GenomeNet

Database: RefSeq
Entry: NC_007245
LinkDB: NC_007245
Original site: NC_007245 
LOCUS       NC_007245             472852 bp    DNA     linear   CON 18-JUN-2017
DEFINITION  Leishmania major strain Friedlin complete genome, chromosome 4.
ACCESSION   NC_007245 AL139794 AL389894
VERSION     NC_007245.2
DBLINK      BioProject: PRJNA15564
            BioSample: SAMEA3138173
            Assembly: GCF_000002725.2
KEYWORDS    RefSeq; complete genome.
SOURCE      Leishmania major strain Friedlin
  ORGANISM  Leishmania major strain Friedlin
            Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae;
            Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Rogers,M.B., Hilley,J.D., Dickens,N.J., Wilkes,J., Bates,P.A.,
            Depledge,D.P., Harris,D., Her,Y., Herzyk,P., Imamura,H., Otto,T.D.,
            Sanders,M., Seeger,K., Dujardin,J.C., Berriman,M., Smith,D.F.,
            Hertz-Fowler,C. and Mottram,J.C.
  TITLE     Chromosome and gene copy number variation allow major structural
            change between species and strains of Leishmania
  JOURNAL   Genome Res. 21 (12), 2129-2142 (2011)
   PUBMED   22038252
REFERENCE   2
  AUTHORS   Ivens,A.C., Peacock,C.S., Worthey,E.A., Murphy,L., Aggarwal,G.,
            Berriman,M., Sisk,E., Rajandream,M.A., Adlem,E., Aert,R.,
            Anupama,A., Apostolou,Z., Attipoe,P., Bason,N., Bauser,C., Beck,A.,
            Beverley,S.M., Bianchettin,G., Borzym,K., Bothe,G., Bruschi,C.V.,
            Collins,M., Cadag,E., Ciarloni,L., Clayton,C., Coulson,R.M.,
            Cronin,A., Cruz,A.K., Davies,R.M., De Gaudenzi,J., Dobson,D.E.,
            Duesterhoeft,A., Fazelina,G., Fosker,N., Frasch,A.C., Fraser,A.,
            Fuchs,M., Gabel,C., Goble,A., Goffeau,A., Harris,D.,
            Hertz-Fowler,C., Hilbert,H., Horn,D., Huang,Y., Klages,S.,
            Knights,A., Kube,M., Larke,N., Litvin,L., Lord,A., Louie,T.,
            Marra,M., Masuy,D., Matthews,K., Michaeli,S., Mottram,J.C.,
            Muller-Auer,S., Munden,H., Nelson,S., Norbertczak,H., Oliver,K.,
            O'neil,S., Pentony,M., Pohl,T.M., Price,C., Purnelle,B.,
            Quail,M.A., Rabbinowitsch,E., Reinhardt,R., Rieger,M., Rinta,J.,
            Robben,J., Robertson,L., Ruiz,J.C., Rutter,S., Saunders,D.,
            Schafer,M., Schein,J., Schwartz,D.C., Seeger,K., Seyler,A.,
            Sharp,S., Shin,H., Sivam,D., Squares,R., Squares,S., Tosato,V.,
            Vogt,C., Volckaert,G., Wambutt,R., Warren,T., Wedler,H.,
            Woodward,J., Zhou,S., Zimmermann,W., Smith,D.F., Blackwell,J.M.,
            Stuart,K.D., Barrell,B. and Myler,P.J.
  TITLE     The genome of the kinetoplastid parasite, Leishmania major
  JOURNAL   Science 309 (5733), 436-442 (2005)
   PUBMED   16020728
REFERENCE   3  (bases 1 to 472852)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 472852)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire, CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR796400.
            On Jun 1, 2012 this sequence version replaced NC_007245.1.
            Data release policy www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..472852
                     /organism="Leishmania major strain Friedlin"
                     /mol_type="genomic DNA"
                     /strain="Friedlin"
                     /db_xref="taxon:347515"
                     /chromosome="4"
     gene            <4636..>7707
                     /locus_tag="LMJF_04_0010"
                     /db_xref="GeneID:3684824"
     mRNA            <4636..>7707
                     /locus_tag="LMJF_04_0010"
                     /product="calcium-translocating P-type ATPase"
                     /transcript_id="XM_883419.1"
                     /db_xref="GeneID:3684824"
     CDS             4636..7707
                     /locus_tag="LMJF_04_0010"
                     /EC_number="3.6.3.8"
                     /codon_start=1
                     /product="calcium-translocating P-type ATPase"
                     /protein_id="XP_888512.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684824"
                     /db_xref="GOA:Q95Z93"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR005782"
                     /db_xref="InterPro:IPR006068"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023298"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:Q95Z93"
                     /translation="MAKLVLPDDPASMDGHLICSLLEVKEARGLAQDEVDKRLHEFGK
                     NELSTGPSTPFWKLVVGQFEDTLVRILLLAAFVSFCLAVLESNMMDLVEPFIILLILT
                     LNAIVGVWQEDRAEKAIDALKDFVPETAVVVREGMTQRILAENLVPGDIVEIAVGDRV
                     AADVRLLTLESTTLRVDQSILNGESVEAMKQVESVRVKRERFPSSMVYRGTAVVYGKA
                     RGVVVRTGKSTEMGFIERDVREQEETKTPLQLKLDEFGVLLSTVIGFICLFVFVVNLL
                     HWFRTHPAATEESWFERYIEPTVHSLKVAVALAVAAIPEGLPAVVTTCLALGSRKMAR
                     QNALVRDLPSVETLGRCTVICSDKTGTLTTNMMSVSEVVTMEVSGKAHKYSIHDSRFN
                     VVAAAVSHNGTPAGEALGNDAALDMVATIATLCSDASLVCGTRSAEVEKVGDATEAAL
                     LVMSEKLYHSAARNGVDGAHLPVDRCRSLKRQLWLKKATLEFTRSRKSMSVCCTSTED
                     ARIHSLFVKGAPEEILKRCTRIMFKDGHISPLTPKMVNTVTANIDRMSGAEEALRCIA
                     FAFRPLPDPKQLDLSDPAKFEAIESDLTFIGVCGMLDPPRREVADAIAKCRTAGIRVI
                     VITGDKKETAEAVCRRIGLMPYEPTTGLSFTGYELDQMTPAQRRAAVSSAVLFSRTDP
                     SHKMQLVNLLQEQKLICAMTGDGVNDSPALKKADIGIAMGSGTEVAKAASKMVLADDN
                     FATVVKAVREGRTIFNNTKQFIRYLISSNIGEVACVLATGLFGLPEALSPIQLLWVNL
                     VTDGLPATALGFNAADPDIMEQAPRRGDEPIVDGWLFFRYMIVGIYVGLATVAGFVWW
                     FLTNGFTLADLASFTTCTDMSNSKCAELANPQTARAIALSILVVVEMLNALNALSENQ
                     SLVVIRPSTNKWLIAAICSSIALHLTIMYIPFFSRLFGVTSLGVDADVVATANPWDVL
                     LPTDFTDWRTVLVLSIPVIFLDELLKLFSRCSNHHRENYSAEWVVGGMSRM"
     repeat_region   7943..8453
                     /note="Lmjchr4:repeat_unit:7942-8453"
     gene            <9782..>10687
                     /locus_tag="LMJF_04_0020"
                     /db_xref="GeneID:3684825"
     mRNA            <9782..>10687
                     /locus_tag="LMJF_04_0020"
                     /product="putative pteridine transporter (truncated)"
                     /transcript_id="XM_883420.1"
                     /db_xref="GeneID:3684825"
     CDS             9782..10687
                     /locus_tag="LMJF_04_0020"
                     /codon_start=1
                     /product="putative pteridine transporter (truncated)"
                     /protein_id="XP_888513.1"
                     /db_xref="GeneID:3684825"
                     /translation="MSRNISVAVYGVIMTAGVIALTVLNIMGTTYQLLYGCVSISVIL
                     CATGFLCIPMTIMKANFFGWCQQVCYILISGGTDNFCMSDASCLPDGPHFSQTFYNTV
                     GAVIGNAAGVLGVYLFARVFSKQSYRVTLICTTLVQILASIFDIIIVERWNLYIGIPD
                     HAMYIMGDAIVYEVCKMLNFMPLNMLISRLCPKGCESTMFAILASFSNMGASTSSTIG
                     AILMETVWPLSSSLPCDFSNLRWLHISGHFITPLIAIPLASVRIPGTSIRSSLASKER
                     TPLLSTRGRLRMERGLRLERTRIPS"
     gene            <12729..>14906
                     /locus_tag="LMJF_04_0030"
                     /db_xref="GeneID:3684826"
     mRNA            <12729..>14906
                     /locus_tag="LMJF_04_0030"
                     /product="putative cAMP-specific phosphodiesterase"
                     /transcript_id="XM_883421.1"
                     /db_xref="GeneID:3684826"
     CDS             12729..14906
                     /locus_tag="LMJF_04_0030"
                     /codon_start=1
                     /product="putative cAMP-specific phosphodiesterase"
                     /protein_id="XP_888514.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684826"
                     /db_xref="GOA:Q95Z92"
                     /db_xref="InterPro:IPR002073"
                     /db_xref="UniProtKB/TrEMBL:Q95Z92"
                     /translation="MCPFDVLASVKDDPSLSPQLREKIGGALTRLREICKTADQPSVA
                     KALPRSCAHNYFKEMISGHAPLRFSCHSSESTHTRVKHFDIASSRLPGPIVMSSSKTL
                     MQRTTPALQSPKEIFAELNVIAFQTLRYIDEVEQIEFDVTNVREHDGSIMEDKERLFL
                     SVCCSVFANFSFFASLHINAEKFLHFLRKLFTCYPLDNSYHNATHAADALQMMSLFFR
                     EPTVNFLFSDEEIAICFLAVLAVDVAHPGASDTLLVALDHPLASVFGDVAITEHASLL
                     VLTSLLVLEDNFFFSTPDMAVSVDSAHLLKEALYDVVLNAALRSRPSLMSALRDIETS
                     GRITDADAPKLMAALLVMACNSFAFRSQAQCCRMGAWFLSELHREECEMERHGIRVTL
                     PHVAGADCAAVLSDYINVVVKPVTAATLALVPRDLQDRLEWNADLVDAAASTGGRACK
                     VVVENSLVQWMTSSLSVMEILKKVATHASSVDRKASKCAILNASPSRSQGTAPDMMRA
                     DSLSSNSSTSGSMSAAKRDEATSNCPQLSFTSEPCSAAGSPTARPGRSEHYFSFLRLY
                     DKCERAGESAKNFVGQLIFLALQLDPRYIAAYARKEYGDDCCGAECAEMGLLISKMEE
                     APSTAEVIASRPPGGSFSNRVADEIDHTDSFVLLLMDMYCSREAALAEMESVVLVSDK
                     AKTPPPAEPAAPKAVPQFQQNSPIRMPVNTESKNTGPRLRLVP"
     gene            <15891..>16112
                     /locus_tag="LMJF_04_0035"
                     /db_xref="GeneID:12981686"
     mRNA            <15891..>16112
                     /locus_tag="LMJF_04_0035"
                     /product="hypothetical protein"
                     /transcript_id="XM_003723200.1"
                     /db_xref="GeneID:12981686"
     CDS             15891..16112
                     /locus_tag="LMJF_04_0035"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003723248.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0035"
                     /db_xref="EnsemblGenomes-Tr:1"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0035"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981686"
                     /db_xref="UniProtKB/TrEMBL:E9ACP4"
                     /translation="MGPRAAGFLIGGFVTAMASAVLLQYDVLRKQELTTRKTEEVVVQ
                     ADMIVHRFHVIEAGLRTLSEGGEARPSAT"
     gene            <16627..>17946
                     /locus_tag="LMJF_04_0040"
                     /db_xref="GeneID:3684827"
     mRNA            <16627..>17946
                     /locus_tag="LMJF_04_0040"
                     /product="hypothetical protein"
                     /transcript_id="XM_883422.1"
                     /db_xref="GeneID:3684827"
     CDS             16627..17946
                     /locus_tag="LMJF_04_0040"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_888515.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684827"
                     /db_xref="GOA:Q95Z91"
                     /db_xref="UniProtKB/TrEMBL:Q95Z91"
                     /translation="MQQRMGAMPMAVLYPQSYLPHSAVPCPAPGYGNMFSGYGAAPVM
                     MMVAGNAPYPVNAHFGHSATPMYFAMDPANSAAPMAVVADAASVCATPKAKLAHSGSG
                     NSLSTQSCCSGGETPSLLSRSAASSTVKQRPHHDVNVWGFALVDQLHPSLQRIPVPLS
                     CLHEPTMGISLYDNNVMSSSTRPCKSSVCLLHAQGLGCAEGSRCRCFHVSSAYLMQCR
                     ATSESLCCALHNCYYSQEMLGANCAPHVSGRCYALSLDDASKFPQDGEKPYLINLSLL
                     NLSLTVGLETLPCVNSVYVVSWKKHVCRLSMDGLCKWTKDCGHIHVCRQLTRFLQDAE
                     TLSIVKTLQERTRPKSSAELYRDIILSENTLRYVRSVAALSLVAALLEAGDVEALKTL
                     ARAKCALLPSQSEALQKLGIALSGSDSTRSVTVSPKLLALLTPKGTN"
     repeat_region   19396..19901
                     /note="Lmjchr4:repeat_unit:19395-19901"
     gene            <22169..>22672
                     /locus_tag="LMJF_04_0045"
                     /db_xref="GeneID:12981687"
     mRNA            <22169..>22672
                     /locus_tag="LMJF_04_0045"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003723201.1"
                     /db_xref="GeneID:12981687"
     CDS             22169..22672
                     /locus_tag="LMJF_04_0045"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003723249.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0045"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0045"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981687"
                     /db_xref="UniProtKB/TrEMBL:E9ACP5"
                     /translation="MAQWIPKTAWKVSNLNKRYGAPYVAKGYASLDPRCSLDAYSSFQ
                     QTVTSADMKKALLSIDSTSSGALVIDVRSEPERRLRPLLSPAIVALHPHDILSGAACP
                     ILPSNKERAEMFVVASEAQRAVNACTALRRWGFSRVTAVSVDAVSEAIAAVQKPADAA
                     TSSSTKS"
     gene            <23869..>25419
                     /locus_tag="LMJF_04_0050"
                     /db_xref="GeneID:3684828"
     mRNA            <23869..>25419
                     /locus_tag="LMJF_04_0050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883423.2"
                     /db_xref="GeneID:3684828"
     CDS             23869..25419
                     /locus_tag="LMJF_04_0050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888516.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684828"
                     /db_xref="UniProtKB/TrEMBL:Q95Z90"
                     /translation="MRSTELIVERGPSRNEAHSMVNESPSNQPQEQFSLEPKWKTAAA
                     PSCESSSEEAAYPKGNEEEEHNEARPRALCRLTDVSTDHYAKNPDSEEEDAQDEAEGD
                     GSHVGAIPAEAATTARPHDLHKAKKKRSNHAKETKAAETLEKPAAPRKKKPMYKVNIG
                     NVERHPPVPEGVNTPRSVMLCKECGVNPSELARYDRKHFQGAGVSDEVAELRYQSYEK
                     RRCARMAQLKPAYKESIKYDLEDPVSVPAAKRKAQAAEEAPARPAAAAQAAAPPPKLL
                     DEEAQMQRQFEAQHQRLLEQERRKTVTSGYDSDGRRRSPPRAGHFYGASVRSVGSAKS
                     PGRYSRNTSVGARPTVDQPYSAAKIYSASIVESRPLTQSEVIMIDEINEREAHRIDTQ
                     ERAFVIQENKQLMHVERELIRERLACVRVQKNAEDREKMQQKMHKRNEARQNVVAKRR
                     KKLEAERQARIQDSVAEKAARCHTTNPYASLMLRQMSGFSTCHTSSSFPSQGADVSAS
                     REQSSEAE"
     gene            <27659..>28447
                     /locus_tag="LMJF_04_0060"
                     /db_xref="GeneID:3684838"
     mRNA            <27659..>28447
                     /locus_tag="LMJF_04_0060"
                     /product="DNA topoisomerase type IB small subunit"
                     /transcript_id="XM_883424.2"
                     /db_xref="GeneID:3684838"
     CDS             27659..28447
                     /locus_tag="LMJF_04_0060"
                     /EC_number="5.99.1.2"
                     /codon_start=1
                     /product="DNA topoisomerase type IB small subunit"
                     /protein_id="XP_888517.1"
                     /db_xref="GeneID:3684838"
                     /db_xref="GOA:Q95Z89"
                     /db_xref="InterPro:IPR011010"
                     /db_xref="InterPro:IPR014727"
                     /db_xref="InterPro:IPR018521"
                     /db_xref="InterPro:IPR025834"
                     /db_xref="UniProtKB/TrEMBL:Q95Z89"
                     /translation="MQPAQSPPVAPPSVPAAAPKKTPIDISALKLKMSPSVRATLAAA
                     GVLGQCPRPIEAADEDALLKLKPMKAMAPPVKKAVAPVATTAPPPKVRRVESSSSSSS
                     GSSSSSSDDDSSRDDSSDSDSSSYSSDDRSSSSAESVVSGEATLFHIAQSQGLVNKEI
                     LTQEEEEVPTLVPPRPPVVRSFPNDIGKALERYRERLNREENIIRIKDDNKAVSLGTS
                     KINYIDPRIICSWAKAQDVPINKIFSATIQKKFPWAMNAENFDF"
     gene            <29376..>30113
                     /locus_tag="LMJF_04_0070"
                     /db_xref="GeneID:3684839"
     mRNA            <29376..>30113
                     /locus_tag="LMJF_04_0070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883425.1"
                     /db_xref="GeneID:3684839"
     CDS             29376..30113
                     /locus_tag="LMJF_04_0070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888518.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684839"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q95Z88"
                     /translation="MMEPTRNAEYSKQEYWDRRYTEEEHYDWFPSVYPMCVAAAFETV
                     EAVYRVQRSTGAFNGTLKVLHLGTGNSTLCADIRATYEAKYPTEDSRPYRLVQAATDY
                     SAVVIDRMQAKYGLAHPLEDVHWVVADIRDLSRVREQFGPFFDVVLDKGTMDALQADK
                     ANQNMEDDIERMLCEVSRCVEGGAGTRVYRVFVQITWEIPYLRLYYTTRNATHTFAWG
                     TNVTYRFLGESDMYRVYTYEVSPPSSE"
     gene            <30809..>31285
                     /locus_tag="LMJF_04_0080"
                     /db_xref="GeneID:3684840"
     mRNA            <30809..>31285
                     /locus_tag="LMJF_04_0080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883426.1"
                     /db_xref="GeneID:3684840"
     CDS             30809..31285
                     /locus_tag="LMJF_04_0080"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888519.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684840"
                     /db_xref="UniProtKB/TrEMBL:Q9BLQ6"
                     /translation="MRRCLTPAGAWVSTWRRVTTVSRAVGYNPSHCPPLTETDANKTT
                     SATSTAAPVAPTSEDYRALLLDLLLYRRETLTPVMEALRLERDEVETKMQQLDTHVRE
                     LSSIRNELRQLAEAMLDAERTRLRDFVMEPSNPPAAESTTAAQAAAQSEEVEEIVL"
     gene            <32421..>38015
                     /locus_tag="LMJF_04_0090"
                     /db_xref="GeneID:3684841"
     mRNA            <32421..>38015
                     /locus_tag="LMJF_04_0090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883427.1"
                     /db_xref="GeneID:3684841"
     CDS             32421..38015
                     /locus_tag="LMJF_04_0090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888520.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684841"
                     /db_xref="UniProtKB/TrEMBL:Q95Z87"
                     /translation="MPSPPHVIAYSMQRRVAPPYSSLRGRPVGTRGIDSFPVRLRMYV
                     ASSPLTASVGGSSSCFTSARLFTDTVASLSPVVNGASSAPPSPFEVHQVIARAAQRGE
                     WEHAIRLLVGSLHSHCVPLAETYQLVLLAALRGGGWQTSVQLTKQVATSTLSTTALYH
                     TAADLLLAKPTFNLETSGTSLDRVVLEELVPLMLADATQHVVWRPRHREAALQALGKA
                     NKHQTISALFRRWTAATALLGGVSRLRCSEEEATLFMAAFGVTGDWRSAETLRTSLSQ
                     ISAPLLISYVRAFAVAVQHAETSSLAEPQQLVPWEMALDTAAAGKQDAPLLEAVTELL
                     RVARHTAAPAGGARWWWAASTSTNAKLAELRRRVAISTRAAAQLLAECHVTTAQVRSL
                     LDAVRVSGVLSSAAAEASPYYEGWANVVLVLSQYCPHALVSVDGCADGLVQLLPHPHL
                     QVRQQRGGATPRTLALWRHVAQSAAGGDVAKPASVAWYVVYTSSALHYLRHAALQPAQ
                     LAKAEGTLSAGLARQLRCPGHHPIHGALLTGFADKPDALFILLRTVSAHINVPSAERC
                     VTLVMRDEAASISEIVDELLLSFLEPLDALGTPEEMCEAVCAASEAALRSSPLSYSST
                     QFVCLAVWYTCHQLRRGVSLGSLRPALRRTVSLVERLPGSAEALTLLSAQLQWCWGAS
                     LEALREQAVPILLQREEWGVLARLLERCPQPLSTQERHILQRCKNGAKVAALQNLVTA
                     HRATAAWEYWQGELCGAAREAPLPASLHDSLVSLLLAHGLVTEAHAVLDSSGASEVRV
                     SHTTWSHTGLRVYDYARRWRRREQGMQLAELWAAAALAEEEADRDGSEVRRREATVIL
                     ALYAGLALEHTHRAVDASQVIAAAVDYVLRYDEAHHHRGTQPSLDVATLHRTDAQLAA
                     RLPDYVQCAAPRLICAALNCSGESSRQPATKAACSSVDSGAVSEVLRSVAYLLPLTST
                     SGAAVMAWSETLLRLYTVAGACAIDAMPAVATLGQRLLHQAAEQNIAVAPSFLRLVLA
                     TGPLSTILLAAVRQCLLLRPGSAPTGPSSIDVAATAVQVAVSLADSGNHSAALEWVEE
                     FELWQRGEAAGKEGTEPGLQTVVDMPTQLSWLQAAQGAAQRRADQRAALCQHRRAEQA
                     AASRGSVVFELYSRDALDRLIDCDAWEEALDAFLRVLAAPTDVQSLLSADSMKLMELR
                     DAYLSANVLNSVMLCVARCAPWRTTVQAWMLLTSQVPLLPWNACAAALTPSIHELLRV
                     MARQCALPHEVGTVVAWMVAELDLPRSATSPLCSLFADCIGAASSTGVGHAWTAAEAQ
                     LCAELVAQLRRLCGEKRVREAGHAIAEAQAALFPPSLHTPAPHIEERTVPSAASWLLP
                     GRPPLSAEELDTLAVVAPLLLLASTPQLESLAQQHLGGTFQAHELKALLHLYREELLQ
                     RVATVRAPDAALVQYLAQNATLRVLLSQCAEVKPATHPARRTRDRAAAEWIAQHVFDG
                     FLPLSTAEELWKACEEPAKKLAECRWSAVAEAELCRELLRRHGKPPEKLSTAPHLTRQ
                     AISHYWSCFHRILLPEMHFGPLELCCLASYAPALAEARAACPDMTQPAYADAVAELAN
                     HAYKSHFCPSSIPVEDTLSYLRRPHCAAAIAAVMTSAFKKLKVLHAQLSDVRSAAARG
                     YRLPFPWNTVSAAAVQLPPELDRQCLADAARCIAHDAVPVTKTAPVHASHTCIVSPLL
                     RRWTQWATEMACAGSPKSLPQAASLLLVEWTKEALQSSCDLPRADQACSAALTAAGGR
                     DDKVCALWREVARAGKRELQQQRCRDLSAVWQLLAGAKVWRFMDPGHVMVLRRLVCPS
                     NSKVTALPSKRDAARHHRKTSQ"
     gene            <39200..>40939
                     /locus_tag="LMJF_04_0100"
                     /db_xref="GeneID:3684842"
     mRNA            <39200..>40939
                     /locus_tag="LMJF_04_0100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883428.1"
                     /db_xref="GeneID:3684842"
     CDS             39200..40939
                     /locus_tag="LMJF_04_0100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888521.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684842"
                     /db_xref="UniProtKB/TrEMBL:Q9N858"
                     /translation="MDRNCPSRTSRRCACAPWRRRVLLVCAWAVTAVLLSNCVLAWPQ
                     FLYVRRREELPAAVRADADDVHARTSPRLFPGTVERGEQARMLWEEAEAKGRLSPCWK
                     RSLQLLHAKCAEVRNEDTMRSRLALFMATCDANSDGRAHPSFHCGSAATQPSELSAHA
                     VRQCVQGLSDSAYAAFLQYRLHADVLCAYLEEELYQQRTEAAVAAMHLQMQRSSHMLT
                     ALQHSGAEVVALMKDSQTLQQESREAASSLLHQLDLLHNGQAAALQSLQQAVSAILHT
                     SSHTDAALGELHTRVQGAAAEALASVQALSQETLKRFAEVEAQTRGVVRLVQQMDTLH
                     QLLARQRLPRHRMAWVLGCLCGVLALTCLPQTAAARLPATLLTVVGCAGVPLLRWWTG
                     QARWLFLHETAWESLCLSLAVGLVGYCAYRYTPSDTYRHRSLARKEAIRVWGELQLQQ
                     QQQLGDAMLQPYVPQIPILGPQPHPRMVRSGAPEASLSVAHAWPPLSIVVSPRDDEVE
                     ATSTTADGSHCTASSEGSVSVPDEVSSAASTPNRKRGRPFTAGDDAVRHHATARTRRS
                     TARSTCRTTRRKG"
     gene            <42038..>43081
                     /locus_tag="LMJF_04_0110"
                     /db_xref="GeneID:3684843"
     mRNA            <42038..>43081
                     /locus_tag="LMJF_04_0110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883429.1"
                     /db_xref="GeneID:3684843"
     CDS             42038..43081
                     /locus_tag="LMJF_04_0110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888522.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684843"
                     /db_xref="UniProtKB/TrEMBL:Q9GRM8"
                     /translation="MLACSLKQTDRTRSDASLGTVEELSGWASVAEALLGECACAALV
                     DVAEPSARARLVVEYADSLVALVHMHAADVAALQLRAATAEEKRSDALARQLRAAVQE
                     CETMGSNLDSERTSRAALEEESRRLLNELLITQEEREALRAERTAVWCAVREAHAVAG
                     VTCAAKATMEEHVRVLSEWVRSAQAALTSATALMGTTTPLPVTVTPYQPARLLYRRVL
                     PTTPMNPVTASLLRVKEQVQQMREPSVAELQLAVGMYRHRGDEAAAPLTPSPRTRAAT
                     ATATVLTPAPLPVNRSLGRSRSCTPHRSTNGSATQREVDVVASPPWRTRMMKLQEELK
                     GLRRELGTATASP"
     gene            <43834..>44736
                     /locus_tag="LMJF_04_0120"
                     /db_xref="GeneID:3684844"
     mRNA            <43834..>44736
                     /locus_tag="LMJF_04_0120"
                     /product="putative exosome complex exonuclease RRP40"
                     /transcript_id="XM_883430.1"
                     /db_xref="GeneID:3684844"
     CDS             43834..44736
                     /locus_tag="LMJF_04_0120"
                     /codon_start=1
                     /product="putative exosome complex exonuclease RRP40"
                     /protein_id="XP_888523.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684844"
                     /db_xref="GOA:Q9N857"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR026699"
                     /db_xref="UniProtKB/TrEMBL:Q9N857"
                     /translation="MTQPSAVVAIGGGLRLLAQPAPTPTADGSSQALTDVFLSEYCAP
                     LQRSSHHLHTHVPRYTVPTPASRRYTPRAGDPVLAIIARKVSQHYYYCYIGGSALAYM
                     DALAFDGATKVSRPRLVEGDVVYCYVKPREGSSYVDGVHRSVASEVFDTTGEVEVSCT
                     AAEVGLPPKDWTSGEAVFGPLQGGRVLHLPLVYVRRLLTPMGSSPEKASAQQRKRDHT
                     EGEGSDGDEVPASYLLQLLGRRVPFEVAVGLNGLVWVRGLSSEADATAAARRTVAVSS
                     CISEAQYDVTRAEMEARVEVYFPS"
     gene            <45648..>46124
                     /locus_tag="LMJF_04_0123"
                     /db_xref="GeneID:12981684"
     mRNA            <45648..>46124
                     /locus_tag="LMJF_04_0123"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003723202.1"
                     /db_xref="GeneID:12981684"
     CDS             45648..46124
                     /locus_tag="LMJF_04_0123"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003723250.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0123"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0123"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981684"
                     /db_xref="UniProtKB/TrEMBL:E9ACP6"
                     /translation="MPDFSQFIKYLNANLHAPTGQYAAQGGVGGKGAGGASGATEAAS
                     PASHGDTSAFIRSCDTTWRVLLPSDAAAKESGTRSSGPSAAAAAAHTSPSHPSVTIGR
                     MMVSTEDRWRIQAQMRREEARTGQARKEYNKKVTRAIKVTKGPSENAFPPGRGRPL"
     gene            <47123..>48427
                     /locus_tag="LMJF_04_0127"
                     /db_xref="GeneID:12981685"
     mRNA            <47123..>48427
                     /locus_tag="LMJF_04_0127"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003723203.1"
                     /db_xref="GeneID:12981685"
     CDS             47123..48427
                     /locus_tag="LMJF_04_0127"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003723251.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0127"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0127"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981685"
                     /db_xref="UniProtKB/TrEMBL:E9ACP7"
                     /translation="MLESDNGARPLHDGTVLISPDASPNLTRRATNHYSAENTEAPPL
                     VDLLMRASETIREERGRADSLEKENAKLQAQLDGVRLAYQLVATQRAQRNSQTLGRVT
                     ALDKAGDDTLFAYVRDRLIGTDRHPSSEHEGCSCTRESSSRARLGQRQRRSNAAAPPV
                     ASAAARAPSHGSITAATRSCTKRGYAGITPPESVLPKTAEPHISVATEAHDKHGYLPT
                     TLRNCDLKSAKDHLATSLTGDGSRKGEEDAEMVEGGSNTEESPTHWMARRLLRALAPR
                     PTDSVVGDIVHTMVTALQKDVQAELSRPSDGGHAAPSRMRGFALVRLQPCVYRLLVGP
                     PAEVKAMERAARGGNRSARQTTPRLPSAALHRDHFLLYSGNPEPNTATHPCPPTTTNT
                     VLHLTLDTGALRVVRGGGHVDLIDYLERRLQTKLYTRRSRLA"
     repeat_region   48734..51353
                     /note="Lmjchr4:repeat_unit:48735-51355"
     gene            <48946..>50541
                     /locus_tag="LMJF_04_0130"
                     /db_xref="GeneID:3684845"
     mRNA            <48946..>50541
                     /locus_tag="LMJF_04_0130"
                     /product="conserved hypothetical protein in leishmania"
                     /transcript_id="XM_883431.1"
                     /db_xref="GeneID:3684845"
     CDS             48946..50541
                     /locus_tag="LMJF_04_0130"
                     /codon_start=1
                     /product="conserved hypothetical protein in leishmania"
                     /protein_id="XP_888524.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684845"
                     /db_xref="GOA:Q9N856"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="InterPro:IPR009030"
                     /db_xref="UniProtKB/TrEMBL:Q9N856"
                     /translation="MGPFAPRCCALALLCSVLVLAAVLVRAESFTVTRDVTMSSTSFD
                     DYTMVLDLSSSSADVVTVQLINSQVSGNGLTIKNARGSTPSSARLSMSMAITTVAQSA
                     ITLSGVMPANSDIRIVATTSSLAPAQSLFDFSGLALDSNATVMVENTAVTWPKDSINT
                     GSIVLISAGSNAVGIKNTAALFVLNATAINGASVVRVDTQSSFPISKGAALAVDYGRC
                     ERCSSALVSINVPLVVDASSLFRVANCKVVGASNGLLTSAGSITVSDKSAYLIYDSAV
                     ESGALFSFPAGLEDASEAYPFAVSGGSTVSFLNLKGSSTGVAAGQSVPNSLEQSNAIG
                     GGCVISDKELRVASEYRSHGLSVETVVDSQGASSGTCANAKCIPGNTKPGATVSGTEL
                     CTCQCSSTKHHSPFCTSVVDPMQNYDPNVWCTVPDCITCDRLDPSNRCTECDTGYSLT
                     SDYQCKAITTITTTTTTTKAPTCTAPHCSVCAAGSGSICSSCRSPYTLSNGVCVANTN
                     IAAGAHTATLAAAVCVAAALYAL"
     gene            <51572..>53167
                     /locus_tag="LMJF_04_0140"
                     /db_xref="GeneID:3684846"
     mRNA            <51572..>53167
                     /locus_tag="LMJF_04_0140"
                     /product="conserved hypothetical protein in leishmania"
                     /transcript_id="XM_883432.1"
                     /db_xref="GeneID:3684846"
     CDS             51572..53167
                     /locus_tag="LMJF_04_0140"
                     /codon_start=1
                     /product="conserved hypothetical protein in leishmania"
                     /protein_id="XP_888525.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0140"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0150"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684846"
                     /db_xref="GOA:Q9N853"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="InterPro:IPR009030"
                     /db_xref="UniProtKB/TrEMBL:Q9N853"
                     /translation="MGPFAPRCCALALLCSVLVLAAVLVRAESFTVTRDVTMSSTSFD
                     DYTMVLDLSSSSADVVTVQLINSQVSGNGLTIKNARGSTPSSARLSMSMAITTVAQSA
                     ITLSGVMPANSDIRIVATTGSLAPAQSLFDFSGLALDSNATVMVENTAVTWPKDSINT
                     GSIVLISAGSNAVGIKNTAALFVLNATAINGASVVRVDTQSSFPISKGAALAVDYGRC
                     ERCSSALVSINVPLVVDASSLFRVANCKVVGASNGLLTSAGSITVSDKSAYLIYDSAV
                     ESGALFSFPAGLEDASEAYPFAVSGGSTVSFLNLKGSSTGVAAGQSVPNSLEQSNAIG
                     GGCVISDKELRVASEYRSHGLSVETVVDSQGASSGTCANAKCIPGNTKPGATVSGTEL
                     CTCQCSSTKHHSPFCTSVVDPMQNYDPNVWCTVPDCITCDRLDPSNRCTECDTGYSLT
                     SDYQCKAITTITTTTTTTKAPTCTAPHCSVCAAGSGSICSSCRSPYTLSNGVCVANTN
                     IAAGAHTATLAAAVCVAAALYAL"
     gene            <54197..>55792
                     /locus_tag="LMJF_04_0150"
                     /db_xref="GeneID:3684860"
     mRNA            <54197..>55792
                     /locus_tag="LMJF_04_0150"
                     /product="conserved hypothetical protein in leishmania"
                     /transcript_id="XM_883433.1"
                     /db_xref="GeneID:3684860"
     CDS             54197..55792
                     /locus_tag="LMJF_04_0150"
                     /codon_start=1
                     /product="conserved hypothetical protein in leishmania"
                     /protein_id="XP_888526.1"
                     /db_xref="GeneID:3684860"
                     /db_xref="GOA:Q9N853"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="InterPro:IPR009030"
                     /db_xref="UniProtKB/TrEMBL:Q9N853"
                     /translation="MGPFAPRCCALALLCSVLVLAAVLVRAESFTVTRDVTMSSTSFD
                     DYTMVLDLSSSSADVVTVQLINSQVSGNGLTIKNARGSTPSSARLSMSMAITTVAQSA
                     ITLSGVMPANSDIRIVATTGSLAPAQSLFDFSGLALDSNATVMVENTAVTWPKDSINT
                     GSIVLISAGSNAVGIKNTAALFVLNATAINGASVVRVDTQSSFPISKGAALAVDYGRC
                     ERCSSALVSINVPLVVDASSLFRVANCKVVGASNGLLTSAGSITVSDKSAYLIYDSAV
                     ESGALFSFPAGLEDASEAYPFAVSGGSTVSFLNLKGSSTGVAAGQSVPNSLEQSNAIG
                     GGCVISDKELRVASEYRSHGLSVETVVDSQGASSGTCANAKCIPGNTKPGATVSGTEL
                     CTCQCSSTKHHSPFCTSVVDPMQNYDPNVWCTVPDCITCDRLDPSNRCTECDTGYSLT
                     SDYQCKAITTITTTTTTTKAPTCTAPHCSVCAAGSGSICSSCRSPYTLSNGVCVANTN
                     IAAGAHTATLAAAVCVAAALYAL"
     gene            <56822..>58417
                     /locus_tag="LMJF_04_0160"
                     /db_xref="GeneID:3684861"
     mRNA            <56822..>58417
                     /locus_tag="LMJF_04_0160"
                     /product="conserved hypothetical protein in leishmania"
                     /transcript_id="XM_883434.1"
                     /db_xref="GeneID:3684861"
     CDS             56822..58417
                     /locus_tag="LMJF_04_0160"
                     /codon_start=1
                     /product="conserved hypothetical protein in leishmania"
                     /protein_id="XP_888527.1"
                     /db_xref="GeneID:3684861"
                     /db_xref="GOA:Q9N853"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="InterPro:IPR009030"
                     /db_xref="UniProtKB/TrEMBL:Q9N853"
                     /translation="MGPFAPRCCALALLCSVLVLAAVLVRAESFTVTRDVTMSSTSFD
                     DYTMVLDLSSSSADVVTVQLINSQVSGNGLTIKNARGSTPSSARLSMSMAITTVAQSA
                     ITLSGVMPANSDIRIVATTGSLAPAQSLFDFSGLALDSNATVMVENTAVTWPKDSINT
                     GSIVLISAGSNAVGIKNTAALFVLNATAINGASVVRVDTQSSFPISKGAALAVDYGRC
                     ERCSSALVSINVPLVVDASSLFRVANCKVVGASNGLLTSAGSITVSDKSAYLIYDSAV
                     ESGALFSFPAGLEDASEAYPFAVSGGSTVSFLNLKGSSTGVAAGQSVPNSLEQSNAIG
                     GGCVISDKELRVASEYRSHGLSVETVVDSQGASSGTCANAKCIPGNTKPGATVSGTEL
                     CTCQCSSTKHHSPFCTSVVDPMQNYDPNVWCTVPDCITCDRLDPSNRCTECDTGYSLT
                     SDYQCKAITTITTTTTTTKAPTCTAPHCSVCAAGSGSICSSCRSPYTLSNGVCVANTN
                     IAAGAHTATLAAAVCVAAALYAL"
     gene            <59445..>61040
                     /locus_tag="LMJF_04_0170"
                     /db_xref="GeneID:3684862"
     mRNA            <59445..>61040
                     /locus_tag="LMJF_04_0170"
                     /product="conserved hypothetical protein in leishmania"
                     /transcript_id="XM_883435.1"
                     /db_xref="GeneID:3684862"
     CDS             59445..61040
                     /locus_tag="LMJF_04_0170"
                     /codon_start=1
                     /product="conserved hypothetical protein in leishmania"
                     /protein_id="XP_888528.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684862"
                     /db_xref="GOA:Q9N852"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="InterPro:IPR009030"
                     /db_xref="UniProtKB/TrEMBL:Q9N852"
                     /translation="MGPFAPRCCALALLCSVLVLAAVLVRAESFTVTRDVTMSSTSFD
                     DYTMVLDLSSSSADVVTVQLINSQVSGNGLTIKNARGSTPSSARLSMSMAITTVAQSA
                     ITLSGVMPANSDIRIVATTGSLAPAQSLFDFSGLALDSNATVMVENTAVTWPKDSINT
                     GSIVLISAGSNAVGIKNTAALFVLNATAINGASVVRVDTQSSFPISKGAALAVDYGRC
                     ERCSSALVSINVPLVVDASSLFRVANCKVVGASNGLLTSAGSITVSDKSAYLIYDSAV
                     ESGALFSFPAGLEDASEAYPFAVSGGSTVSFLNLKGSSTGVAAGQSVPNSLEQSNVIG
                     GGCVISDKELRVASEYRSHGLSVETVVDSQGASSGTCANAKCIPGNTKPGATVSGTEL
                     CTCQCSSTKHHSPFCTSVVDPMQNYDPNVWCTVPDCITCDRLDPSNRCTECDTGYSLT
                     SDYQCKAITTITTTTTTTKAPTCTAPHCSVCAAGSGSICSSCRSPYTLSNGVCVANTN
                     IAAGAHTATLAAAVCVAAALYAL"
     gene            <63149..>64663
                     /locus_tag="LMJF_04_0180"
                     /db_xref="GeneID:3684832"
     mRNA            <63149..>64663
                     /locus_tag="LMJF_04_0180"
                     /product="surface antigen-like protein"
                     /transcript_id="XM_883436.1"
                     /db_xref="GeneID:3684832"
     CDS             63149..64663
                     /locus_tag="LMJF_04_0180"
                     /codon_start=1
                     /product="surface antigen-like protein"
                     /protein_id="XP_888529.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684832"
                     /db_xref="GOA:Q9XZX8"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="InterPro:IPR002049"
                     /db_xref="InterPro:IPR006212"
                     /db_xref="InterPro:IPR009030"
                     /db_xref="InterPro:IPR015500"
                     /db_xref="UniProtKB/TrEMBL:Q9XZX8"
                     /translation="MRSRAILIAVLVVACVALSPAAAYTTNQCREVSRCDVDGTFVYA
                     FSGECVCCPEMPTGDILPVQCVPSAAHCPSVPSCRACDTTAGMCDACMTGYVLEPTNI
                     CNECLASMCDVCQSSSEGKRCQLCSIGYYWVSGGECHPVSNSQASESNMQCRVAFCST
                     CASTTASTCAKCNDGYAKDSNGFCVSDCNVQQCDMCYTGNSTDCQLCSAGNTWSATGC
                     SAGASGCRVGHCTSCVAGDNTNCATCEPGYTLTAGYCLPQQLCTDANCASCPSDAGTC
                     TQCANGYGLVDGACVRCQEPNCFSCDSDANKCTQCAPNYYLTPLLTCSPVACNIEHCM
                     QCDPQTPSRCQECVSPYVVDSYDGLCRLSDACSVPNCKKCETGTSRLCAECDTGYSLS
                     ADATSCSSPTTQPCEVEHCNTCVNGDSTRCAYCNTGYYVSDGKCKAMQGCYVSNCAQC
                     MLLDSTKCSTCVKGYLLTSSYSCVSQKVINSAAAPYSLWVAAAVLLTSFAMHLA"
     gene            <65617..>67746
                     /locus_tag="LMJF_04_0190"
                     /db_xref="GeneID:3684833"
     mRNA            <65617..>67746
                     /locus_tag="LMJF_04_0190"
                     /product="surface antigen-like protein"
                     /transcript_id="XM_883437.1"
                     /db_xref="GeneID:3684833"
     CDS             65617..67746
                     /locus_tag="LMJF_04_0190"
                     /codon_start=1
                     /product="surface antigen-like protein"
                     /protein_id="XP_888530.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684833"
                     /db_xref="GOA:Q9XZX9"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="InterPro:IPR006212"
                     /db_xref="InterPro:IPR009030"
                     /db_xref="InterPro:IPR015500"
                     /db_xref="UniProtKB/TrEMBL:Q9XZX9"
                     /translation="MRSSRGGSLAVVAVAVCLAVLAAIGTCVFDSQEIGGSSFTFVGW
                     SSASKEESYQGCTLTGKAFRIQGAASSLSDDATLPGGILRFSSLLVSNGYIVVDKYFP
                     RNTNITIKDASGTVAAGMPFIDANTAIYSDQLSIVVTDSTLSWAAARSGQSMVRAPFT
                     IQLSSSLFVLGSTVTQASSVVEVVGPSSISQKSALAVDYAKCTGCAQGLVHFTDFVRV
                     WDRSLLRVSHSSVKGATGKPLIGIAQSAGASLAVENSLFVVENVSSPTSNLIDAAVRM
                     GTDAQITLRAVTVKSIGATMAGSVTAQLLTADDIAQQIPSISVVPDTRCAAACVPTAT
                     VDSSCKCACNADMPNMNFCTAMKDPYTNYAYLGCSAGCTTCFNETACLECRPSYEMLP
                     DMTCSLTGLQCTDPNCKTCTTYGQCTDCNDGYGLTSSSVCVRCSVAGCKSCPVDANVC
                     KVCLGGSEPINNMCPCTDPNCASCPSDAGTCTQCANGYGLVDGACVRCQEPNCFSCDS
                     DANKCTQCAPNYYLTPLLTCSPVACNIEHCMQCDPQTPSRCQECVSPYVVDSYDGLCR
                     LSDACSVPNCKKCETGTSRLCAECDTGYSLSADATSCSSPTTQPCEVEHCNTCVNGDS
                     TRCAYCNTGYYVSDGKCKAMQGCYVSNCAQCMLLDSTKCSTCVKGYLLTSSYSCVSQK
                     VINSAAAPYSLWVAAAVLLTSFAMHLA"
     gene            <68838..>69386
                     /locus_tag="LMJF_04_0200"
                     /db_xref="GeneID:3684834"
     mRNA            <68838..>69386
                     /locus_tag="LMJF_04_0200"
                     /product="surface antigen-like protein"
                     /transcript_id="XM_883438.1"
                     /db_xref="GeneID:3684834"
     CDS             68838..69386
                     /locus_tag="LMJF_04_0200"
                     /codon_start=1
                     /product="surface antigen-like protein"
                     /protein_id="XP_888531.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684834"
                     /db_xref="GOA:Q9XZY0"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="InterPro:IPR009030"
                     /db_xref="UniProtKB/TrEMBL:Q9XZY0"
                     /translation="MSVKHLLMAAMLVAVACSVAMASDASSWSSSSAPAHGSVSLVTM
                     PTAPSSKSSISSSSATGANETASTTSTTTNTVNTAASSCAVSNCVTCSSTNPNVCTTC
                     NPGYAVDRLGQCMVVGSCNVAHCVTCHANDNARCLSCASGYMPTASFKCVPEQSKNAA
                     LRTSSMVVSVGVALVGTALTMA"
     gene            <71536..>72369
                     /locus_tag="LMJF_04_0210"
                     /db_xref="GeneID:3684835"
     mRNA            <71536..>72369
                     /locus_tag="LMJF_04_0210"
                     /product="surface antigen-like protein"
                     /transcript_id="XM_883439.1"
                     /db_xref="GeneID:3684835"
     CDS             71536..72369
                     /locus_tag="LMJF_04_0210"
                     /codon_start=1
                     /product="surface antigen-like protein"
                     /protein_id="XP_888532.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684835"
                     /db_xref="GOA:Q9XZY1"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="InterPro:IPR009030"
                     /db_xref="InterPro:IPR015500"
                     /db_xref="UniProtKB/TrEMBL:Q9XZY1"
                     /translation="MPAFAFRSNPHKRGAAAVLLLLAIAVVATLTVSAQTIDDYPPVA
                     CDGTVPNCLECRKVGMLSLCSNCKEGYSTAVSPANPTEFGKCKPYDLSTCRLQNCLRC
                     AADDNTKCVQCPVGYPNINTYLCDRTTAAPTTVAPSITTTTTTTTASPTTAAPATTTT
                     AAPTTAAPTTSAPSSDCQAPSCATCAPGNQYTCAVCESGMVLMASGQCMAAGSCSVTN
                     CAQCYPNDNNRCSSCESGYALTVSYTCIPRKSGNAAASPTPLLAALAIVAVAATVACV
                     M"
     gene            <75474..>76538
                     /locus_tag="LMJF_04_0220"
                     /db_xref="GeneID:3684836"
     mRNA            <75474..>76538
                     /locus_tag="LMJF_04_0220"
                     /product="hypothetical protein"
                     /transcript_id="XM_883440.1"
                     /db_xref="GeneID:3684836"
     CDS             75474..76538
                     /locus_tag="LMJF_04_0220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_888533.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684836"
                     /db_xref="UniProtKB/TrEMBL:Q9XZY2"
                     /translation="MTPHAAVLTVATVVAVLLGYGTKGVCGYNFVAITSLFYVPGATG
                     TRSEDAGMCLERGGYLATEATAVLHEADVQALESEGFTTYYAFLGGGIVQPWHMESYE
                     MGFCPFSIKDPDMWWNTSFSQTNGDNNNCYWRWSVGRWIEMPSTSGLPHDEAKTGIIF
                     YRGQSTLGYDRRVNGFPLFFPFKPPMYHPNMQLGHHLVLYRGGQHPTEAVWGDTYARG
                     GFTYGDNFANNPQLVEATLKDWKLVCQTQGPLRLNYEMTNTPSQFQERWWVIFFSILF
                     VLCLITFLALVFCQEREDMDEPPEDAPEWAEKETAQRIVSRRYVSQRSFRRSESSSSG
                     NSLSDRSNFSKDEDGESVSR"
     gene            <77688..>78464
                     /locus_tag="LMJF_04_0230"
                     /db_xref="GeneID:3684837"
     mRNA            <77688..>78464
                     /locus_tag="LMJF_04_0230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883441.1"
                     /db_xref="GeneID:3684837"
     CDS             77688..78464
                     /locus_tag="LMJF_04_0230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888534.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684837"
                     /db_xref="UniProtKB/TrEMBL:Q9U191"
                     /translation="MPTMENVAFAGYAYYSTGGEGFIYALSSKEDVESTGTPVILVNA
                     TSKAANFFPFLFLVVGGILMVGLIAFVMVTFCCRRKVAKLEKMYWELQCTFANVNNAL
                     VQEASRRTASPASLKQKHTPQSTSRLVAGAQLTPQMMQRHGSIARVDSMRQSQHILEP
                     LPPAAAVFPAAPLPYGMNANPLYFQPVTTSAASPYTCSHGDKGAQVTVFAAQPPPILS
                     SPQSQRQTRLSTGPAAPQSPCTTPEPPLRRRASKVSFVGA"
     gene            <79881..>80753
                     /locus_tag="LMJF_04_0240"
                     /db_xref="GeneID:3684867"
     mRNA            <79881..>80753
                     /locus_tag="LMJF_04_0240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883442.1"
                     /db_xref="GeneID:3684867"
     CDS             79881..80753
                     /locus_tag="LMJF_04_0240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888535.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684867"
                     /db_xref="InterPro:IPR004182"
                     /db_xref="UniProtKB/TrEMBL:Q9XZY4"
                     /translation="MQQQPRPVVAQYAYIELLPLRYTGPAPPPAPACMDPTPDEQYRR
                     GVAEKRAALKQKEARRQMSSSGSGMLASLKSAVSQAVMTMEKGAADVSTRTESQVRQL
                     EYQYDCDRFNLHFHELAENGEVLLADYRCSAMHSGLRVNGHVQITPHYLCFLAETTSS
                     IAKTTDAVMGVFVAARHPTSANDEPRNRPVGIKQVIALADIVSIQPSVVLESIGGQAP
                     FFMLLPAPTVRPTALQLYTQDSKLYQFMNFESLVSRATVALNDVVKGTALDQAYNYLD
                     HAWRDTVNLRSKDV"
     gene            <82583..>86992
                     /locus_tag="LMJF_04_0250"
                     /db_xref="GeneID:3684868"
     mRNA            <82583..>86992
                     /locus_tag="LMJF_04_0250"
                     /product="RNA pseudouridylate synthase-like protein"
                     /transcript_id="XM_883443.1"
                     /db_xref="GeneID:3684868"
     CDS             82583..86992
                     /locus_tag="LMJF_04_0250"
                     /codon_start=1
                     /product="RNA pseudouridylate synthase-like protein"
                     /protein_id="XP_888536.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684868"
                     /db_xref="GOA:Q9U190"
                     /db_xref="InterPro:IPR006145"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:Q9U190"
                     /translation="MHGASMRAAWAAAVSRRPSHIACGSSSSPLWALQPRRASSVHCG
                     RVSQATSGTSSSHASSRHGRRPRRGQPNARHIAPAAETRFSASSYRMGCNHIADRVKR
                     RRQLEDAIQAAQAFRKWCAVHAPCTQAAVGASVSATTPLRPGELSPSHAPVLHRVGGS
                     VATLADIGSDEGASSRTTRHHLGFRPPTTPTTNPPLTAGGAVPLTERRMLEHYAVLLH
                     NVRAAAARVATSDYHHFYAAVVEELLMASKSGGGSGAFSVPRSVVWQDAAASTYHGES
                     EDATAQAERRLAAWASYWYKDLKQWYSRHGTHTPGAGNAVDAQQLLPHGELWQDVLDG
                     GEGVVGTREEDKSMAALLLQGQWRAAIDSLLEASAKPPRSASAAAMVPNGSSTTASQQ
                     LSVAELFSAASVRRRHCVPWRHSPHRGSANSSSSTLPPLPRRLALAPVTPAELRLLRH
                     PPSPGLRVLPHSIAAKVQRAGCQERPAGDRVAAAPSLLLEAAVAAEVAGGRATGIPPT
                     CVVRLRRRLWVLQHLPRHLPASLVRFQEPRQPSLRAGGGRGREVRSGAMPHAHLLRSH
                     ALEKLPWYTLCVLGEVLEASGNGDPTVATVLHNARTHMCAALFLSVHADYAALHDYAH
                     TLFLTLGSSMVARAVAARQRQRGRSDGGAAVTVFESAFAQTAIALLQPPPPAAYAAAG
                     LSPRPASSSGNAASFLARSSSARTPSSSTDITDVHVVPPRVFRRLCAAVQDWRNYHLS
                     LYCETLSQIADSDGMALRELARVLAAQPHGEDALQEEVAVVLAPESAAAIVTALLLQL
                     LDQLSRPSASPSSTTTRAPLSFLSNAARTAGPHTSAGCDPQGASPSLPPLPPDLCFCV
                     PHDKAHAVASYFKGIFHPSFFRRVVTAAPRTNGDECQLGDDGAAATSTITATITAGAR
                     TADELNGNASALPSFVLPPAEWERNAAARLVGRTLRRLDRYPTRTTEAFFARYVRGDD
                     VDWKREVGEEGGSEAAAARSASTTVAPPLAMSLFVVNLQAAVNHWRERHRSPILGVPP
                     PASSHAQQQEQVSLPAQPSVNAAGDGRTADTPLAATAAATPTGAEASLTEAGKDGLPD
                     SIVLLASPPMLPHGLHAVYKPAGVNCTLHAHYPSLVYPFLTRELPWKARGAVAADGSD
                     RNRGTSASSSPAPCVPVLRQQGLVNRVDVGTSGVVLVARTADALHGAADAMIREHHMR
                     KTYRALVQRWPPFSSSSSSSASTVRYDDDNAAAAPLFSVSPFLSPMPSAVVCAPVYAA
                     GATASSISRRSALPLSHGRQLQSPGQPSADALAASRAGSTLSWSSSVPVSLSSLEHVH
                     QQYATLHAALQDQRNAITRYRVLEYFASAGVAYVQVELCSGRRHQIRQHFAQLGFPLV
                     GDARYHAGVVAGHAGTTLGMRRAALHAYTVDILATTDGDDLASSEEVPDRVVVQAALP
                     ADMHRALLALRQAEQAKPGQQQQQRRQPQQPRG"
     gene            <87664..>88470
                     /locus_tag="LMJF_04_0260"
                     /db_xref="GeneID:3684869"
     mRNA            <87664..>88470
                     /locus_tag="LMJF_04_0260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883444.1"
                     /db_xref="GeneID:3684869"
     CDS             87664..88470
                     /locus_tag="LMJF_04_0260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888537.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684869"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR023566"
                     /db_xref="UniProtKB/TrEMBL:Q9XZY6"
                     /translation="MALLSPASSASAPPSSRDKASYCLQQAQAAKAAGNAALQAGNPR
                     GASFEYKKVYLYLAEYLPSDVAQSASPVALGCGNGGGSDAGGNSGLVQMLQQQQRRKE
                     PKNVAAAAVTDRESSALPSTTEEAARLKLQEEMTQLYATTLNNLALAHMKLGRYQEGV
                     KCATAVLEQPALRAALDAGAEQCTSARFSDTSAGKALLRRAACYVKLSDWALAEADIC
                     TLRRATLEGAHAASGGDALDAAVVQLTQAVEQGRKAEAAKEKKMMRLMFA"
     gene            <89112..>90554
                     /locus_tag="LMJF_04_0270"
                     /db_xref="GeneID:3684870"
     mRNA            <89112..>90554
                     /locus_tag="LMJF_04_0270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883445.1"
                     /db_xref="GeneID:3684870"
     CDS             89112..90554
                     /locus_tag="LMJF_04_0270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888538.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684870"
                     /db_xref="GOA:Q9XZY7"
                     /db_xref="InterPro:IPR010729"
                     /db_xref="UniProtKB/TrEMBL:Q9XZY7"
                     /translation="MRCSARRANVAALYEFVDGNFLNNKRPAIPGGAWPLESLRRKSL
                     ADLQQIWLSLLKERNMLSTIKEHYLRHQEELGAMPAPSRLKMVEESMENVKRVVKERD
                     AEATAEAVRIFKERLAKGIYRYPPGPPPPPGAHDPTSTVKLVLSRRVDEERLRELLGR
                     FNVFEAHKGIVKLTMQLPEDVLTQKRDAEQLWQQYMAERRNVEEYYKWPGSSTGSAES
                     ASVYDHTVVELAPGVYSGHRGTSAIESNCVDDSNDGAHGVVQAARLPVPPPKTRPPPP
                     RNPLEHIKYQQRSVLSKAVIQLGYFPNITTTAPRFTKADDVPRPVHPDEIEGPWEVRV
                     TYDAKDGLAYVQSLSLTSIDGAAVLSVEEEFPAAAQPYAAVDPVYQEAVRREMAQEET
                     LMKWPNVPKWKYQYDLYTKKHLAQVVQYNYSNVVDYVDREVLLTGRSVWESPIDIDPT
                     CGGMKSVPAHAKKPKRYMTHGLAEVGVTDI"
     gene            <90977..>97258
                     /locus_tag="LMJF_04_0280"
                     /db_xref="GeneID:3684871"
     mRNA            <90977..>97258
                     /locus_tag="LMJF_04_0280"
                     /product="putative adenosine monophosphate deaminase"
                     /transcript_id="XM_883447.1"
                     /db_xref="GeneID:3684871"
     CDS             90977..97258
                     /locus_tag="LMJF_04_0280"
                     /EC_number="3.5.4.6"
                     /codon_start=1
                     /product="putative adenosine monophosphate deaminase"
                     /protein_id="XP_888540.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684871"
                     /db_xref="GOA:Q9XZY8"
                     /db_xref="InterPro:IPR001365"
                     /db_xref="InterPro:IPR006329"
                     /db_xref="UniProtKB/TrEMBL:Q9XZY8"
                     /translation="MRAHVFRIARTKMGISRRAGGDPVAHLRAPSSRQRRGAAWGWGV
                     ALCALGAATSPHIKLHGDLTPSSLLSYSNTYVWRMAGWLPRGGGGPVVDGNTLEHTQC
                     ARERSRGYPSSLFLVVVFGTMSVHATEEAISLPSTSGHAGRQHSTSIVCAEDRADNSS
                     GGGNSAAAFRSGSCVGATASAGGVAAGGPLTSWRRSLAPSNAANASSGGCAPITTVHT
                     NSGVGSGASTQSRLRPSPLQHCRASSVMWGRLVGARGGTAAAGSNNNASAVTNVYTLQ
                     LPGDDGGIEMAAAQPLLLGALRMRETYKGVDKGHYEVGVGSTGSGASNSLTSAVTMAA
                     DASRTTHPMQGVPHPPQPASQSQHLQTQQQQQQVPSPSLMTGPTTLQQVDGVFHWSDE
                     KTPIASWAQFRADVLALAACVQDPSCVAASKCRLEVLEEKYHLHRLYNADVEENSDRY
                     RRGGGLFANACRVDTCVGATTAMNAQVLVEYIQRTVDERGDDIVGVSDSAPLGSGLAT
                     AGAGGGGVVGAPGGEQLTLARVCELLDFPEPYLLTVEGLGLQPSVNRALPYYDALDPS
                     MNSGGRNSAALLRLFLSLGQRPQWGAYLAGVVLPCLRRNELRTGDVQATEMTLEITGA
                     LTHEWENTAAWVRTHELDSFCSNQFQLAFPVTKWCSRGGSVGSGAFSFFDMHVGRAYS
                     GEACDDRSITANNMHGVGRGPSDSLTDRNAASAAALPPGASPDEAVNYDNYQQLLDHI
                     FLPLFMATLAPEDPKYVDLATLLQHTGAILLTGNENADVMGSTAAGGGGHGCASGSRA
                     DGGAAAGNAAALHVDAMSSDWRRRPADTPYTEPVSLTYLCYYIWANLCSLNALRRRRG
                     QNVLQLRVVASSATMPNTSSAHDASLLLLSYLIADVVVDAVALDRQPVLQYLYGLHQI
                     GVAMCPIARSSLGTTSLDEHPVARLLWRGLCVSLCTLNPLYYHSSPEPLLEEYTAAAK
                     VHRLSPTDISEMALHSVCMSSFEDEVKASWVGAGLLRDGWRANAVELTSVPTARLQLR
                     YESWKAERKLLLLPSGSPAGFPIGAAGSVAEIGSPLDDTQSMVRRDMATAARRFTTTL
                     SPHRNASSALAPDGQAGMGSTGGAAAALQSQAPYAVLDPAVDFPRVTLIGPFDRDIQN
                     AHLVQALHRALDLRHQYCSLPLPPDPSSSAAAVASDSVSNSDVKASWLAALTRDPHAV
                     LPHPTQSMSWAFKSAVPSLSPHNKMSGGHATGATGASSMVHGASSYLQFDEDEWKYKT
                     VEGIIVPHEVHQIPRLPQDMYHYTEFCNHVEEIRCLIDNIRVRDFALRRLQLLEHRFK
                     LHAAVNHSRELGSTAARASHNRDFYQSTKVDNNIRMETGMTARQLLAFIVDKATHNGD
                     DIVSHPKGKEPQTLRQLLADLHITADSLTVDDLNVQAGATSSNGGAPQNPFASEGQQQ
                     DELLTLLLKTDNQMNGRYFAELTKRTFEELSRDQHTFSESRLSVYGASAEEWALLSHW
                     FDTHGMSSSHNQWVVQVPRIYSSLRKAGRVASFAEYLEHVFEPLWRISLHPNSDPRLF
                     HFINHIAAFDCVEDERRPDVPLHLAMRSPHEWTTEDEPPYNYYLYHLYANLRSLNCFR
                     QRRRFSVFSFRPSCGEAGGVDHLIGGFLLAQSVNYGVRLADSAPLQYLFYLAQIGVTL
                     SPLSNNTKLQLNYLHNPFPQFFRRGLRVSLGTDSPLLYHHTQEPLLEEYSIASKIWKL
                     SPNDLSEVARNSVLLSNFSLRFKEEKLGAMHFLSSSAGNDVAKTHLSDVRVAYRFEAY
                     HTEVGFLEYISGLHFHRALLTLEIEAQCMQLYGVNTNDSSGSTGGGVVGIIDKTPKEA
                     DLVQLEAQRTCMQRQLWELTSAVSELHRQNRLLTTKLAEEKERDQLAAQLRRQRVDAK
                     LRELQNLVTQKEVRPHTRATTEHHQPQDTPDDDKGDVDADGSGVPSVPHPLTPSAASV
                     SPPPLSSGSLRAGVAAASVPPAAAASAATPGAQPPPSPPALHAPADSASSTLRKHQQQ
                     QQGDAVAQTRRLLAHTESLWRTSPVQADGLHWADGGRGKQPPPQLPPLETATSSSSQL
                     SVSPASLRKRWSPSPLVDD"
     gene            <98734..>100077
                     /locus_tag="LMJF_04_0290"
                     /db_xref="GeneID:3684872"
     mRNA            <98734..>100077
                     /locus_tag="LMJF_04_0290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883449.1"
                     /db_xref="GeneID:3684872"
     CDS             98734..100077
                     /locus_tag="LMJF_04_0290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888542.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684872"
                     /db_xref="GOA:Q9XZY9"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q9XZY9"
                     /translation="MRSSRHLCGLPTVRTVAATGWRYHRHGAPEKVLQYERYRVPFDR
                     TSGQVVVKMLAAPVHRHDKNLIEGHGGPIAVPKACLPHVAGVEGVGVVEEVGSNAKLA
                     LKEGDMVWINNPSVGSWATHIVTDAENLDVVPCRADVDIEYLASLSLFHTAYHLTHDF
                     VNIQPNDVVLQTGASSSIAQICQGYLRAKGAKLFQTMQLGRTEHAHLLAFFKLRGAFA
                     VVPYNYARTNYMRRLLSDVPPPKLLLNHTCGGYASNLVNLLGDNGVCVTYGNTSHQPM
                     QISNMDAIARGVQFKGFFLPSWIRRHTREARMRVHQNVVESMTITQGHGIFRAQRFKM
                     DGDSAFAFSNAWDAPLASRKAVLRIVGEYGEWRRPRSDQAGWNIGRAVWEDMLQQMWE
                     SAGTTENPQSMKYYTPFDDIHSSFYDAKQSKELGHRDVFFRRPNAPRHNAAEQQQ"
     gene            <101699..>102457
                     /locus_tag="LMJF_04_0300"
                     /db_xref="GeneID:3684874"
     mRNA            <101699..>102457
                     /locus_tag="LMJF_04_0300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883451.1"
                     /db_xref="GeneID:3684874"
     CDS             101699..102457
                     /locus_tag="LMJF_04_0300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888544.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684874"
                     /db_xref="UniProtKB/TrEMBL:Q9BLQ5"
                     /translation="MAYRHQATDQFHRFLHNPHVVQPDGVDGLPRVKGDQQQWLNTEQ
                     WHGYSDTYLQRHMQYPATVELNNPAVNARHDLLYECLGLVYELYGGLAEDLQELHDDP
                     LHPHFHRRIARIKRDRERIATELDKRYAKLHPTVKTVYDAFLVRRYYHLADWIEHVER
                     KRERLINDLSPDVMEKTMRMRGIAEQYLRHLRALEHALYEDPLMGLLGGDRGTNVLDQ
                     YTPGELAMLRQKAAYFRNMRRFGANQLDADMHTH"
     gene            <103123..>105045
                     /locus_tag="LMJF_04_0310"
                     /db_xref="GeneID:3684873"
     mRNA            <103123..>105045
                     /locus_tag="LMJF_04_0310"
                     /product="putative beta-fructofuranosidase"
                     /transcript_id="XM_883452.1"
                     /db_xref="GeneID:3684873"
     CDS             103123..105045
                     /locus_tag="LMJF_04_0310"
                     /EC_number="3.2.1.26"
                     /codon_start=1
                     /product="putative beta-fructofuranosidase"
                     /protein_id="XP_888545.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684873"
                     /db_xref="GOA:Q9XTP3"
                     /db_xref="InterPro:IPR001362"
                     /db_xref="InterPro:IPR013148"
                     /db_xref="InterPro:IPR013189"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR018053"
                     /db_xref="InterPro:IPR023296"
                     /db_xref="UniProtKB/TrEMBL:Q9XTP3"
                     /translation="MIPGSVRCGVILFLVAVAMMAAAAMKDGVPYEPIYHIRPPKNWI
                     NDPNGPYRDPVTGKIHLYMQYNPNGPLWGDIAWYHVTSQDYVKWTRPESPVAVWADRW
                     YDKWGAYSGTMMNNNYSEPVMMYTCTEPENIQRQCIANPPKSDLQGKRTLNTLVKSAL
                     NVIMSEDMIPGVVAMENFRDPTEWWQDPTNPNRWLIAFVARIKDREGDNAHVIVFSTE
                     DPSFQSGYSFSHSLYVYKYDLDHMFECPDFFTLKQGGEHYLKVSTMPSHRDYIIYGSY
                     QLNTTSSQYVFVEDPARSFTFIDYGPFYASKTFYDPILNRRAIWGWTNDELTNEQIIA
                     NGWSGVQNMLRTMVYDHTEKKIKTQPVPETKGLRLDKLVDLRGVAVTATPTQVIASNT
                     NNTLYHEIVARFTLADPTTFAAAATYPSDSDVPEVGVMIRANANLSQYTTVSVRMPGG
                     GPSALQSTEQIETYPPIKIFAGSSAANCSAECDKMRLCESYTFWGKNNTCKLYWKTNP
                     MKSKDDATSGTVREPLLYLGRTQSGTIGSTAPLHGRAPFATATPNGFELHIFVDDSVL
                     EIFKDEGLETLTGRLYIDNGADTTGIAVYARNAGTVTVDVEVYTMDTIWKAPTPNAAK
                     NFTDALYNLLDTLIAV"
     gene            <106566..>108026
                     /locus_tag="LMJF_04_0320"
                     /db_xref="GeneID:3684847"
     mRNA            <106566..>108026
                     /locus_tag="LMJF_04_0320"
                     /product="putative beta-fructofuranosidase"
                     /transcript_id="XM_883454.1"
                     /db_xref="GeneID:3684847"
     CDS             106566..108026
                     /locus_tag="LMJF_04_0320"
                     /EC_number="3.2.1.26"
                     /codon_start=1
                     /product="putative beta-fructofuranosidase"
                     /protein_id="XP_888547.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684847"
                     /db_xref="GOA:Q9XZX0"
                     /db_xref="InterPro:IPR001362"
                     /db_xref="InterPro:IPR003014"
                     /db_xref="InterPro:IPR013148"
                     /db_xref="InterPro:IPR013189"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR023296"
                     /db_xref="UniProtKB/TrEMBL:Q9XZX0"
                     /translation="MTHANPPANRPPRRPLPFSPTPAQTHPSERIHLTRRHDRSLIAF
                     VARIKDREGDNAHVIVFSTEDPSFQSGYSFSHSLYVYKYDLDHMFECPDFFTLKQGGE
                     HYLKVSTMPSHRDYIIYGSYQLNTTSSQYVFVEDPARSFTFIDYGPFYASKTFYDPIL
                     NRRAIWGWTNDELTNEQIIANGWSGVQNMLRTMVYDHTEKKIKTQPVPETKGLRLDKL
                     VDLRGVAVTATPTQVIASNTNNTLYHEIVARFTLADPTTFAAAATYPSDSDVPEVGVM
                     IRANANLSQYTTVSVRMPGGGPSALQSTEQIETYPPIKIFAGSSAANCSAECDKMRLC
                     ESYTFWGKNNTCKLYWKTNPMKSKDDATSGTVREPLLYLGRTQSGTIGSTAPLHGRAP
                     FATATPNGFELHIFVDDSVLEIFKDEGLETLTGRLYIDNGADTTGIAVYARNAGTVTV
                     DVEVYTMDTIWKAPTPNAAKNFTDALYNLLDTLIAV"
     gene            <109167..>111740
                     /locus_tag="LMJF_04_0330"
                     /db_xref="GeneID:3684848"
     mRNA            <109167..>111740
                     /locus_tag="LMJF_04_0330"
                     /product="putative mitochondrial exoribonuclease DSS-1"
                     /transcript_id="XM_883456.1"
                     /db_xref="GeneID:3684848"
     CDS             109167..111740
                     /locus_tag="LMJF_04_0330"
                     /EC_number="3.1.13.1"
                     /codon_start=1
                     /product="putative mitochondrial exoribonuclease DSS-1"
                     /protein_id="XP_888549.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684848"
                     /db_xref="GOA:Q9XZX1"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:Q9XZX1"
                     /translation="MRRRLFTLVRVRGTAAVATPTVGVVAARQRRGAASAVTSTTLGS
                     PSKSSHHTTSSTAPRTIIANAAAQFSGTYLDVAWTRQFILGSLLQRYDPLRYAPSSPS
                     SPSSPSSITARLVESALLESQRLLSSTWKLPVRPLDTVSEARILRLLARYAAGEGILS
                     DTTLEMLQRVLARLPGAPACISDPLHMRALLELIGYVEPGDNLNRVAYAGELHYPPQA
                     HAFMAELLAEGRQRDGGDAFDAIRERRAGPGYAIDSATTSEVDDAIGVCVDGATGAKY
                     FVVYVSDATVYCPFDSTLEQLTARRLTTTTYLPEGVFFMLPKPIVEAATLREDRPCRT
                     FNVIFQIDESTGEVKNYSVAVGWLDQLRRITYDQVQEIVNKEEGKEEGDEHDSAAVVA
                     AAHDTDASSSPPLLAGCADSAHPPPAWMTREDKDNLFYILRCARLRLRARLERQQRQQ
                     QQHHHGAGGKDCGDEGVPATPPVDFSLPDPLIEVKGTKVLSVTDQVISTQDARLAVAE
                     LMIAANEVCSRVAQANHIAMPFRGTRTLSSDHLVAHYYTEPEGVRTLMSLDASHIFLA
                     EAMQSSVRRLSTVTRAIYHHVPLHHAGLDTTFYTHSTSPLRRYADMLVHHQLKTWLWQ
                     QRRGGGSSDHTSATSTSAARAAMVAAPQQLIPEHAMASLCTMISAKQERASLLQDNST
                     RFWILRYLEDLERASANAAAAARGDGDGDTHRKKTYLCLVGETRRVVAAPAYSRFACS
                     SAEMSQLLSLPLTAPSTTSSTVRRPASLQMDAVARWRQETPEFTYVSDVYIPEVQLAH
                     TITHHRDDVLVGAVLECHITRVQPTQGVLELAIERVLPGGDERHYERLWMGGFVSQLD
                     A"
     gene            <112359..>112913
                     /locus_tag="LMJF_04_0340"
                     /db_xref="GeneID:3684849"
     mRNA            <112359..>112913
                     /locus_tag="LMJF_04_0340"
                     /product="putative ADP-ribosylation factor"
                     /transcript_id="XM_883458.1"
                     /db_xref="GeneID:3684849"
     CDS             112359..112913
                     /locus_tag="LMJF_04_0340"
                     /codon_start=1
                     /product="putative ADP-ribosylation factor"
                     /protein_id="XP_888551.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684849"
                     /db_xref="GOA:Q9XZX2"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q9XZX2"
                     /translation="MGQLFTSLWSMFNGNKSYKLLILGLNNAGKTSILYYLQLGHSIA
                     TQPTLGGNTETLAITHPQTNNTITFTCWDLGGQEQLRESWKLYYDHTDAVLFVVDAAD
                     AVKFPKAKEVLHQLLHDEPSLQHATLLVLANKQDMESAAAPAELIEYLELGKLKDRTW
                     TLMGCSSSTGESLREAMNWIAENV"
     gene            114816..121292
                     /locus_tag="LMJF_04_0350"
                     /pseudo
                     /db_xref="GeneID:33145914"
     misc_feature    114816..121292
                     /locus_tag="LMJF_04_0350"
                     /pseudo
                     /db_xref="GeneID:33145914"
     gene            <122235..>123041
                     /locus_tag="LMJF_04_0370"
                     /db_xref="GeneID:3684852"
     mRNA            <122235..>123041
                     /locus_tag="LMJF_04_0370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883464.1"
                     /db_xref="GeneID:3684852"
     CDS             122235..123041
                     /locus_tag="LMJF_04_0370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888557.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684852"
                     /db_xref="UniProtKB/TrEMBL:Q9XZX5"
                     /translation="MTVRRMFCFLLPPPSHHRLSRSSLAHAHLPHIRMSAHFAQCRST
                     HVHTYTHTHVHTHDTLARAACRLCTSSPPVRAREMALLAPKALHKRVKGTNVEVRKEV
                     TDDNTDAQLALLYSIHADDETELRWLHNTLRPERNLVHPSDAFLHGIKALHPAAVFNT
                     FDVKKAKLRRLTKYEKDKETAMKRRKKEVAPTAAYKAAVNPHKTPRTGGAAPADEVRV
                     LSRGMNKAQKARSRTRTAHKSGKVVNGAEAPKGFFTKWKKRKLEKIGRGL"
     gene            <124169..>125230
                     /locus_tag="LMJF_04_0380"
                     /db_xref="GeneID:3684853"
     mRNA            <124169..>125230
                     /locus_tag="LMJF_04_0380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883466.1"
                     /db_xref="GeneID:3684853"
     CDS             124169..125230
                     /locus_tag="LMJF_04_0380"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888559.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684853"
                     /db_xref="InterPro:IPR008775"
                     /db_xref="UniProtKB/TrEMBL:Q9XZX7"
                     /translation="MRRALHAAALPSRAPLTPQRYKSYVLKFLRGQLPHDLKDCAGAL
                     GCLYGTLPDVDEYRQFVVPLQVLQQYHQLGYAKLPRPVLDPPQVDILADEVNQLANNV
                     EHHPKSEHLYATSLADLTGGPLFYCQGQWRCAWGMHDLVYLPTLTVAASQALGNRLVR
                     LWYDEAFMKEARTGPCVPWQQNYVRWQHTTPVNHVSIMIALDTLNKDRGAPCLIPGSH
                     RWREGQLLPPVPYDPTQSETQQLNTIWDITNDDEQEMLADTPPATVDLRRGEALLIHP
                     KTLFATHGNRSLDAARCCCVHYMGEATCAVQDGPLLPHTTRFRAGTRVSGPFFPVVFD
                     PAMTEDLLMLDNKEGGAAA"
     gene            complement(<134260..>134994)
                     /locus_tag="LMJF_04_0390"
                     /db_xref="GeneID:3684854"
     mRNA            complement(<134260..>134994)
                     /locus_tag="LMJF_04_0390"
                     /product="hypothetical protein"
                     /transcript_id="XM_883468.1"
                     /db_xref="GeneID:3684854"
     CDS             complement(134260..134994)
                     /locus_tag="LMJF_04_0390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_888561.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684854"
                     /db_xref="InterPro:IPR016187"
                     /db_xref="UniProtKB/TrEMBL:Q9XZX6"
                     /translation="MTVLLALAICLAASTACAEMLLAPSDSKIPFTTFGQLQQVCAAT
                     QAGSTPVAMYTATMTALVADLMSDKKVTHAYVSAYLNADRRWTWFVYEGGEVIETLMN
                     SSQWAPGNPTGAHTTYRHAAYSTTDKGLISATGYDNYPVVCKYENQTDYSPPGKKFPW
                     WSILIIAAVVVVVVTVAVCCLCCKRKQFDDAGDEDSELTTHSGSFRSYSTSHTDSNKS
                     DSSSLLTSRRSSSSGSESRSDGSSSS"
     gene            complement(<138204..>139226)
                     /locus_tag="LMJF_04_0400"
                     /db_xref="GeneID:3684855"
     mRNA            complement(<138204..>139226)
                     /locus_tag="LMJF_04_0400"
                     /product="anaphase promoting complex, subunit 10-like
                     protein"
                     /transcript_id="XM_883470.1"
                     /db_xref="GeneID:3684855"
     CDS             complement(138204..139226)
                     /locus_tag="LMJF_04_0400"
                     /codon_start=1
                     /product="anaphase promoting complex, subunit 10-like
                     protein"
                     /protein_id="XP_888563.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684855"
                     /db_xref="InterPro:IPR004939"
                     /db_xref="InterPro:IPR008979"
                     /db_xref="UniProtKB/TrEMBL:Q9U198"
                     /translation="MEYDDGEYGRESSVEALAQSQESEQVASAASGLPESSSSAGSAK
                     PSFRILSTRQLAQWARVRHQMDVGCSGNTVWTVSSAKHGNGVLHLMRHHDLNNFWQSD
                     GVLPHVIRIQLGQLTPVEAMAVYVNSAVDQSYSPRVIRVKAGTHNGDMTEVAKADIGA
                     GQECGWVLITLREMAGDDGDDVEGGGPNDGGGGVAAGVRIQHQQQEVRPRQQDGGAPE
                     GGAASSYSPPIPYSEVAAALGHGNHATPSSAGVQTSAAMPRIPRSTSNPADRWLWCTL
                     IDIYICENQFNGRDCHLRGIRLMGPRYEELERVSNADATGTVTCARPLQGGEPLEGTA
                     DELQLR"
     gene            complement(<140672..>144049)
                     /locus_tag="LMJF_04_0410"
                     /db_xref="GeneID:3684823"
     mRNA            complement(<140672..>144049)
                     /locus_tag="LMJF_04_0410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883472.1"
                     /db_xref="GeneID:3684823"
     CDS             complement(140672..144049)
                     /locus_tag="LMJF_04_0410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888565.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684823"
                     /db_xref="UniProtKB/TrEMBL:Q9NFA7"
                     /translation="MRGGARHAAAVTAALPCSQSASHSMVSSPHSATVTTSGGVFGGN
                     SPATASPSSGCRQQRLSRGSLSEACPSPTPSVSYTSQQQQQRSQRQMKKGRHHHRVGG
                     GRREAQRRRLPASSASDAAMSKPKVPPPSFPGRRSSSSGSSGGDDIAAGMCTVEDIVK
                     SAVDPQAQFTMSSNASHTTTITTDDDDGNEPDSSCSPLPRQQQQQQRPPDQSRRTKGN
                     RDSKPRIARGWANTRRWENLPQKQRKQRRHLQSRQDRHRIAAKSSEASVEAGATAHNV
                     ANEEDAVAGNMQGSAAAPEEEEVTVSCKPRNGRGFASPPATTAGAAAEETLENEELLP
                     AAATRQVPGRSAKNAMATPSRRPAVTEGGGRSRHRRRLSPAHPVASSPAVSRDSSIND
                     AVGDAAVDEETQPLPRLSHAGHDGKTAVPAGGPRRPLRAGNKESRRQKQMSTAVPQPQ
                     SGPGVATGMAPVTAVAAFSTRPPPLLCVPQDPIIVARQVCHTTHTVVAESALPDPPPT
                     VMRLAAFSSAKGSITDPCVVAAVLPMAAGAAAHAVGPAVPHGGRVKGTAAPSTAGPPT
                     VVSSRSMPPPPSEEDQQLSRRGLRFGAAPFYPAATVSLILAMAPDADSNGGDASLPSL
                     AAAVPSPQSLLGSYSMSPARSPPLVHQTSSPLGDSRQNHSRSSTGGPMSRQSTFVAEL
                     AAATDTPWTSTVIAPSHASPPSSIGRDDTDGDGPSSGTPSVPVKSPAHGAATAASYSS
                     NTEMQNVVGDRPSMRRSALMVTNTATGACVSPATVTTPSGSPTALWSGSGGNGPPMRT
                     SGHTSGASSITAPAATTSPGGAGHHSATHSGSTPQGVVVREFPQAPYPVVNRTTELHQ
                     SQQQHSMRSPRLMSESDLDCVQHNRVPVSDVVAKDEGTLVDTLFADVNMIEDDESEVD
                     GDDLLSSRGGGERWTMQPAPSPVASSNGSPLVASSPVVRTPHSMNQQLQHRSGSFSAG
                     VRMLGKEAGGQVFGGGYWYPSGLWASTDATGRGSGSGGTGTGSYRGGGGDVKTTLAAA
                     VTASIGSGSGAAAWRGLSTPPHRHRGFSASCASVASTMSLIDPKQPQAEGAAYDMMGE
                     DDEWEMNSSAYADSLDEAQIQWIEEQLRATENPAGYF"
     gene            complement(<146305..>147390)
                     /locus_tag="LMJF_04_0420"
                     /db_xref="GeneID:3684822"
     mRNA            complement(<146305..>147390)
                     /locus_tag="LMJF_04_0420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883475.1"
                     /db_xref="GeneID:3684822"
     CDS             complement(146305..147390)
                     /locus_tag="LMJF_04_0420"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888568.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684822"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:O97220"
                     /translation="MAEAQARKRTESLSKMYSKTPISEGYALWDREYLLAAMRVFTFK
                     AEGAPPFVLAPYLDSVAEITLQMHDLEDAAEQFAIAAGKYQLIDQKVLADLMRFKVTE
                     VSSSAEIALEQVQAYLAAQDPQANGSGENSTVQTKSAFARVYAYLADLLLRSVDEEQA
                     SEAVLAQALTAAELAVQLGWDRDHCGWLLVGDVHAASGNYEKAKEAYGKALQRCPHYA
                     KALERQIGVVQQLVRAADECGDDAGKATLNTELLTLLSRSIEVHPLANTFREKAFLLS
                     EMHGDDAALAFVAETLEHPPQEEIEVIGSSAKEMTSTLLKAKAAILADGNQLDAALEA
                     ATKALEVDPNDEEAKSIIRDLHESMAA"
     gene            complement(<148744..>161118)
                     /locus_tag="LMJF_04_0430"
                     /db_xref="GeneID:3684821"
     mRNA            complement(<148744..>161118)
                     /locus_tag="LMJF_04_0430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883477.1"
                     /db_xref="GeneID:3684821"
     CDS             complement(148744..161118)
                     /locus_tag="LMJF_04_0430"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888570.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684821"
                     /db_xref="GOA:O97218"
                     /db_xref="InterPro:IPR001304"
                     /db_xref="InterPro:IPR016186"
                     /db_xref="InterPro:IPR016187"
                     /db_xref="UniProtKB/TrEMBL:O97218"
                     /translation="MGQARSAAARHTPAFGSFTRPRAGVPPSPSTSRALARWTVFTVA
                     LLVVVAALSPGVFEPARADDGFRAVTVASCPYGWSLYSPPMPINTTDSAAEAHLCARV
                     FIRTPVPDSAAESLCTSLFSSGSDAPLSRDGVTPWPYATYASPHGVAVHSAAENAFFR
                     SLFSDAYNAGAEDDGVVVLGGAAGYGVVHWYADASSSGGNALHQRQKMRTRAELQEIR
                     SPSWLNSSRAAHTRGGLPQQLAQTTAVEAASAAAASTGSAAYTNFAADVDWQRHSGLI
                     AMRASGQWTLLTSAASAHAFACAFKADFTVIPPATSPTSRGSGNARGTSSSSGNSDSN
                     SEGESNSGFPQRGGSHAKRPAAPQPAPPCLSGWTALPASVDTSDGAANTVCYRLFANA
                     SEVGGRLGKNFEGAREHCAAVNPKGSLASIMSQQENTWVVSTLLSAMAAPPTPCTCDG
                     SSMAEAPAHAASVVAMNGVTHSARTVFLGGSFMHDSSGAGLIGSWYADQYLFNASEYA
                     AASPSSPAWPTSTNLYYSNWSEGEPALSYGVVGITPPPPTECDCGNASTSSTSPVSAA
                     GMWVGLDPRSTQPFLCSYLNDGSVFPSVPPTPMPNPSSTTSPTPSPSEHCLSGWSHLA
                     LTNSCYRVFPSASTETEGGSAVTAATMEEHCEQVLRGQVVVSKIGRVRAVAMQSIAES
                     DYVGSLLSLYLKDTRNTVVVPEGGSSGSIDSTSSPLPVSLAGVSFIDHGAGGFYLSGV
                     RELDPLLADRLWAAGEPANVKGCVAVDAGGLWYYIPCSSSSASMPANEAVRVLAYTCQ
                     YRASDIDPKQDLIPEATTQPPIPTSNPDWSSDSDSSSPWLPLGQRVQALSGAVHVVAA
                     AGSTGIYALQGPNATIPPVASVHGLHFFFAPLSAYYTYPAPRRAVDGTVIVPPVQTTP
                     GMSVDDLLSIAITGESSPVAPCAGHKEQSRIARVRANVITVQHTNHSEVGYVCVSQDG
                     RNYVPTAITYEVTEVTVDGFINTPSRSPAANSTAAWLPPLFCGTAIEVATTTPSAAAS
                     ACALQRDVAIAEHATGTVQLVLRRSGGASAAGTVTTVLSPEVDTVVSHVRLSSSADCM
                     GEQVPFQLLDSEIEVRHVSSERYTQSSSPLRAASGRVRGNASLQYSVFSYQHASVHAA
                     RLASLDPVYNSSEVSSVLAQFQHPAEYYVCVSVHKPPSTLTSDVAEIGAASRRLLALW
                     GASVNPGISSSSSSSSGASTTFSLSIAERLAARTSVSPAGAAVRTYTAVPGLKAHLVP
                     PPVSIKGMWALPPRRLRQQRAWSAGASGSTTAAGAPWATLVPAAATHNRSAHYLLRTQ
                     HPFDSTDPMSASSSSTALPSTVHLHIPQHSSPIILLDGHHAERGMLALLSQKPNDCNR
                     HQPLPLDDPTRAAATWPRHLDTMVPLSTVTMTVEGSGTAAATATVAYMQLNLNHTGLW
                     GHHPTRTDDPAATQQTWYVCISYGALSPFLPVRQPALRITVHRQRVDRFLIDSSVSFT
                     RSEAVAAAEAADASTTHLNVNAGFAGMLWLHGLDVRLWSTTTLHSAQVAFSVVLPSSG
                     TADDTAAQCANANLFYAQRALGLLTPESCQHTRAAGVNSSADDDAACEDSEAVRAGMV
                     VPLGFFTQHSLRRMQLCLSVPLPFATNTTGGSSELVPQRRFFAPLVNTTLDVRPIQLL
                     YMGRYSSIPASAAAVPPNPAAPPSTGATLIRLAEGARDVVLPLTGYGIRPDMTMFLSS
                     QLCHGVPISSIGRHDNLVKEQSALNISVVSLYDLPSSYWAPMGADNDAQGDGGSESGS
                     THQPRVFVVLKHSDLLSSSAAQRLFGASTAAADGARKPLNVCLYAPGTATLVFPTNFQ
                     LVVEPPRVTAIRNLPSDAPLLARATAHMPPYNNNSSSSSSSSPLPPSSVATVVYAGIM
                     DLIVEGFGLEGTNTWLTPAVDCGNASSHLWRTPVQLSALPSSTTTTMRIAVENGSVTS
                     PLYAESTRYVDPQTSFSSWFISLRQAETARVGADANISSGTYVDRFQWCVRIGEANED
                     EAVSPYVSTGLPYRLVIPATDGFVLEDSPKHQNHITTVLPLPMQHATGGRWFAMKLAG
                     PIVDVVQAIGSPLYMFLAPKDLPCYALKNSYIHQGLHSFGSASFSAVNGSAVLLPRWL
                     TVPGIYQLCASTLYPTLDSADEGIEAALQFFSLHGLQVQLTNAVYSVSALNHTTSVTV
                     EQGQEWALPISGSLLTNRSLVRFHASASQCSQPMVATTSSGGAELPDIRVQDAFTGFS
                     LFGDEDDNRDSEDSFPASVHYIVLPQSLIRSLAAPATYVLCFQPQNHLDWRVAPAISL
                     IVKTHVRRPTAYSYFPADGSEDVVLLTALPPSKVALEWNTGEENMVNVVGTAGRQVSL
                     ALWCLPAPTRSNNSGVGVEEDLVPCGDHRRVMFVKPMDNDEDPCFVDAEAVPEDVVRG
                     PYVLHTGVLTMPYVPSTRGSGNGDDAVPVIIPNITQPWIMCLETGPERWREPVHPMFQ
                     LQYTHAMPTGFRVKADDASNTTAPFPAHKVGVAATTSAEVDRGTGMRAGGNTTLILYA
                     QDSSQVVYLNGYGIERGHRLRFGARCEETMEPPASSRSRGGVSSGGGAGMVNSTLSDM
                     ADYHHRVAARQLLANTRLYTDPLPIEDDNGVFLVPSTHILLSEEATSGAGGIAACVST
                     DGGATYAKTSLTLRVLPSRLRIDTETTQRNLLAQILTDTLLVPENSYGSVDLTALIKA
                     GRAIGSSTEAAMASPSSVGGSGMRDADMYLPPGTQVLLSTNCSYNSHGIPLLTVSVSN
                     VLTLAKHHTGTVTPQRLRVCVRNPEAAVAAAAVLGSGVSEDDGGTTTAFFVASGVYYR
                     VISVQVSRVSLHAWTPTEAMQADLIEQVVLRRSAREDLLLPVLLKSTARAETTVTVAS
                     SPEDELLQRLELSPSALSLLSLTRFYVGQPCYRSAQSPDPASAISPYVSSYGGMQLNF
                     GADRITVSPLPGQGQQQLSSLSPPDSLSKTLVAALPSGNTYSVPHYTLESRGSVCFSV
                     DGGLHYLFVGIAHFTEEWAPTLRVTLNAEEDEKGKDVREEADATTTATPSTNAMRVYT
                     QSSTTRQLLDTRYVDPGTLPPWTAAANHTEAHVLADLGQLTTAMLWTGFLGDNAFAVN
                     GLLYLLASSHAAPFAETSPSGLILGGGPQPQPLLFSLDNRLQNISTNMTVTVVPWSLT
                     CYGDAQQRELYVHPPDVGLLAATTPGRCSAGMRDGVRVRVVPLSMAACNDTIAVDTLY
                     LFDLSTVQPAVWGATAAAGEAASSPARAMQLPIGLRYTPEGLYALCLRQDLPYVSSLL
                     SDNNARAPGNLVPATYAATPLRLRVSRNWTVVSVSSATVSNSSDNVVAIAQSSHAELP
                     VTGTAVRVRGTPVLFAFAPPSAQTVTRRGGSGLWTWSGGCAAVPEAWDPVTGMPLVSA
                     SASSASGPDGLLLTAPWRNAQSGVLRVDAAYVSRVEWDTAAVVPAAATNGNSTTASAR
                     YAGRLRSYALCYSVDGGLSFQAAGTAGQTSPRTLAAVVVPPTITSLSCNRTTAADPAQ
                     RLLGWSADNATATTVRVQYLYSSPGADASITSSPQVVTYAARPPTYTYAWTSAFVGNG
                     MGAASGRRLPTVTTTAADVPTVAAAVALVRTSRYGARCDGAAAVSANFTQFYGTTVFG
                     ADAWNVSAVNTSSPLAMPIFLINLQHGGVWSTADTAAVVAWRGAQTAKGVAEFERMNP
                     VLSQETWVNQTAALWARYKDVPGAPLNGQSILGWATDAATAASRSNGESIVVCLSIDG
                     AHFYSADVARAAALAPKAQAQQQVVIATASASSSSTTTTVTHLSPWPLYLRSIVGPSI
                     SNASANTTMASVTTQLLWMREISMVMELLARPTTNAATATAAAASGSPYLGCTSASLA
                     LFQEAMAAALGIDPSVVVVQLHMSGLVALPKAAASLHAVESVAVAAVQARHRAAGTLG
                     GLQRASTALTDKATADPQPVLLPTYALVLSIIADAVAYNAAVNTSTLSAAPDLLYRGV
                     QLLRDNASGPALLATLARGRDAVATASLSSLTVNFTLRNGVDLHAANATMSAALPWSP
                     PQEVAWRRLFLSIPHATLSPGPVPDDKDNDTTSKLRWWAIPLLLVLPGIMVYGTYYVY
                     KKYLQPANEATKAPVVEEHQ"
     gene            complement(<164785..>168888)
                     /locus_tag="LMJF_04_0440"
                     /db_xref="GeneID:3684875"
     mRNA            complement(<164785..>168888)
                     /locus_tag="LMJF_04_0440"
                     /product="serine/threonine protein kinase-like protein"
                     /transcript_id="XM_883479.1"
                     /db_xref="GeneID:3684875"
     CDS             complement(164785..168888)
                     /locus_tag="LMJF_04_0440"
                     /codon_start=1
                     /product="serine/threonine protein kinase-like protein"
                     /protein_id="XP_888572.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684875"
                     /db_xref="GOA:Q9NLC0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q9NLC0"
                     /translation="MAEHAAIADMVPTSRGDGRHLHCLHPQRYQLLQLASSSITGCET
                     SHSAAPKTAGVEGGRINSVSGSGAQPRQHYRRARSIHITLRKTRSGSRPVNAQRDSSI
                     GVSRDLGVATGVAEGRTPNTRQRHGSFGSASGALGDAVSPTSTATVTGTPTGAGGAAA
                     SSPFTFPVVSGCVSPKLTPRHHDAMSASLTVTAGGAHRAPLFDDVANSNNNPNSCGSS
                     RIMNSSSYTPYILHTHGRSGDGTASDSTTAAAAPAINMQTTGAAATNVGSSSSSMVGG
                     AGGSSSSVGPSSGSCVPTVHGVGYFNTFVKAIHPSDMKQALLPPNMRDRAVVLGMKHG
                     DQAAEAMAAHRRPFSSGAISRRSSSFSGNHGRVHHHPSVSRAQAVSQRSHASGYSGGL
                     RSSSMSGCHTAAGIYNGKNSSHRHATATHGLQDCAPPYPDSASVALHPQPHQQQQPGH
                     PPTPAWRGHLSSMPTVNLGTSPRLSPSAVPAAASDQQDQHRRHYRARSYTVGGRVRSS
                     SSSSGGGAVVVATAADATTPNASGRVGYVDSAPSPSPNRSVSLASSSPTAAAPVFGAV
                     ATTAAGQCSRTSTLIHHPSLSREGSSVETTMTAITATLPPASPLPAYTESRASSAVTG
                     TMTPRTPRPANAAIEAAAAGISSAQRGIRLIEHPSHGASSGQQRSVSSDIVNGLDDSV
                     DSVRCGSVPSASNTSAANMMGSASGTLDRYNYGGATAASRQGGTAVFATSHRYARDSV
                     ASEDKTDDEGRRHRGPLRRYSTTLTNTTTEDEDEPQQQLAQPSTLELLRGNHLRRESG
                     AGGGGGNVNVAAVLSRARAARASATGAAAAGATNRDGSPTTAIERWRAQEQQRKRDEE
                     RQQQRQRQRQRLSARQWREAFHRLQEKRVRWRMRGYIGRGTSGVVYEGVLEDCKQTPV
                     AVKVLEVGVPIPVDLDTSGDDNDGQSSRQARYTENSGAPTSAADAAAADAACMSPSQQ
                     EALLVLLREVEMMEKLHHDNIVTCLRCQVTPVQDRYLELHQQQQQQQQCRDGGSNNGE
                     GLSGTAAAGRDSEEVGKRRHDSAGRHYVGNGKAAVCDGVFSASQSPQRNAAPRIPVQV
                     EIVMELCNRGTISSVVRRSPGGQLPVRVARRYLRDVLKGLAYLHRNNFIHRDVKGDNV
                     LISAADVAKLADFGCSRRIVLTNNVHGAADSEGGTSSIATTRTAATDSRFTTMAEYQW
                     FDTTGVAQTMVGTPMFMAPEIIQASGPPCMTTPTASSPASSTFEGNDGGHGSSSKATP
                     PPAPVGYTASADIWSFGCLVLEVFGRTPWPASGGNAYHLMKQIEQSVADLPPGVPDGT
                     PAELLDLLRCCFHRDPHRRSTARALLRAPWMTCKDEELEEMPPRRRY"
     gene            complement(<173211..>175775)
                     /locus_tag="LMJF_04_0450"
                     /db_xref="GeneID:3684863"
     mRNA            complement(<173211..>175775)
                     /locus_tag="LMJF_04_0450"
                     /product="putative calpain-like cysteine peptidase"
                     /transcript_id="XM_883481.1"
                     /db_xref="GeneID:3684863"
     CDS             complement(173211..175775)
                     /locus_tag="LMJF_04_0450"
                     /EC_number="3.4.22.-"
                     /codon_start=1
                     /product="putative calpain-like cysteine peptidase"
                     /protein_id="XP_888574.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684863"
                     /db_xref="GOA:Q9U0T9"
                     /db_xref="InterPro:IPR000169"
                     /db_xref="InterPro:IPR001300"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR015232"
                     /db_xref="InterPro:IPR022684"
                     /db_xref="UniProtKB/TrEMBL:Q9U0T9"
                     /translation="MSYPPTEVDVISNDSLFSDSVEFDAAEKPIAAEDVHGVADPNDQ
                     PLGHDDRGLPTDDAVMRAGSGYPEEEPAGPPPVTNAFMKPRKTATKPPREWVPVNLQV
                     PEEDPEDEFDIGTAQKPVYESPETPAATGGAAAPKVRFVNGEPDITGEVTNCFEEPGL
                     LYRIVDRPNKTWAFYNDSRSFEVHVVCTFGKHSKITPLENTKMTRDENTGEYVMELTV
                     YPGETEPFIKGFVNGFASKLSALPLSQEYFQARSEAQNQQVVQVEMDAIRAIAGDETD
                     AERVLQICLENGLPFVDLSFPPVQSSIESGAAKPFKRLPWGRPRMYVKPELHDQIRLF
                     RNRICPGEVEQGELGDCWLMCAVATLAEDPTVVMQVFRHPKGADSARCERAIGAYRVS
                     FNKNGLWRSILVDDYFPVIAGAPAFAHSRDLCELWPAVLEKAFAKMHGSYAMIQSGDP
                     MHALTDMTGFPAMRIDEMVSKATVHSGRDLESRMIQWQRKGYQAILTTPGKAPAIPAE
                     AQSSPDFSDQPEMEEAFAGTGFLPGHAYSVLDVKEFQKGQIRLICLRNPWVHGSGWTR
                     AWAWDALEWQQHRDIATACGFSKHKGDTSIVWMTFEDALKYFIGGGVLFCARAAHDAR
                     VPITFADCKPGAVFQVSVKAPMDVTFILSNMDHRGMHVDEAGAAESDPNNMDYPAVML
                     SLAAPVPKETDVYQVVQNSSTDMTQPSDNAWLFLQAREIAMTCHLEPSTAPYLLIPRL
                     MEGDETVGNGNGGGEDMRDFVHPIYYVNDYAHLSRSASSVKAKEIAVTIGFEADGEIG
                     DNVIVAMCKIGEGNAVFENFPKFPTDDVEPHEEEMYFQTKESNCGYAQEKAGTAIC"
     gene            complement(<179906..>181345)
                     /locus_tag="LMJF_04_0460"
                     /db_xref="GeneID:3684864"
     mRNA            complement(<179906..>181345)
                     /locus_tag="LMJF_04_0460"
                     /product="putative adenylosuccinate lyase"
                     /transcript_id="XM_883483.1"
                     /db_xref="GeneID:3684864"
     CDS             complement(179906..181345)
                     /locus_tag="LMJF_04_0460"
                     /EC_number="4.3.2.2"
                     /codon_start=1
                     /product="putative adenylosuccinate lyase"
                     /protein_id="XP_888576.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684864"
                     /db_xref="GOA:Q9U0T7"
                     /db_xref="InterPro:IPR000362"
                     /db_xref="InterPro:IPR004769"
                     /db_xref="InterPro:IPR008948"
                     /db_xref="InterPro:IPR013539"
                     /db_xref="InterPro:IPR020557"
                     /db_xref="InterPro:IPR022761"
                     /db_xref="InterPro:IPR024083"
                     /db_xref="UniProtKB/TrEMBL:Q9U0T7"
                     /translation="MSLPSAQEAAAPSVTTTAHKAPAEISQDNPLYSLSPLDGRYKRD
                     TAALRAYFSEYALFKYRVQVEVLYFQALCKEVPVITQLRGVTDAQLEKLRATTFENFT
                     VDDARMIKDIEAVTNHDIKAVEYYLKDKMSACGLEAEKEFIHFGLTSQDINNTSIPML
                     LRDALHHHYIPTLDQLIAHLKSKLPEWDVPMLARTHGQPASPTNLAKEFMVWIERLEE
                     QRTMLLSIPNTGKFGGATGNFNAHLCAYPGVNWLEFGELFLSKYLGLRRQRYTTQIEH
                     YDNLAAICDACARLHTILMDLAKDVWQYISLGYFDQKVKAGEVGSSAMPHKVNPIDFE
                     NAEGNLGMSNAVLGFLSAKLPISRLQRDLTDSTVLRNLGVPLSHALIAFASLQRGIGK
                     LLLNKDVIAADLEGNWAVVAEGIQTVLRREGYPKPYEALKDLTRGNAHVTEETVHRFI
                     QQLEGITEEVRQELLAITPFTYVGYTARP"
     gene            complement(181903..185242)
                     /locus_tag="LMJF_04_0465"
                     /pseudo
                     /db_xref="GeneID:12981688"
     misc_feature    complement(181903..185242)
                     /locus_tag="LMJF_04_0465"
                     /pseudo
                     /db_xref="GeneID:12981688"
     gene            complement(<185923..>186489)
                     /locus_tag="LMJF_04_0470"
                     /db_xref="GeneID:3684865"
     mRNA            complement(<185923..>186489)
                     /locus_tag="LMJF_04_0470"
                     /product="60S ribosomal protein L11 (L5, L16)"
                     /transcript_id="XM_883485.1"
                     /db_xref="GeneID:3684865"
     CDS             complement(185923..186489)
                     /locus_tag="LMJF_04_0470"
                     /codon_start=1
                     /product="60S ribosomal protein L11 (L5, L16)"
                     /protein_id="XP_888578.1"
                     /db_xref="GeneID:3684865"
                     /db_xref="GOA:P48157"
                     /db_xref="InterPro:IPR002132"
                     /db_xref="InterPro:IPR020929"
                     /db_xref="InterPro:IPR022803"
                     /translation="MVAESKAANPMREIVVKKLCINICVGESGDRLTRASKVLEQLCE
                     QTPVLSRARLTVRTFGIRRNEKIAVHCTVRGKKAEELLEKGLKVKEFELKSYNFADTG
                     SFGFGIDEHIDLGIKYDPSTGIYGMDFYVVLGRRGERVAHRKRKCSRVGHSHHVTKEE
                     AMKWFEKVHDGIIFQAKKKKKMIRRRRR"
     gene            complement(<187162..>187734)
                     /locus_tag="LMJF_04_0480"
                     /db_xref="GeneID:3684866"
     mRNA            complement(<187162..>187734)
                     /locus_tag="LMJF_04_0480"
                     /product="putative ADP-ribosylation factor"
                     /transcript_id="XM_883487.1"
                     /db_xref="GeneID:3684866"
     CDS             complement(187162..187734)
                     /locus_tag="LMJF_04_0480"
                     /codon_start=1
                     /product="putative ADP-ribosylation factor"
                     /protein_id="XP_888580.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684866"
                     /db_xref="GOA:Q9U0T6"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q9U0T6"
                     /translation="MGNVFSSWFEGLFSNKNASIVMVGLDAAGKTTILDKLKLGASRE
                     TVPTIGFHVETVDYRNVTFHLWDVGGQKRLRALWKMYYEGANAVIFVVDSNDRARIGE
                     VREELRTLLSDPLLAGAALLVLCNKQDLPHRLTPAELVEGLGFRDLSDNGLGRYLAGH
                     KWYVQGCCAHTGDGLYEGLDWMCSHLPDNV"
     gene            complement(<189305..>190261)
                     /locus_tag="LMJF_04_0490"
                     /db_xref="GeneID:3684831"
     mRNA            complement(<189305..>190261)
                     /locus_tag="LMJF_04_0490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883489.1"
                     /db_xref="GeneID:3684831"
     CDS             complement(189305..190261)
                     /locus_tag="LMJF_04_0490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888582.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684831"
                     /db_xref="UniProtKB/TrEMBL:O97206"
                     /translation="MAKSSRSKWKKMHRRQRAQAEATNTVKRICLLNKKLKLTVKGGI
                     SAVPPQEPEKRFHFLNPVLDSRVPNTRKNLNNNYRAELNHVEYDYTKPLKLAPPKTNM
                     YGKTDVDAPHPMTVMYETIDADTPLAGHALTKADMERLARRQAQQESEASAAVADAEK
                     DASKEDGDNADDGPEEYVFGMEDAAPRRARGQHKTSAKKKGSVAPKALKGAASASVGA
                     SSSVSETGSSSRMLAAAAAAMTNEEEEADHRTRNGGVTAVNKIASMQTMRKKNGTMVS
                     AGGASKMKKVGQLGGSSGTRVVSSGGKVARKDVGNAKSGSKR"
     gene            complement(<191067..>200105)
                     /locus_tag="LMJF_04_0500"
                     /db_xref="GeneID:3684830"
     mRNA            complement(<191067..>200105)
                     /locus_tag="LMJF_04_0500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883491.1"
                     /db_xref="GeneID:3684830"
     CDS             complement(191067..200105)
                     /locus_tag="LMJF_04_0500"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888584.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684830"
                     /db_xref="GOA:O97205"
                     /db_xref="InterPro:IPR002934"
                     /db_xref="UniProtKB/TrEMBL:O97205"
                     /translation="MSSRRSSPPSPQTSATSWSTLPSPATAAGAPSPVSVPHVVYPAQ
                     TDATAAPQAVPVCSRFAALRSSVLSPASSTANLSASNTPAKSVPALEVGTSLLDRRKP
                     SPASPRGPKAATWTTATMTSAAAAACASHSSKTQHTQSHPSADADSVQGCADSGVGGV
                     STTSSLSAACAPQSASLTAITASSGKLYRPPHAREDSSKQRWSAGDGGGADNTATATD
                     AGTTVSAATPTSLDSAAAVAGAAAVPTASSSSSPPPLRPSVSAAASKSTDALWWFPVS
                     KANALSSTAPQRCGGSISAAPSSAVSVPATAAAVASGASPEATLPPPATSEDDQHGRA
                     GKSSAVHSSVTATPREPVAAERREPTELPPKPSRSAKRKQKVRAMAAAAAAAAAAAEA
                     EAEAEANRQPDAEVEVEVAAERREVVVAHPKCSSMDATSDRGSARIGFGAHSSPACTG
                     SAPTKAAAAPNTSSVSRRPGWHPSFATSAAVSTTVAGEVAVVVAGDAEVVDSSGNGGP
                     KMMVNGLSNAMPVSFAGALPSTTYAGQTANTMPGMSDAAGQLLPTEMATAGGGGGGNT
                     GYMNGHGYQQQQLLRHSHPSPTQQYYDVSLLSQQQLQMAACGYYNRFHIASPHQQQQQ
                     QHCSHTWPSTSGVDLSSAAATTSPNSSSSTSAKVLLAAGAATTSVTGAAATMLDTANT
                     AMSASGGGAAPPQHRAPGLHRGRGAVAAAAASQSTAGQLAPSASPPPAPAATGRASPS
                     ALLPARSGNLPSIRVGVSTTMNADSSGSPSTAATGGTSNFAAPRADTLSSNATAMGVG
                     CTGNTMLNMASGMPQHHHYHHHTPSLAHPSSISGQLSQRPHQHHHQTMSLGSLSLDGG
                     GGGQVNTTHHDDMESQSSMSPGAAQEHIPATISPHMSSRSQGGPSAAVNWGSMCGSNH
                     GRSANAKHKGAASDCAHSRGSNSYSGSTLAGFSNSRHSGSRHGHTQQQAMMMNQAGNY
                     MSSMYGRLPTPDQQAAGHIGSSGGGMMPMHHNALNVGGGGAGQQPMLHHQQAQQQQQQ
                     HTVARPPPIPYYDFITVLPTFVATCLTLKPEDEANREQLCWIIEAVLRKHLNQNAEIR
                     VHGSITTGLALPSSDVDLLAVGYQPIAPLEALQRLSKALLELDEDSKNDALRLQELIE
                     AEAQHRRRQLMEEAKKRAKQVALAAATGAGVAVAPDQDHHWTRESCCSASDVCEAASL
                     RDSDSDADNNDHGRRSEENASEGEGASGLSPKRVACAGSIAESLLLGSTVATEEMPVM
                     GEMDEAVRAAPNRRVSSHSRRSPCAPQDGTATMALQRSVSASSRSTESSTTCFSAAAF
                     PLDTRKLFLTSSATVGDDDEFARLASGSGTVPGAGATSTCNKSGVGHTDSASASRLHN
                     PDVATAEDTEVYGTVGDVEQAEEVFRGQIEKDYNFSTSVDLSALFAPSMGSGMPPVAP
                     PVAAASGLSIGGASSSSSGLALQTATTRLHNSASLSSPRESAAASGSADLKGTPRSLP
                     PAMTSGLHTDEDNIAAHAQPLPRSKAAPADADMSANEAELRCRQVRLADGGAAEPEGR
                     TASGGGDAAAAEAEAAHAGTETVAADEAATAQLSPVSPTAAASGERAATVQTAAAPPA
                     SQDAVTRNSIVLGATDGRGRGVGHLTYVPVHEGPLFFVQSITATRVPVIKLTDKATGT
                     KVDITFAGGEHWRSMQLTRSLLEVFPHARTLILFLKYCVRSLSAGESEPGGVTSFAIY
                     LMVLHFYNECRQRILLLLRERNAASSSAEAQGRQAGADAGEHQHQHQQLQKDRAAEEA
                     LRRGSAADNSAASPAAPRLAAVYQDASTTAGPAPLTLGLLEYMLGEYLARVEQRHAQL
                     VEEAGARRSASLDAAGAGDVAELYSSSGNIQKTVPALGRASSSTAVATGACATIKAAY
                     ASDDKERLRAIRQTILGFVGDPAAATTAAVAPAPLTTTGATPEKEGGTRRTQQSQPSS
                     SDAAEGASGGGAAAGASSSIGTSTPSPLREQQPPNLSGTAGLGGTTTTTTLSAGEELA
                     PVVDAAPGRLAPPPRHYLLKTVEPQPHERVVGEGSHVDTPRADEVAGRGEKVAEDTSA
                     VHSTAALTTPETVHQETRADAAAAEVAEGTETPEKPVAAATDSAVNVNPVKAGQDAAG
                     AHASRVAEAAAAAAASTSKKASEQHSGADSEDSAFDAFAVDFLRRQAEVSDLFLDFCH
                     YYGCAFDYETSGIRFTADGRSEVVAKPLLCSRRGQHFHMTSPFDPEYDLTARMTHMRD
                     FQWLCWWFAEWGAARQSPQYYGSCSLQYVLQCLSPMSADADCQAVHHALMKQAVAAAR
                     RADSTAAATLAQNHSMSVPMLAFQESMGSNHHMMLMQQQQQQSAPRQPHTMMMSMDGN
                     TKFYGAQQQQQPQSMRNSTTTMMPMTLRAHPQQPHQQVGGVPVPPMNVHSGPRVEQQR
                     CGGAGVAQHSVAAPFPHLQSMMMSSGSPGHAHQQQQVNHSEANGMDTATHAGGGGLGE
                     HGHHNAPHPKYGGSISIASTAAKTGSATIHETAAIRTASSGSRSRPVSESGTTAAAAV
                     SARTRARQRPPLQLPYVDSREEAFEGSSSHAATTPTAAGMMAVHSYSTEDDDDDGGGD
                     MAAAAAASSTSANHLFSLPYGESPEGTWTSRTATTTTTYGGNSPRDRVDVTLTPVKGD
                     EDEDEAGGRYGDHGYGSESVVDYTDRLDQCGGRGGASAVMLQHYPQQLAPHDAQATAE
                     GNAGVGEHGAGGPCNGYAPSMAYACNHGYAASQQQQVSYGSPHQMNRAAGVYLSPQQQ
                     QQFGQQQEHAAAAAAFYYQAFAQQQQRQQQQVPYPPSPQLKQPQPIISGAGSGFVATA
                     GTSSSSSYPFPALYYDLQQHLWQQQQQYHTTRNSSGFVGSALTAAADQDGGSSHRSDG
                     TSSTTATSASAQQQQQQAFLYTPYVGYPSVAFGVGGTRNTDAARTAAGGGEVPQQQQQ
                     PDMVAMPSMTTYQNAAAVATGLPVSTGSADVCVSASEPPQQRSTHGGHRHPVSHHHSG
                     GGDGSHAASQ"
     gene            complement(<203683..>208197)
                     /locus_tag="LMJF_04_0510"
                     /db_xref="GeneID:3684829"
     mRNA            complement(<203683..>208197)
                     /locus_tag="LMJF_04_0510"
                     /product="hypothetical protein"
                     /transcript_id="XM_883493.1"
                     /db_xref="GeneID:3684829"
     CDS             complement(203683..208197)
                     /locus_tag="LMJF_04_0510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_888586.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684829"
                     /db_xref="UniProtKB/TrEMBL:O97204"
                     /translation="MPPLLPHREPQLISLPSSRKCQSPSQCGRKHLPLADLCHQNDKG
                     SSAGAGGTRKVSGLGGRNASTKNASSAAASASGLPRLAALAAVPPSLDMFLTASSKAL
                     ERVVVSDNESAQVMHSSAAAPAAAVAPAAATQPLKSLTVSPFTAPVSFESSVSAAASA
                     SLSCPSNGLIRFTAMPAEEGCILPLPAAATTPAEVYLESRVSYPYNGADAMATLNLPS
                     PPPASSPHVDLADRGGSAAATTTAPLLRQQESRISLSESTPRAPPICQERLSPAAGAM
                     KPTNSPAGPFSYPAAAPVAEAAAAAEAAAAATCTTSTTFKGVASSAAALTAHPADYGS
                     RTNSVGGTLRHEAGGAAAFEHAPQQQPPSCPPRTSESFATAAATYPTTAAAPGSPSGP
                     LKMQPSSLLSRMTTPAAAREVVAAGVGNRDNSSDIDSTSPQLFASVASSLLVPLAVSE
                     TSTERTRITPAGSVNSLCVYRAPPPPFLRAPSDATRSGSPTSLSPVAVTAGTGVAMDV
                     VGYLEYGYDTLWRTLARFFAAAFLPHIFLWHAVPALIPQLATSAAAEAAAPPCVRVYA
                     VACNHPEVVLFALELFVAGVMLWSLARYRQLSTVQRSRRHHSLHGGLHCNSTSLAARP
                     SSAGVGSASVAAARIAGVWCTAHLPTTTTKKLVDSAESPSTSIEMAGMRPLSSARGLR
                     LRPLHSPGAGGIGSGLAHRIGSHTTMPLLHLPLRPFGGVRSAATMVARAAISGSATPV
                     RDPANVSAYPAEPGGAMRCFGVRSVSGAIVSNSTLSGRSSASSVGTPSLSPYPFMGLA
                     TPAAEVMQRGFSDVHEIDSLLTPGDAGGGGGGAITTLTTPFEAEERQSGGSLLHGHHP
                     RTATWDAPRLQQPSRELLSGSDAGCQRVFPASPPTSVVTPAAAAVAASAVRTDSLLLS
                     PGGAVKAAPAPSSPIFGRDGPVPTMTYFGIGLGFLVCAGLAEWRLSVDYYFAWYSFAL
                     DTNAALWFWLVPVCLLGTAAYVVLLIGGHTLRWRALRQLHESNARGCHNDDEDEEEAA
                     RQGAAAAAALCRLRWMSWCFACVPYPHPDVALFFDLPESVIMRPDATALLPKLASRGS
                     MVGAFAVDESDAVSPIVLCTPRERGFCDGGDETVYDDEVNARGSALRQQSRVLRESGK
                     DKYGEAVFLTTDDTLEPVDDILRLKRETPEQSTPAPDISGDVGSLAVATALDNFKTAS
                     LQTITSAAAADVSGSPCKPLLPPLLPRRPLSRVFSTAMVRSFPIGRRNLSGLGASFSP
                     ASSQSLWIFGQRPQRGCAASRTWVERAARQLRIPNLTMRLRRLCGLTQQRRAEQRSQR
                     RAWTSWSGERGSLERLVAWTYLIMLFFFSQALLSLMYFTWLWRSIAGEAATAAMYATD
                     TERAAMPVPPSFVVYGCTKWQQSLRNVLWVIPPFCASGDVSVSSPRPSTTWSMASQVA
                     LLFTLLGQRHFQVAYLYTNVALPIGFVISLCILAHEVQLHIKSRRLLRLLALAKSRVE
                     TARKVREAML"
     gene            complement(<209655..>212867)
                     /locus_tag="LMJF_04_0520"
                     /db_xref="GeneID:3684859"
     mRNA            complement(<209655..>212867)
                     /locus_tag="LMJF_04_0520"
                     /product="putative huntingtin interacting protein (HIP)"
                     /transcript_id="XM_883495.1"
                     /db_xref="GeneID:3684859"
     CDS             complement(209655..212867)
                     /locus_tag="LMJF_04_0520"
                     /codon_start=1
                     /product="putative huntingtin interacting protein (HIP)"
                     /protein_id="XP_888588.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684859"
                     /db_xref="GOA:O97203"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:O97203"
                     /translation="MQVFREAIEKNGGPLPLLYYLQPDAGNTPDPGSAPYRDKSIDLL
                     NTRVDRRTFFECVLSDADFAILTTFLMSGVSVNATRDEDGASALHIAAAGTLEVLNDD
                     DAQGGGSSGQMAGGDGAGGDNMRGFHAATRETDERADDGDASSGSTSSILNPPCKNQL
                     IISFLIDNGADVNAAMHGGHGQTPLMMAASRQNMRVVKLLLAKGADLNVQDAQGRTVL
                     SYAVAYPHVMEALRLWMGEEAFYAAAVRERLLHTACRSLGNAYAALYLTEQIGLDVNM
                     SDDVDAAAAAATPAPVQPGQALPVDPKNPRRDCIQNRPRTPGTAAMFFAADASEGQHS
                     AWSIARSSASSVSPTTNATTTAPARNFAHSPCVGVGRLGAAAVEAVDMGALHSGDTPL
                     HCAVSTVDVALVRALLSKGADVHAANHSGVTPLQLARSQSSLAQSWKQYWKDELIVML
                     WPTSASAAAALRRHRELQRDKSPRKVRALLTAYSHANTTQSREKVVREEPALYLWKRH
                     TPMDVVLLVATATLPHVFFYICCCIIRNFFVLLCLLPLIYGVYVGMQRLDRRRAQSRS
                     LTDLGWCVGFVLAQGLCLLLCTTYYYHQYYSFHMEDHTALSWRLVPVVTATGVLAAYV
                     VLSSPGLVTSTEGQRKGIYASLRNAQGEYERELLYSIDLRTMVKKPLRAQYCPQLRRV
                     VLRYDHFCGYLNTAIGGGNHRAFLWLQVALLSMLGCFYYYACEYRRLMNSFAGLARTS
                     AAAAGRAPGHSTTRVAVAMEMDRAVMEKFETALLATAWRRFAYTYSQVILPLMILMVV
                     YALCTQLHAIARNLTFYDVEHSEDESSLYCFTLGSRVYSLFDNGIWANLREFFGWSSL
                     TQKVYRVPQINPYLQQVVKDHQRWQLTGGDACCDDNDRQHQSCTHASGAACKSGAAAA
                     AGTTTTAGAMAGPVELEECESTRAQPMLRAPQHKALAAAAASANVGGPPQGREAAQQE
                     RQPASQAEEGGEEVHDEAEDYADNGGGNYGSALAMHIFQEMIRSGGTVVDRRDAIDVT
                     AHGGGAGAETQQEWDAAVEKARQMYHFYRQSIGGTGDGGY"
     gene            complement(<213573..>214919)
                     /locus_tag="LMJF_04_0530"
                     /db_xref="GeneID:3684858"
     mRNA            complement(<213573..>214919)
                     /locus_tag="LMJF_04_0530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883497.1"
                     /db_xref="GeneID:3684858"
     CDS             complement(213573..214919)
                     /locus_tag="LMJF_04_0530"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888590.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684858"
                     /db_xref="UniProtKB/TrEMBL:O97202"
                     /translation="MCRRSSSPPLRTSVTGPSSPSPPPPIPSLPSCRAAITAVPASRL
                     LARIRMSSTASSASLLPCPASTPYPTRTRAPHVLSSSSSTAAPPNAAKTLKQADMPLP
                     LMSSLSSAAGVVSSTAPPASAPEPSFASYVLERVSRNPFLIGETPRSLRPPPSQPAAT
                     DDAPSIPSALDAAQRAVIAQASTSGAAATSSPASALAVTAVLQRALVDAPLLPVGGCH
                     LLHEHVWTPFLASAEAAKQVGCYRKALQLYKAGQAESGTGVNAPLQQQQQQQQASRTE
                     ATASARDGALSSTARGAAVDLFAASPLATSPTDHQQRSYQGGVGVLQTPEELSLALTE
                     DALQANMDQALARLVGSREELQRGLAKLRQLLDGLRAYDAVPFEELAQQEQAKVRRLF
                     APVAAAAADGSARSNTNTSSSGVVLATGAAAAVERGAPAVLGEANTLANRKRSREA"
     gene            complement(<216926..>218692)
                     /locus_tag="LMJF_04_0540"
                     /db_xref="GeneID:3684857"
     mRNA            complement(<216926..>218692)
                     /locus_tag="LMJF_04_0540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883499.1"
                     /db_xref="GeneID:3684857"
     CDS             complement(216926..218692)
                     /locus_tag="LMJF_04_0540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888592.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684857"
                     /db_xref="GOA:O97201"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:O97201"
                     /translation="MDVPLPSRQFTMVPGQNIDPLFLCPLCHDSWADPVELVPCGDIF
                     CKRCIDAARAQHAVQPMIMQNFQCPLCQTVLQSDKKPNRMLLNSVLMIEVECRYCHWR
                     GTRESSEQQHTCTGVDGAVKSNHHSTGLSDVAFSTASPPAEGMPTREGGAQASPSPPA
                     SQPAVCNGPRRAQREIEDGYIPIGDDPSSATLRASDMSPLRDSVDPSQNCIPAEAVSA
                     NSSCMVTFPLQTPHTGPTNDSASHTCTSTSASPSHPQELWRRYGLSQIEYDQLVGIFM
                     MFDGGTGRLSRGRLRDLCFCMNFVQREDDVGVIFASMDHACKGYISQDDFLRWLSTHQ
                     PDPSALFGLSRYEYTDALLQFRTADPEYNGVIDASSFRYLCLRHGYAQTPEQAMRHFQ
                     LCDERRTGYVSLRQFLQTLKFIKTGHDGDLAAPPPAISIAVSGSSHSGSGLPQPAAAP
                     RSSSPVHLSRRTGASIGGGGASSFSGTSESASLQVSECFLSDTAQASPHPSRQLHAQH
                     HGASNYASLVQPPMSPLRAPSQRQQRQQQRFVNGGGGVATLPVIGQQRPEASPTAKAV
                     PASRLHRQNGRGSRGKEECVVM"
     gene            complement(<220364..>224947)
                     /locus_tag="LMJF_04_0550"
                     /db_xref="GeneID:3684856"
     mRNA            complement(<220364..>224947)
                     /locus_tag="LMJF_04_0550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883501.1"
                     /db_xref="GeneID:3684856"
     CDS             complement(220364..224947)
                     /locus_tag="LMJF_04_0550"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888594.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684856"
                     /db_xref="GOA:O97200"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011717"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:O97200"
                     /translation="MTATILRTNYALLLFYVREKYWHHAEEVCLSVIQSTDDHMFRVW
                     RALTLDRQGMANDAIREYKTVESRRATAVPALMGMQLIYKHNRDQEGVAQTEAKLDGF
                     EVADNMGGWVQAAALCWAAGNINAARDILLKFTDNEAAMAYRDEYTNYGTIRGWVDLL
                     SGRGALLEKAGTLFSSMLEMEEAQYSFFQAGNEAGGGGSGTTKWTDMNAALGYVAFLE
                     RKTQLTKARSLLDRLVVLYPSCSIPPLVGKARLLMQADDWEQAIEVTHRILAHDRGNV
                     EALALEALYAIGKDTRQDAAPVRLRRLLDAVRAKEPRNVALLHQFALVFSRLAGDRLD
                     LLNITTQFSEMACALDSRSGDVLCGLGYQQLYRHDYKTAVATFRKAATLTDSLDPLLG
                     TVTCLLHQGDLEEAATQLQFCNQLQPAAQRNAELSMLNAQLRWRRRGMEEETAVLRYL
                     DQAAEAIKQDVKERAGSGMEVYVHLNAPVALAIAHAYLMHCRNEPPDPMFKHTDVVGE
                     KCGRHLEFVVQHLPACMEAQLMLAKVWFVTGDVRRAQNLLKNTLLMQEQPLPDAFLLS
                     SHICQYMGDVKLATQALERALTLDFSLQEQPLYNLLLGTVQGTTGKYAEALASLKRAH
                     GTVKSAATASSAGKPANPLSVPETATLYIQLAQAQLRVRDVDAARATLAEAALQFRDS
                     AQIGRVVIAQAMLAARTDVDRGIELLRQVPSKSEFYTAARSQLGKLFLTQKHNLGMYI
                     QCFQEMAEAAPSAQSYVALGEAYSAIQEPEQAIAAYEKARALSPSSSELSVRVGRALV
                     AAHDYAKAIRYHHDALMSDPHLSIVRADLATLQWRLGRIDAARETIVMSPVYELPSTN
                     DAGAGVASAAAAGSAETVGTAIERINLYLLLYKVLRDQPWTVPLSAQGTADTGSEGDH
                     GDAALTALLTARSLQRRLIEQQLRAETAEVNAEQRVVMSGICTELGTRCIYSTPAPPP
                     SSVIMTDKKVEAAAALALQSAVAARLTNAREYLREAITYDESNECAQLESAQLCYRTG
                     DMDGCERHCTTVLRMADGGSRNADAVILLANLYTQQGRTEDARDMFDDLLRKTPQHYE
                     ALVYYLILLYHAGQLTEAKDALGRAAAAVPAGQRADPGLSYARGLYEHLCNNNAEALR
                     HFNLARLPTDNAWCTRALVCMIRIYLVPTTQDLWVRGTNPAAAATGGAELHDNIRYAE
                     QLLLLLPVHSEERRILQAYCAMATRRPEELETALHLFLECIVAAETGGVSGARAACGA
                     TTAEKKGRSGSGQDTAKAGKKPRCVGDSDSDDDDDLQLLASMHEIAAELAQRSSGSST
                     ATLAFALQCKVVHPEAFLGLAISLYVSGQETAARNVLARLLENKKVMTKMPVTKQADK
                     SKGDAAEPPAPIIISPPIAILTCSEEDTIERAMLLQAYMDTQEGQLDNARFVLQQVLA
                     ANQGCGSAWNALGMIYERNQKHKDASRCYQKAWELVQESDPAVGYKLGFNYLRGGEPV
                     KAIDVCKRVLAHHATYPRIEADVMDVAYSMLRP"
     gene            complement(<230933..>231835)
                     /locus_tag="LMJF_04_0560"
                     /db_xref="GeneID:3684877"
     mRNA            complement(<230933..>231835)
                     /locus_tag="LMJF_04_0560"
                     /product="putative tyrosine phosphatase"
                     /transcript_id="XM_883446.1"
                     /db_xref="GeneID:3684877"
     CDS             complement(230933..231835)
                     /locus_tag="LMJF_04_0560"
                     /EC_number="3.1.3.48"
                     /codon_start=1
                     /product="putative tyrosine phosphatase"
                     /protein_id="XP_888539.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684877"
                     /db_xref="GOA:Q95Z86"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR004861"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR020428"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:Q95Z86"
                     /translation="MPTASASREPLVPSINFSMVCPGVYRSGYPTKKNYSFLCALRLR
                     SILYLCPEDYAESNLKFCEENGIHVLRFPTEGNKEPFCDVSEPLMHRILSAICDTRNL
                     PLLIHCNKGKHRTGTVVACLRHLQGWSLVSIFEEYKRFASDKARVGDQQYVELYHPIV
                     KLTPPFVALWVTVTPRVTLVTSDRELMEAEAMQLGYSLLAPDKHLMKNGSSTNKSTAP
                     TAAAASGAASVTAAPAAAAAATAGSGPTVAVSTSGPSAAGAMQQQQPSQPVTSAASAS
                     ASNSGHSLAPSLMATAATPAAADR"
     gene            complement(<232401..>237098)
                     /locus_tag="LMJF_04_0570"
                     /db_xref="GeneID:3684876"
     mRNA            complement(<232401..>237098)
                     /locus_tag="LMJF_04_0570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883448.1"
                     /db_xref="GeneID:3684876"
     CDS             complement(232401..237098)
                     /locus_tag="LMJF_04_0570"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888541.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684876"
                     /db_xref="InterPro:IPR001194"
                     /db_xref="InterPro:IPR016117"
                     /db_xref="UniProtKB/TrEMBL:Q95Z85"
                     /translation="MFGKSVGGGGDAGDGVPLITRLLLLRATARFELSPSAPSAGETA
                     PALPELSIISHYAQGPPLTSTSSPRPATATPKEAAHFLGVHPSLHGVLRCLAAGRLAQ
                     RVKLRRLQTDVVRTSVKLTRAVERASSAEVAPASRSRGMDSSQLQGVVAAAAANFVED
                     VAWCSTVTPHCPQLNPWCLLPVSAEGCYLTLPSSQFVQWCKQQAARCCAGDGTALSVE
                     PDARGGPMRYNDIVHYAGAGEDGGYVHGYAFILEGDVFSGSSVVVDAAAAAAKAAMDS
                     QRPDAALRGDSDEEASVLVWCVLSDAPVFNFMRALTHEAVAAMSNVAQRLYRERVASA
                     ESASASAALSPDIYTALLDDAIQKEVVLPLVKELLHFGSASSRTLPGDTFTVQLALRS
                     SSGGAIASHPLTFCRPLDLLYPYADVPLSLLLLSFNEDALRVLLSLLMQEERVVVLGA
                     TPQHASACVVSLLALMSPLTWVSPLVPYLPPHLAAVTGLLQTLLKPPFAQQQQQQVSS
                     GKSSTAVPPSQRTESSGFLVGSTAAIQPYLILLSSASPGKAGVSVTGYGGSGKRALRV
                     WIADARTGCVGVCPQEPVARFSRADSPASTDPPDGSVATAAVSSSAVNAWAARAHVDL
                     RRIASHSGQGDGCRSATNLYGAVRSSLRAMAKSNVMDAAVLDLLPAFSDNLRDQLRRV
                     VSAHKRRLFRHSLEAVAQHTQARLKDLESLAARLARGLRQAIMTAGAGSNMSFESTFS
                     NTLANRSLDSDTEDGNGELTAMRTGDDDGDDTASLRSIAEALARSFSKSFAGGPASLT
                     MSFAAAPVPQFPSLSLDEVWQVQGGVFDYMVSRFTGAYRRGLSTTTLGSGGAGGGGQR
                     RAPAIEWPLFLVPGMDQHQALAERVAHTHIFKQFECAVLAAEQVGLRRVFSGAAPARV
                     GKAQAPQHHGRGEEGHPLLANVRYLALFALQCSRARLHYAELYTDLASVDAVGLVYTS
                     LVTRWFADRPGPSSSMGVPRAIRLLAGGCNGAVEGAVAAAKHAAYSGSGSGVYGSSSN
                     DGDGSGGGSGGGGGSGLRGFFSKVAKAMKHGYGGNGRARGLHTAYLPAAIACRHTFSV
                     PLFSELRVARQLFAVTSHLEKTSMESSSGEAGGAAADCRGHHHHRHRNAQAFLKTCMP
                     PPQRIKYARQQELQQHIALDTDFTLHDCVSVVRVAGLGSGDHSVPETGFYSGERAYGR
                     GLGIESEMFDPVARAGADSNGRRDKTSISADAQQRDRDLQAMSEASLYICHALPLDMV
                     HRFDAYEPLLRPVASGGAETSPASAGQDALDAGSAAAYLLVGLLFPSCLNVWHEVEAR
                     AMRAVSEQSLSQVANPPASAASSSASSAQSRLLPPSRAETPAETSVPQDSRYSFSAPA
                     QAAAPLLSVWSAFTSGAPQDYPSVSSLLPDRSLGGDAQQHQAPPMYASTAALTSCHRD
                     VWDSWGFQAPSAMVSVQLTPVQGTAAERPQTQVADSGGSGNEGGVWSTGAPLGPPMML
                     GGMETTQPCISVACSPTPAAAVASAPRGVMDNLFADTPTHSMGYAAAAAAGNVSQQQP
                     PVPSRPHTLDNFF"
     gene            complement(<239178..>240080)
                     /locus_tag="LMJF_04_0580"
                     /db_xref="GeneID:3684907"
     mRNA            complement(<239178..>240080)
                     /locus_tag="LMJF_04_0580"
                     /product="spermidine synthase"
                     /transcript_id="XM_883450.1"
                     /db_xref="GeneID:3684907"
     CDS             complement(239178..240080)
                     /locus_tag="LMJF_04_0580"
                     /EC_number="2.5.1.16"
                     /codon_start=1
                     /product="spermidine synthase"
                     /protein_id="XP_888543.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684907"
                     /db_xref="GOA:Q95Z84"
                     /db_xref="InterPro:IPR001045"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q95Z84"
                     /translation="MPGPGLLPDGWFREESTMWPGQAQGLKVEKVLYDQPTEFQHLTV
                     FESDPSGPWGTVMTLDGAIQLTDYDEFVYHEMLANLSLACHHKPERVLVIGGGDGGVV
                     REVLRHKSEKDGVVQSVELVDIDGAVMQQSKKHFPQVACGFANPCVTATVGDGAAFVR
                     NVPDSVYDVIIIDTTDPKGPASELFGADFYTNVLRILRPGGVVCNQGESVWLHRPLIE
                     KMMGFLKKDIGFATVKYAMIYIPTYPCGSIGTLVCAKSADTDVTVPMRPVESLGFADQ
                     LKYYSSDMHKAAFVLPRFAAHLNE"
     gene            complement(<241698..>242501)
                     /locus_tag="LMJF_04_0590"
                     /db_xref="GeneID:3684906"
     mRNA            complement(<241698..>242501)
                     /locus_tag="LMJF_04_0590"
                     /product="hypothetical protein"
                     /transcript_id="XM_883453.1"
                     /db_xref="GeneID:3684906"
     CDS             complement(241698..242501)
                     /locus_tag="LMJF_04_0590"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_888546.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684906"
                     /db_xref="UniProtKB/TrEMBL:Q95Z83"
                     /translation="MSWLNRKRPTTPLYIPDPRRPSIVFVLTSPEPVLSALLLGVSCY
                     FLMIVTGSTPLDGPGGLWQAFGRKSRARMQSRESVLQPDPPLAISFDMLIVVLCVFAS
                     NSVLAACSRVLAGEQRRVEDAAEAEWLAAVSNPETRHERLAKDAQELAEKVKFWQEND
                     ERRKAGQTVRRERIKKLDVMADEVMTNIIVIVSVAVSLGAAYSILMQPPNQVRGLGMV
                     GMLVVLIGGLIVCGLDRYISSMRHYCNYVNLLCIFSLLVLTARASVVAE"
     gene            complement(<243289..>252480)
                     /locus_tag="LMJF_04_0600"
                     /db_xref="GeneID:3684905"
     mRNA            complement(<243289..>252480)
                     /locus_tag="LMJF_04_0600"
                     /product="hypothetical protein"
                     /transcript_id="XM_883455.1"
                     /db_xref="GeneID:3684905"
     CDS             complement(243289..252480)
                     /locus_tag="LMJF_04_0600"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_888548.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684905"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q95Z82"
                     /translation="MTKLTHVCLVALAGYALAGLVGTYFLVRFRRLHCVRQVQPWYCI
                     VHYVCYGGFIAYFMSAGSMRRCRGSQDIGKRTASLWGASSQLLPRWTRTSAGASPPQP
                     DWAQPASQSSSVSTLWQVGVLLGQVVLDAFLSPWTEVVPASSSPAAATRIVRLYDIYE
                     PLLQAIAATAFFSSFALLCNARWRYAVMGTAERHPGLWRAIVGFTTTTATPAALVGAT
                     DEVNKDGASILDGAGTYAAAAASLSPPMRRGSVVAPRILVPQSLAAQRRRSALASSYV
                     NHARDRGGSTQGNLADSGVSTRISISTPGAEDVCGGGDLTATVRAKQVKRATGGHEAT
                     AAAAPSLNDVLVKDATLRGSRRKSWRRSLRPARPQQQQKRTPSPTNDDYDDIDDDDEK
                     VWNIVEPGSSASHVTSSSPFRDYEDPSSTSSSRWRRLLRCSWWRLWSFSACECEEGQE
                     RTSRTGRAGDGDRGCSSRERHRHLQHLRQRLLVAFWLSDVVVVLLTFLMFALLAVARV
                     AAATATASAWAAVEASTTQESSGPERGRRGGQRLLTATAAAAAVPCPTEGFVGVAGLL
                     LLAAVRVLVGRWMRLPGQLLTAASAAAAAASVATPAARQQQLRPRLPCRTWRRLGNST
                     FRGSLDLWHLPSTRRLHGMETAGSAAMSATAAAAVVSMTPVPFHFRHVLTVALLLLML
                     QFFSDAAWAWAAAVLLTTGSAVANLVDAVADPLRWVSTEYRRLLCRTWWELFFSFSFT
                     PPSLESVNAQGQHVAGSMPAATPGPLGGPGLPAAVGRELLVSRGNSIGMAVSAAVMPP
                     FGSRLRRHSIAHRSARLMKAGGGTSPPWTVRRLGASFTGAAVDPASSLPPPSAVTATA
                     ATVLGEGATGVVAGEGREDDGLLGGDAPGSHGVDGAGAAVVTAVSPMQFWHSVAAKVL
                     QQSGRATGEAAELGSSSSRALGGAEDVNGVGVVPTVATALLHTMPAVNPLTMLSPTPG
                     MEHLSSTPARFTRENLKGSMLLTLPTVARVGGKAEAAELEMRERLLAMERAKLRHEER
                     AMRVRRLSASDTMAAASTLSDENETKLHAGNPPAHSAVPGAREHADHQDDGGGAPENA
                     KEAQQQQSVTQDGWLSRALATVVPSFAATRCICEGDGVPPSSPSTQLDSTSTMLNVSF
                     SESVSLSSSTARAWTDEEEGFARFLDCVSRNGDNTYALQSLLAVYGHTYRHRVDAKGR
                     SALHYAAMGGFVQGAIFLSRIGAEPNVLDKAGYAPLHYAVLYRTEVHTSPHITAESPS
                     AAVQGARHLVGIPIVETTAVQAAAQATRRRRRDQQQRLKWVQAQLQAAYSAGSDASSG
                     MENRKSSGRSPQKTACTKTARETSLRTRTDPVTTSTPGKPLAVSPLQIFTPSSQRPLS
                     SMSVSNVAAGSTSSAVRGPNPTAIPATTTAVPATTAAAAAAAAVVEPEEGHWYGMVGA
                     LVRLGAQVDLPTAKGLTALHLAVMQGSVGLVNTLLREGANPLLGLEVETLSLASVINA
                     ASCWESDKENTEVLVKGAGKTAAPCSSGGQANDQAATHPTQQQQQALSDTPQRTSNKG
                     RDTTSLVSSENDNSHKALGNASVPLAAFTQHCEWVDMHITNAGNPIANGYCKSPLLLA
                     VELDADLAVASMLHRVALQATTARVVAGLSQSMVAAPRMPERPPPAALAAPPGAASLL
                     AMVSMPHDSLASLPVAAASGGLPTSPASRSRAFTASAVHPLADNGAGDAATALPSPMS
                     AAAAAIPDSPSTRTWWERCCLHGFNPVHIALVLGNAQVARVLLLQGCYTEDVVHDRDA
                     AAAPHKRVRKAEKLGGRARRSSLNKLRTITTATPALPEGALATTRTTVPSLLSSQATA
                     APDVTDSTSLDLASGANISFHVEGLAAEQQQQQPVLAHVAAPLSEEADGCSRYTSVSG
                     EAAAAPTATLSLVPAVFWVRPLRLNLFHLAAVGNSTECLAYVLRWRGAPDYVPCALDD
                     VFENEQRGESVRRESATATQGAYQRRRQQRRLRAYQSSQAACNLAGVAESLAVVAATT
                     EPNPPNAEEYVLPADGGSSSSSSASAPGVGHMMASGGGAAAAEAAPLLEKIVELDDVS
                     RSPSSLPVAAATSEVVAGIEAALQRSLSPSSTNRSRTGTTEMAFKSDTDVIASSSSSD
                     IFNHTWSSARWSAESNEAASMAAAPTTPLRERRTRAKQQGFVRALVTLLQTNIRVDAV
                     RRRMRKTVFGRSASRKTTSPRRVHSRRQSSQRLRMDGGDDEDGDGSNDNTVMAKTCFG
                     SISAAAALHMDMAVCYANMGHPPRRRKRGECGSEKDADDSSSRSSSSSSNHENVKCRI
                     VEAPGAPRELYRRATKGAERPRRQRASAFVSAVAKLRHCITGVPIDFTHLAAVETAVD
                     RACAQMVSASSRRALQQALLIVARRLQNQHRRAQLVTGLSCVAAAATAAMEAAAAQDD
                     GQASRAESDDESTRITTTLATVEVSTGNVGGNGDSVSAGKSESLISSLSRSRQRDRVM
                     EAAHHHHRRCSSSSCPSPDSPSAMSYYSSFHSIMTTTATTMRGSSPAAPDARASVSAS
                     DEEKPRRRKQHRQQSALRLLRALSAELNAVDTRGLTPLHYAIANQNASMVYLLCAYGA
                     TFAFASEQTEAHLMGRSAEVIAAAAAVEHHTDGCDMVTVVASDTQPAASQEELQSTTA
                     PTDSMSQASSLPTAWTYARAQLSSPSINVSTDTLSSLGKIYYAQLTPSTQEALRRAAK
                     AGSAEYLLRMPTQEDREAERQQRKLPSPLPVSEARDAARTNPQRSVSPLAPHAVLSPA
                     APTTTVMSATVAEREDSPATAQLRSTSPVMVPVSCLTAASQQPTTMAATLTAALGISD
                     ADVATRATAAPPDAFLSAKEPLAKASMMTGGVKDGGGGGDALGAQLQTHLIHQEIRTL
                     QSMIAGNDSGSVNGEDLAACLRPPPQRLRTSPNADVSLDETEDEATAAANLMVGRPFK
                     QDVGQETPRQPNASSSSAPKTSAAMRTPAAATSVGAEAASSTGVTEPTQGARGAAVPP
                     SSPSSNAAAAAVEYTLLEPHDVFITHVVRNPAKAETIMRAAMEGTALRYLFLASVVSG
                     GSL"
     gene            complement(<254218..>254724)
                     /locus_tag="LMJF_04_0610"
                     /db_xref="GeneID:3684909"
     mRNA            complement(<254218..>254724)
                     /locus_tag="LMJF_04_0610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883457.1"
                     /db_xref="GeneID:3684909"
     CDS             complement(254218..254724)
                     /locus_tag="LMJF_04_0610"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888550.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684909"
                     /db_xref="UniProtKB/TrEMBL:Q9NEE1"
                     /translation="MSISSSSGNNHGGNAPPPPPLTPEEKAARDARLQREHESYIRGI
                     ATMRSLPRLRSTIAGAGGKTNTNTRIAEEREEVRQQHLRAAAAAAAALLQRRQVHQET
                     VAKLESVQAKKRNRRAAKKAKKQQRLEEMLRSKLDSGSDASSDGSALSSSASASPSRD
                     SDDDGEDA"
     gene            complement(<255550..>259290)
                     /locus_tag="LMJF_04_0620"
                     /db_xref="GeneID:3684910"
     mRNA            complement(<255550..>259290)
                     /locus_tag="LMJF_04_0620"
                     /product="hypothetical protein"
                     /transcript_id="XM_883459.1"
                     /db_xref="GeneID:3684910"
     CDS             complement(255550..259290)
                     /locus_tag="LMJF_04_0620"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_888552.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684910"
                     /db_xref="UniProtKB/TrEMBL:Q9NEE0"
                     /translation="MQPPPQQQRSVCPLSSVSAPKPPPRTGQAEGKNDGGCAPSAGEG
                     HVIRASTYALWEQLYAPASVPLTVERFLYLRLSAKGNGESNDARGHQYCADDLKWVRS
                     LFGEVTTQLDASAPSASMALSTAPAAAVAPGEQSRGAPLNAATAVATAASLQESRDDK
                     GRDEPQRAWKGSLPDVASSVAAPPTEQCTSADVEQTSVSTPLRVPQACANAKSASVVD
                     SGRASEPRSAATTLSHPDAVIASDVSLSCASAAPMSIERDDSANCIDENEEPEPCVDT
                     WSVEAASAAPALHRHTPSTSVAAVRTDEKGRRNGSGRDTGCSPPLVHSASRGGDGEGC
                     GAVDDEQAHTLAQQEKAAESCGAWESATATTTPVRPYRLYCRYRTSHDTDPSAEGGNG
                     NEEEDAEHGGRGEEDSNDVGFLSLATSPSAAAPEQWRPCPVVGTDVGHSTPSPKPTVV
                     LEDTMTALAVSALPCGLTRNGEDGSRLDSPMRHRHTARVSTSMSPVVDPNGLVFSPSC
                     RQQMRLRLQRRCPRQTSEGSDAEYAPHTPVPGSPSQSPRPPPSCWSTPLLRERCRRDA
                     QTPPAPAPLSAASQPPVSPAPSPTDMADRGAGATDELCAGSHAADAAVMGASPSRVIH
                     LKKEKAVVTVSNIGQERRRSAAATANEDDAEPRDAVALDSPVDASCSAEAGDDGQGRR
                     DGSSVAPVAIGVEDERVGGDEEDAEGDAVEPASTVSLSPQRPSLECPAQRRATAAPRS
                     DHAEGHTECDFPSAEKAVRTANSVPAPVADVSVAPSSPSTSPPPHASHESFNPSTHGE
                     EPQQRHPHRPLPENRAARRSVSNMDFRWADEADDILRRQQQRVYSLQAARTATLAGGD
                     TRCSPSTSRCSPGGGPRRYTPLSQDGETAQGSQSGDGTRLARAYGGSEASYSVSPQPQ
                     DPGTHHYSERAMMRREGMGVEAVASHTDGSGIVTEQGDVAPSSHRAGRSEELACLSVT
                     RSGEGRADIALASTSSSTPPTAPLRQPLLASVAEAAAADDASMPHTDRLQQQQQPAPH
                     HAGTKRLRENHGGDDGRSDAAHARRSPAPSSVPVSSQTVTKRKRSDGSGGAPSRERRH
                     RTDDRVRRRQNSRGNMAAKTATRSMLCASPATVFALPRNISVDPGASMAAPSLTTAAP
                     PAGPSLSLLRPRAGNCASDSPSAAPAPKGAKGTSTHLGAASLPHRRCGLAVTREGAQQ
                     QSTQDCARGGALHALPRGHKQAARQSTTAPVVRREGECVQDM"
     gene            complement(<262507..>263523)
                     /locus_tag="LMJF_04_0625"
                     /db_xref="GeneID:12981689"
     mRNA            complement(<262507..>263523)
                     /locus_tag="LMJF_04_0625"
                     /product="hypothetical protein"
                     /transcript_id="XM_003723204.1"
                     /db_xref="GeneID:12981689"
     CDS             complement(262507..263523)
                     /locus_tag="LMJF_04_0625"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003723252.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0625"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0625"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981689"
                     /db_xref="UniProtKB/TrEMBL:E9ACP8"
                     /translation="MSNGKEQVIALLQELGTTAIPKFVDSGEALAYMAYKDGVLEKAI
                     TLLNSEHSEPKSSSIEPLRVNSEQLANAVIERVFDEHTRVLRSKLAEAEKAAGMWKKV
                     ALCGGAEEGKSVCHTALAQSTLCVPARVSVGSQVCSTDEDTAAFDSNASVQQRKLVCE
                     AVKEWLAGWTAKMLSTVGEKLELWCSSQLGLTPVRITQDEHEVRRPSLDDSLMALDSQ
                     NSSRHAPRQVDNARLSSGKISSRGKNKISARKTSPSLALSPGENHVQPLILSPLNAAA
                     SSVPTPSHPKVGTHSPQYAQPGSQLYVMRTMSLKARAKQLNGKQQAAISNIPVSRKPH
                     LPHI"
     gene            complement(<264201..>264803)
                     /locus_tag="LMJF_04_0630"
                     /db_xref="GeneID:3684911"
     mRNA            complement(<264201..>264803)
                     /locus_tag="LMJF_04_0630"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883461.1"
                     /db_xref="GeneID:3684911"
     CDS             complement(264201..264803)
                     /locus_tag="LMJF_04_0630"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888554.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684911"
                     /db_xref="UniProtKB/TrEMBL:Q9NED9"
                     /translation="MTMNFGNMTLGGAMATFGGQSNPMCNYTSPLAKKFVYKEVGKVY
                     YPLRRHVFRTKVRTAAEIRFNEIVKRYMKEKMTFKRGCYAATITNTVELDHMGSIIPK
                     DEYEVKRLTSYMTSKKMSNDYKKHMQELWTRVLFVCESTNLVGVTENAMHQNSRPGTD
                     EEFMSLIWYSSFVTTLMAFVVTLCIWWYRYGQAPQYAEFK"
     gene            complement(<266352..>267341)
                     /locus_tag="LMJF_04_0640"
                     /db_xref="GeneID:3684912"
     mRNA            complement(<266352..>267341)
                     /locus_tag="LMJF_04_0640"
                     /product="hypothetical protein"
                     /transcript_id="XM_883463.1"
                     /db_xref="GeneID:3684912"
     CDS             complement(266352..267341)
                     /locus_tag="LMJF_04_0640"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_888556.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684912"
                     /db_xref="GOA:Q9NED8"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q9NED8"
                     /translation="MEHRPRPELTFAQARYVNTSHPATATFPAACNIFASVSSSGSMA
                     LNLLRVAVPALALVMLILWMARFVVMHLEARRMRQQATHWRTLPSYAEVQAMAAALRP
                     TRPASSQEAAEDDTTPAAAAEAGDAMHCIICFSTVVDHPVELLPCGHQQFCARCLVQI
                     WQCSGIYRRLRCPLCRQPAELVCPVIVANSKPSVDDVLLLQNYNGGFCGTKKVSLLDC
                     CVLRLRVITHARLLPIVIGLRIAVLHATMFAYMLMPTSLTEVVDGAVQQQQAVKPNVP
                     SSALAAAYASVVRVFTVVVYTAARYADDFFLVAVSIILTGHLLQSALFKDLKL"
     gene            complement(<269237..>272947)
                     /locus_tag="LMJF_04_0650"
                     /db_xref="GeneID:3684913"
     mRNA            complement(<269237..>272947)
                     /locus_tag="LMJF_04_0650"
                     /product="serine-threonine protein kinase-like protein"
                     /transcript_id="XM_883465.1"
                     /db_xref="GeneID:3684913"
     CDS             complement(269237..272947)
                     /locus_tag="LMJF_04_0650"
                     /codon_start=1
                     /product="serine-threonine protein kinase-like protein"
                     /protein_id="XP_888558.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684913"
                     /db_xref="GOA:Q9NED7"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:Q9NED7"
                     /translation="MNAPVHERSGTSSNSVPPAHKKQRYEGGCSGKVLHDRDADSVSV
                     WGVLVAQNLPSRENGLLAHASRCRCPVEGADVPRKESVTKLIASSSLCNPGEDWLWRH
                     VPPALRQLYFPACSHSASTYPCASASAECSEKCWTASLQQEGDKSHPSPPRLLLPLCS
                     TRSNNGAVRLGRLASNDIVFATNPCVSNVHCTIAYQPESDPRRGDAAAAQDKEAQRAA
                     FEATGAVAKVVDPLHHSPRPATEAPAVPHPRGDATGRNSAAAAHVVLSDSSTNGCIVN
                     GQKVGKGRSVRLRDGDVVELINAGTRHTTDYNLAFLFLTAEVFVRWVAQQPHQASTTQ
                     GADEEDIASAEKAAKKEHQQRQALPTAARRHALLCRAQWNVEAQVRRMYGHSVDEYYS
                     LDRAHPLGQGTFGTVYRAALRAEASASSQSPSLLDAGVGVAAGVPSSWEYVFSGDGVV
                     EWMANPAEVTELREAYIRGKEQRAPAAVLHVSASAASTTAAEADATTTDDAAPQVFAV
                     KIIRKQRMLVEALRQQQQQQQHLEEGEGGTDRAPVSCIHNATTVATPDTAEAVPGTIS
                     TADAAVIEQLLLMETQPDDLAAQRRKEWTAGVLASLQLADSTPAALAPSSSLSALRKS
                     QHKPRDDDDDSSDDGDAQPLPQQDREQRRRELIRCLPKALRRTYEKELQHRRRQQCEI
                     NILLAVRHRNITALYEVFDQPDHLALVMEQATGGEVWDLLQIYKRRERRGQTGARKSE
                     RGANNHRDTGAQRLGDGKSDSTTAAATAATCDDDDDVELVSVGGPLPEFMVKIIIVQV
                     IEAVLYLHTMGIIHRDLKLENLMLQRPCDRYALNALQLQTLVHQLRAYSRPHHASDAS
                     TSAATTCEEDSEAVEFTNPLSVLYTVHVPRHMWPVVKVMDFGLSHVLDQLQTHPFDAA
                     GAPHGFIGTLSQMSQGVEGSSAAAAAAAAREAVPERVKLIYSRNDATTSCGTPIYAAP
                     EVTNPALRPDKMGYGAAVDMYSVGVIAYALLTGRAPFPSAKNPRRPGGPPVVNYDAPL
                     RVQRHRRRPASAGPLPSSRPSSSAARPPSEVACLPPLSVAESVRVVLPKERAELSAAS
                     STASEQTRQWRRRAEAVAASVRCAEQKGAHAEGSDGGSSATLADPLFATTVEQLCASL
                     TAYADMCASGGLEVDLDRLVYVSADAAATGAQANASVGRVMAPDGHVADVLLPPISAL
                     GTSFLRGLLEKYPSRRLTAYEALQHPWLRECV"
     gene            complement(<273636..>274085)
                     /locus_tag="LMJF_04_0660"
                     /db_xref="GeneID:3684914"
     mRNA            complement(<273636..>274085)
                     /locus_tag="LMJF_04_0660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883467.1"
                     /db_xref="GeneID:3684914"
     CDS             complement(273636..274085)
                     /locus_tag="LMJF_04_0660"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888560.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684914"
                     /db_xref="UniProtKB/TrEMBL:Q9NED6"
                     /translation="MPRSRGGGGGGLRGGGRQGSFSGFRAERRPGTTSHPPQPNGVTN
                     IYVQRPMAGGGGSGILGTMAAVAGGSVLGHGISNYLYGHSNQAPTQPAEAQQLAQAAQ
                     QEGHVCTPQLVGYSKCLEANPESADSCKWAWDYFTQCQREHPMQPPQ"
     gene            complement(<275783..>276241)
                     /locus_tag="LMJF_04_0670"
                     /db_xref="GeneID:3684915"
     mRNA            complement(<275783..>276241)
                     /locus_tag="LMJF_04_0670"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883469.1"
                     /db_xref="GeneID:3684915"
     CDS             complement(275783..276241)
                     /locus_tag="LMJF_04_0670"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888562.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684915"
                     /db_xref="UniProtKB/TrEMBL:Q9NED5"
                     /translation="MARSRAAPRASGGSSHHAAAPPPPKKAEPLHQSTPHAHPPQPNG
                     VTNIYVQRPMAGGGGSGILGTMAAVAGGSVLGHGISNYLYGHSNQAPTQPAEAQQLAQ
                     AAQQEGHVCTPQLVGYSKCLEANPESADSCKWAWDYFTQCQREHPMQPPQ"
     gene            complement(<277572..>278018)
                     /locus_tag="LMJF_04_0680"
                     /db_xref="GeneID:3684924"
     mRNA            complement(<277572..>278018)
                     /locus_tag="LMJF_04_0680"
                     /product="putative ubiquitin-conjugating enzyme e2"
                     /transcript_id="XM_883471.1"
                     /db_xref="GeneID:3684924"
     CDS             complement(277572..278018)
                     /locus_tag="LMJF_04_0680"
                     /EC_number="6.3.2.19"
                     /codon_start=1
                     /product="putative ubiquitin-conjugating enzyme e2"
                     /protein_id="XP_888564.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684924"
                     /db_xref="GOA:Q9NED4"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:Q9NED4"
                     /translation="MLTTRIIKETEKLQKECPPGITATPTKENPRYFMVTIQGPPQSC
                     YEGGLFRLELFLPEEYPMKPPKVRFLTRIYHPNVDKVGRICLDIIKDKWSPALLINKV
                     LLSIQILMSSPNPDDPLANDVAEHWKEDEASALQTAREWTRKYAKP"
     gene            complement(<279952..>282216)
                     /locus_tag="LMJF_04_0690"
                     /db_xref="GeneID:3684925"
     mRNA            complement(<279952..>282216)
                     /locus_tag="LMJF_04_0690"
                     /product="hypothetical protein"
                     /transcript_id="XM_883473.1"
                     /db_xref="GeneID:3684925"
     CDS             complement(279952..282216)
                     /locus_tag="LMJF_04_0690"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_888566.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684925"
                     /db_xref="InterPro:IPR019347"
                     /db_xref="UniProtKB/TrEMBL:Q9NED3"
                     /translation="MRAVKSRNAGGLRSVRDVDSNRDAAAAPVHAKRAAAAASLTVAV
                     HRSDGSDTHREKGVPDDAMLEVSVGATGEEDKFPEDPLAVAFALDAPLTFTARDNPRV
                     VARLPLRFKDVLPTVCHQLQFRQRQATHQTSVDADSYSTKSNPLSSPVPPTADATSYA
                     QPPYQHAHLSDMVMRLLPIAVGQGRSCKTAMMHPSDSDEDPAAAATTVAAAAAHGPEN
                     TDKHLHQQQLAASAKARAGREAADAVLCAPARVPVLEDELYRKWAAEQILDYLFTSPT
                     SADGAGSVDRDEARRSFTVAACLSGMREVPAGTVEYVDLLRRMLALADSRRGAEPNDA
                     VDDADVDLPAYVRDVLVGVLPPENAPAADAANTASAVERLPVVTTTLRSTLDAVLPPR
                     LFLYYLIHQETAVAVQQQRQAAQQRQARLRRHLETHPDDVSVLEEIETLREALASEYA
                     EVPVGAVLVTLERTSDVQAPRDYLVKLEQTLDEVLQKVQARCCGRPLQLIRTNTARPS
                     CSRPQHTASASAASSGSPSSFDPSPPPDTQLKQKNASSSVKAASAKGREAPAAVTILA
                     TPDKWVCTHTLKPLPAQPVATSVSGGGSATVAATLNVLELNKERTLVQLSLLGEELLR
                     QVTVDLPERGILLRRLLDEAQLSIDARAILARERCKATQEHLLDGQDAREATAAQCKV
                     LESEVAELRSRLAYVTARKAALGAWVEEQKAQELTASRERAHFERNLRERLVAHTERV
                     KAAQDAERRSSLPG"
     gene            complement(<283441..>286785)
                     /locus_tag="LMJF_04_0700"
                     /db_xref="GeneID:3684926"
     mRNA            complement(<283441..>286785)
                     /locus_tag="LMJF_04_0700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883474.1"
                     /db_xref="GeneID:3684926"
     CDS             complement(283441..286785)
                     /locus_tag="LMJF_04_0700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888567.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684926"
                     /db_xref="UniProtKB/TrEMBL:Q9NED2"
                     /translation="MAPVSSCVFVEASETLAQRRTSAEMHPNVQQHDGLSARSPASPL
                     AQVPGRSDNTHTYDANASEEVDVVSATTCASSPEAVLEQPRHVAPPQQRPGRLQRAPR
                     RRWRSRSASAPELSLPTPPPQHLFTRARASREHANEDARSTGVSLSSVTAVGSRSRSS
                     SMLDGMRLSPPLVTTAAPGISGVTSADDEEHRAEHASVLSWNPRSRAHPLHGVTHHGS
                     SAKRKRCLGHRPWSASDGRPPPDSPQQPPLRTSLPSARPYTYDIPATLAGLLCRYLSR
                     TPPLSPVEAAAGVPLPEDGTACTRFLSVRWGCVEITAPQSQSSPHRRPPVEGCSWTAA
                     SSSPSARPPPRPPLRAASSPSPPPRLSATHVINKHDADKEKRGSSSGCSATSCHVPHR
                     SQQPQQQEHLWNLLTHYPRDASACLALGLSVCAALDAMRAAPPPVLPVAVLQDIAATT
                     ATEVCFFVHACEEAWQTPDNASPESTAAPPPLARSVDHATCTCGCLAAGQLLDPALYR
                     FHLLYYRHHHRYAPLPRGDGGEGQAGESVMRDAHNGGERNALEEARAAVFGHPHVQGQ
                     LPRHPQHAPLPPHYGRQVPGTAAERAPVPTATPPPPHFARVQGTSPTVLLPLLAVQTL
                     SRFVGVSNARRSSAMSRQRRRWGLRETRRSCQRSSAAPPGSTATASPPLLAADSASAA
                     ALDKQAISRPSTMQPAQTAKGKDDEAEADPVSNYAHFCDETERLWAVMASVLLAWKQL
                     EQCVSLTVLVPRLEVLPSSSLHARQFAPQSPSLHVSRSSDLSPLARAAASMRLHQTTV
                     EGMLLHAAFERAALARLRVRLLSLSPRPRDTAEANLSGDVASSLLMMESFLYSELKGR
                     IAHLPLWCAVAVEVLQLYIEQSRHDRALRERRAQEESDGATVPGAAGRNDHAAWDFVH
                     SSRVQQVVLLATRIMTLPCMFANGASTPALAAARAETPPPPPCRTCRWHRTSLANHAA
                     RAARECDDSQHASHDFQAAAATPASPVGAKVAVPVSAATVTQLSAVMARHPLFGVAVA
                     VVGGGVPLHWAEACVAPRAMNVHSLATVPPPPLPAQVNSRSGDGVDACRTRVAAMAAA
                     DAEAQTALRRLVQLLHKWLREAERRA"
     gene            complement(<287775..>290159)
                     /locus_tag="LMJF_04_0710"
                     /db_xref="GeneID:3684941"
     mRNA            complement(<287775..>290159)
                     /locus_tag="LMJF_04_0710"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883476.1"
                     /db_xref="GeneID:3684941"
     CDS             complement(287775..290159)
                     /locus_tag="LMJF_04_0710"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888569.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684941"
                     /db_xref="GOA:Q9U110"
                     /db_xref="InterPro:IPR001478"
                     /db_xref="InterPro:IPR010261"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q9U110"
                     /translation="MSAVDALAAAPSQPREHLNIIYADEGKRYKLSLRTPIGRLTIGK
                     VKQCLAAASSCPIPLHDMVLHLNGVPLSNDKDLCASLGIGNGATLSVEPRHPPRRCNG
                     GEGDGDGGAWQRHSPRMRGARGTPSPVGAAAAGSPASSSLSPPFPMSRQRRLLELQTL
                     QQADEMLRKDDAVRDDVLRHTMHHVEEEMDHANLHCRQLQRQRESAEEELHRMKEKEA
                     EAARERERLAVLRAQEAARATERAAQLVERREQLRAEQEAARAVAMLKLENEKKKALL
                     AQQQAFFDAERERAQLEQENFEATTKARELELRAREIDIEHLRLARIREARALDMDRR
                     LAVKQRLHYYAQLGVEAPRALQREAAALLLTEEGKTDDDAEDEEPAGNGSSHWPSAQR
                     HGPDSKMSVTGLNGHTRQSVARTLDTNNNDLVRSRGPSSSPLSHADQRVAGVATVPDG
                     GFYDARENAEENLRRLGDDLGLGDGLQFDDSNTCVISIDGEYTLLVMYDAATERLYLY
                     STLLASLPPVVQATAEGQLKLYEFLLEASLLGREMCGGGVGASLRNDFVLMSASLYMP
                     TSQPWSLRTLAPQFLHCLRHWRTKLTEFLQTLEAQEGCGQGGGTGAVPATPPAAARQS
                     PQHHVYTSAASSLSPSMARSAPHAGSAATSIASPHPKSSAASPSPLQASNSAAVAVTP
                     LAAPHTSSFNGSAKRVIPVLGLEVTGTVLVNGVPTHYQDGVLVVNAAGPSVLAGVQPN
                     DLIEALNGTRVRNVGDFRRVIEEELTPGMIVPVRINRGGVAMVVTVRVEAGRSL"
     gene            complement(<293778..>295928)
                     /locus_tag="LMJF_04_0720"
                     /db_xref="GeneID:3684940"
     mRNA            complement(<293778..>295928)
                     /locus_tag="LMJF_04_0720"
                     /product="hypothetical protein"
                     /transcript_id="XM_883478.1"
                     /db_xref="GeneID:3684940"
     CDS             complement(293778..295928)
                     /locus_tag="LMJF_04_0720"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_888571.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684940"
                     /db_xref="UniProtKB/TrEMBL:O97216"
                     /translation="MDSHASLTSLVMAFHTAVDEQQRSSSNTPFPSSCAWPDAGGPVS
                     HHAYRGTQRRVSSLSLNNEGATETTAASSAVDGASRPASATAAAAAGASSQQRALSPL
                     SCPEHHRRRSSTSSRHNLDSVVEEFLQKATYDADVPPGLLRFLQIQRNHQLQQQQQAQ
                     QHSQLHPRTHSPSVPTPSVNAVRNGARRTPPLQSWAVPLHGLDSATSRKAATAPMATN
                     SNDHDVLFHDYSSSCTVGRQFCWLTEAVAPGSPSSVAGEDEETGKALSATGEGGNSSA
                     HARPRPTTATTTVKQPEEDIFQQGHYSSHAMAAPPGNPQDAMERCHLSASALQRRYST
                     IADFCQGVRDGDGRGDGTTACFDSAASLVRLQRAYQPLSSTATVSSSHSPAFVDFLGS
                     RPCSQPEGVPRVLRVSDSSLLRRTRSDTGTTLAVSIHEAAGVQPWEPQQPRHSARNRG
                     ADSAGAGGGDTEATYQPTSSASLIPSPPSLIPSVLRGITTSASARFTVSGARQPPHVV
                     NGEDWRSRSCVPPSPLPQLSLAAPRASSRLSVSARLFSGAATANTTNLSNASTTDVSY
                     ANLPSSVAATCSMLAPTPSSADWGSFGSLGMSSVQQYHHHHHHHHHHHQPRFRRVRTG
                     GASNHSSSVFKPTGAEAAAAAAAAVSLIDVITAGNASGRISSYGEMEPSLTAGVTWIG
                     QISSYAASVTSPTTGTFTSTTNYCCSGASNSMTV"
     gene            complement(<297019..>299325)
                     /locus_tag="LMJF_04_0730"
                     /db_xref="GeneID:3684939"
     mRNA            complement(<297019..>299325)
                     /locus_tag="LMJF_04_0730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883480.1"
                     /db_xref="GeneID:3684939"
     CDS             complement(297019..299325)
                     /locus_tag="LMJF_04_0730"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888573.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684939"
                     /db_xref="InterPro:IPR010378"
                     /db_xref="UniProtKB/TrEMBL:O97215"
                     /translation="MCVCVCVCGGWQRERGGPLASRIGTRKSSRKGSRARTADCPTHA
                     GQRACSDSRCRRERPPSTPLLLFAPTPLSPLSALLCACSRHVREPQATRHPSSPPCPN
                     HQPPSASAFSLSLSSLMEPLPRQAAMRSPAAPGRVTAAAGPPASSAAQQGAAKGTVAA
                     DGTAMLTAPLGLQATVLSQPSFLPSLGEDLGDVTEEGDILFPVLGDPWSRVQRGQPPC
                     SRLTSTSTASPQQQQQQQQPTRGPVTMPVNLCFSTSICVQPVLTLPRKMGALLASEVF
                     RALLCFHNAANYSLTQARIHVGVAQPPAPLRRALLRCTVETLPPKSHYTLVAAAPLSE
                     ASTYALAVAVDYYDPSGLQRQLKWNSTFKTEQPIMEVQPRFLRYVRPTWTLAKDQPDG
                     SENDSESEPRSSTASRAYALYQLSIGLKNMSSVPLSLTDSKLVLPSLTHHRGAAVFRE
                     VVASDGRVESVQLRKCCSTSSTAAEASRVPAPVLLMPGDTHLLLFTVGILLEELRHAT
                     VVHGRGGLMTRRLSPRLASLGYVQWTWRRANGETGTARSAPLRVKELLAEAEVELCVT
                     HVIAESAAHPSTRPPSSKTTASEDGDVAAADPHHHALHQQTPPAPLLAGLPVTAHFKV
                     VNHSNVHRYDVAIKVRVERLAPQWLYTGPTVRLLGLLESASSLTFSLTLLPWQAGWRS
                     ISRDAIELVDARTLQAILWPPSATALLQSVSGESDVALGKAASISGDKADGREEATMA
                     ATAPAIAAVAMKALPAADADTLCDVLVL"
     gene            complement(<299645..>302095)
                     /locus_tag="LMJF_04_0740"
                     /db_xref="GeneID:3684938"
     mRNA            complement(<299645..>302095)
                     /locus_tag="LMJF_04_0740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883482.1"
                     /db_xref="GeneID:3684938"
     CDS             complement(299645..302095)
                     /locus_tag="LMJF_04_0740"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888575.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684938"
                     /db_xref="UniProtKB/TrEMBL:O97214"
                     /translation="MMALAATATVTASEVMESSISDSGEASGSSKSRSSSVDSARAVA
                     AARAYDTAAIAIIPGLVVPLTSASSKGGCAALASAVASLEALADTVDTVLHRLDKAAA
                     SQQRRLNAVQKRICICADFIDCLRGRRTSTLLESKPRYPQPVPFKPRSRDGGVRAKAV
                     KSQRGAQDGTNAAAIIISGVPSAVSTAHSHRFLRPRRSSPLPPVAPSSCSGSSTDDSD
                     DDAAQQPQQPSYQPPMRAVPVVSAFADSERAIATAHRGFAWCGGSLSDVSSPAPPVNA
                     VAAMRLAESMPLETVLLDGEESSAVTVGHGGRGEAAAGHLNGRGTLMNAASLQPSSSS
                     ALAWQPRCLPAVRGGQAMHNASEMPSTLSALVSFPARRMAYRHLVAASSSNGSDAKGA
                     IASAQHGAPIYRDPYSLTGLAATARSTPTTWLHSTSTVDIQCNFTTPLQAQQYAFVPG
                     GDAAAASSRALLRDMPRNLPLQHLATVRRWDQRGRDMQGHTSGSTGSDDVEEHDNDGG
                     PRQQRRASRRGPRGFETIAPGQEQRQRWARRRHAVGDGSTASEESDDDTEAATRAAHR
                     RRESSRARPKQQQARETSTQPTTTALSAPPAAPPSLAPPPPPGVTRSTTAPPPPPLPP
                     AALLQGKPNPPMIPLGSGGSAPPRLPPPPPPPPPPPPPASKLLSELKSASGSCPPLPP
                     PPPPPPTSSKMPVGAKPGGGGVAAPAAPRVPPPPPPPPQPQKSAVSALTSMLGERRRV
                     LQGDDSSSTSSGSDTGNGKYGGARRKQADSSDSSSSSTPPGVNPTARGRMVGSAAPRL
                     PPPPQLAGGSSSSSDDSD"
     gene            complement(<303003..>303644)
                     /locus_tag="LMJF_04_0750"
                     /db_xref="GeneID:3684937"
     mRNA            complement(<303003..>303644)
                     /locus_tag="LMJF_04_0750"
                     /product="putative 60S ribosomal protein L10"
                     /transcript_id="XM_883484.1"
                     /db_xref="GeneID:3684937"
     CDS             complement(303003..303644)
                     /locus_tag="LMJF_04_0750"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L10"
                     /protein_id="XP_888577.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0750"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684937"
                     /db_xref="GOA:O97213"
                     /db_xref="InterPro:IPR001197"
                     /db_xref="InterPro:IPR016180"
                     /db_xref="InterPro:IPR018255"
                     /db_xref="UniProtKB/TrEMBL:O97213"
                     /translation="MARRPSRCYRFCKNKPYPKSRFCRGVPDPKIRNFDIGRRRATVD
                     EFPVCIHVVSRELEQIASEALEAARIQANKYMVKRANKDVFHMRTRAHPFHVLRINKM
                     LSCAGADRLQTGMRGAFGKPNGVCARVRIGQILLSMRTKEAYVPQAFEALRRAKMKFP
                     GRQIIVMSKYWGFTNILRTEYEALRDAGKLEQRGTHCKLIAPKGKITMRNVMA"
     gene            complement(<304727..>305461)
                     /locus_tag="LMJF_04_0760"
                     /db_xref="GeneID:3684936"
     mRNA            complement(<304727..>305461)
                     /locus_tag="LMJF_04_0760"
                     /product="nascent polypeptide associated complex
                     subunit-like protein, copy 2"
                     /transcript_id="XM_883486.1"
                     /db_xref="GeneID:3684936"
     CDS             complement(304727..305461)
                     /locus_tag="LMJF_04_0760"
                     /codon_start=1
                     /product="nascent polypeptide associated complex
                     subunit-like protein, copy 2"
                     /protein_id="XP_888579.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684936"
                     /db_xref="InterPro:IPR002715"
                     /db_xref="InterPro:IPR016641"
                     /db_xref="UniProtKB/TrEMBL:O97212"
                     /translation="MLSVLHYRRLLLLSFPLHPFSPLSHPSHERAWCMCRSVCRRFIA
                     GLHRITFLFQRSITHTPPPPPPPPHSITMSVEEVQNAAAMADEEIPTLEAAEVPQNAK
                     QSKRYAKAMAKMGLKPEPNITKVTIRKVGSLSFAMVQPEVYRFPGTNTFVIFGEAQLE
                     DTSALAQEAAARAAVSGAASASSDAAASVPAAEEDDDEEVGAGDLDEKEINVVMSQAN
                     VSRSKAIKALKNNNGDIVNTIMELTM"
     gene            complement(<306534..>307052)
                     /locus_tag="LMJF_04_0770"
                     /db_xref="GeneID:3684884"
     mRNA            complement(<306534..>307052)
                     /locus_tag="LMJF_04_0770"
                     /product="nascent polypeptide associated complex
                     subunit-like protein, copy 1"
                     /transcript_id="XM_883488.1"
                     /db_xref="GeneID:3684884"
     CDS             complement(306534..307052)
                     /locus_tag="LMJF_04_0770"
                     /codon_start=1
                     /product="nascent polypeptide associated complex
                     subunit-like protein, copy 1"
                     /protein_id="XP_888581.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684884"
                     /db_xref="InterPro:IPR002715"
                     /db_xref="InterPro:IPR016641"
                     /db_xref="UniProtKB/TrEMBL:Q9U111"
                     /translation="MSVEEVQNAAAMADEEIPTLEAAEVPQNAKQSKRYAKAMAKMGL
                     KPEPNITKVTIRKVGSLSFAMVQPEVYRFPGTNTFVIFGEAQLEDTSALAQEAAARAA
                     VSGAASASSDAAASVPAAEEDDDEEVDAGDLDEKEINVVMSQANVSRSKAIKALKNNN
                     GDIVNTIMELTM"
     gene            complement(<307760..>309481)
                     /locus_tag="LMJF_04_0780"
                     /db_xref="GeneID:3684883"
     mRNA            complement(<307760..>309481)
                     /locus_tag="LMJF_04_0780"
                     /product="putative heat shock protein"
                     /transcript_id="XM_883490.1"
                     /db_xref="GeneID:3684883"
     CDS             complement(307760..309481)
                     /locus_tag="LMJF_04_0780"
                     /codon_start=1
                     /product="putative heat shock protein"
                     /protein_id="XP_888583.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684883"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:O97211"
                     /translation="MLPRQCSGELYQVLELDAQCTTAEISQQYRRLALRYHPDRNAGA
                     TVEQFQRIEEAHRVLSDLRQRQLYDTVGREGLKQLGDYGSGMVGSLLLAVGNVAAGCL
                     LLGFMTASLFIALLISCYKIDAPREWPSWGVVLIPVWCFLPVLLLASLTVMMTSVRRG
                     MYILLLPSVRLLLCVVIATTTAAALDHRIAPLTAFIPWLIWYVLGTVSDLAMLVPTVY
                     SRTHSPLFGEGEDAGVRGNHHTNTSVEDPFLWPGSGHGEASSIDESEATHSSGAEGGF
                     GNDSFLSQPWKTARYWREVAEVLFEAVCVYTFLALAFRRAVQQQAYLGSLHSLPRSRG
                     TAGDSIAAAPPVLSFWVILAPLMTYFGVHVLISVLEGSFMDSTVATTPASPEETPVAQ
                     STSPNAAAPSSSPQQCTHRRRVSCRERVANVILRVFPSACGLYMTCMWAMKGEYEYNK
                     RTSGPDPSAFLAFLPILVVLGALAFLVCCGGCLVMCIGSAVFPAESAAADFAATGGSG
                     ASHVSAGRNSRERNYRSTVSRTSPTSGNRSHTHARPSQHAGGTGAATLPSFRGGSATD
                     VAIEQVD"
     gene            complement(<310500..>313733)
                     /locus_tag="LMJF_04_0790"
                     /db_xref="GeneID:3684882"
     mRNA            complement(<310500..>313733)
                     /locus_tag="LMJF_04_0790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883492.1"
                     /db_xref="GeneID:3684882"
     CDS             complement(310500..313733)
                     /locus_tag="LMJF_04_0790"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888585.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684882"
                     /db_xref="UniProtKB/TrEMBL:O97217"
                     /translation="MGSNVSVLLHADTPVPNSVIMTQQKVRASPNVGSGGDVVVRCPK
                     IRVTAAEKVKHCLRSSGSACAAKRASPLSAEESPILVVADCAAPGAFTTSRTYVPVLN
                     AILDDMEARRTARAAAADAQNSGKAVCPIGIEFDPTLYLGDRLNRSEARAACTEYCKL
                     FFTHLIDALENVGKEVSVIAGGVVAPPRLSILYLDVRSCGLDDTTGPWLASSLIMRAV
                     RRTRPYALVSARANAAGSSEDGFLSYFSPDVKADMVWASLQHVLMAHNNMSLQGVEAV
                     LENLLADDATHDVLLQQQGVDAKALKSREVIRALTQDRLFPRQDSQLLPHLYLVDVRY
                     NQYSDAELQRLQGRTPDADNHRYAAYSYARPPVSQAQHSSHSGAQAHMKLSNDAAIRE
                     VWDGHKGAAPDAISASNPSSSATSSSVLSAAMSQLSVTTTSTEADPLWAKKASAATPP
                     PPSTDAQERREVAAPVHTPLPTPSPPLTPRGELRMAQPVHQPSGIQVRSHQASPASSQ
                     QAYLTKMVAAATSPTLATQQQTAMPTSPRVLSARHPTHSPYRVDVVEPPQVYKVLATQ
                     PPNSAREAPAAATSSHPTARRQSVPTAPSQGSSTVARACCLSELEREEGKLADAEVEV
                     QSLLLHQHRHLHPHSQHHSWQRSNGGGHNPSSSGADDEPWLDEVYTQSHGRGTSPEVG
                     AGSRRRFYSIPALAPPGPPFASSAARVTPTMWEAASRKRHESPAQVASRQASPTSSRR
                     RRRTIYDGVQPRVNSQRHVGNERLARAEYEAATAAEARAREWLREHAEQRGTAGLRSG
                     RGDPVSARQHPACDPSPSQRVECGRKWGRHSPLTELSSHSPAPQRPAAASSLTPTKAN
                     GAWASTHRRRVHQNHHAGAAAMPGTEQDSPAWRSHHPSTTASAITPAKRHLSTAEPPH
                     IVPRGTVTSRLRKVTSHRQRHFSEMEEREDTYCARNWQPRTTFRTASVTAAMRAPRAH
                     PLEMAAVLQEQKQRTSTEPHCDSDSSVYSAAMMMETSPLRSGDRVPRREWSSPVQRTS
                     RGRSVVPMSVPSQQSRCSATATSTPKCNENGAELVHVKLRTRARAAY"
     gene            complement(<315158..>316276)
                     /locus_tag="LMJF_04_0800"
                     /db_xref="GeneID:3684881"
     mRNA            complement(<315158..>316276)
                     /locus_tag="LMJF_04_0800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883494.1"
                     /db_xref="GeneID:3684881"
     CDS             complement(315158..316276)
                     /locus_tag="LMJF_04_0800"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888587.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684881"
                     /db_xref="UniProtKB/TrEMBL:O97210"
                     /translation="MGRPSLSSSEEVTTSPPTAFLPLLLLLLAASVCVIATTAAAPPP
                     SALVPSFPRTRHQASRPPLRLPMMDPYYGKARKPYVPIDTCSPGGTWVEERRYNRVRP
                     TVTGAAAAAMEPGASGASSPGADSLTAADRRPRRVLCGNWQEEDALERDLLAIQEAQL
                     QQQHNQASGELLTSSSAPVQHMQTFLKSGWNPTATMEVITEQPNGIYTGGHTSTPYLT
                     CDSRHPTMRSLDSTYRVEFNSTSSNVTSLRRPDLGVRSQRLMEQARVAAKEMQAADLR
                     ARQEQQQLREVSMKWMSRSCGPNVSEYRATMCDENEVLPIVEELSQDYLSDEPITLYT
                     GNPNTGKTMTVHGKTPVDPVSSSRFGKHTHFSEFKYAY"
     gene            complement(<317131..>319146)
                     /locus_tag="LMJF_04_0810"
                     /db_xref="GeneID:3684880"
     mRNA            complement(<317131..>319146)
                     /locus_tag="LMJF_04_0810"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883496.1"
                     /db_xref="GeneID:3684880"
     CDS             complement(317131..319146)
                     /locus_tag="LMJF_04_0810"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888589.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684880"
                     /db_xref="GOA:O97209"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR010613"
                     /translation="MVHKKQAWAKRVKKERFKKKFLTRMQATRLLQMESVQFRRLCIL
                     KGIYPRALNRSKQKQSGNEKQYYLAREIKWLVRDQIAEKMMAYRAWEKKVKRAEAMGR
                     SEDLKVLQTSRVKPRHSLVATIKERYPYFIDAIRDVDDAMSMIHLYAFLSPEIKSDTT
                     IEIHHSLTSGLSERAKEVCERWDRYVARARVLTKGFISIKGYYYEAIVKGERVRWLCP
                     HEYAHRFPPGIQQYVMLSFLEFYLEMMKFVLFKLESDLARDEADRLAAEDEEGVTRAN
                     AEDFANGAALAVLDVGANQAQAKAVKEAESKRSLMEEELHKVRELFRGLTFFISREVP
                     AKHFALVINACGGRVATDYVPSNITHVVVDRPALPPGMKKHDQLEYVQPQYIFDCLNA
                     RLVLPVTGYRIGEELPPHVSPFSVSITNSAEDNAAVVQVKKDHPRIVGYVPARVHEIR
                     KLINPSYSAVDPEGKVAHLEDEYSDEESHVAVPEMDMEDDVSLSGDELAEARRKPAWQ
                     EEEVTEEVQRPKLSAFKVKKQREMNLMNAPTNEVVARRRQALRKAQEKSRQTETSEAR
                     LQRKMSEVKRQEAATRKMQLQVARKKAARFYKMVSGVVQGTAKKVATLEAKAKHIAEG
                     KLRKTEDGKGLVNKRLEARRQRAEAKGKKLKERKAGNPYKKLPKWVQ"
     gene            complement(<319874..>321379)
                     /locus_tag="LMJF_04_0820"
                     /db_xref="GeneID:3684879"
     mRNA            complement(<319874..>321379)
                     /locus_tag="LMJF_04_0820"
                     /product="putative peptide deformylase"
                     /transcript_id="XM_883498.2"
                     /db_xref="GeneID:3684879"
     CDS             complement(319874..321379)
                     /locus_tag="LMJF_04_0820"
                     /EC_number="3.5.1.-"
                     /codon_start=1
                     /product="putative peptide deformylase"
                     /protein_id="XP_888591.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684879"
                     /db_xref="GOA:Q9U112"
                     /db_xref="InterPro:IPR000181"
                     /db_xref="InterPro:IPR023635"
                     /db_xref="UniProtKB/TrEMBL:Q9U112"
                     /translation="MSCITSPPQPSSPPRMDAHTCVCIGITMPPAARQRKGARRSLTL
                     PLLSLPWRKIRDQEGGAVCAGPVQQLPWKVRAEAALQSRPSPPAIRRRYLALSLPMRT
                     SAAAAVAAAAHAGVRALHTATGVAGNSCGASPRATVAPPPHSGLTLPSFTRCGASSAA
                     FITRAHSVGCCGCAAAVKQHRLYSSHGCSSNSSGSFADSSRPYVPGQAVQETYPIIQL
                     PARSLWCRQYALDARRVAQGEYAGLISQVREARHYYQYPSMSAPQTGWNVQMFTLFDN
                     SVFINPVNLDEEVWRAEAARQGMSWVAFEEEKMRELRAEGLTGFAWEPCASSGFLLHY
                     IERPLTVRMRALDEHGKPFTVTLDKMRARMALHELDHLQGVLFTRRVVDTDHVVPMEG
                     FVTMSDWSDDYPSLEARSTFLYTIFTPPYHFVSDAVPDGNLLDRKFEDGIYPGCEQDR
                     QQRIELTAMEEIQRNVWRKEKAKRKEGGQQCGRGDVTAVEDDDGSGAAGAR"
     gene            complement(<322127..>326065)
                     /locus_tag="LMJF_04_0830"
                     /db_xref="GeneID:3684878"
     mRNA            complement(<322127..>326065)
                     /locus_tag="LMJF_04_0830"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883500.1"
                     /db_xref="GeneID:3684878"
     CDS             complement(322127..326065)
                     /locus_tag="LMJF_04_0830"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888593.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684878"
                     /db_xref="UniProtKB/TrEMBL:Q9U113"
                     /translation="MNSAQVDGTTAVPSEDNFAASSAKERQGSQAQEPQQPSLDDEAP
                     SSCVSTHSSRLPPRRHERLSVTEAPREPQRSFASPASSTAVPGSSAASETIRNGGALT
                     RRNGAAVLLATDSAAINGHISAGSSVAAAAPPLPPWGRKSSSSRTFSEKPPAEKSRDA
                     ADGAAPAWKTPARQQPPPPPETVVASPSPAAASLASLESAVIKADAMVRSWQQCIDTN
                     MENLSSSLASSVFRSGHSAAPGAAPPPAPPSTSASPAHLRDAAEEASQTSSRLKRTSQ
                     APSRSGAGEVHSKASKDSAEDGMNPACHQSAAASSVGVPATAEAVVTTRQPPSVRSRT
                     SSAVVGVVRRGNALVRPEVGEEHGATGSSASSVYQRLPRADPFDKESGSSSHCDSGAL
                     PPPPAFSSFASVPSVAAADAAATPKRARGSANHRSFSGSCGGALPPQRRDHQGSVTSR
                     TTAGFEPFHLHTVHRSAVRRSMSPCCAPPDPLSSMPAQERQRLLNLPHQLSTAPGTSR
                     LDMNFEQDVKELYRQMHLVDPHLLSRPGRRQFYIPEQADLFGMYPEPPMTTDEDGNEI
                     VKYLAPIPIRAQSFVPSQTRKSSQSPPMAPASGVQHGKAAGADATDGSNSGRAVVRPG
                     RGLSSFVVGYGEETTAKGRGGLTQPRGRIVSDITAPYRRNMAANTGRTGHIQRESLMA
                     NCLPPPCGSETPLPASARSLSSGMMAADESQTSTPFTIMRPTPSSELSNNIPVSDSEY
                     GYAQVTTARMMPTAAPLQDQQQPCVNAVAAFVEDEEYSYSVQSATVMVSSKPTLTVSA
                     AVVAHSSLGGGAGSSSSSHSEGISLQVKPTVAPPPTCVDANTTMVLDAGPKLTATSRP
                     TSTDGAPAAVAERRSRPVRSGEGAVNAAEKASASSLAAASVSLLTEAVTGASSCNNSS
                     AVASAVAAGGPSEPKKAPKDSRRSTGIVKSLLLPQQAEQLQPGESEAVAAAASQSTAP
                     TPKTAPSSVMDKSTHSLAFSVTASSTVVDPSTEPPIPTARRHADPVPVSLSPLSESSS
                     LSQRKWRERIQPTKETQVSPAASAAATAAAAASPSTSLAGTPPALPPPPQAKPAVAVS
                     SEPDKPSAVHEGHVSALERYRRKEAAMSKNGDMRRVYRRSRCSESSATVEAVTEVPAA
                     TAAQSDTVACSPPGLKPASTLSMTASSSSPNVVGGAAAGHRSRCRETPLVLDRGTQTE
                     FVFVLDDLQGRQLQQLQQKQLLKNMQLMQLQLQRQPLLIINAGSYSPSTFTTASTPRM
                     SLSPQPQTSGSTSPSMKPRQCSAGLSPTRQRRGHLVNDSRAVRDALWWPK"
     gene            complement(<327709..>330384)
                     /locus_tag="LMJF_04_0840"
                     /db_xref="GeneID:3684942"
     mRNA            complement(<327709..>330384)
                     /locus_tag="LMJF_04_0840"
                     /product="tyrosine phospatase-like protein"
                     /transcript_id="XM_883502.1"
                     /db_xref="GeneID:3684942"
     CDS             complement(327709..330384)
                     /locus_tag="LMJF_04_0840"
                     /EC_number="3.1.3.48"
                     /codon_start=1
                     /product="tyrosine phospatase-like protein"
                     /protein_id="XP_888595.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684942"
                     /db_xref="GOA:Q9U0Z9"
                     /db_xref="InterPro:IPR004861"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:Q9U0Z9"
                     /translation="MSAPPSQPHSMWVRRGHSTHDAAAALFEEMSHAARTGGGAGALP
                     TSLLTAAPRSHVQHLRGSRCGGTAADASLSQPSYSTGLSPAATTTTTVTSPSGGHTSL
                     PLALPNPLPTPSAATPYFYVHRLGSRRSAVGQYHVNCHSRGGSDPAAAPHAWGVPPSS
                     PTYPPPPSRSNLFPGLVSAATAGAPMDIENGAGHNSPGSLSTSSQSLTASTGLGGGAG
                     SGAVGGSHLTTPPTTRGTPAAAAAATPVAAPVYVWHSSSSMAGAAPWLRLHRPANAAA
                     ACVGGRRGSAAPAAGTSGRTGGVWTPQNPGSSGVGTLASPPHPTYSLTLLEHAHLSTV
                     FGAADEDAAQRSSTGGLSGRDTGGGVPAMTRGLSQPHHQQELHADPVAGSGASGSLSA
                     ALPLTLVPPFRFARVESGVYRGAYPVLRNFPYIRRLRLRTMVSLIPEPPTYDLKCFAE
                     AEHIQLHHIHAERAKGEVQLLPSELSEALQLIMNKDMHPLYIHCLDGRHVTGLVIMAL
                     RKLLQWDANVANAEFQRFTREVQDEAAFIADYTGPLLVPPHLPAWLWGGSIYDAATGQ
                     QKRLPTTIRLRLSTAVSGGAGSAAATAGGVAAAPGAGLGCVSASASGGASSVTGTGPV
                     NGPLSAASVAVGHKPKGTMRGPSGDLRSQAAAPWMCVPQAETVAADGQHYIDVDRLPV
                     APPLRGSLPGAAAPQWIPSAEPSAAASTGTVSGSGSGTGTLNVHLQLTRSSAHSSRST
                     SEKSNMAGLPAVVSAAAAASSTGGVGGDSRWQSTVSWDALQQHQRRLASSLIHRNAAP
                     SKGPGASGLLDGRVSALLWTPGLIVPSATVGGGSGIPGSGRVSGGSAGSSGGGGGAAG
                     GNANGGGGAVVGVNGPPTGSSQPPSARTPKRSYSR"
     gene            complement(<331841..>333043)
                     /locus_tag="LMJF_04_0850"
                     /db_xref="GeneID:3684943"
     mRNA            complement(<331841..>333043)
                     /locus_tag="LMJF_04_0850"
                     /product="putative serine peptidase, Clan S-, family S54"
                     /transcript_id="XM_883503.1"
                     /db_xref="GeneID:3684943"
     CDS             complement(331841..333043)
                     /locus_tag="LMJF_04_0850"
                     /codon_start=1
                     /product="putative serine peptidase, Clan S-, family S54"
                     /protein_id="XP_888596.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684943"
                     /db_xref="GOA:Q9U0Z8"
                     /db_xref="InterPro:IPR022764"
                     /db_xref="UniProtKB/TrEMBL:Q9U0Z8"
                     /translation="MQQPCFFAARCGAQRISRLATAAAATVSSSPAIMRCAMSSSSSS
                     STSSNGLLTVHASATAMHALHSGSLPVSSTLTQRNLSALATSLTALRTMRGAATIVVP
                     ARASFFAGAAVSPMATACSSLFAAQRCYGVARATRVALSPKKSNEGSGQLQGVNNLER
                     YKGEEEDEQKNGGGNEQENPFNMNSGPGYLPFPPPFHTINIVMILFLANVMCYLIMNL
                     GNDDWRDFVVEHCTLSHENWTRIYPLFTNAFYQENILQLLIDCWLLWQFGDTMLGFLG
                     NTRMTFFALLCTLGGSVIHVARQKFELYYGMDELEVRGRCYGPNPFIMGLVAIEGLIF
                     RHLNFIQQPPIPFLVLTAFVMVIDVWRIFTTKPEEHGAATGGALMAYLFWALPTRMLG
                     LDKLTATL"
     gene            complement(<333818..>335047)
                     /locus_tag="LMJF_04_0860"
                     /db_xref="GeneID:3684885"
     mRNA            complement(<333818..>335047)
                     /locus_tag="LMJF_04_0860"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883504.1"
                     /db_xref="GeneID:3684885"
     CDS             complement(333818..335047)
                     /locus_tag="LMJF_04_0860"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888597.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684885"
                     /db_xref="InterPro:IPR016082"
                     /db_xref="UniProtKB/TrEMBL:Q9U0Z7"
                     /translation="MRRCVMAKGEDPAHVAGWDDRQDAVEWWWTEANDSRGRQRLEAA
                     AAVAAAAASSTVGLPLFPRFSPGRRRRRRPPAPPPPPPPLFLSRHLHSMPWLWCTCVK
                     MQMYYTPTALTCPLSNSLAAHVGHIIVGVAALLPYSMLLFLTVMCNPRKHEPVLRAQR
                     IRWLTFHSLMFRLLRCITASPAVAASVAVAAAQTPTSLRPAAVCRRGVHLAPSVLAAS
                     APPPPPQQQQQPTSAAVPASTATSTTTIAAGPYRRVGNVFIVTCIDHPFKFSWEVNRM
                     LRELRLEFMGQTTVVPDIPPVRKRIWRVRHVVRVDQLDLDEAKALIGIPEHISFRDLA
                     GQIPPTFGRGGSVANPHMRSKMNFMRLRRMRLRDVMHRDQLEKRLLEERHHALQQQQQ
                     QQQGGGEAAAAAAATTA"
     gene            complement(<338400..>342125)
                     /locus_tag="LMJF_04_0870"
                     /db_xref="GeneID:3684886"
     mRNA            complement(<338400..>342125)
                     /locus_tag="LMJF_04_0870"
                     /product="hypothetical protein"
                     /transcript_id="XM_883505.1"
                     /db_xref="GeneID:3684886"
     CDS             complement(338400..342125)
                     /locus_tag="LMJF_04_0870"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_888598.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684886"
                     /db_xref="UniProtKB/TrEMBL:O97004"
                     /translation="MTADRVRSGSASRALNGMGLPASSTVAAAPQPQQGSLAAMSVLP
                     RTGSSSQQQMRLEATSRDGAPAHGVLLGSLTEYRPGSAVAYANWAAAARASTGASAAV
                     PYPSTAAVPALRASSSRDHSAGSPPEALSLSAQGSSENLFEHNAPGARQGGVQGSGAP
                     PLAPFQHRTSLDAGLQGGDVIASQGLRGSKHSIAVLKVTPGGRVQECTRPPTSDSTFQ
                     ADGGWSTPGVHAAPVQPPRRTSFNQVGSTTQLDSASAGVQVERIAPVSETSLSTMSRA
                     HVAMPQAVAADGVRQRPPRRSSTSSSAAIVQSSPCVAATTAAPVAAAKSTQPATFPMP
                     SSTTTSSPAASTQHTGSRLSCQSSHGPPRSTHSPERSTTALTAVSTDAALHHRPSCNG
                     AVREAGEPLLIGSSTLQVSTTTLTKTTKKVRYRLPDEPFDPDAPDPSDIGGLRAEEEA
                     ALLDPVSYTRAVDEVAGRYPMLLRRPSAQGGDALRGRRGSASSRLGDGAPRPTFLLDD
                     GNRWARATNRPTVATTRDPSGTATTQLPAPRILQKTGVAGKTAVPDTNSGPFPAHQRV
                     AADGNTAQASNGEEAGGHLLQRHVQQIATGKQLVKGTAFEPPSIGKQHTVRCRRAQDE
                     DRMNAAAAAQSALKDKGSSAGAAPPESRRRRSGNLEGLYAEILRRTQQNRRTMLPTTI
                     PPAAVPPQALPLQPPGAAVRAARPTTERRSGRPHLSSAEPAPSQRGSGVNPGVAPRLP
                     HTAPQPWSSSQPCIPISHEETLSDSEMSNRNGYRTPLMYSAPQREQQAPTPLARAGAT
                     ATGGAGPRLSNSVLHPSPGVPQPYQQQVVPPRLSFSLTRGPPPLAGGGRPVEPNQHLD
                     SASPRPQQQQQQQQCPSPHVRPGYGVAAAALSTGSHMPEYTSGRSGKYTSAVFAPPPP
                     PASELDHLRRSSGGKPCDCVSGSHAPPPPPARAQPSQHPLSSSSYGSSAYRRDDEDGE
                     GYNAAPFDSHYPADEAHAAGTHATSVTVTAVGRNSAGAPEQHSCATHVHGAPQVNNGT
                     GSSSQQRSRSWQHAEVNLPQRTAAVHKENLRAEGMERPHDEGRSHHRTHGSALPPPPH
                     PPPTTSAAASSSTAQRTAAGASGHLRYGSSSNAVHSTTLRTPSAVANAPTPTSHAAFV
                     TSQAEYNEALMSTSSCTTDTQPVAVSECGEDEMITDEDDGLVKKGPPVLVLGDEVFTP
                     DGYEYVKEGDEYAEYDEQSNTESEDSRGNHQELEEER"
     gene            complement(<344184..>344726)
                     /locus_tag="LMJF_04_0880"
                     /db_xref="GeneID:3684887"
     mRNA            complement(<344184..>344726)
                     /locus_tag="LMJF_04_0880"
                     /product="hypothetical protein"
                     /transcript_id="XM_883506.1"
                     /db_xref="GeneID:3684887"
     CDS             complement(344184..344726)
                     /locus_tag="LMJF_04_0880"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_888599.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684887"
                     /db_xref="UniProtKB/TrEMBL:O97006"
                     /translation="MRSTPHGPPPHPRTSSVRQDAITYPYAYAAPGRQAPSAGYEHDD
                     NTTAEAGPTRRCVPGRGNRAMPASNTGPYPSDVNRTLSYPEPAPARTAAPAVAIMQPS
                     SPFEQDHTPVVYTVQNTTTDTHRHETEYGGVLTIRTTTVTRTITERLVASDEDDDSSE
                     NGEVYLDDARNEASVPSLHR"
     gene            complement(<346752..>350591)
                     /locus_tag="LMJF_04_0890"
                     /db_xref="GeneID:3684888"
     mRNA            complement(<346752..>350591)
                     /locus_tag="LMJF_04_0890"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883507.1"
                     /db_xref="GeneID:3684888"
     CDS             complement(346752..350591)
                     /locus_tag="LMJF_04_0890"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888600.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684888"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:O97005"
                     /translation="MGNAASSPRRAPSASSSSSPARAFSTTPATEPRPTKMLVNAAPR
                     ASASNFRSPAAITAASVNRQARSQSPEARSASLQQAALQRRQRIPGTNGSGTNVHGHV
                     GTEEDLFLAFTRNADPISLRVLELIQQADAVPLDSPGEQLRLLQECYPLLERVPNSRF
                     DQLAVTVYQKEGDVYHQQGDIENAKNTYSRAITLAEKRVARQEADMYMVLKRYVLAMV
                     GMARIWYNHERDHQGFTFVDHKHHKVQAVDGGDALHDANSSMSSLESSLMSDGGSVFS
                     LNEAILKSMAPRPPRRQTGPHFQRVKMRAPHVMQSSQLNREDEFVLHSRMTRELVASP
                     CELLLLRCCEVVQIGHNSQSELLIPAQIELAQIYEDLTLYSRALLLVRRCAGILCSVY
                     DYDHPWVIHLMHRADRLEERLEEQMRNNMATKIQATWKMHRAMQQLEYTLGHPVRRHQ
                     RIPRKYRAMPDLDFLREYVGDMPADELLGDDADDGVYGGPGGDHGHYGQQAAEPEQWT
                     EVPPSAPVPESGRHTGDPRRPAGTPSARQERKPPYNATALVRYAPNEHAERGDTFTTL
                     VPNATVVGTTQDTQTDTDVHHTEYGDVLTVRTTTVTKTITEDLVDSAGDDTDEEPSED
                     EGQPAAPLHVGAPPPQRQQQQQPRHATHSTHPPQLEPAPYPPDDDADEYDEERECSWA
                     ERAPTELQQQQQPAPQAPPPPMRREKQTQVHPCGHVVTTQTRRAPPRVNKQTEAAWPL
                     RREEEAEPPRTSRQAATTASHPVRRETATHYNPDRGAHRAPAHQPPPPAPIPQRQPPV
                     PSPLPPSCRRRASGSRPAGGLEADNALYPTDSTPSIVARAPESRENSLPERPPPKADR
                     PRVHLHNSRAAENALDDEPSRSAQRGALPQQRHTQTAPPAHRSGAALEAPLDDYEDGN
                     APYQEEARSEVIAGSDAQPSSSAPSRLYVPDVRHNSRRELFRDLVEPNTAFQEEWNGC
                     PAFLPLLGHRRGSGRSSQSSSMPRTSSESGQLVQHALGHNGSHPSKQQKVPIQLYDRR
                     HQRGSDGQGQQSGMPMYLTTPTNEYPLALPQAAQQPRTVKTTRDYKVIKTRRVRTYTR
                     EPVSSIMDSENTSSHSGSVSIGESMSSAHWEVDSASVSGSTHVEYVEENDEHVDAASV
                     NSKPSNVSAPRQQQRQPSAKTPAGNVRVPHRPHKPRMPTPPTKPLAKATGDGNGNGNG
                     SSGDVVRRPSTLPTKAETVQVVSENPEDRDSDVLPKYSSRATKVTRHVKSGHHGTTTR
                     TTRRFSTPHQPVTDKQR"
     gene            complement(<351990..>357668)
                     /locus_tag="LMJF_04_0900"
                     /db_xref="GeneID:3684889"
     mRNA            complement(<351990..>357668)
                     /locus_tag="LMJF_04_0900"
                     /product="hypothetical protein"
                     /transcript_id="XM_883508.1"
                     /db_xref="GeneID:3684889"
     CDS             complement(351990..357668)
                     /locus_tag="LMJF_04_0900"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_888601.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684889"
                     /db_xref="UniProtKB/TrEMBL:O97007"
                     /translation="MSTARAGCSIRTTRAPLATPRPHTGRAWPMATSANTIYDSATVN
                     VYYRHPSGASPATAAACTSAAHAAPQQQQRAPSSRYSPSASPRLGSSHNRGVLFRTAP
                     LASAGLPLPPATAAAQRGSSQQHPLPPAPPQVSPHPARHNRQPTLSQLQHRSLVDSND
                     RRSAISPTGLLSRLSASGQSHGSPAPSSQHTPKCPASAAAPSSSPSLQPPVSSGVASL
                     MGGSHHRPPAPSAPCGVENVSRAAGARLGHARLVAGANSSRPLERPPPTSQTRRPVVY
                     VEPMAAIADARPAPQSQLDTNLQTHFTTPRAAASTWRTSNDGNATVAASPQQQQPQPS
                     LPLNYYALEPSLQLTQHRHVRHIVVRDFNSAPSSLHPQQQPVIVLVPQPRPAPPQQER
                     LPRLYSSTTRPAGGPSRGAVQNNIYAGMAAEDTSSGASEVTSTRSSRTRQVFRRAPVT
                     ASDIPTGSPYGAMPTYAVVMPQRSLPAPPKTGASAASAGLPPPSAPAEAAQQPQHNSR
                     CPPSSSRPSPQESRDHAAREQPLPQPPPQKRPALPQRHQPQRAETAKSQLPPRMRLPA
                     DPFYSEELIPEQRREGAWDGNASTQQSGHRGGHSVRVPSQQQLSLSHEEDLSLSAMLS
                     SATVAAPISTKTDPYAGHTAPDGEPRPLHVPMPPPIIQRPYAATEEEGAPRFSVRKVT
                     APQRESDAPSPRHSPPAEHTLLHSRGAADAGEAAAKETREQLSAAKEAVTAMTTAGVQ
                     SSKKPQQLQHEPDGSPNGDDVDELLEADDLIMQPSRPQSSRHGAAVGSSPIQSIHSPQ
                     SPAVECFSDAPRSVHAVTGSETTTEQQQQQRQHPEPQLRPTSLGRGAVASAESDRCAA
                     EEKAELTPPPPAQLLPTAMDDITERDVGEQSNYVYRGHMNMTLPQKMDAPRCGGSTAV
                     HGATEGLEPPQDVAVDVMGTAEELREGKEALCGPSTGADVGPKTLQEADDTSEPTGAS
                     AAPLVLRERYVYVDPLEEASMDAAYMLDTLEQQYVRINEETSEEMEDVMHVVELNRYD
                     RAAAMSRSFMPKGRYPDVLPMLRYPEDAVPADAFAATTTGSRSRPASSPSAGKLTYFP
                     LRETAYLNLCATVWLSRFHTAEARGLLAAEARGPASDDDTAANGADHEGACPSSAAVV
                     YHNLDHPSANLLAALDGRVSAHVQAFLSETCAGRDGADPCNYDAACVRLRDENNIGCL
                     PHGVWAEAAPQTLSFADHVTNILLTATVPHEAERRRAEAARKTTAEEVAARRTWLYFL
                     GASPWNYEVVAANDAYAAMPTAAARLAYAFMYKARTRNVDGGLGSLMFSMLSQQVPEA
                     AFVDCLLMQEKLRLALLHSCSNIVACCALRQRVLRTPQARVPSKETPSTSASVWTSPV
                     LSPYLTLYEGSATPPTRRPPDGASELFRLDRPAGVDEEASGKDGPSSTALCQHDDSHP
                     KEEATPCGADERVDLYSVAVQLNYFFPTKTQRGMHQLCAALIEDLIAMDALPVPEQVV
                     TPEGVVLTDRTSIVDALVVEGAQAMQHIIMTLSALRKEVQPETADSYRTLRGSIDTAA
                     VWATMEKRLILFDPAIMCFLSTPVPVNDLFEYAATDGPPSMQPQSTGRKSWLVEVLRL
                     QHVAETVQYTMEMQDAILVARQLNHLVVSAQRQRALAGKRDSGQQHGRYSTRSVAEEL
                     QMDAVVVGQSMDQVVRRASSASLLGMLGAGNGERTAADEPSLEDLLDPNTSRDSSDVS
                     VRAVLVALCSADPEKPTAEVQEYLRHLLALYFEVRTPDGNTVDSGDTQQVAMARLMTA
                     EMATWDWFGDTMQNGTLRAGAAPAHCDKIRVSAEELASLCPRVLGRRVGVASTVVADA
                     TAAVIAASTTEAVEPAPRAHDEGNDDDSVLVTESTLRLPQDSRRLFAQEM"
     gene            complement(<359955..>360701)
                     /locus_tag="LMJF_04_0910"
                     /db_xref="GeneID:3684890"
     mRNA            complement(<359955..>360701)
                     /locus_tag="LMJF_04_0910"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883509.1"
                     /db_xref="GeneID:3684890"
     CDS             complement(359955..360701)
                     /locus_tag="LMJF_04_0910"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888602.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684890"
                     /db_xref="UniProtKB/TrEMBL:O97008"
                     /translation="MANSRASTLAAAAAAASTAAVKPLSYVSLRSHDGKHVILPVAAA
                     AGSRVLHGIFQGLYVMRLHQCNSPADQPPHAQHEQYPMVEEDAQQGELHIPRSGSSSS
                     SGSDVANKAHGSAEVKVDDPIPIIEDEDDIEEDEARHQVNGAAYRSYAAVFPSNVACV
                     PPPPSPLLSTSPPAAPSPCVPPLLEVPICSLEFSTLMRVAEFLVVKITLASHPHYLHE
                     ANVFGDLDRTSERDQLVAMQVLLGADFLNC"
     gene            complement(<362254..>364053)
                     /locus_tag="LMJF_04_0920"
                     /db_xref="GeneID:3684891"
     mRNA            complement(<362254..>364053)
                     /locus_tag="LMJF_04_0920"
                     /product="hypothetical protein"
                     /transcript_id="XM_883510.1"
                     /db_xref="GeneID:3684891"
     CDS             complement(362254..364053)
                     /locus_tag="LMJF_04_0920"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_888603.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684891"
                     /db_xref="UniProtKB/TrEMBL:O97009"
                     /translation="MEQPPPEQWSSPSPVTMSGGVAPLPQPPLSGFNYRRNPALMMAE
                     VPTPPGTITIQDARAAPTTGLRRPQCGEPHFHTANATSSSPVPPMAIPYIALHNVGWK
                     DSNFKGRKWVIMPMVAGFESTFIANTLQGLLCLPGCESAMMGESAVTSSSDGGSRDGN
                     ASALGQDDSRRCGESGVVQQSSRSSSLAEPPPPPQQQQQQQAHEAAADDDDGLEQHSH
                     ARSPSPDGADEHSLSSSVTSDPIATEDRAARSSSADGGDAGKGSGARRAETVKSRDAG
                     CSPQALRGGIRSQWGTRVKTAASRTYAAYVMQHLSDANIQLRTPAPHDRLPSDAPVTD
                     TQVDNAEELESLRGQSATVPRCLAPVALPKEPRVAPQVSGGSGAGKARAHVSIFLAHE
                     AKEDEVCTSTCGTTSAAGAEPSEPSVTTTTVAPAAMPPGTASATAIAAVSPPEKAAVL
                     MGLEEGHSSDDNNSPTPSSREEEEEEELWVSTEDTSAGQAGGAAQNAETTRMTNRQVA
                     QDGSRYTCFASNCVDNMPNYPLPQLQSEDLVDLAAFMVVRSSLQPDEATDLHLGTHVL
                     GNPQNVRLLPPEQRAALMSRAARLMEAAVFLQV"
     gene            complement(<366592..>367668)
                     /locus_tag="LMJF_04_0930"
                     /db_xref="GeneID:3684892"
     mRNA            complement(<366592..>367668)
                     /locus_tag="LMJF_04_0930"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883511.1"
                     /db_xref="GeneID:3684892"
     CDS             complement(366592..367668)
                     /locus_tag="LMJF_04_0930"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888604.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684892"
                     /db_xref="InterPro:IPR013892"
                     /db_xref="UniProtKB/TrEMBL:Q9NFA5"
                     /translation="MYLSMISCARRKLPAPTGTSSLCVCVCVCRYPRPAPHICRPTRD
                     GERCRRNLIKRPHGEPPSRCVACPLPLLPRPSSSALCGAFQLLPRVAVRIPCETENET
                     DSFIPQRRRLAHSVTRDAVLCTLTHLPKSAQPSFGHGQVFFLSAGVTVRVHACGVPVT
                     TRNERRPRVSVSVSPDHPLSCAVARAVVEAAPAAVLHTHTHTRASEQQRTMSLYGARE
                     SGGDEMLTPGITGMSGNYRNESNCHRFWNRLMTCMRESQELDVLYDCRSRMLDMRECV
                     VRHKQSTWVMRETMTSIRHEGELRKWLRDYDEKMGHPPLLEAVAAVRKKVDAEGGVDI
                     MNPTVFKDPDMYIPRRGKVASADR"
     gene            complement(<368998..>370461)
                     /locus_tag="LMJF_04_0940"
                     /db_xref="GeneID:3684893"
     mRNA            complement(<368998..>370461)
                     /locus_tag="LMJF_04_0940"
                     /product="putative chaperone protein DNAj"
                     /transcript_id="XM_883512.1"
                     /db_xref="GeneID:3684893"
     CDS             complement(368998..370461)
                     /locus_tag="LMJF_04_0940"
                     /codon_start=1
                     /product="putative chaperone protein DNAj"
                     /protein_id="XP_888605.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684893"
                     /db_xref="GOA:O97016"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR012724"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:O97016"
                     /translation="MKAASCPPAAARLYRVYGPVHLLPRTTAMRRLAAASAMAVTAGS
                     LGETLLSSAAVSAGGAAHSAMGGSTALLQHRRWQSGGGSKKDLYSVLGVARNSTPEQI
                     KSAYKKRAKALHPDVNPSPTAAEDFAEAKQAYETLSDPQKRSMYDMTGNASAAGGFGG
                     PGGTGGGFNPFGAGGNPFAAGGNPFANMGGANQPGGGQGGFSFNDFEEIFQKMSNSGK
                     DKTRKPQGPEPGADIHYKLVLSFLEAVKGCQKEISYNTMRRCGACTGSGCQDTGSRTK
                     CPHCGGRGKKVMSTGFFHMQQDCTHCGGTGELGRTTCTQCSGKGIVKDRSVQTLPVPK
                     GVDNKERLKVTGKGEAGVRNGPPGNLYIEISVEDDPVFHREGSDIHVITPITLSCAVL
                     GGTVRVPTLTGEVETRVPVGTQQGDKLVLRGRGVHRPNHNKTGDFYIHFAVMLPKELT
                     EEQKKAIADFAKDERPLHLNDAQLQELKGRYRSWFAT"
     gene            complement(<371996..>372637)
                     /locus_tag="LMJF_04_0950"
                     /db_xref="GeneID:3684921"
     mRNA            complement(<371996..>372637)
                     /locus_tag="LMJF_04_0950"
                     /product="putative 60S ribosomal protein L10"
                     /transcript_id="XM_883513.1"
                     /db_xref="GeneID:3684921"
     CDS             complement(371996..372637)
                     /locus_tag="LMJF_04_0950"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L10"
                     /protein_id="XP_888606.1"
                     /db_xref="GeneID:3684921"
                     /db_xref="GOA:O97213"
                     /db_xref="InterPro:IPR001197"
                     /db_xref="InterPro:IPR016180"
                     /db_xref="InterPro:IPR018255"
                     /db_xref="UniProtKB/TrEMBL:O97213"
                     /translation="MARRPSRCYRFCKNKPYPKSRFCRGVPDPKIRNFDIGRRRATVD
                     EFPVCIHVVSRELEQIASEALEAARIQANKYMVKRANKDVFHMRTRAHPFHVLRINKM
                     LSCAGADRLQTGMRGAFGKPNGVCARVRIGQILLSMRTKEAYVPQAFEALRRAKMKFP
                     GRQIIVMSKYWGFTNILRTEYEALRDAGKLEQRGTHCKLIAPKGKITMRNVMA"
     gene            complement(<373534..>374169)
                     /locus_tag="LMJF_04_0960"
                     /db_xref="GeneID:3684920"
     mRNA            complement(<373534..>374169)
                     /locus_tag="LMJF_04_0960"
                     /product="putative adenylate kinase"
                     /transcript_id="XM_883514.1"
                     /db_xref="GeneID:3684920"
     CDS             complement(373534..374169)
                     /locus_tag="LMJF_04_0960"
                     /EC_number="2.7.4.3"
                     /codon_start=1
                     /product="putative adenylate kinase"
                     /protein_id="XP_888607.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684920"
                     /db_xref="GOA:Q9U1D3"
                     /db_xref="InterPro:IPR000850"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q9U1D3"
                     /translation="MSGETQQQQQQPQGTTPRKVFFILGGPGSGKGTNCARLVEDFGY
                     THFSAGELLREAARSGTGNLAKIGDIIRSGNIVPSEITVELLRQAIVDHPNSVGYVID
                     GFPRKEDQARMFEEGIAKPAGILYYDCSEATMEERLLSRGTNSTEKRDDDAAETIRHR
                     FRVNVQECMPVVEAYKANGRCHVIDANRDRDTVYAETKKVFLEMGEKPLKA"
     gene            complement(<375010..>376536)
                     /locus_tag="LMJF_04_0970"
                     /db_xref="GeneID:3684919"
     mRNA            complement(<375010..>376536)
                     /locus_tag="LMJF_04_0970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883515.1"
                     /db_xref="GeneID:3684919"
     CDS             complement(375010..376536)
                     /locus_tag="LMJF_04_0970"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888608.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684919"
                     /db_xref="UniProtKB/TrEMBL:Q9U1D2"
                     /translation="MPVVASRDYRASWEIPYDFHPRIHAYPGSRSAARPCMGAPSPTS
                     EASDAATAPRHQRVKRTLRHYRRGPRAATIAPAVAAPEDDQGAAQATTSSTAGSPRKL
                     APVAPPKPQCPSLPQQQRQPKRCTGRRPGQASHATPTSSAVNDEGDAGASPAVLLAPT
                     PPLHAAAKARSGVRGISAPSTALHQARSHATSLSTRCSVPQRPSSTTVGVARCLLASR
                     PTEYRGRGSGTQPPSSSSITAPATAAAAHTGYHHRTKPHYSLRPSYAAHCAQWRRHPV
                     PTIRVADQYHSPPAAREYRLRARQVRHASREDFVEALRSCMASGGQEVVPHSVVDALA
                     DTRDAGSFDPSLHNYNAMVTDAFHNSVEERAARLQATENRMWERIILNVAPLAVAHQH
                     VAGVGGCAVLDSGHVSSPICISSAPEVEYLDKGVADSNEAMAVVVRPFSDELLGDSEA
                     LRVAEAQRRWPKGREWDRQAAIQRAVGSTAQEAIIDLGIDPRYRQPGERPGCVNNRWV
                     "
     gene            complement(<377379..>378872)
                     /locus_tag="LMJF_04_0975"
                     /db_xref="GeneID:12981690"
     mRNA            complement(<377379..>378872)
                     /locus_tag="LMJF_04_0975"
                     /product="hypothetical protein"
                     /transcript_id="XM_003723205.1"
                     /db_xref="GeneID:12981690"
     CDS             complement(377379..378872)
                     /locus_tag="LMJF_04_0975"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003723253.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0975"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0975"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981690"
                     /db_xref="UniProtKB/TrEMBL:E9ACP9"
                     /translation="MASTVPWYCRYGVHGDLAKEVNVDGTVVYRTRERRCDCTPPRPC
                     PLVLPAASSHPHPPPPRRRPADPRTAPPRKCGRGRVVGTGRAHIAPSWQKAHTPLPDS
                     SLPCPSVEMDDTRRHVLVPPLAFDSAVGDFYAGYVSSTSHDAAATLPFIPVINPRPAV
                     AGVAPFTAADDPIAAATAPLGVGSCVDSLLIGMSPVPQPPVREWQPAAAAELGSAAPL
                     ASDAGNPQPSPPSLLQQDLLSPPVPPSAAAVAAPSSPCTVESHAVDRLCGFLHCPTCG
                     QRVAAAAPSALEAVRCMPAMCPMGPHVAPGAEHGTQARGAASVGRFCFLCGIDKQAPT
                     CKAEASVPPLLPSPQQQPLTATEGHTANAPAKEEACATHALPPAATCGNAAAAASATT
                     TPPPPSLPATAGAASPDLHLDQDLRTVDEVLSHLLRNATVNGGRVRPPCGLPQCRLCD
                     PPAAAATAPTVTPSTWMYPPWHCGWWGTQPVMCGSPAVAIVHHHYAK"
     gene            complement(<379216..>382821)
                     /locus_tag="LMJF_04_0980"
                     /db_xref="GeneID:3684918"
     mRNA            complement(<379216..>382821)
                     /locus_tag="LMJF_04_0980"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883516.1"
                     /db_xref="GeneID:3684918"
     CDS             complement(379216..382821)
                     /locus_tag="LMJF_04_0980"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888609.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684918"
                     /db_xref="UniProtKB/TrEMBL:Q9NF97"
                     /translation="MSQRHNRAVVSGQLAQMPWDANGLADDDNDELRTVLEDARTVQA
                     GHLGKSRPTAGPSLSRFPVGPSPHGDGHDHIRSRDNAEADLCETRQAQELGDDFFALY
                     TSQADAVSPNDRSGRGGATPSSANASATVAGSHGDDDDDAASPNDQENEGADRDNDVD
                     VPGEVRVGRADDHHAQQSQYVPECTEDLEEEDSIADSSESPVVSEQPVEGFRSEAQQP
                     PSRSDSAPATERPWQPECWPHPHPPPFAALPRPRQTRVTFHTQRYGAFIKAYLGLSDA
                     EVEQAQRRGRGICMIGVRKAPPSSSHLAASASYATPFSPPSSSSAAGAATGYTFQPMH
                     RRHSHHGFGEPVKVQRTFLRHSVLAVEGDAVFSELIDRAEVLYAVEQHRLDAAWKTHA
                     HDPGAAGEDAAAASATAVAGTPAQPPLYPQFRKLPRVTEPYLRPNARCIALHYGLPDR
                     AASDSSDGSAGRMATDTAAVQPKEGEGEERKPRTHRTSSTPAPPNPYPRASLMAVVCT
                     TRLEEGEEIYVSLESYYRCLDEVSWYRRCYSELNKRCGCPDGVLTPCTAAAEGGGGMK
                     EATAGQDDLIGNVYTGVRRFPEWPADLAYYHGVGRRHASRVAEAAFPFTLVSLAPAPE
                     LGDDQKGVVASAWLPYGTCLLYCGPAVATRKVERLVSERALRGDSAVARTTTTAQYEA
                     QTHPGGEEDDLSFVTDDTYALGLGRHGVCFGQGLTRYINHRYNTSRFGNVELCSVILS
                     VPSEFASAHGTAAAPAGGPEELKSASERATTKSAGVDASSSLTAEERVQVARAATAKR
                     PCHRRRVQRAKKGPPPPVAVASGAAAVPAAAVGDRLAALYAKPKRRPPRRRAPCLFLE
                     ERSFFVTVPFFLVTTDIPPGTSLLAWTYGEDYDAKLERQAVADGHVVPYADAVLLNRR
                     LAASPAADCRLQRYNGDYRFAVGAGDVVWRRRPVRLGIPSSPVDCAGGHDIVDVCVPP
                     PEEDLFVVVQTLRSSVERVLLRPLERVPLTSRQLGTLLREQHLDDYVSPHAPSNARLG
                     PQKGRRRVGRPPSANSKRQRAAALTHDWAAHWAVFRLTDISALAPAPFAGTSSCLTLH
                     ALARYEEALRTCVVATTDSVGLLLMDIDYSAVHRTRDTGGESAAHRLILVNLDDLHHA
                     TSLVRTSPGRAAAVPALCNGLLWPLYCMVQRPRAAAAAAFSAADDVLRARPGSRV"
     gene            complement(<383508..>384842)
                     /locus_tag="LMJF_04_0990"
                     /db_xref="GeneID:3684927"
     mRNA            complement(<383508..>384842)
                     /locus_tag="LMJF_04_0990"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883517.1"
                     /db_xref="GeneID:3684927"
     CDS             complement(383508..384842)
                     /locus_tag="LMJF_04_0990"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888610.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.0990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.0990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684927"
                     /db_xref="UniProtKB/TrEMBL:Q9NF96"
                     /translation="MRGDRSPCSHARSSQDEDVSIYLCVCVCACPSLSAPCYTSSAPS
                     HIALPAPPWHMRQPTLTHTHAHRESFRFHRIREWQIRNESHTHTHTQAARIGPSPLPP
                     TQSSAQLLLYRSVSRRRRVLSFACRVGRVLDISPPSLLSLSLSLCVCVCEKESETPMS
                     SDAALDEKLTELLRVMVSRLPVNKTLPAAVVQQLLRAKYGDTYPEAYVESCSAFISDT
                     VMKLMIEKEKAATAVTANGDASDEDDDDDDDSNASDEDDSDEGDSEEDEEEDAASDSD
                     DEDFDSDDDDDDGDDDDDDAEEPKKKSVRAEEVDGIVLKDQEAAAAPSSAVPVAERCK
                     AMAECLRKLSYHVRAPTAEESLEDYLREFLLVEFEKHGMDPNKYSKSDIKRYRIKREV
                     ELLQQDGASLSLDRRNRAGRGFSKGAGGSGSQASPSPSAASARQASMFLDDE"
     gene            complement(<385381..>388917)
                     /locus_tag="LMJF_04_1000"
                     /db_xref="GeneID:3684928"
     mRNA            complement(<385381..>388917)
                     /locus_tag="LMJF_04_1000"
                     /product="putative chloride channel protein"
                     /transcript_id="XM_883518.1"
                     /db_xref="GeneID:3684928"
     CDS             complement(385381..388917)
                     /locus_tag="LMJF_04_1000"
                     /codon_start=1
                     /product="putative chloride channel protein"
                     /protein_id="XP_888611.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.1000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.1000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684928"
                     /db_xref="GOA:Q9NF95"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR001807"
                     /db_xref="InterPro:IPR014743"
                     /db_xref="UniProtKB/TrEMBL:Q9NF95"
                     /translation="MQLSPDDFEGTVVGPPPHYRQSWLEWFWRALCETANPNTMHTEY
                     LTPAELEKQASFESLDYYKPYPDMYVEYLRESQEGRRYQYTQGDAAAASPMTEMSGGI
                     SHEADSGSAGRTRYSVSYPLGSMAESFARLQMDTAERHVTLRWLLHVVIALSVGVVAT
                     VVSYAVDILEKYRAEVLYRIMTSQRHRSVGNLQGLLYTVVGSVVLVAIAAGVVVYFEP
                     AASGGGIPDVMAYLNGVHLRKAMNLRTFIAKAISCICAVAGGLPVGLEAPLIHLGAIT
                     GAGVTQGRSRTLGFQTSMFQAFRNNKDRRDFITAGAACGVSVAFGAPIGGLLFVMEEV
                     SSFWDQSSNGQIFLATMLCFTFSTIINSIVEGRRLLGWVSNAAAVLFEVNITIPLNLV
                     SIIPSLFLGIIMGSLAAFFTKTNLILIKWRRRVLRPCQFRRLLEPVVIGAVFSTCMYV
                     LSLVSPCAELHDIGTVNETVQQWGTEGGWRLFNNTCTKPKTYSPLGTLNMASGKNTIR
                     HLFSRQTAGEFPVMTLIVYFLIYFASACMASGTSVSGGLVVPSLVLGAVFGRLFGLLM
                     FHIGVAKIPDVPRGYASADAWMDPGVFALIGAGAFLAGTSRMSMAICVIMVELSAELH
                     YLLPVMVAIVMSKTTADWLCEPLYHQMLLMDSVPYLPPNIVKPEFEQLTAADVMASEV
                     VTLRMRERTEVVLAALRDSTHHAFPVVEAVPIDDGAADGDDVKAKSPRRESASAFALR
                     KQDGTKRGSGEASAPPVTPAGAVAPRSATNTSTAASAATHVRYKFVGLVTREDLQVYF
                     TLPQLQEYNESLSTTSPMTTVPLTAKDSDGFGGRLAPCVLAIRHLSWTQWTWQKSRLF
                     FRTSDRYEWVRTHMPDGIPGRTEVGAGNDSFISENRLPPVLDLSLIVNRSPWVIPPFF
                     NLQMTYQTFRMMGLRHMVVVDGDTVAGMITRKDLLVNSLRHRMKELSARLATADSAAP
                     SLPPSYTKHGILGDQVQRSHSEGGRDEVDGGLPTRAGTRANSAAGPREFRDSASTNGR
                     GAVSAWKSPLPNVFASAGGEAPTKPHGSFLQSTEAAGAPATPSASISSPLTTLFGSAS
                     SHSTVHGNGGPGFPTASMVAAAAYRTATSSPPHVIAHEPRSEAAAALSWNGSRGVAEA
                     DTRDSSVANVFANGHQTPATSPLPADVMSLFN"
     gene            complement(<390501..>391169)
                     /locus_tag="LMJF_04_1010"
                     /db_xref="GeneID:3684929"
     mRNA            complement(<390501..>391169)
                     /locus_tag="LMJF_04_1010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883519.1"
                     /db_xref="GeneID:3684929"
     CDS             complement(390501..391169)
                     /locus_tag="LMJF_04_1010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888612.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.1010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.1010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684929"
                     /db_xref="GOA:Q9NF94"
                     /db_xref="InterPro:IPR009292"
                     /db_xref="UniProtKB/TrEMBL:Q9NF94"
                     /translation="MSDDGPPPVHDAHKRPRRTTSSRGAGRSVKAASSATCAVAQRRA
                     DPRFDPMFGRADRRMFEQNYGFLREAEAKEEAERRFRIQCLRCVIRRCELEEAGEDLD
                     EYDLSDYEQEVFGEDHQRELREMKLTPPQRLYAELEQLQRASQLYVSKTRDASVKDRR
                     SSVKKELLRKEVVAVKAGRKARPYFPKRAEVKRAMTADTFSRLNDKGGKAAVDRYVIR
                     KRKK"
     gene            complement(<391744..>392370)
                     /locus_tag="LMJF_04_1020"
                     /db_xref="GeneID:3684931"
     mRNA            complement(<391744..>392370)
                     /locus_tag="LMJF_04_1020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883520.1"
                     /db_xref="GeneID:3684931"
     CDS             complement(391744..392370)
                     /locus_tag="LMJF_04_1020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888613.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.1020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.1020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684931"
                     /db_xref="UniProtKB/TrEMBL:Q9NF93"
                     /translation="MHRKGERALKRQSAQAVVTKTFETAFGKEQACYGESRAGRGPIP
                     SCLSSVWERRLPPLPRTILSRYASHALACAAARCVCVCVCVCVYVCVCVCVCVSVPLM
                     SACCIHHHHHHHHHRPPFPFPFLCSFLFTYICSSLTHTHTHTHTQSVCVCVVSCVRVQ
                     WVSLAPPFRSSPRSMLSVSPTLAHRDAASACIWCMYIYIYVCICVCMT"
     gene            complement(<392527..>393111)
                     /locus_tag="LMJF_04_1030"
                     /db_xref="GeneID:3684930"
     mRNA            complement(<392527..>393111)
                     /locus_tag="LMJF_04_1030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883521.1"
                     /db_xref="GeneID:3684930"
     CDS             complement(392527..393111)
                     /locus_tag="LMJF_04_1030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888614.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.1030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.1030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684930"
                     /db_xref="InterPro:IPR013714"
                     /db_xref="UniProtKB/TrEMBL:Q9NF92"
                     /translation="MSGTHNGELRAPSRQSCCHRSWPVVFLIMSIIVVVLAFICVILG
                     FLHSAITVNVGFLGVYCLIFSLLALSAEVLQFSSLNGVLFVWMKYFHVLLYYRPRGVF
                     YILFGVLLLGTRTVEIIAGAVAIALGALILLVSMVAGMPEFEEAPEEEPHRRNGGRTS
                     SAAVRGTSPGTRSNAKTKTSAAPTGSKSHREPNV"
     gene            complement(<395306..>396463)
                     /locus_tag="LMJF_04_1040"
                     /db_xref="GeneID:3684932"
     mRNA            complement(<395306..>396463)
                     /locus_tag="LMJF_04_1040"
                     /product="acyltransferase-like protein, copy 1"
                     /transcript_id="XM_883522.1"
                     /db_xref="GeneID:3684932"
     CDS             complement(395306..396463)
                     /locus_tag="LMJF_04_1040"
                     /codon_start=1
                     /product="acyltransferase-like protein, copy 1"
                     /protein_id="XP_888615.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.1040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.1040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684932"
                     /db_xref="GOA:Q9NF91"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="UniProtKB/TrEMBL:Q9NF91"
                     /translation="MCITHQHQAVDGAARAVDRRHSTPSPHLPLPLPLPLPAQTTQHI
                     FSHVIESDAAAEVQSDRGRRRKMVSNSVLVVSIACAIWYVLLRQRLVPVKLMRAWFLM
                     VNILTILPVSALTKLVVQLGRLGVPTYCVQRLCIIPLVVAFRMVWWLNPQIRVHLCFE
                     LDGSGQRLSWEGISQHHSAYVGNHASFWDVYAFIGLTPFRQLLNTRTMMKSSLRKIPI
                     FGGVFDRVGHFPVYFKSDADGNFEVDKEKQAQVQEGIDAHIASGGNLAFFPEGAINKN
                     PRVLQTFRYGTFHTIFKHRMETYYMVHAGAEKTWPWWTMIGGMPTDMHVRVGRFPIDY
                     DHEDSKDVPRRMQQHMQKVYNEILAETDAKDAISAEATASCAATPTLGKQS"
     gene            complement(<398243..>399313)
                     /locus_tag="LMJF_04_1050"
                     /db_xref="GeneID:3684933"
     mRNA            complement(<398243..>399313)
                     /locus_tag="LMJF_04_1050"
                     /product="acyltransferase-like protein, copy 2"
                     /transcript_id="XM_883523.1"
                     /db_xref="GeneID:3684933"
     CDS             complement(398243..399313)
                     /locus_tag="LMJF_04_1050"
                     /codon_start=1
                     /product="acyltransferase-like protein, copy 2"
                     /protein_id="XP_888616.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.1050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.1050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684933"
                     /db_xref="GOA:Q9NF90"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="UniProtKB/TrEMBL:Q9NF90"
                     /translation="MGAAVARVVHETAARLPHLTGRQQGALLAVALGTGYTLLRQRLV
                     PKWVMQKWFLLSSTALIVPSSALVYLIDPLRYLGVPRRCVQRICVFIFGCIFKAVWWV
                     NPQIRMHVQFDANEHGKPACWDDIARTGAAFALNHTSFWDAFEMVGITPMSHLIQMRT
                     LMKSSLRKIPIFGGVFDRVGHFPVYFKSDADGNFHVDKEKQAIVSQHMRWHLRLGGNL
                     VFFPEGAVNKTPETLQAFRYGTFATVIEHRLRVYYVVSVGSEKTWPPRMGCGGLPADV
                     HIRIGAYPIDFDGDSSKNVAVGLQMRMQQVRDEIAAEVAAAEETRGRRRNGSVLEAKG
                     AKTLDIAPPHAAREVHATRATT"
     gene            complement(<400486..>401943)
                     /locus_tag="LMJF_04_1060"
                     /db_xref="GeneID:3684934"
     mRNA            complement(<400486..>401943)
                     /locus_tag="LMJF_04_1060"
                     /product="hypothetical protein"
                     /transcript_id="XM_883524.1"
                     /db_xref="GeneID:3684934"
     CDS             complement(400486..401943)
                     /locus_tag="LMJF_04_1060"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_888617.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.1060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.1060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684934"
                     /db_xref="UniProtKB/TrEMBL:Q9NF89"
                     /translation="MSDASASPSPSVAPSPEFTLRDYVVHQRALQQLLRSQPVWLLDD
                     VLGLRYRARLRLRLSPRPQLHFTEDAEDDSHSFETDWPSSKRHDAAEHGNNDFQASAM
                     DDGYPVVPLTPACSIEPAAEADEACGSGVRLRIAPDAACGAAASADSLSFLIIPASTE
                     AGLTPASAWVTVLRRLCRLSSAPPRASGVVDATKRLKGDWGTPSAPCHVDPVSTDQNG
                     VVTPSAVNEGDEGMLTIATPTPSSCGGYASSPVSVEVPPVSSPAHLIAGTILDRDVEE
                     DRRQLERLTEALRARTREAAELKAQLRQVTTTTPSLASARLDPTLSNRSAAVDSTAAA
                     TPAVVAAGEEVERPPTMAHVSSGLVPALQGFPPHLAEMSSEDDDDNESGGDDDEDGSS
                     GEHGAGRAAPNCFRGSPSSAAFILSEDSARPQAPRSGHVCNLGSLGPTCGDEDALRIY
                     NEIHGGHSSSCSSDRRSSSSSMSSATSVSMPQPAG"
     gene            complement(<402474..>402863)
                     /locus_tag="LMJF_04_1070"
                     /db_xref="GeneID:3684935"
     mRNA            complement(<402474..>402863)
                     /locus_tag="LMJF_04_1070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883525.1"
                     /db_xref="GeneID:3684935"
     CDS             complement(402474..402863)
                     /locus_tag="LMJF_04_1070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888618.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.1070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.1070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684935"
                     /db_xref="UniProtKB/TrEMBL:Q9NF88"
                     /translation="MWPFSSAAANTRSSSSIAASLPLERRLIRVSKADISRVTADDIK
                     RVSARLTNDELTTSLRLLVETNRLGDVLASASSSAWTEAVAEVTEARMGLSSNVMRDR
                     MSLLYNILPYVSDNFLSVMGSSYSRDP"
     gene            complement(<403603..>406275)
                     /locus_tag="LMJF_04_1080"
                     /db_xref="GeneID:3684908"
     mRNA            complement(<403603..>406275)
                     /locus_tag="LMJF_04_1080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883526.1"
                     /db_xref="GeneID:3684908"
     CDS             complement(403603..406275)
                     /locus_tag="LMJF_04_1080"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888619.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.1080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.1080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684908"
                     /db_xref="InterPro:IPR006994"
                     /db_xref="UniProtKB/TrEMBL:Q9NF87"
                     /translation="MSSRQMRRLQDLVDRATGLDADDFDDDDAVPRTMQVRKSVHHRQ
                     QKKSKKKTGAAASPPPMPTTSAARQVPGTDIVADPPTLSSSTSERPKKGKIDASKAAT
                     SAPAPPPATSATTDDWEEVSEDEVHTNGSTAKPCSKKAQMEDAVTRAEETAAAAEDAK
                     KRRRAERKKSRRQQRRQQQAEEEEALLDAVLARRQNEQVDPASSNGVGSPVAEHHPAG
                     GPVLVAASSTGTGPSMGGAVAGGNAGETSFLQLVMACDANQLDTRLERIRMFGVEAVE
                     DVGDDRTPHRRADGRVRDTGSVSFFPAHHMTVKFVHSAFATPNRYRWIPYDSLGIFLT
                     TEEARDEWGQAWRAYLLVCSSNAFQRAQASLEACQERLGGVQDLVDCLARNRVYHIPT
                     LLQCVYAMEATGESAFAMELLDVALYQVGVVLRRFTLAGTWVSRQLPCHRSANTLIFQ
                     VLQRGVHAALKRGCLRTAYERARCLLSLDPDDPCGMLLLLDYTALRAKRWVWLLEVRH
                     RALSVRAARRQPRRGAAAESEEADVKEALAAAGLTLRDAALAEDVLRLPNYAFSWALA
                     KHFIEREEARQRSDEVSGGAGRPSKVLRGLTAAQRASLAATPSAVELLSAAVLRFPQA
                     AARLVDGLGGVDVVCGTEGATLSSSSQASVWQQLVWQAGGHPDSAADAAVHNRLADLF
                     VTRHEELWKLSECVSLLRHVVRRMLSEPATGVRAADSGDGSEENANEPASVICVGQTR
                     YRNITRDSVMGASVAPIPADLLEPDAAELAMAQEAAALGLGAGEDGAQPATVQRVMQL
                     LRGNLETFGENEYVRNLLDEVRREFHDRIWGGAREGSGDDEAGGEVRDWYDVDESEDR
                     EEQEWYSVASGGSEDADDDVAPSDADEVGEAARQ"
     gene            complement(<407119..>411108)
                     /locus_tag="LMJF_04_1090"
                     /db_xref="GeneID:3684904"
     mRNA            complement(<407119..>411108)
                     /locus_tag="LMJF_04_1090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883527.1"
                     /db_xref="GeneID:3684904"
     CDS             complement(407119..411108)
                     /locus_tag="LMJF_04_1090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888620.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.1090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.1090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684904"
                     /db_xref="UniProtKB/TrEMBL:Q9NF86"
                     /translation="MVNSRAEPSALDFLSPHGKDAREASLQFRPSAKSRRPHRHRDRP
                     PTPASGAMLRPPAEHPPHRQRYIEDALYDKSDLDDHEADAGCDGDAYTAPPPSVATTL
                     APASPSRSLYADVEAARQPLPPAVETPSMGSHAPTPVSSAPQSAAKGSRQGDIAAEKE
                     RMREERAGDDDGEADAAVLVTHAEMETVVAAALRRYEKERDAEEEAVLRQVSKEVEEQ
                     ASRYADLVEAYNTVCADRATLQEKLTEAAGECEELRRALQKARQTQQAQQDSMKRLEV
                     ELCHARDAQQQQRQEEEQRMLVKAVGADWEAQRARYEKRQGTLEAQLHQARKELQEME
                     ARVAEQDDELTALRERAAKASAETEDEYADIHLRMRQLAQNMASMEGALRERDATISE
                     QAARLREAADRQEAEVRAVTAEKEKAEAALTSVRDALQRQTDDSRRRMHRVTELQQQR
                     EALKDEVKVARHTLQAASEDQGRVVQSLQDVLFILKQRASSRTDGAGRVRPPPSALSL
                     RSGCQFPANRRRDHMNSTLVYEDDHDKNADDVLSCSAISQSHSRSGSATRTLELSSSE
                     DDDDAENGRLFSLAAATAREAYCSTASPKPRAHRASSPLPPAAAPGQRRARTLSPPQS
                     ARVATREAPTNHVKGSASASSLSPELRRQSMQALLLLREIHRYVLSLPSQRRKSSPGG
                     DVTPAGTRGSAGRSGATAAKLEQACRYLKSELDRAHRTLQEAQAECQWRTLSMKKYEE
                     DVHAARREVLAAEKQRLACETQVETAALVREELEAQLTELKATCAAATAKQRASEDAV
                     AAAKAAAERSAALAEEAAQLKDAAESALAREQAKGARQATALRDHAAAQTALTDELDA
                     LKEKHKAALAQLQTYHAREAAQLLKQQQEESHTRGTAAEAWKTERASLEAHISSLETK
                     LRASAGATTAAKRRCATLEEQLALHLDVERTTLKTIGDVAHAPPFPLSVDAAVVGNSS
                     CTLHSHGVALPTEKQLFGGDDEAPEVEAVTMVSAEATPTRKGVHKELAGAASHTRTTS
                     GRTTALSLVSARLSTAAATAANVASSTAVSPASPASSPHLGNALSETTNSSAIAALAP
                     LRQHIVAAVQQLALEVVRLRQGAVLASVKSPVITQPRTTTRRPCDTRSEEVWYSGATA
                     RNGDVPVESCQTWGSGGDVRRLSTATLGSPPPMEALIAAQPQPQYQHQHQPPRTPRRE
                     HPCAGSVVQTRTLGEAPQSRQRSGRSQSRSPPTPSQPSPPAAAGEHIYNVSPYPCLRP
                     QRSLSSSSPPASHSAVAAHGKLWNEARRSASMKDGLSGYSYSTGRGSVDGSCSPARPP
                     SLRVLSLPR"
     gene            complement(<412992..>413666)
                     /locus_tag="LMJF_04_1100"
                     /db_xref="GeneID:3684903"
     mRNA            complement(<412992..>413666)
                     /locus_tag="LMJF_04_1100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883528.1"
                     /db_xref="GeneID:3684903"
     CDS             complement(412992..413666)
                     /locus_tag="LMJF_04_1100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888621.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.1100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.1100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684903"
                     /db_xref="UniProtKB/TrEMBL:O97199"
                     /translation="MLHEPVSTANGHMPRRSSLGCRLRSSPFLSCVAYVNTLTCDSLM
                     HALRATVSQRIATGVDVECHRLTSGAAVVSTPTQVHISITSANFVRQRSSRPALLPLL
                     THPPPPSPSLHPVMSRSRQQQAAEVTLHHFFKTERVIRLECERREAKARLKLIDIMSG
                     DLDDQLLCVAQFKKEWLQSRRVLEEARQAVVQEEGSKRAYVEEEYVRTINTMSRHYHP
                     LSSRVV"
     gene            complement(<413935..>416793)
                     /locus_tag="LMJF_04_1110"
                     /db_xref="GeneID:3684902"
     mRNA            complement(<413935..>416793)
                     /locus_tag="LMJF_04_1110"
                     /product="putative proton motive ATPase"
                     /transcript_id="XM_883529.1"
                     /db_xref="GeneID:3684902"
     CDS             complement(413935..416793)
                     /locus_tag="LMJF_04_1110"
                     /codon_start=1
                     /product="putative proton motive ATPase"
                     /protein_id="XP_888622.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.1110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.1110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684902"
                     /db_xref="GOA:O97198"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:O97198"
                     /translation="MSSKSAAASLVDGSVGTPESWLPLNSVRAPPRVLDSTAVYEARQ
                     RFGMNEVRLTVTPLHRFVVGALLSPSTALVAAGAFVYEVVGGSHCLWFTLAWLVVMRI
                     AVLVTTAVVDRARVRRLHRCLVPGRAVAYREETWAMVGSAQLVPGDLVRLVAGSGVFA
                     DCSLYSGSVLIDMSDVTGRTRTEPVTAGQLLIAGTKVVDGAADAVVRYTGPETFVGQT
                     IELVERLPHGFEERQRLSRAYVSTYFLVAAVAVTAEVVLFGALRGWDGYSMWKVARET
                     TLLALLCAPLLFDLAVYVAVSRGASAAMQRSQAVLLRLRALLSLASVDMLLVDKTGTL
                     SSGHCTLAAHHRAYLAGYPSRAAVVQLMALACRWRQPSLHATKRAVLRSADLDACDEY
                     TQLDYVEHEGEHRSSALLRRRDGALLRVTEGRLRSVLAVVQHPESAAACMEAQRLVFA
                     WSQSGLRCVAVAVAEGDDPWRLAGLLTFADPLRSDAAPLVSDCSRLGVDVTLISGDEH
                     RAVAAAAEAVQLKSEVMSGHDVPPLRLWEAEHRSPASALSVTVDLSAAANSASEYAAC
                     CAYAEMQPHQKAALVRALQQSGRVVAVLGDGVNDAAAARLSDVGIALLSAEQGQAAAR
                     GALWGADIALTSDHLGAVVELLVVSRELFSTIYSVFFWVAAAALQLSVLVAALAVAVP
                     RRCVGESSNEMGLGLPPSGLHVLTLIYINGLTLIWVSTEAGDDTYWTVAPCCLSYRVA
                     LLQASTMAFIGLVGGVALGIVGGLACDRRGWWPLVSPSMLPVITEERLGGILTFYILY
                     LNLFLTMSCASPVRAGWRFWRRSRLRVVLALAVVYGLCMTWAIDAHPRCAACLCVYCG
                     VVAVLQDMAKLTVHGICYCLGFRTYRACVDGIHARVDADEDAAVALPRRTTSTPSHDA
                     AGRRSSASSSLDAVVGCIASLDVKLFCRARPAPMTPAE"
     gene            complement(<418659..>421289)
                     /locus_tag="LMJF_04_1120"
                     /db_xref="GeneID:3684901"
     mRNA            complement(<418659..>421289)
                     /locus_tag="LMJF_04_1120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883530.2"
                     /db_xref="GeneID:3684901"
     CDS             complement(418659..421289)
                     /locus_tag="LMJF_04_1120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888623.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.1120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.1120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684901"
                     /db_xref="UniProtKB/TrEMBL:O97197"
                     /translation="MYGRACSCGRDMCRGSHHLKLTRTSLPRILLVDRCRFNSSSLVD
                     PFAAFSAHEQAHAHTRRQSRREIRPRAHTQRHILAAARAVFPLPCFISLRLPSTPRCF
                     LSYFRSASSLAPRCCVVRGVARHLHVRVRRRGALRCISGENLMMSSRSGSGTATAVYE
                     ALPSTPVRRQLGTSTDDAAIFLEDTVDRVTAQCIDASPSALALLSPQHMPTSSAAHVD
                     VTEYDVSYLGSLSASHRKSAGGGSSGNGRPSHHHHCALHNVTNASVTKMNFSSASASK
                     SPNPKAAGRSLSHGAHPNSVSHSTSLARSTPRRSTHDRSPAASEPLVPLVEYEALQRE
                     CNRYEKMYEHQRALYEDMAEKHANAYQALQDKIIEVVALSTRNEESKRFIRQLKREMS
                     ESRTRVMDMQNRALEEAKLERSAKMRYEALMKEHERKYERLVERHETKLAGMESLVRD
                     LTCLRGEQDSIHVSQLDSLLKAAYSKSTALFNDLLRQGKQIDLLYEAKGALEAQVEQQ
                     RKEKREIEATLREERRHMASEMERMIEQIEEQQQSILNLRQMLIRTMDNRDNVFAYSR
                     GPRHAQGVEGDEDGSGNESTSSSLTCSPPTSPFGDGGVSEEVEEVEEDENENTGGDGV
                     YAAPARGEAKKSGADVERSPVRVRGATTATEPIMSASSEYVAPLSSNSVVAPRRMTTS
                     GSQASVPLSKARPAAVVPPLPLTSRDGTLSFRQGPCRNQRSGSDADRRTAGTAADDDQ
                     RPCKRSSSDKGSAANSEAAEASPSAAAAAAASSSTSTVASRRRLDFTTALAAVAEKRR
                     RDRAIREEIDLEHGSDKENSKPPVPHRVVVRSCAVGSITTARKAVLVERDGTNTGAQR
                     GEDDEAEPRLFPRNVLTPRE"
     gene            complement(<421926..>422858)
                     /locus_tag="LMJF_04_1130"
                     /db_xref="GeneID:3684900"
     mRNA            complement(<421926..>422858)
                     /locus_tag="LMJF_04_1130"
                     /product="putative cytochrome c oxidase assembly factor"
                     /transcript_id="XM_883531.1"
                     /db_xref="GeneID:3684900"
     CDS             complement(421926..422858)
                     /locus_tag="LMJF_04_1130"
                     /EC_number="1.9.3.1"
                     /codon_start=1
                     /product="putative cytochrome c oxidase assembly factor"
                     /protein_id="XP_888624.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.1130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.1130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684900"
                     /db_xref="GOA:O97196"
                     /db_xref="InterPro:IPR003782"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR017276"
                     /db_xref="UniProtKB/TrEMBL:O97196"
                     /translation="MHRSLLRCALPGEPMLESYRSGVLRCLRCHLGAMRPDFPVGSAA
                     TEVAALASTATTPLTCSRRAFRQQGAAHPNTPDATEAAELEKDWQALKTYGMIGGFAL
                     LCVATLWYGSRQAKQRYFGAEGSARVSVETRGRPALGGPFVLVNTKGEPVSQAEFLGS
                     WAFFYFGFTHCPEICPVELNRMSHVVDAVRAARPQERIAPLFVSCDPRRDSLEAIDEY
                     LSVFHPDFIGLVGTPKQVNDACRSYRIYYSIPTDEDAAQEDYLIDHSIAIFLFDPQGR
                     FVDFFGNRYDEREITEKVLHYMSEYAKDPTWTNW"
     gene            complement(<423686..>424588)
                     /locus_tag="LMJF_04_1140"
                     /db_xref="GeneID:3684899"
     mRNA            complement(<423686..>424588)
                     /locus_tag="LMJF_04_1140"
                     /product="hypothetical protein"
                     /transcript_id="XM_883532.1"
                     /db_xref="GeneID:3684899"
     CDS             complement(423686..424588)
                     /locus_tag="LMJF_04_1140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_888625.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.1140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.1140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684899"
                     /db_xref="UniProtKB/TrEMBL:O97195"
                     /translation="MSSTPDAPRPVIAKRHHPPQYLAPGQHLKVASRKPAQKLGNAAG
                     GDAFTGGPPRDPWEDFDENREEPCPSSAGHSGSQRHQHTTTGGGHPYSGRVSVSRSTE
                     RTSPHSKEGSVSGLAVPPKAAPPTDSQTAAGDEGIDRGAAVSSDEDDHYYTITSEPPK
                     LSAAERAKQVLEAQHRALEAKQLKALTQQGVARRPATLVRNRHGRLNAIAAQPVSMAA
                     EESGSALLIAAAPASASVQPEKSHVRSSKAPEARTVPSAPRGGEGGSDGAVDSPRDSH
                     DDLVDSCPSTTIQATTGSLEIDLD"
     gene            complement(<425301..>425807)
                     /locus_tag="LMJF_04_1150"
                     /db_xref="GeneID:3684923"
     mRNA            complement(<425301..>425807)
                     /locus_tag="LMJF_04_1150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883533.1"
                     /db_xref="GeneID:3684923"
     CDS             complement(425301..425807)
                     /locus_tag="LMJF_04_1150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888626.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.1150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.1150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684923"
                     /db_xref="UniProtKB/TrEMBL:O97194"
                     /translation="MPPKFTHPRLVHHVSLFTRLKAWWLGIENPEVLSRYGERGVART
                     VWIEWRGTLAVCAGGFVLFIGRQQSKCANDILDNIELNRQRFYQRDFTPAYVPDAPSG
                     VYDGVRGYSYRDESSGLMINADNKLVSDESRAARGERLAKTEVTPEMVAQARNLLHSR
                     RYEGTPEG"
     gene            complement(<428009..>429064)
                     /gene="FBP"
                     /locus_tag="LMJF_04_1160"
                     /db_xref="GeneID:3684922"
     mRNA            complement(<428009..>429064)
                     /gene="FBP"
                     /locus_tag="LMJF_04_1160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_883534.1"
                     /db_xref="GeneID:3684922"
     CDS             complement(428009..429064)
                     /gene="FBP"
                     /locus_tag="LMJF_04_1160"
                     /EC_number="3.1.3.11"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_888627.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.1160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.1160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684922"
                     /db_xref="GOA:O97193"
                     /db_xref="InterPro:IPR000146"
                     /db_xref="InterPro:IPR020548"
                     /db_xref="InterPro:IPR028343"
                     /db_xref="UniProtKB/TrEMBL:O97193"
                     /translation="MDVRRTPTPTTLTQYIIKSQPPHSRGDFTLLMMAIQTSVKVIEK
                     NIRRAGMKGMLGYIAGQSANATGDHQAKLDVISNIAFKAYLLSSTSVCVLGSEEEEQM
                     IIAESGRRGDYLIFFDPLDGSSNIDANVSVGSIWGVWRLPKDTTINSVEDANAVIRML
                     KGTDMVSAGYAVYGSATNLVLTSGHGVDGFTLDPNIGEFILTHPHISIPKKRSIYSVN
                     EGNYGKWEPWFKEYIDYLKMNKTTRYSARYIGSMVGDIHRTLLYGGIFCYPKDANQVE
                     GKLRLLYEAAPMAMIVEQAGGKAVGSNGRILEQSITRLHQRTPVYFGSRQEVDLCMAF
                     RDRNVKTEALAPTSSKL"
     gene            complement(429932..431309)
                     /locus_tag="LMJF_04_1165"
                     /pseudo
                     /db_xref="GeneID:12981691"
     misc_feature    complement(429932..431309)
                     /locus_tag="LMJF_04_1165"
                     /pseudo
                     /db_xref="GeneID:12981691"
     gene            complement(<440646..>441581)
                     /locus_tag="LMJF_04_1170"
                     /db_xref="GeneID:3684917"
     mRNA            complement(<440646..>441581)
                     /locus_tag="LMJF_04_1170"
                     /product="putative RNA-binding protein"
                     /transcript_id="XM_883535.1"
                     /db_xref="GeneID:3684917"
     CDS             complement(440646..441581)
                     /locus_tag="LMJF_04_1170"
                     /codon_start=1
                     /product="putative RNA-binding protein"
                     /protein_id="XP_888628.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.1170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.1170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684917"
                     /db_xref="GOA:O97003"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:O97003"
                     /translation="MYGQQFVPGQMYGQPNMMSYQPGVLSPPMSTGVSVMPNYAPPYQ
                     NGMPPGSVQQQQGQGPVQGQAMPQTQPRPRNNEVGNTSSVIHMRNVTPEVTQLSIQNL
                     AQNFGDIKHIVMLRQMNQALIEMKSPKSAEQLVDFFKEPGYAEIDGRRVYIRFSTHQN
                     LTATQHATRTLLVSMFNTQYDVSAAAHITPEIVYQIFASYGTVERIVVLPKNESSQWN
                     HNRVQALVQFDARESAEHVKNILQGQPVTLGETITFTLDIQFSRMDEIKTTNPTTSLV
                     VDDEGAHRPAGTMDPVAMNAAAMTTTGMYPPMGWS"
     gene            complement(<444401..>451876)
                     /locus_tag="LMJF_04_1180"
                     /db_xref="GeneID:3684916"
     mRNA            complement(<444401..>451876)
                     /locus_tag="LMJF_04_1180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883536.1"
                     /db_xref="GeneID:3684916"
     CDS             complement(444401..451876)
                     /locus_tag="LMJF_04_1180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888629.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.1180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.1180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684916"
                     /db_xref="UniProtKB/TrEMBL:O97002"
                     /translation="MNAMCLSSYSAVWWRPGKTGFMNVVGTISLTEVPKQKSLVKGAV
                     VAAPIALKCVKQPEQDFVVWLGWKGSRNFKKSGKGLHKVLYVCTTATHSGVFFAHHRG
                     KRLGFALIAHDSRNPQKLSSKPTLYKKELSGLMADVLHDGERTKTTTKEGQLVTVRQA
                     VLRQTLEGHVLAAVFVNQRGDVYAVVAHLAKNTWRKWRMEAAVGSMPCIHVPEGGRDV
                     RFVHCDIDAPVDHTSAVVAPSLPLALSTFDRISASSANLSAQVSATVPPLLCVTVREV
                     ILPTRGSGVAAVRVFQSQCVERVSGDVRVMPQPCLTHVDEATAVYTVVVLGEQSSCLL
                     HMRHSMFGSELMTSCATVAGLHRPISACTLSIPSPHRPQGARVSLVLSDDMRVYCCEH
                     FGQVVSVSLSIDGADCSMLMLPVPLAKKSSKKMTTAITLPARLIPVNNETEVLCTNGT
                     VGLFLRVTSAAFSEAVPAPPDLAVEGGTGETAGRGMAGEAEVGAAALRLCLQSLQQLS
                     VRAYHHDLPDVFFRHILPHLRYVGTSQQEVMLIQRVYEQLLQMAEPIREPEWSYLWAL
                     TSLLQKALVKRGRENQLRYTDAFFLQLADTYRQSSFASPSGAALVGDGVRAVVSTEVQ
                     DVIAAPTATVPAEAMYVLDGLAAGVAPVALAEEIVRRMVNTETLSNGTCVVASQAGVA
                     DCVHCMGCVLVASCLDLSVFVIADEVRGLRVSLQRPQVGVCVAIQPHTFASQKEFETA
                     LGLAGDLLCVSSADASFRPDVALLTLGIGGRQHCLNAFLQLFSPVLRHAVDALTPLSS
                     NRTWFEECVATLTQSTTEWVASLLRKGGSDSFTLTATLCHMLCAAQRGVDAAFFRSLS
                     HTLSEEFCTTALVTILFHQTELLLAAIQNYASAVAACISTKNSEAEKGANWQATDVGR
                     IRLQAALAQTSALWAQIDSLSPYRVRDVAESYRISASISLASAARAASASTEGTMVSR
                     TLVLCFRILCLVQYSMAAEEDTSLSVSAESASWTTSDAAVRDCQGVLETLYLIKGGPL
                     PLEWFQWKFMSSVRRAAAIKPTWAPYLVRLMQLSNVHESSSAALKRDFYTLLDTLQSR
                     GASSTTTAEEGDMQRAVTAAESAVGALAGQAEHRDAAAGAEGRSPALSMSTAFFIFSR
                     QRDASLPDWSRLYSLPERRHLFAATWVDALWTLERIPDALDRACAAALARVQLAASEV
                     GTTGQGGDQPPALSEELALPLYAHIYRLRPPVRMHAVIDATPAESDGAYLCVQQRVDR
                     AQQHEEAPREAIATPENATAKPQHEDAQVAVAPAVDTATSAPLPSLSAEPEAAVRTGT
                     SEAMPTEQASSAADAGAAAAAAASAAVAAPAAPAVPTRSGLYSPTSVAWWDTLETTPS
                     RPRALDVKVECATANSTSPATADDNGESSDSATTYTTSASNYVDPVATLESFHRCCYA
                     RGGSQTAAESVGSSWSDSEWHLCKHRYAAARSQAQHRARKRCRCCGRAMRVDYRGRSA
                     GRRGEAADDTTPVRVQWSGTAKETTAPYVRSPLVTAKVPTAAAARPALLGFSARLQPP
                     EEPATLRAQPARMSLAAPSPKATPFSLLTFPFASKGQQASRVRLYTLDGDRVRYVDGQ
                     GTVPLQTTSRPGVGALLNVPPLPATSVFPACRPLVRLPSQPAPAQLEHRDTRVPCAAE
                     AAQPVRFVEVGHAYPQVPRPPAGVAPPAVDAATLQATATSAPVPVRAAEAIAFPSVGV
                     ATPVATTSAPPAPATVTPLPAPTALPIRAPAVLSPAQMSDFRRYTDNLLARQTGSTPL
                     HAVTTASVPAAAPPTADRPSTAPAVTTAVDSARIARLIQQQEEFLRKAEAIMEKCRAE
                     KDGFYRRVEETLCSVTAASQQRHGLSPVEQAQLVQNNIKQRNELLALNHQLLERPLAA
                     ARAGGEEPPVPTVCSATSQAAPPGVTATGATQTPPQLRESVGVPWAATGGSAASTAAA
                     AAFQQRHGLSPVEQAQLVQNNIKQRNELLALNHQLLELQLAAARAGGEEPPVPTVCSA
                     TSQAAPPGVTATGATQTPPQLRESVGVPWAATGGSAASTAAAAAAPVPPSAISVRERE
                     GMKDILSDLQRLNAELMASSASAEAMDRAVKETREVIERYERNKTAEALTAEGIALIS
                     AMRQRTAAIERQLAELPQRFEEKAATDAKKSSSVWASQLSAANTVEGSPADAPPAAPL
                     ASFTSTTAVVPPSSLHFTAQAGTSAGSAEEALLSRDLTQHLPSSNPLGAVSLSTSMPQ
                     TAKPPQPGRAPGPTASVLTAPVVSYATPRASSMFTSVSSVPIDEPTVLRSATPKGAFP
                     PSASFHAERAAGGEVPSLHVCETVECTTVDPPRDMPSNVSAPRVATQLGDLGSLFVES
                     GGRYETRRNASAAPSHTRAAASPRRRVPVRSPAPKPHAGQRRFSSPAQAPGRCHRKHE
                     ERYAMYRATSRPAKVRPAATATPYVPAPGVPFTPAPRVSIGNVFVDRQQSRLMASIAK
                     RMQQLEQDLFT"
     gene            complement(<453155..>454726)
                     /locus_tag="LMJF_04_1190"
                     /db_xref="GeneID:3684898"
     mRNA            complement(<453155..>454726)
                     /locus_tag="LMJF_04_1190"
                     /product="putative tRNA nucleotidyltransferase"
                     /transcript_id="XM_883537.1"
                     /db_xref="GeneID:3684898"
     CDS             complement(453155..454726)
                     /locus_tag="LMJF_04_1190"
                     /EC_number="2.7.7.72"
                     /codon_start=1
                     /product="putative tRNA nucleotidyltransferase"
                     /protein_id="XP_888630.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.1190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.1190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684898"
                     /db_xref="GOA:O97001"
                     /db_xref="InterPro:IPR002646"
                     /db_xref="UniProtKB/TrEMBL:O97001"
                     /translation="MLPRVVRLEAGIPPAHQSVFDFLLSVAAENKLKATLRVAGGWVR
                     DMLLGLHSNDIDIAIETHAGAKIVTGEAFAHRVSEYQLAHGGRGHTVSVIRANPALSK
                     HIETATVRVHEIPVELCALRTDVYTNESRIPQVRPAAPVEDAQRRDFTINALFYNLHT
                     GMVEDYTTGLEDLRLRIIRCPLEPRTTFMDDPLRLLRGVRFVGQLGALNFSLDESITS
                     CVDDSLLQVLQQKVSRERVGKEFVKMMAAAHPERCIALLHGMHILQHVLLVSVVMRQV
                     PGKKQLSNEIERVERLVDLYPDGSKRLETVMRLSAVGLPCLANIGAAAELSEGQRVEV
                     ALFFLVIPFFRGATEGVEETVRNVCMNGLKLPLASCDCVRRLIDAYNHLHAQSMRMDE
                     LAAETLRPETVRKVFDALNILNDKHVFRHALQVVLLVYMLIEESAHLLSGGRIQQATS
                     DFSAAWARVAEHPVLLDAFQLRLPINGKDLQKVYGIPPKNVGTTLLKMRLKLVLCPRM
                     TPEDVAQWLVEGAQM"
     gene            complement(<455601..>456164)
                     /locus_tag="LMJF_04_1200"
                     /db_xref="GeneID:3684897"
     mRNA            complement(<455601..>456164)
                     /locus_tag="LMJF_04_1200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883538.2"
                     /db_xref="GeneID:3684897"
     CDS             complement(455601..456164)
                     /locus_tag="LMJF_04_1200"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888631.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.1200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.1200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684897"
                     /db_xref="UniProtKB/TrEMBL:O97000"
                     /translation="MPPKRPTKPPGGKSVRKPVANRTKMRSLSLQEVYIRSCAEMGLR
                     PNSGFTSFLPDRCGVDYAEDTVDLSRNYVGDKGIAPILATIEKMPNVRALILSENGLR
                     NRGVELLCASAANMPNFEFIELSDNFISEGAAVALFGLIEHHRQLQVVVFENTKIPVQ
                     WRVKLLDMLASKRSTRQKQVRASILVS"
     gene            complement(<460984..>462090)
                     /locus_tag="LMJF_04_1210"
                     /db_xref="GeneID:3684896"
     mRNA            complement(<460984..>462090)
                     /locus_tag="LMJF_04_1210"
                     /product="putative casein kinase I"
                     /transcript_id="XM_883539.1"
                     /db_xref="GeneID:3684896"
     CDS             complement(460984..462090)
                     /locus_tag="LMJF_04_1210"
                     /codon_start=1
                     /product="putative casein kinase I"
                     /protein_id="XP_888632.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.1210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.1210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684896"
                     /db_xref="GOA:O96999"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:O96999"
                     /translation="MPEISSEVAPAIKSIFQGRFFLTKLLGKGGFGEVYAAIQTSSNE
                     MVAVKMEKNNGRNSFLFHEARVMQDIQKTPTKDGISGIATLKYFGQEGDYRMLIMSMH
                     GASLEDFHERLGRFSLKTTVMLAGQMLSRLEYIHSVGYVHRDLKTDNFLVGKGSFSNR
                     IFMIDFGLSSKFIGSDGKHRDMFTGRYFLGTSRFASLRTHQGYSQSRRDDLEQLVYIM
                     IYMYRGRLPWSGLNIKDLSAKERKIGQIKADLSYSQICAKCPQVFEHLLFYSRNMEFA
                     ETPQYDMCHALLQSVLDSMSPRETMDYVFDWNVPASKPTRQSLSPRDEIAPANANAAN
                     QPNMLSGADGKGMFSGFGSSNPPENIFSIGGHGA"
     gene            complement(<463070..>466255)
                     /locus_tag="LMJF_04_1220"
                     /db_xref="GeneID:3684895"
     mRNA            complement(<463070..>466255)
                     /locus_tag="LMJF_04_1220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_883540.1"
                     /db_xref="GeneID:3684895"
     CDS             complement(463070..466255)
                     /locus_tag="LMJF_04_1220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_888633.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.04.1220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.04.1220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:3684895"
                     /db_xref="UniProtKB/TrEMBL:O96998"
                     /translation="MAENGRNAVPEGTMPTVLGNGDAEYPDPRTSRQGNFAAVNSSVL
                     NSSEGNAISSFLLIGKLKSVVYEVLYNLENHAHLHDIDEFIAVTEDCLKALKTVKVER
                     RIEARRMNLSMRNQVNSLVNTLATPSNREADDALGEAVRASATTVSQGPKNYKAALLK
                     QKLTSPKHSPVRAEVQTRGDVEAARYASALRAEERQRQAEERRFDILQEMKQKSEVAD
                     ARSLRAKARREEAETKQRMETQDRMDNGVRRAEEARRQTREKAQRAHSRVEEVLLTKE
                     LRQQNKALLLDKKMSDVEHNQEQMREKLQKQAQERQEAVRAAAERRRNLSQERQEKQQ
                     QREQHRVDNLRRVDEQKKVDQEVKQQKAREWEKKVQQHHVDTTAEAEAKSRKTEEKFQ
                     QSAHLLEEQRERRQQKLERQEQKLREAKERRDRELAARTTLEEMMPPLSEQEVEQQAS
                     RLSRLSITAAHHGKVFADTYRKMSAHPTKDLNRSRLRVVFSRLASAVATPSVVQCRHP
                     LSEITAATLGDVDYEFVRYFYAFETLVKVLVEARKARDFGVMRQTTDILLSWFVDEKE
                     GRENVVYFIKSGCTVLLLTCLRDEAHALILQQNADALRCTMEVLGTCLERISAESQGA
                     AKLAPVRDQLLNEMEVVGVDRVCIAVLQTCTEEGELQLAYTALCIIHTELSVVTRRKG
                     EVKRNWFQQITTSLFTLLQNMLTPNGSPLRESDASLSCERVTILFCLFRTLNTLARWQ
                     LTKFQELLHDGSTDAGAAMEAMQERKGEMKRTPSADSLPALITRTELFHILNGFFMFI
                     HGHLEELETVPASEDAEGATGKGIKSSFTEALQFGITLNSFPAFPCSSSSDLGDSQKL
                     GGKHYHLRATLHECILLVGYLCFDDAPLQDMMGWGKKKPLLGTMLNVLPITYFSNARH
                     ILFPTILSAILQNNRNSMIVREEMSLAELQQFISQEYDPLTKKAKMYAQEHHKQLVAH
                     KMETDPRFALMVKLQGKSWADMADDDDSPPATPRSSETTSTTPAVEKEKLCKGLRAMS
                     LNQSNYFKLERRLPISYWPAAMEQLEKLRQL"
     gene            complement(<467442..>468572)
                     /gene="ACT"
                     /locus_tag="LMJF_04_1230"
                     /db_xref="GeneID:3684894"
     mRNA            complement(<467442..>468572)
                     /gene="ACT"
                     /locus_tag="LMJF_04_1230"
                     /product="actin"
                     /transcript_id="XM_883541.1"
                     /db_xref="GeneID:3684894"
     CDS             complement(467442..468572)
                     /gene="ACT"
                     /locus_tag="LMJF_04_1230"
                     /codon_start=1
                     /product="actin"
                     /protein_id="XP_888634.1"
                     /db_xref="GeneID:3684894"
                     /db_xref="GOA:Q9U1E8"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR004001"
                     /db_xref="InterPro:IPR020902"
                     /db_xref="UniProtKB/TrEMBL:Q9U1E8"
                     /translation="MADNEQSSIVCDNGSGMVKAGFSGDDAPRHVFPSIVGRPKNMQA
                     MMGSANKTVYVGDEAQSKRGVLSLKYPIEHGIVTNWDDMEKIWHHTFYNELRVNPEQH
                     NVLLTEAPMNPKQNREKMTQIMFETFNVPSLYIGIQAVLSLYSSGRTTGIVLDAGDGV
                     THTVPIYEGYSLPHAVRRVDMAGRDLTEYLMKIMMETGTTFTTTAEKEIVRNVKEQLC
                     YVALDFEEEMTNSAKSANEEAFELPDGNVMMVGNQRFRCPEVLFKPSLIGLDEAPGFP
                     EMVYQSINKCDIDVRRELYGNIVLSGGSTMFLNLPERLAKEISNLAPSSIKPKVVAPP
                     ERKYSVWIGGSILSSLTTFQTMWVKKSEYDESGPSIVHNKCF"
CONTIG      join(FR796400.1:1..472852)
//
DBGET integrated database retrieval system