GenomeNet

Database: RefSeq
Entry: NC_005876
LinkDB: NC_005876
Original site: NC_005876 
LOCUS       NC_005876              10152 bp    RNA     linear   VRL 03-DEC-2008
DEFINITION  Kakugo virus, complete genome.
ACCESSION   NC_005876
VERSION     NC_005876.1  GI:47177088
DBLINK      BioProject: PRJNA14957
KEYWORDS    RefSeq.
SOURCE      Kakugo virus
  ORGANISM  Kakugo virus
            Viruses; ssRNA positive-strand viruses, no DNA stage;
            Picornavirales; Iflaviridae; Iflavirus.
REFERENCE   1
  AUTHORS   Fujiyuki,T., Takeuchi,H., Ono,M., Ohka,S., Sasaki,T., Nomoto,A. and
            Kubo,T.
  TITLE     Novel insect picorna-like virus identified in the brains of
            aggressive worker honeybees
  JOURNAL   J. Virol. 78 (3), 1093-1100 (2004)
   PUBMED   14722264
REFERENCE   2  (bases 1 to 10152)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (14-MAY-2004) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 10152)
  AUTHORS   Fujiyuki,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-SEP-2001) Contact:Tomoko Fujiyuki The University of
            Tokyo, Graduate School of Science, Department of Biological
            Sciences; 7-3-1 Hongo, Bunkyo, Tokyo 113-0033, Japan
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AB070959.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..10152
                     /organism="Kakugo virus"
                     /mol_type="genomic RNA"
                     /host="Apis mellifera"
                     /db_xref="taxon:260684"
     gene            1157..9838
                     /locus_tag="KVgp1"
                     /db_xref="GeneID:2943458"
     CDS             1157..9838
                     /locus_tag="KVgp1"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="YP_015696.1"
                     /db_xref="GI:47177089"
                     /db_xref="GeneID:2943458"
                     /translation="MAFSCGTLSYSAVTQAPSVAYAPRTWEVDEARRRRVIKRLALEQ
                     ERIRNVLDVDVYNQATWEQEDVRDNEFLTEQLNNLYTIYSIAERCTRRPIKECSPISV
                     SNRFAPLESLKVEIGQEASECIFKKPKYTRVCKKVKRVATRFVREKVVRPMCPRSPML
                     LFKLKKIIYDLHLYRLRKQIRMLRRQKQRDYELECVTNLLQLSNPVQAKPEMDNPNPG
                     PDGEGEVELEKDSNVVLTTQRDPSTSIPAPVSVKWSRWTSNDVVDDYATITSRWYQIA
                     EFVWSKDDPFDKELARLILPRALLSSIEANSDAICDVPNTIPFKVPAYWRGDMEVRVQ
                     ISSNKFQVGQLQATWYYSDHENLNISSKRSVYGFSQMDHALISASASNEAKLVIPFKH
                     VYPFLPTRIVPDWTTGILDMGALNIRVIAPLRMSATGPTTCNVVVFIKLNNSEFTGTS
                     SGKLYASQIRAKPEXDRILNLAEGLLNNTIGGNNMDNPSYQQSPRHFVPTGMHSLALG
                     TNLVEPLHALRLDAAGTTQHPVGCAPDEDMTVSSIASRYGLIRQIQWKKDHAKGSLLL
                     QLDADPFVEQRIEGTNPISLYWFAPVGVVSSMFMQWRGSLEYRFDIIASQFHTGRLIV
                     GYVPGLTASLQQQMDYMKLKSSSYVVFDLQESNSFTFEVPYVSYRPWWVRKYGGNYLP
                     SSTDAPSTLFMYVQVPLIPMEAVSDTIDINVYVRGGSSFEVCVPVQPSLGLNWNTDFI
                     LRNDEEYRAKTGYAPYYAGVWHSFNNSNSLVFRWGSASDQIAQWPTISVPRGELAFLR
                     IXDGKXAAVGTQPWRTMVVWPSGHGYNIGIPTYNAERARQLAQHLYGGGSLTDEKAKQ
                     LFVPANQQGPGTVSNGNPVWEVMRAPLATQRAHVQDFEFIEAIPEGEESRNTTVLDTT
                     TTLQSSGFGRAFFGEAFNDLKTLMRRYQLYGQLLLSVTTDKDIDHCMFTFPCLPQGLA
                     LDIGSAGSPHEIFNRCRDGIIPLIASGYRFYRGDLRYKIVFPSNVNSNIWVQHRPDRR
                     LEGWSAAKIVNCDAVSTGQGVYNHGYASHIQITRVNNVIELEVPFYNATCYNYLQAFN
                     ASSAASSYAVSLGEISVGFQATSDDIASIVNKPVTIYYSIGDGMQFSQWVGYQPMMIL
                     DQLPAPVVRAVPEGPIAKIKNFFHQTADEVREAQAAKMREDMGMVVQDVIGELSQAIP
                     DLQQPEVQANVFSLVSQLVHAIIGTSLKTVAWAIVSIFVTLGLIGREMMHSVITVVKR
                     LLEKYHLATQPQESASSSTVISAVPEAPNAEAEEASAWVSIIYNGVCNMLNVAAQKPK
                     QFKDWVKLATVDFSNNCRGSNQVFVFFKNTFEVLKKMWGYVFCQSNPAARLLKAVNDE
                     PEILKAWVKECLYLDDPKFRMRRAHDQEYIERVFAAHSYGQILLHDLTAEMNQSRNLS
                     VFTRVYDQISKLKTDLMEMGSNPYIRRECFTICMCGASGIGKSYLTDSLCSELLRASR
                     TPVTTGIKCVVNPLSDYWDQCDFQPVLCVDDMWSVETSTTLDKQLNMLFQVHSPIVLS
                     PPKADLEGKKMRYNPEIFIYNTNKPFPRFDRIAMEAIYRRRNVLIECKASEEKKRGCK
                     HCENDIPIAECSPKMLKDFHHIKFRYAHDVCNSETTWSEWMTYNEFLEWITPVYMANR
                     RKANESFKMRVDEMQMLRMDEPLEGDNILNKYVEVNQRLVEEMKAFKERTLWSDLHRV
                     GAEISASVKKALPTISITEKLPHWTVQCGIAKPEMDHAYEVMSSYAAGMNAEIEAHEQ
                     VRRSSVECQYAEPQAPRNPDDEGPTIDEELMGDTEFTSQALERLVDEGYITGKQKKYI
                     ATWCSKRREHTADFDLVWTDNLRVLSAYVHERSASTRLSTDDVKLYKTISMLHQKYDT
                     TECAKCQHWYAPLTDIYVDDKKLFWCQKEKKTLIDVRKLSKEDVTVQSKLINLSVPCG
                     EVCMLHSKYFNYLFHKAWLFENPTWRLIYNGTKKGMPEYFMNCVDEISLDSKFGKVKV
                     WLQAIIDKYLTRPVKMIRDFLFKWWPQVAYVLSLLGIIGITAYEMRNPKPTSEQLADH
                     YVNRHCSSDFWSPGLASPQGLKYSEAVTAKAPRIHRLPVTTKPQGSTQQVDAAVNKIL
                     QNMVYIGVVFPKVPGSKWRDINFRCLMLHNRQCLMLRHYIESTAAFPEGTKYYFKYIH
                     NQETRMSGDISGIEIDLLNLPRLYYGGLAGEESFDSNIVLVTMPNRIPECKSIIKFIA
                     SHNEHIRAQNDGVLVTGDHTQLLAFENNNKTPISINADGLYEVILQGVYTYPYHGDGV
                     CGSILLSRNLQRPIIGIHVAGTEGLHGFGVAEPLVHEMFTGKAIESEREPYDRVYELP
                     LRELDESDIGLDTDLYPIGRVDAKLAHAQSPSTGIKKTLIHGTFDVRTEPNPMSSRDP
                     RXAPHDPLKLGCEKHGMPCSPFNRKHLELATNHLKEKLVSVVKPINGCKIRSLQDAVC
                     GVPGLDGFDSISWNTSAGFPLSSLKPPGASGKRWLFDIELQDSGCYLLRGMRPELEIQ
                     LSTTQLMRKKGIKPHTIFTDCLKDTCLPVEKCRIPGKTRIFSISPVQFTIPFRQYYLD
                     FMASYRAARLNAEHGIGIDVNSLEWTNLATSLSKYGTHIVTGDYKNFGPGLDSDVAAS
                     AFEIIIDWVLHYTEEDNKDEMKRVMWTMAQEILAPSHLCRDLVYRVPCGIPSGSPITD
                     ILNTISNCLLIRLAWLGITDLPLSEFSQNVVLVCYGDDLIMNVSDNMIDKFNAVTIGK
                     FFSQYEMVFTDQDKSGNTVKWRTLQTATFLKHGFLKHPTRPVFLANLDKVSVEGTTNW
                     THARGLGRRAATIENAKQALELAFGWGPEYFNYVRNTIKMAFDKLGIYEDLITWEEMD
                     VRCYASA"
     misc_feature    <2123..2500
                     /locus_tag="KVgp1"
                     /note="Picornavirus capsid protein domain_like.
                     Picornaviruses are non-enveloped plus-strand ssRNA animal
                     viruses with icosahedral capsids composed of 60 copies
                     each of 4 virus encoded proteins; alignment includes
                     picornaviridae, like poliovirus, hepatitis A...; Region:
                     rhv_like; cd00205"
                     /db_xref="CDD:119412"
     misc_feature    order(2141..2143,2147..2149,2153..2155,2201..2203,
                     2276..2278,2345..2347,2390..2392,2471..2473)
                     /locus_tag="KVgp1"
                     /note="drug-binding pocket [chemical binding]; other site"
                     /db_xref="CDD:119412"
     misc_feature    2774..3346
                     /locus_tag="KVgp1"
                     /note="Picornavirus capsid protein domain_like.
                     Picornaviruses are non-enveloped plus-strand ssRNA animal
                     viruses with icosahedral capsids composed of 60 copies
                     each of 4 virus encoded proteins; alignment includes
                     picornaviridae, like poliovirus, hepatitis A...; Region:
                     rhv_like; cd00205"
                     /db_xref="CDD:119412"
     misc_feature    order(2870..2872,2972..2974,2978..2980,2984..2986,
                     3032..3034,3101..3103,3170..3172,3218..3220,3299..3301)
                     /locus_tag="KVgp1"
                     /note="drug-binding pocket [chemical binding]; other site"
                     /db_xref="CDD:119412"
     misc_feature    3938..4573
                     /locus_tag="KVgp1"
                     /note="CRPV capsid protein like; Region: CRPV_capsid;
                     pfam08762"
                     /db_xref="CDD:255023"
     misc_feature    5558..5884
                     /locus_tag="KVgp1"
                     /note="RNA helicase; Region: RNA_helicase; pfam00910"
                     /db_xref="CDD:250218"
     misc_feature    <7976..8185
                     /locus_tag="KVgp1"
                     /note="Tungro spherical virus-type peptidase; Region:
                     Peptidase_C3G; pfam12381"
                     /db_xref="CDD:152816"
     misc_feature    8804..9643
                     /locus_tag="KVgp1"
                     /note="RNA_dep_RNAP: RNA-dependent RNA polymerase (RdRp)
                     is an essential protein encoded in the genomes of all RNA
                     containing viruses with no DNA stage. RdRp catalyzes
                     synthesis of the RNA strand complementary to a given RNA
                     template. RdRps of many viruses are...; Region:
                     RNA_dep_RNAP; cd01699"
                     /db_xref="CDD:238843"
     misc_feature    order(9071..9088,9272..9277,9395..9397,9401..9406,
                     9554..9559)
                     /locus_tag="KVgp1"
                     /note="active site"
                     /db_xref="CDD:238843"
     misc_feature    order(9071..9076,9401..9406)
                     /locus_tag="KVgp1"
                     /note="metal ion binding site [ion binding]; other site"
                     /db_xref="CDD:238843"
     misc_feature    9275..9277
                     /locus_tag="KVgp1"
                     /note="putative nucleic acid binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238843"
ORIGIN      
        1 gaattctagg gcgatttatg ccttccatag cgaattacgg tgcaactaac aattttagat
       61 agtagccatg aacaaacatt atagtagctc actacgtatt gatcattttt ataatgactt
      121 gcgtagyatg aagcgctgct tgtagttgta actatgttay tttgcaagtt ggagtttact
      181 attttggatt atgaatatgt gcacttagtg tctgtattta tagtcgtttg tggttcaagg
      241 ttttgtgtta gtagtacatt tatgtatgaa tgtaccttta gtatgaatgt tatagaatga
      301 caatatcgaa ggaaaaatct ttataaaata caaaaatatt gttttwatta cttcgatatg
      361 gtgttttata gagtagattg ccatgtgacc gctcatagaa gtccattatg gtttatcaat
      421 cgaagttgaa tgtatttata agaatattat acttaattag taatattagt agtccgtaac
      481 tattatcatc cttttttaca gtttgatgtg ataatagacc actgcagtat cgagtagagt
      541 ttcgaatgcg tagtgcaata gtacaatcac tgtcaccgac catctattgt aatgatagat
      601 ctgtcggaaa ccattattta tgaagtgact agcaatcatg gattaaatta gatggtattc
      661 tagtttagag gtgattcggc gctgcggtgc gactgaaact tctaaattag catgtcagat
      721 tgtattatga atgcgttagt agtaatttct gcgatagagc tgggacccct cagtctctca
      781 ggtattgtat gaggcgaaag tgtgaaagtt ttgtatatgt ttttatatat acgactgtat
      841 cgggaattcc tttagcaaga atccttttaa tacagtataa tttgtgctac ggtacgttac
      901 gttcgcaggg cacccgttaa tgtctcatag cccagacgat ggcggatgga aagacatcat
      961 attttatttt aatgctgtct ttattgctga tttattttgc tgtttttatt tgctatttta
     1021 tatttgctaa ttttcattat tgcgaaatat attacattgc tatttttatt atatacgcta
     1081 gattcaattt tatttatcct atattttcaa tttaattttg attttgaagg taaatatata
     1141 taattaatta ttagaaatgg cctttagttg tggaactctc tcttactctg ccgtcaccca
     1201 agctccgtct gtcgcctatg cacctcgtac atgggaagtt gatgaagcta ggcggcgccg
     1261 agttattaaa cgtttggcgc tggagcaaga acgtattcgt aatgttcttg acgttgacgt
     1321 ctataaccag gcgacatggg aacaggaaga cgtgcgcgat aacgagttcc taacggaaca
     1381 actaaacaat ttatatacta tttattccat cgctgaacgt tgtacgcgcc ggcctatcaa
     1441 agagtgctct cccatatcag tttcgaatag gttcgcccca ttggaatccc ttaaggtcga
     1501 aattggtcaa gaagcaagcg aatgtatatt taagaaacct aaatatacgc gcgtttgcaa
     1561 gaaagtgaag cgtgttgcaa ctcgcttcgt tcgcgaaaaa gttgttcgtc ctatgtgtcc
     1621 cagatcccct atgctattgt ttaagcttaa gaaaattatt tatgatttgc atttatatag
     1681 gttaagaaaa cagattagga tgttgagacg tcaaaaacag cgcgattatg aattagagtg
     1741 tgtcactaat ctgttacaat tatcgaatcc ggtgcaggca aaaccagaga tggataaccc
     1801 taatccagga cctgatggcg agggtgaagt tgaattagaa aaagatagta acgttgtttt
     1861 aacaactcag cgagatccta gtacatctat tccagcgccg gtgagcgtaa aatggagtag
     1921 atggactagt aatgatgtag tagatgatta cgccacaatc acatctcgat ggtatcagat
     1981 tgctgaattt gtttggtcga aggatgatcc atttgataag gagttagcac gtttaatttt
     2041 gcctcgtgct ttgttatcta gtatagaggc taattctgat gctatatgtg atgtgcctaa
     2101 tactattcca tttaaggtac ccgcatattg gcgaggcgat atggaagtta gagttcaaat
     2161 tagttctaat aaattccaag ttggtcaatt acaagctact tggtattatt cggatcatga
     2221 gaatttgaac atatcgtcta agagaagcgt ttatggattt tcacaaatgg atcatgcttt
     2281 gattagtgcg tcagcaagta atgaagcaaa attagttatt ccgttcaagc atgtttatcc
     2341 atttttaccg acaagaattg tgccagattg gactactggc attttagata tgggtgcttt
     2401 gaacattcgt gtaattgctc ccttacggat gagtgctact ggtccaacta cctgtaatgt
     2461 cgtcgtgttt attaaattaa ataacagcga gtttacaggg acttcttctg gtaagcttta
     2521 tgcgagtcaa atcagggcaa aacctgagrt ggatcgtata ttaaatttgg cagagggatt
     2581 gctaaataac acgattggtg gtaacaatat ggataatcct tcttatcaac aatctcctcg
     2641 tcattttgtc ccgactggta tgcacagttt agctttaggt actaatttag ttgaaccatt
     2701 acatgcatta cgtttggatg cggctggtac gacacaacat cctgtaggtt gtgctcctga
     2761 tgaagatatg actgtatcat ccatagcatc tcgatatgga ctaattagac agatacaatg
     2821 gaagaaagat catgctaaag gatcactttt gttacagtta gatgctgatc catttgtgga
     2881 gcaaagaatt gaaggtacga atccgatatc tctgtattgg ttcgcacccg tgggtgtagt
     2941 atctagtatg tttatgcaat ggcgtggttc attagaatat aggtttgata ttatagcatc
     3001 ccaatttcat actggtaggt taattgtagg ttatgtgcct ggtttgacag catctttaca
     3061 acagcaaatg gactatatga agttgaagtc atcaagttat gtagtatttg atttacaaga
     3121 aagtaatagc tttacttttg aggtgccata tgtttcatac agaccatggt gggtgcgtaa
     3181 gtatggtggc aattatttac cctcgtcaac tgacgctcct agcacattat ttatgtatgt
     3241 gcaggttccg ttgataccta tggaagctgt ttcagatact attgatatca atgtgtacgt
     3301 acggggcggt agttcatttg aagtttgtgt tccagtccaa cctagtttag gtttgaattg
     3361 gaatacagac tttattttac gtaatgacga agaatatagg gctaagacag gttatgcacc
     3421 atattatgct ggagtatggc atagcttcaa taatagtaac tctcttgttt ttaggtgggg
     3481 atctgcttct gatcaaattg ctcagtggcc aacaatttca gtaccaagag gtgagctagc
     3541 tttcttacgm attarggatg gaaagcragc tgctgtagga actcaacctt ggcgtacgat
     3601 ggttgtttgg ccttctggtc atggttataa tattggtata cctacgtata atgctgaacg
     3661 agctcgccag cttgcacagc atttatatgg tggtggatca ttaactgacg agaaggccaa
     3721 acaattattt gttcctgcta atcaacaagg acctggtact gtaagtaatg gaaatccagt
     3781 atgggaagtc atgcgtgcac cattggcaac acaacgtgcg catgttcaag attttgaatt
     3841 tattgaagct attccagaag gagaggagtc tcgtaatact acagtcttgg atacgaccac
     3901 tactttacag tcgagcggat ttggtcgcgc cttctttgga gaagctttta atgaccttaa
     3961 aacgttaatg cgacgatatc aattatatgg tcaattatta ttgtccgtta ctacggataa
     4021 ggatattgat cattgtatgt ttaccttccc ttgtttacca caagggttag cgttagacat
     4081 tggttctgct ggctctccac atgaaatctt taatagatgt cgtgatggta ttataccatt
     4141 aattgcatct ggatatagat tttatagagg agayttgcgt tataagattg tttttccaag
     4201 taatgttaat agcaacattt gggtacaaca tcgaccggat cgtagrctgg aaggatggtc
     4261 tgcggctaag attgtaaatt gtgatgctgt gtctactggt caaggggtgt ataatcatgg
     4321 ttatgctagt cacattcaaa tcacgcgtgt aaataatgtt atagaattgg aagtcccatt
     4381 ttataatgct acttgttaca attatttaca ggcgtttaat gcgtctagcg ctgcatctag
     4441 ttatgcagta tctttaggag aaatatcggt tggttttcaa gctacaagtg atgatattgc
     4501 atctattgty aacaaacctg tcactattta ttatagtata ggagatggta tgcaattttc
     4561 tcagtgggtt ggatatcaac cgatgatgat cctagaccag cttcctgcac cagtagtaag
     4621 ggccgtgcct gagggcccta ttgcgaagat taaaaacttc ttccatcaaa cagctgacga
     4681 ggttagagaa gctcaggcag caaagatgcg tgaagatatg ggtatggttg tccaagatgt
     4741 tattggagaa cttagccagg ccataccgga tcttcaacaa ccagaggttc aagcaaatgt
     4801 cttctcactg gtgtctcagt tagtgcatgc tattataggt actagtttaa agacagttgc
     4861 ttgggcgatt gtttcgattt ttgtgacttt aggattaatt ggacgcgaaa tgatgcattc
     4921 agttattact gtagtcaagc ggttacttga gaaatatcac ttggcgacgc aaccccagga
     4981 atccgccagt tcaagtactg ttatatctgc cgttccagaa gctcccaatg ctgaagcgga
     5041 ggaggcaagt gcttgggtat ccattattta taatggtgtg tgtaatatgc ttaatgtggc
     5101 tgctcaaaaa ccgaaacaat ttaaagattg ggtaaaatta gctactgtag attttagtaa
     5161 taattgtaga ggtagtaatc aggtatttgt atttttcaag aatacatttg aagtgttgaa
     5221 gaaaatgtgg ggttatgtat tttgtcagag taatcctgca gcgcgtttgt tgaaagctgt
     5281 gaatgacgag cctgagattt tgaaagcatg ggtgaaggaa tgtctgtatt tggatgatcc
     5341 caaatttaga atgcgtcgag cgcatgatca agagtatatc gagagagtgt ttgcggcaca
     5401 ttcatatgga caaattttgc tacatgattt aactgctgaa atgaatcaat cacgaaattt
     5461 gagtgtgttt acacgtgtgt atgatcaaat ttcaaaattg aagactgatc ttatggaaat
     5521 gggatcgaat ccatatataa ggcgtgaatg ttttacgata tgcatgtgtg gtgcatctgg
     5581 aattggaaaa tcatatttga ccgattcttt atgcagcgag ctcttacgtg cgagtcgtac
     5641 tcctgtgaca acaggcataa aatgtgttgt taatccatta tctgattatt gggatcartg
     5701 tgattttcag cctgttttgt gcgttgacga tatgtggagt gttgaaacat ctactacgct
     5761 ygataagcag ttgaayatgc ttttycaggt ccattcccct atcgtgcttt ctcctcctaa
     5821 agctgattta gaaggcaaga aaatgcgata taacccggaa atattcatat acaatacgaa
     5881 taaacctttc ccgaggtttg atcgtattgc tatggaagct atttatcggc gtagaaatgt
     5941 tttgattgaa tgcaaagcga gtgaagagaa gaagcgaggg tgcaagcatt gtgagaatga
     6001 tattcctatt gctgaatgta gtcctaagat gttgaaagat tttcatcata ttaagtttag
     6061 gtatgcacat gatgtatgta attccgagac cacatggtct gaatggatga cgtataatga
     6121 atttcttgaa tggataactc ctgtgtatat ggctaatcgt cgtaaggcga atgaatcatt
     6181 taagatgcgt gtggatgaaa tgcaaatgtt gcgtatggat gaaccattgg aaggtgataa
     6241 tattctcaat aagtacgttg aagtcaatca gcgcttagtg gaggaaatga aagcatttaa
     6301 ggagcgtaca ctatggtcag atttacatcg cgtaggtgcg gaaattagtg cgtcagttaa
     6361 gaaagcttta ccaaccattt ccataactga aaaactacca cattggactg ttcaatgtgg
     6421 tattgctaaa cctgagatgg atcatgctta tgaggttatg agttcgtatg cagctggaat
     6481 gaatgcagag attgaagcgc atgaacaagt tcggcgttca tcagtggaat gtcaatatgc
     6541 agagcctcaa gctccaagaa accctgatga cgaaggacca actatagatg aagaacttat
     6601 gggagacact gaatttacat cacaggctct agaacgtctt gtggatgaag gttatataac
     6661 tggaaaacag aagaaataca tagccacgtg gtgtagtaag cgtcgtgaac atactgctga
     6721 ctttgatctt gtgtggactg ataatttgcg tgtgttaagt gcgtatgtgc atgaacgttc
     6781 agcttcaact cggctttcta cggatgacgt caagttatat aaaacaatta gtatgttgca
     6841 tcaaaagtat gataccacag agtgtgctaa gtgtcaacat tggtatgctc cgttgactga
     6901 tatctatgtt gatgacaaga aattgttttg gtgtcagaaa gagaaaaaga cacttattga
     6961 tgtccgaaaa ttgtcgaaag aagatgtgac tgttcaatca aaattgatta atttgtctgt
     7021 tccatgtggt gaagtgtgta tgttacattc aaaatatttc aattatcttt tccataaagc
     7081 atggttgttt gagaacccaa cttggcgcct aatatataat ggtactaaga agggtatgcc
     7141 cgagtacttt atgaattgtg tggatgaaat ttcattagat tccaaatttg gtaaagtgaa
     7201 agtgtggttg caagcgatca ttgataagta tttaacccgt cccgtgaaaa tgattcgtga
     7261 ttttcttttc aagtggtggc cgcaagttgc gtatgtgttg agcttgctag gtataattgg
     7321 tataacagcg tatgaaatga gaaatccgaa accaacttct gagcaattag ctgatcatta
     7381 tgtaaatagg cattgtagct ctgatttttg gtcaccaggg ttggcatcac ctcaaggatt
     7441 gaaatatagt gaagcagtaa cagcaaaggc acctagaatt catagattgc cagttactac
     7501 taagcctcag ggatcaacac aacaagtaga tgctgctgtg aataaaattt tacaaaacat
     7561 ggtttacatt ggtgttgttt tcccaaaagt gcctggtagt aagtggcgag atattaattt
     7621 taggtgtctt atgcttcata ataggcaatg tttaatgttg aggcattata ttgagtcaac
     7681 tgccgccttt cctgagggaa ccaagtacta ttttaagtat attcataatc aagagactag
     7741 aatgtctggt gatatttctg gtattgaaat tgatttgttg aatttgccta gattgtatta
     7801 tggtggtctc gcgggagagg agtcatttga tagcaataty gtgcttgtga ctatgcctaa
     7861 tcgtattcct gagtgtaaga gcattattaa atttatagcg tcacataatg aacatatacg
     7921 tgctcagaat gatggagtgt tagtaactgg cgaccatact cagctgttgg ctttcgagaa
     7981 taataataaa actccaataa gtatcaacgc tgatggtttg tatgaggtta tacttcaagg
     8041 agtatatact tatccatacc atggcgatgg tgtttgtggt tcgatattgt tgtctcggaa
     8101 tttacaacgg ccgattatag gtatccatgt tgctggtact gaaggattgc atggctttgg
     8161 agttgctgaa ccacttgtac atgaaatgtt cactggtaaa gcaatcgaga gtgaaagaga
     8221 gccgtatgat cgtgtgtatg aacttccgtt gcgtgaatta gatgaatctg atattggttt
     8281 agatactgat ttatatccaa ttggtagagt ggatgcaaag ctagctcatg ctcaaagccc
     8341 ttctactggg attaaaaaga cgcttatcca tggaacattt gatgtaagga ctgaaccaaa
     8401 tccgatgtca tcacgtgatc caagaayagc accgcacgat cctttgaagt tagggtgtga
     8461 aaagcatggc atgccctgtt caccgtttaa taggaaacat ctggaattag cgacaaatca
     8521 tttgaaagaa aaattagttt cagtagttaa accaataaat ggttgcaaga ttagaagttt
     8581 gcaagatgct gtatgtggtg tgcctggttt agatgggttt gattcaatat cttggaatac
     8641 tagtgctggt tttcctttgt cttcattaaa gccacctgga gcatcaggta agcgatggtt
     8701 gtttgacatt gagctacaag actcgggatg ttatctcttg cgtggaatgc gtcccgaact
     8761 tgagattcaa ttatcaacga cacagttaat gaggaaaaag ggaataaaac ctcacactat
     8821 attcacggat tgtttgaaag atacttgttt gcctgtagaa aaatgtagaa tacctggtaa
     8881 gactagaata tttagtataa gtccagtaca gtttactata ccgtttagac agtattattt
     8941 agattttatg gcatcctatc gagctgcacg ccttaatgct gagcatggta taggtattga
     9001 tgttaatagc ttagaatgga caaatttggc aacaagtttg tcaaagtatg gcactcatat
     9061 cgtgacgggt gactataaga attttggccc tggattagat tccgatgttg cagcttcggc
     9121 gttcgaaatt attatcgatt gggtattaca ttatactgaa gaagataata aagacgaaat
     9181 gaagcgagta atgtggacca tggcgcaaga gattttagcg cctagtcatc tatgtcgtga
     9241 tttagtgtac cgggtacctt gtggaattcc atcaggttct ccgataacgg acattttaaa
     9301 tacaatttca aattgtctgt taattaggtt agcttggtta ggtattactg atttgccttt
     9361 atccgagttc tctcaaaatg ttgttcttgt ttgttatggt gatgatctta tcatgaatgt
     9421 tagtgataac atgattgata aatttaatgc tgtaacaata gggaaattct tttcacaata
     9481 tgagatggta tttacggatc aggacaaatc aggaaatact gtgaagtggc ggacgttaca
     9541 gactgctact ttcttgaagc atgggttttt aaaacatcca actagacctg tgtttctggc
     9601 taacctagac aaggtttcgg tagaaggaac gacgaattgg acccatgctc gaggattggg
     9661 tcgtcgtgca gcaaccatag agaatgctaa acaagcgcta gagttagcat tcggatgggg
     9721 tccagaatac tttaactatg tcagaaatac tattaaaatg gcttttgaca agttgggtat
     9781 ttatgaagac cttatcacat gggaagaaat ggatgttaga tgttatgcta gcgcgtagta
     9841 tttaatttta aatacttatt agttttaatt ttattttagg ttattggaat tgagggaagt
     9901 accacccccc aagaccttcg ttttaaatct actaaaagga gtggacctat atataagagc
     9961 ctgaagacag agtggattag accaccattt ttagcttata tatgggaaag gttgagttgc
    10021 ctctaaagac tcagctccat agtagagtag ttttaattac gattaaagtg gtactctagg
    10081 ttaggtgtta ctcgcgtatt atcaactagt ggtaatgcgt cctaatttta gtatagtttt
    10141 aaccataata gt
//
DBGET integrated database retrieval system