103; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153897.1"
                     /db_xref="GI:499467257"
                     /translation="MVSTMNIIAYKDLTLEVRRSSRRRTVGITVERDGSLILSAPEQT
                     PESKLQEIVHQRSQWIYKHLIRKEILNPSVPEKEYVSGEGFPYLGRNYRLQVIADDAS
                     QEKLKYYRGRFQLQQSSQHQGRELFIEWYKSHLKAHLQSKVEQFKHRVEVNPNSIQIR
                     ELGNRWGSCSTKGDLYFHWRVAMLPSNIVNYVVVHEMAHLKERRHNQTFWETIECILP
                     DYQDSKQWLATQGIYYDL"
     gene            98943..99497
                     /locus_tag="SGL_RS01845"
                     /old_locus_tag="slr6104"
     CDS             98943..99497
                     /locus_tag="SGL_RS01845"
                     /old_locus_tag="slr6104"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153898.1"
                     /note="slr6104; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153898.1"
                     /db_xref="GI:499467258"
                     /translation="MKNIIISNLVDKFKQVESLSQDLQESEIFEHFSNYCIVSNEYQE
                     EFNILNIRVAGGNDLGIDGIAIIVNGSLINDVEELEDLITRNKLIEATLIFIQAKSGE
                     NFEGSEFSNFVFGIKNFFDFQSKLNINDELKHKQSLIKKIYDDPLLFKRGSPQLKYYY
                     VYTGIWSDAEVLNDSYKEKKSPLK"
     gene            99535..100551
                     /locus_tag="SGL_RS01850"
                     /old_locus_tag="slr6105"
     CDS             99535..100551
                     /locus_tag="SGL_RS01850"
                     /old_locus_tag="slr6105"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010872778.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_010872287.1"
                     /db_xref="GI:499174700"
                     /translation="MISNFGHIVKTYLSNFPKDDYPVLDTFKFVSIWLGLVLDQSQTS
                     MRSMFKRLNLRGETVDISTFSKASKKRDVGVFREIIFSLKKELSKRKEIKQGELEIFP
                     LDSTIVSITSKLMWNLGFHQVKVFSGINLSTGIPGGIVIHFGQGHDNKYGNETIEETP
                     ENGVAVMDRGFCDLQRIKRLQKENNKYHVLRIKNNIKLEKLANDNYMVGTGKNKIESR
                     VVIFTHDNSEFRLVTNLPIESKEIEGVSDEKIAEIYKKRWQIELLWKFLKMHLKLNRL
                     IAKNENAIGIQIYTCIIAYLILKLLVIPKEAGTTMLDKLRYLQAFMCEKISYVHWLRE
                     LALR"
     gene            100603..101829
                     /locus_tag="SGL_RS01855"
                     /old_locus_tag="slr6106"
     CDS             100603..101829
                     /locus_tag="SGL_RS01855"
                     /old_locus_tag="slr6106"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153899.1"
                     /note="slr6106; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153899.1"
                     /db_xref="GI:499467259"
                     /translation="MRFNDSGSDDDNSLERIKIEDKNISDLNLFNSVSSFVVDNKEIQ
                     EKIRYATNSISKTIEFEKRISLPTIENIQQSFLGIISAEELIKLITDSSNNILRGIFY
                     DNVRDFQGDNEVNTEISNTIQSSFQDLFVLLNNGITIVAEHASQISSKLTIEGFQVVN
                     GCQTCHVLYNNKNLINDKIYISLKIIVSDDNDVKTRIIKATNQQTVVKKEELIAITDF
                     QKELESYYEAQPEEYRLYYERRSKQYASLTNIEKVRIITIPLQIKAFSSMFLDYAHLA
                     GRYHANLLTSVNDNIFINTHQKIAYYVSAYASYKIDYLLRNKQIDKKYNPFKYIILMG
                     INLYLSEHKKTNNISSKKFASYCEIIKENLWDDDKLTTMISQIINNINHITQTDLDRS
                     YAKTRSFIDTFKDKFK"
     gene            102151..102672
                     /locus_tag="SGL_RS01860"
                     /old_locus_tag="slr6107"
     CDS             102151..102672
                     /locus_tag="SGL_RS01860"
                     /old_locus_tag="slr6107"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153900.1"
                     /note="slr6107; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153900.1"
                     /db_xref="GI:499467260"
                     /translation="MILFQGKDSLYYHNGNGGDNWKIGSPQTHIFNAHQTRSLEDLQI
                     QALTLVNRDRQLNNLAPLVADPLITKTAQGHAEDMAKRNFYGHDTPEGKSPTDRYQAL
                     GGKGGVGENIVVLPGSPHFSLNYGLVERFQKSWMYSEGHRKNLLTPNYTKFGYGIATN
                     PNTAKVYAVQNFQ"
     gene            102911..103720
                     /locus_tag="SGL_RS01865"
                     /old_locus_tag="slr6108"
     CDS             102911..103720
                     /locus_tag="SGL_RS01865"
                     /old_locus_tag="slr6108"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153901.1"
                     /note="slr6108; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153901.1"
                     /db_xref="GI:499467261"
                     /translation="MLDFSAISEALDIFDGVRNEIVGAVGESIFNQAAKKYLSDDYIL
                     INDIVLKSSSGTTQIDQVIVSKFGLFVIEIKNYKGWIWGDVNSQYWAQTLSKGSKNKF
                     QNPIRQNYKHIKALECLLKCQPNYLKSLVVFSSFCQFKTSLPSNVVQGEAAYINYIKE
                     HKESLISDDEVKEITQKVLGARLDASEHRKHIQKVKNQYQNADENTAPECPKCGKNMV
                     LRKSKSGPNVGRSFWGCSSYPQCRGIVNIKTAEEKAADDINKMHKLFKRLF"
     gene            complement(103764..104327)
                     /locus_tag="SGL_RS01870"
                     /old_locus_tag="sll6109"
     CDS             complement(103764..104327)
                     /locus_tag="SGL_RS01870"
                     /old_locus_tag="sll6109"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011153902.1"
                     /note="sll6109; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011153902.1"
                     /db_xref="GI:499467262"
                     /translation="MKINRQGQAKVLTEQELHDLFTIGLLTPRDRLLFGICLYTGCRI
                     GEACSLAWADVTTDAMTFRIEKTKTKSSRTVAISPALQVLFDEYRQQQCFRFSSSYVF
                     RGKRVGSHFHPSMAHKILKAATDRIEVRGVSTHSFRRTALTMMCRKGINLRVIQKISG
                     HKNLNVLSHYLEVSEQEKEQALSTISF"
CONTIG      join(AP006585.1:1..106004)
//
DBGET integrated database retrieval system