GenomeNet

Database: RefSeq
Entry: NC_007247
LinkDB: NC_007247
Original site: NC_007247 
LOCUS       NC_007247             516869 bp    DNA     linear   CON 18-JUN-2017
DEFINITION  Leishmania major strain Friedlin complete genome, chromosome 6.
ACCESSION   NC_007247 CT005245
VERSION     NC_007247.2
DBLINK      BioProject: PRJNA15564
            BioSample: SAMEA3138173
            Assembly: GCF_000002725.2
KEYWORDS    RefSeq; complete genome.
SOURCE      Leishmania major strain Friedlin
  ORGANISM  Leishmania major strain Friedlin
            Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae;
            Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Rogers,M.B., Hilley,J.D., Dickens,N.J., Wilkes,J., Bates,P.A.,
            Depledge,D.P., Harris,D., Her,Y., Herzyk,P., Imamura,H., Otto,T.D.,
            Sanders,M., Seeger,K., Dujardin,J.C., Berriman,M., Smith,D.F.,
            Hertz-Fowler,C. and Mottram,J.C.
  TITLE     Chromosome and gene copy number variation allow major structural
            change between species and strains of Leishmania
  JOURNAL   Genome Res. 21 (12), 2129-2142 (2011)
   PUBMED   22038252
REFERENCE   2
  AUTHORS   Ivens,A.C., Peacock,C.S., Worthey,E.A., Murphy,L., Aggarwal,G.,
            Berriman,M., Sisk,E., Rajandream,M.A., Adlem,E., Aert,R.,
            Anupama,A., Apostolou,Z., Attipoe,P., Bason,N., Bauser,C., Beck,A.,
            Beverley,S.M., Bianchettin,G., Borzym,K., Bothe,G., Bruschi,C.V.,
            Collins,M., Cadag,E., Ciarloni,L., Clayton,C., Coulson,R.M.,
            Cronin,A., Cruz,A.K., Davies,R.M., De Gaudenzi,J., Dobson,D.E.,
            Duesterhoeft,A., Fazelina,G., Fosker,N., Frasch,A.C., Fraser,A.,
            Fuchs,M., Gabel,C., Goble,A., Goffeau,A., Harris,D.,
            Hertz-Fowler,C., Hilbert,H., Horn,D., Huang,Y., Klages,S.,
            Knights,A., Kube,M., Larke,N., Litvin,L., Lord,A., Louie,T.,
            Marra,M., Masuy,D., Matthews,K., Michaeli,S., Mottram,J.C.,
            Muller-Auer,S., Munden,H., Nelson,S., Norbertczak,H., Oliver,K.,
            O'neil,S., Pentony,M., Pohl,T.M., Price,C., Purnelle,B.,
            Quail,M.A., Rabbinowitsch,E., Reinhardt,R., Rieger,M., Rinta,J.,
            Robben,J., Robertson,L., Ruiz,J.C., Rutter,S., Saunders,D.,
            Schafer,M., Schein,J., Schwartz,D.C., Seeger,K., Seyler,A.,
            Sharp,S., Shin,H., Sivam,D., Squares,R., Squares,S., Tosato,V.,
            Vogt,C., Volckaert,G., Wambutt,R., Warren,T., Wedler,H.,
            Woodward,J., Zhou,S., Zimmermann,W., Smith,D.F., Blackwell,J.M.,
            Stuart,K.D., Barrell,B. and Myler,P.J.
  TITLE     The genome of the kinetoplastid parasite, Leishmania major
  JOURNAL   Science 309 (5733), 436-442 (2005)
   PUBMED   16020728
REFERENCE   3  (bases 1 to 516869)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 516869)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire, CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR796402.
            On Jun 1, 2012 this sequence version replaced NC_007247.1.
            Data release policy www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..516869
                     /organism="Leishmania major strain Friedlin"
                     /mol_type="genomic DNA"
                     /strain="Friedlin"
                     /db_xref="taxon:347515"
                     /chromosome="6"
     gene            complement(<1840..>2142)
                     /locus_tag="LMJF_06_0010"
                     /db_xref="GeneID:5649156"
     mRNA            complement(<1840..>2142)
                     /locus_tag="LMJF_06_0010"
                     /product="histone H4"
                     /transcript_id="XM_001680718.1"
                     /db_xref="GeneID:5649156"
     CDS             complement(1840..2142)
                     /locus_tag="LMJF_06_0010"
                     /codon_start=1
                     /product="histone H4"
                     /protein_id="XP_001680770.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649156"
                     /db_xref="GOA:Q4QJ78"
                     /db_xref="InterPro:IPR001951"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ78"
                     /translation="MAKGKRSADAKSSQKRQKKVLRDNIRGITRGCVRRMARRGGVKR
                     ISSEVYGEVRRVLKAYLEDIVRCSTAYTEYARKKTVTACDVVNALRQKGHILYGYA"
     gene            complement(<4337..>5944)
                     /locus_tag="LMJF_06_0020"
                     /db_xref="GeneID:5649022"
     mRNA            complement(<4337..>5944)
                     /locus_tag="LMJF_06_0020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680719.1"
                     /db_xref="GeneID:5649022"
     CDS             complement(4337..5944)
                     /locus_tag="LMJF_06_0020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680771.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649022"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ77"
                     /translation="MSISSLPLEGLTAIADFFDSASVPLAFTSVSPAGRVAGELAAFA
                     CPAHCYGHAASPHTPMLSMDPSLMERVAVITDTQHLKNAEWWMVRSRCPVDNDPYPYP
                     LRSVYFCLSSALELSVDVLARVPLCASTVTKLNLNARCDSHNHISSLGAISRLVHLRE
                     LMMKNTTVLQSTRQLPMIMTQELHAVFRKLRKLVVGDFYLVKHLPLHDLPELEEVDLS
                     GTGATNGVVQALSSCHRVHTLTLSGCVGIDSFAPLTALTRLSQLDLSHTRLDNTDLLH
                     LCCSCPQLFFLALNSCNRITDFSPLALLHDLTYLHVARTRFRNADLERIHALPELEEV
                     HMSSCRVVDIFTPLAALRTLRMLDVRDTWMDDAGVEAVARCCQLLRLNMSACPAIEHF
                     SPLARLSLLEELNLSCSPVTDTCLATLCTAASSLRVFLLNGCRLVSDFTPLGSLGSLE
                     EVGACDTAFNDAALEAVAQCPQLTKLHLHVCTGLTSLTPLAACSHLIYLGIGGTRFSS
                     TASEREGASLQERGVRLSHQVFLGTDF"
     gene            complement(<11715..>13742)
                     /locus_tag="LMJF_06_0030"
                     /db_xref="GeneID:5649023"
     mRNA            complement(<11715..>13742)
                     /locus_tag="LMJF_06_0030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680720.1"
                     /db_xref="GeneID:5649023"
     CDS             complement(11715..13742)
                     /locus_tag="LMJF_06_0030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680772.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649023"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ76"
                     /translation="MAKQKLGFKIKGKNVSYEGYPERRPKDLMDILVKMGVDQAVVVT
                     TFRENIENHQEYSDTQVMGMYSEAKSAREKKTRAKASSSPGQSAAAAAPPQPDTADEA
                     ERPQKILLNYRGKQLSYTGLLSGKRNAVLQLLSKQEELTKELAVETFHMNLPDDPSTD
                     EQIWLLVQAVKDRKSRKNQSKGTDTEGSSGNGAAASRTAGSNTMDSITGMSERERDDL
                     DNFILQVLQQPAPDVAELLRGNPKRHKDVDDNTELALTARMSGKIPVYLQEENSSNTK
                     LIYATAHMSFEDFHNIVEKKFGRRMTMSFYDGDDIIMMDDDDVLTMFLEMTMQNDPKK
                     VRLICSNPEHPKKVVDDRLTDTRQQSLGGVQVSTTKALAYSSGELNVSEIRSYSGHSL
                     AVYCCCFSPRGDMFVTASRDRTVRLWNLRTGVSTMMKGGHNGFVLSCDYSPKGNRVAS
                     SSDDRTIKLWSTSSCNKVATLKGHEDKVYCVKYNATGELLVSASCDTTVRVWNAESQA
                     KLMTLRGHSLAVFSCAFSNTDSGKFVVSGSDDRVIKLWDWGANREIMSLVGHIGTVWT
                     VVFSHNDRYVLSGSMDYELILWDSISGTRLRSMDGHKASVHHAIFSEDDAYIFSCARD
                     WSVMVWRTTDGEHIETIIGHLSTVYHMDIREDKLLTSSLDDKIKLWSIRHR"
     gene            complement(<14599..>15474)
                     /locus_tag="LMJF_06_0040"
                     /db_xref="GeneID:5649029"
     mRNA            complement(<14599..>15474)
                     /locus_tag="LMJF_06_0040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680721.1"
                     /db_xref="GeneID:5649029"
     CDS             complement(14599..15474)
                     /locus_tag="LMJF_06_0040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680773.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649029"
                     /db_xref="InterPro:IPR021757"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ75"
                     /translation="MRYCRPSRPLVLARASSVLSSSRTFHSQHRTPIIPQVHVHDEPT
                     AQRIHVGYYLHRHPVVKHSPHPLETEMGYLLEREQQRYSRHESAESATAFFASRGQTI
                     DILGRTDPNQIKGNFFGLELYQDAMKVVMQRYTPEKRLTSADLWQPNALGDAPPPRHT
                     LHRKLDDFLYLIVQEGATGKWTIPHTARKDDESLRMTADRAISSQNSEGLDCYVWSNA
                     PQATVFLKDDNTRLFIYAATYLAGRPQFASFEPKPKDHAWVTRHELLQYSDTFKSAEL
                     LKALLDISADGTFEA"
     gene            complement(<21431..>22843)
                     /gene="PUF5"
                     /locus_tag="LMJF_06_0050"
                     /db_xref="GeneID:5649024"
     mRNA            complement(<21431..>22843)
                     /gene="PUF5"
                     /locus_tag="LMJF_06_0050"
                     /product="putative pumillio protein 5"
                     /transcript_id="XM_001680722.1"
                     /db_xref="GeneID:5649024"
     CDS             complement(21431..22843)
                     /gene="PUF5"
                     /locus_tag="LMJF_06_0050"
                     /codon_start=1
                     /product="putative pumillio protein 5"
                     /protein_id="XP_001680774.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649024"
                     /db_xref="GOA:Q4QJ74"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ74"
                     /translation="MVLKSNYPDAQPPTAMGAPPKKGPQPYRSPCYSSASANPTAAST
                     LVQPFSLPMALQSPRMLPSHGPRPTVLIPISGHETIESSKQSGKMYTHNPYASTCTTP
                     SACLAQSTSMESSSFTSPYVTAMVPRTTAMTPPHFSCASTFPVYAASEGSCCEAGALA
                     NMLEDQFLSVLGNIPSTAMSSRGRHVLLNVLRLQHMDKIQMIYDELVPQFNIIAMDQH
                     GCHVARTLIEYISTPQMEALVPYIDLHVIRQMATTTQHTRRVLQAIFEHHKSDALMPI
                     VEVVTSDCQRLSVTQQGCIAIIRIIEYAKPAQKRTLISALVPLLSTLAKNQFGNYVVQ
                     CILKNMEGYVSLNDLVGSFQGHWVELSCDKYSSNVMEKIVGMLQGSLRQRIVNELIFD
                     VAHLQCLMQNSFGNYVLQAVIGSAVNQYEYGLIYDAVTPLLHTSPYGHRIEAKLKSRC
                     DALYSKAAPAGTTPVDAMNK"
     gene            complement(<27083..>28048)
                     /locus_tag="LMJF_06_0060"
                     /db_xref="GeneID:5649025"
     mRNA            complement(<27083..>28048)
                     /locus_tag="LMJF_06_0060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680723.1"
                     /db_xref="GeneID:5649025"
     CDS             complement(27083..28048)
                     /locus_tag="LMJF_06_0060"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680775.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649025"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ73"
                     /translation="MNTLGSSGSAGAEAPLVGGPDALTLQTINEQQLIILRQKELVST
                     LKECVEELGAQLRRAGVKPLEAAQKEDGCKGTLSYVSEMQLRRRVRTLEDENKKLSDL
                     VDELRAEVSAISAQLCAQQLHTQSEKDVWKAKVSSAEAKSVATAHLLEATGKRNQQLV
                     HHLETLRREGEVSAYECTQWRSLATTAVSHLDHANQRYARAQINSIEEDVHRYAVNRL
                     RLVRVAASASLSLDSGTPEETRKIWSRSAQLPKLHPAPQVFQQQQQEPVCSPLHVSYK
                     RPLSQLLPCQPPQPTTSYSLPPPTAEHVNAETHLSPSHCAALAQT"
     gene            complement(<29784..>31160)
                     /locus_tag="LMJF_06_0070"
                     /db_xref="GeneID:5649026"
     mRNA            complement(<29784..>31160)
                     /locus_tag="LMJF_06_0070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680724.1"
                     /db_xref="GeneID:5649026"
     CDS             complement(29784..31160)
                     /locus_tag="LMJF_06_0070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680776.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649026"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ72"
                     /translation="MTLMHDDVLVVAGVSVCHVSWFAVDTHSLLLASATADAARISQK
                     DRWQQQRPHDGGTWTENEDVQLDFVLYGAKASAMNDTSEVVDYTFLTAQPQPSRVPGE
                     ALVAYQARLKHWMETCYAAHYAARFIDHLRSASPALSFEYDSVLKLISSADGQRTVRG
                     LVAPALDGSGHHLISFTVPLFVTGRAAKVFQSLNNVAVLYCTMSHVKWKPSYQLTSVE
                     ADVHTRFRTAQRTGRITLIAESVVLRLRDAAAAGGEAGATTEGRAADSLISFLHSCVD
                     LYGLPRLSMAQQGAGFLDHIPRLEHTLYRRIREPLHFMKLVLGLMADFGSPIDVSASC
                     RALTATVDSATPQLPLPWSPQQQQQQHPPPMRRTATFCVVDRTTAMSFTIGLHYQSGD
                     EFPSVETTCNQYLDAQHGATVSRRVKFSRSASSMRKDDDGFLDVEDLRVIVVRETLEC
                     MSGSAALA"
     gene            complement(<34880..>36853)
                     /gene="ABCG1"
                     /locus_tag="LMJF_06_0080"
                     /db_xref="GeneID:5649027"
     mRNA            complement(<34880..>36853)
                     /gene="ABCG1"
                     /locus_tag="LMJF_06_0080"
                     /product="putative ATP-binding cassette protein subfamily
                     G,member 1"
                     /transcript_id="XM_001680725.1"
                     /db_xref="GeneID:5649027"
     CDS             complement(34880..36853)
                     /gene="ABCG1"
                     /locus_tag="LMJF_06_0080"
                     /codon_start=1
                     /product="putative ATP-binding cassette protein subfamily
                     G,member 1"
                     /protein_id="XP_001680777.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649027"
                     /db_xref="GOA:Q4QJ71"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ71"
                     /translation="MPRLRNEPICNGISIDAEDQEGTSNHGHQTLSYGKVDSQLHGSI
                     AESDSSTRRAIGVPSSYSLPLSWHRLSYSVGKKRILCGLTGTALPGRCLAILGSSGAG
                     KTTFLNAICDRLASGGELRLSGRRQLGDCEFERHFRKAMGFVAQDDIISPLSTPYDAL
                     WFSLRTRRGTSRAETEERVQEMLNVLRLQHCRDTKVGIPGLESGLSGGERKRCSIGIE
                     LICDLKILLLDEPTSGLDSVTSAKVVHLLRQLSRTGRTVIYTIHQPTAEVLSYFDDVM
                     LMTQGRIAYHGTMAASLDYFESIGFSCPSKYTPTDYYMVLLQDSVTSKVLIKRWRKYL
                     KNGPRTPHTAAVRLAKSRGESSAARFLDAYIAKFGSSPAVQLYELTRRTMTEISRDYL
                     YLFSYMAQAIFFAIVVGLIFLNVRANVEGIQDRQGVLFMTVMNRAMSSTFIMINTFNN
                     VRAVFMREQQAGAYSPLMFFLGRSFAEFPVQILAVLVESCILYWMVGLHRHPGSFFYY
                     FGVIALLSQVATGLGFAISASCPSVVVSSALASVSLMVLYLGGGLLASTDRLRPYWYW
                     LEKPSFMRHAYILVLRNELHNVPHIACDYYRWGDGYCINQARDGRTVMRLLGFDGDPQ
                     SASVYMWVSLAIMFFLLRSISVIVLMVAAREKT"
     gene            complement(<40263..>42254)
                     /gene="ABCG2"
                     /locus_tag="LMJF_06_0090"
                     /db_xref="GeneID:5649028"
     mRNA            complement(<40263..>42254)
                     /gene="ABCG2"
                     /locus_tag="LMJF_06_0090"
                     /product="putative ATP-binding cassette protein subfamily
                     G,member 2"
                     /transcript_id="XM_001680726.1"
                     /db_xref="GeneID:5649028"
     CDS             complement(40263..42254)
                     /gene="ABCG2"
                     /locus_tag="LMJF_06_0090"
                     /codon_start=1
                     /product="putative ATP-binding cassette protein subfamily
                     G,member 2"
                     /protein_id="XP_001680778.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649028"
                     /db_xref="GOA:Q4QJ70"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ70"
                     /translation="MPPPAATRAPTEDTYTDYSFTPISIDEPDVHHHQRRDSGKVDSQ
                     LHGSIAEFDSSTQRAIGVPSSYSLPLSWHRLSYSVGKKRILCGLTGTALPGRCLAILG
                     SSGAGKTTFLNAICDRLASGGELRLSGRRQLGDCEFERHFRKAMGFVAQDDIISPLST
                     PYDALWFSLRTRRGTSRAETEERVQEMLNVLRLQHCRDTKVGIPGLESGLSGGERKRC
                     SIGIELICDLKILLLDEPTSGLDSVTSAKVVHLLRQLSRTGRTVIYTIHQPTAEVLSY
                     FDDVMLMTQGRIAYHGTMAASLDYFESIGFSCPSKYTPTDYYMVLLQDSVTSKVLIKR
                     WRKYLKNGPRTPHTAAVRLAKSRGESSAARFLDAYIAKFGSSPAVQLYELTRRTMTEI
                     SRDYLYLFSYMAQAIFFAIVVGLIFLNVRANVEGIQDRQGVLFMTVMNRAMSSTFIMI
                     NTFNNVRAVFMREQQAGAYSPLMFFLGRSFAEFPVQILAVLVESCILYWMVGLHRHPG
                     SFFYYFGVIALLSQVATGLGFAISASCPSVVVSSALAPLVLIPLALGGGLLASTDRLR
                     PYWYWLEKPSFMRHAYILVLRNELHNVPHIACDYYRWGDGYCINQARDGRTVMRLLGF
                     DGDPQSVSVYMWVSLAIMFFLLRSISVIALTVASCARTA"
     gene            complement(<43400..>44488)
                     /gene="ABCG3"
                     /locus_tag="LMJF_06_0100"
                     /db_xref="GeneID:5649030"
     mRNA            complement(<43400..>44488)
                     /gene="ABCG3"
                     /locus_tag="LMJF_06_0100"
                     /product="putative ATP-binding cassette protein subfamily
                     G,member 3"
                     /transcript_id="XM_001680727.1"
                     /db_xref="GeneID:5649030"
     CDS             complement(43400..44488)
                     /gene="ABCG3"
                     /locus_tag="LMJF_06_0100"
                     /codon_start=1
                     /product="putative ATP-binding cassette protein subfamily
                     G,member 3"
                     /protein_id="XP_001680779.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649030"
                     /db_xref="GOA:Q4QJ69"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ69"
                     /translation="MGFVAQDDIISPLSTPYDALWFSLRTRRGTSRAETEERVQEMLN
                     VLRLQHCRDTKVGIPGLESGLSGGERKRCSIGIELICDLKILLLDEPTSGLDSVTSAK
                     VVHLLRQLSRTGRTVIYTIHQPTAEVLSYFDDVMLMTQGRIAYHGTMAASLDYFESIG
                     FSCPSKYTPTDYYMVLLQDSVTSKVLIKRWRKYLKNGPRTPHTAAVRLAKSRGESSAA
                     RFLDAYIAKFGSSPAVQLYELTRRTMTEISRDYLYLFSYMAQAIFFAIVVGLIFIVFS
                     CVHVDSAPSFFSILPLTLSVWAVWCGVSLDRCLSVLSVRCPLRITACASLSRYLHSYM
                     SGKCTGSSTAPCGLAVMWWREVCRRALL"
     gene            complement(<46131..>47936)
                     /locus_tag="LMJF_06_0110"
                     /db_xref="GeneID:5649031"
     mRNA            complement(<46131..>47936)
                     /locus_tag="LMJF_06_0110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680728.1"
                     /db_xref="GeneID:5649031"
     CDS             complement(46131..47936)
                     /locus_tag="LMJF_06_0110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680780.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649031"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ68"
                     /translation="MRYSHSRTLLDVERQQRDGRHGWQARMWHLTWLTLVLLGFYVVC
                     TYNVWRYPRPVRHVWIDSVLVEVVEDDWVERARPWLLYGSFGCGALRVLLHCVLCPAA
                     SAAPAGNTGATATARERTRGGRTRAATATAHNASQPSLMKEISTIAVPAWARRRSDGN
                     LPRGTRGAVPADATAAAAALAPQKSTFDPTRPMRTEKDLEWFLACENAQQQQWRSAEA
                     ALSGAVALHYRDRVGASAAGGGGVDSGPVDAAERDVISVLYESKPLHQRGRSGTAAPA
                     AFGVHSSSPSSSSLSIPWADLGIFHLEETLQRTREWMSDVCRRLVADVEQCDRWFNEH
                     QIEAYDCHHSLQELAPAPPSHPQPAAMAPAPTMRWGPPAPVPSVAAAPQHETKLVSLL
                     REKGRCRQTQQGMQDLDMALRYDQRLTLEVRLDVSGTFSSSSAAPPSNAELTACREYV
                     LQRLRTFAKQRYLISYNSSGGDVETWRSGFPCDAHLLLHVLRTSVKGLKEYVLFGYQT
                     GLQAQDLALYVGDTGEPYFYVRFRQGSNETLLSTRQGPTSLMEAILAFAAVVHVYYHD
                     VYGGVRSTVDLNEVGLLKVVTEGRRVDWTSTGGES"
     gene            complement(<49294..>49857)
                     /gene="CYP2"
                     /locus_tag="LMJF_06_0120"
                     /db_xref="GeneID:5649032"
     mRNA            complement(<49294..>49857)
                     /gene="CYP2"
                     /locus_tag="LMJF_06_0120"
                     /product="cyclophilin"
                     /transcript_id="XM_001680729.1"
                     /db_xref="GeneID:5649032"
     CDS             complement(49294..49857)
                     /gene="CYP2"
                     /locus_tag="LMJF_06_0120"
                     /EC_number="5.2.1.8"
                     /codon_start=1
                     /product="cyclophilin"
                     /protein_id="XP_001680781.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649032"
                     /db_xref="GOA:Q4QJ67"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR020892"
                     /db_xref="InterPro:IPR024936"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ67"
                     /translation="MRAVAVVAVVLCALSFLNVAAEPEVTSKVYFDVMMDSEPLGRIT
                     IGLFGKDAPLTTENFRQLCTGEHGFGYKDSIFHRVIPNFMIQGGDFTNFDGTGGKSIY
                     GEKFADENLKIKHFVGALSMANAGPNTNGSQFFITTAPTPWLDGRHVVFGKVLDGMDV
                     VLRIEKAKTNSHDRPVKPVKIVASGDL"
     gene            complement(<50821..>51381)
                     /locus_tag="LMJF_06_0130"
                     /db_xref="GeneID:5649033"
     mRNA            complement(<50821..>51381)
                     /locus_tag="LMJF_06_0130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680730.1"
                     /db_xref="GeneID:5649033"
     CDS             complement(50821..51381)
                     /locus_tag="LMJF_06_0130"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680782.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649033"
                     /db_xref="InterPro:IPR012816"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ66"
                     /translation="MPSSSKKQNVVTFSEVHDPLYGMLSPLSPSPLVVRHVQYPSLHH
                     YFLCERFKGSPAEQWMAEATTVWSLERLVKTAEEEGYQRHNWNKVKVDVMLLGTYFKF
                     KQNEAARAVLLSTQPSLLLYHTPTDDFWGDGGDGKGKNVLGVVSMAVRARLHSEEERQ
                     KQRPPASGRHSKSAAAKSPALPATRT"
     gene            complement(<52926..>53669)
                     /locus_tag="LMJF_06_0140"
                     /db_xref="GeneID:5649034"
     mRNA            complement(<52926..>53669)
                     /locus_tag="LMJF_06_0140"
                     /product="putative 20S proteasome beta 6 subunit"
                     /transcript_id="XM_001680731.1"
                     /db_xref="GeneID:5649034"
     CDS             complement(52926..53669)
                     /locus_tag="LMJF_06_0140"
                     /codon_start=1
                     /product="putative 20S proteasome beta 6 subunit"
                     /protein_id="XP_001680783.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649034"
                     /db_xref="GOA:Q4QJ65"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ65"
                     /translation="MIEDHAEYGHSHYPQKLASSTLTLPKQGVKQQQWSPYHDNGGTT
                     AAIAGKDFVILAGDTRLNGDYCLHSRHDQSKIFQLTPYTYMASNGMQADRLQLQQMLK
                     YRVKWYQYNNGGKVPPTKAIAQLMSTMLYHRRFFPYYTFNMVVGLDEEGHGVCYSYDA
                     VGSTEPFLYGTRGSAASFLEPVLDCLINRQHMTAQAPPEMTKEETLALLKNAFTGAAE
                     RDIYTGDSVSFFIITKDGVQRESFELRKD"
     gene            complement(<54512..>54841)
                     /locus_tag="LMJF_06_0150"
                     /db_xref="GeneID:5649035"
     mRNA            complement(<54512..>54841)
                     /locus_tag="LMJF_06_0150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680732.1"
                     /db_xref="GeneID:5649035"
     CDS             complement(54512..54841)
                     /locus_tag="LMJF_06_0150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680784.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649035"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ64"
                     /translation="MFRRNSRLLVRLPKCRRPRERPWEIFNVRDFGYHEGSQNYMMWL
                     GTAVVFTSMLAFEVYQQIQRIFQRGDTCSACEAARAHYRKRVEERERETEAQTQYSLK
                     LRKPHAS"
     gene            complement(<55454..>56857)
                     /locus_tag="LMJF_06_0160"
                     /db_xref="GeneID:5649036"
     mRNA            complement(<55454..>56857)
                     /locus_tag="LMJF_06_0160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680733.1"
                     /db_xref="GeneID:5649036"
     CDS             complement(55454..56857)
                     /locus_tag="LMJF_06_0160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680785.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649036"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR006674"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ63"
                     /translation="MCVCGGAWTKREEMLRKHRPRELTILDRVYEHISLPPLVVAAID
                     TPAFQRLRSLHQLGASSFLYPGAVHTRFEHSIGVAHMARTLLLNIQHHQPDLGLSEVD
                     IELGMLAGLLHDVGHGPFSHLFEDVVSRRCGIEFNHEDMSEKIARRVLRDLVPQTHVD
                     VVVGLMRGKALLGITYGEIISNKRNGIDVDRLDYFIRDSMCCFGKPTVDVRVNRLFNS
                     ARIVCEEGQWQLGFEQKLALSLREIFTLRAKLHKNVYQHQVTKAIGHMIGDVIHAAAP
                     HFRVGGHTLVECAQDETLFLKLGDWILEAIEASEAPHLAEAHAILHRLRTRDIYRVAY
                     SSALDITMRAPMAAVDWPAAILEHAHPSFPLNADDFIAEVVVINQGKGTEDPLESVLF
                     FNPKKPSQPLTRLKPAEDLKHGSPLFTPLQFEERTLMVFERRPTNGAVQRACERLNAD
                     PKYAAFFTDSLPFYNTK"
     gene            complement(<58183..>58608)
                     /locus_tag="LMJF_06_0170"
                     /db_xref="GeneID:5649037"
     mRNA            complement(<58183..>58608)
                     /locus_tag="LMJF_06_0170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680734.1"
                     /db_xref="GeneID:5649037"
     CDS             complement(58183..58608)
                     /locus_tag="LMJF_06_0170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680786.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649037"
                     /db_xref="InterPro:IPR005651"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ62"
                     /translation="MRLLTHNFLACLKCDTYPLLVTAAEMEEIPVEYDAEFTRRMLAR
                     VDYASLRTTFHALREAHESVRGPSHDEGADTAEGALASSELPETMEGADFSDHSAFLR
                     TAHYAMNVVAVRNGTLECPACKTTFSINDFIPNFVPEAK"
     gene            complement(<59132..>61150)
                     /locus_tag="LMJF_06_0180"
                     /db_xref="GeneID:5649038"
     mRNA            complement(<59132..>61150)
                     /locus_tag="LMJF_06_0180"
                     /product="kinesin-like protein"
                     /transcript_id="XM_001680735.1"
                     /db_xref="GeneID:5649038"
     CDS             complement(59132..61150)
                     /locus_tag="LMJF_06_0180"
                     /codon_start=1
                     /product="kinesin-like protein"
                     /protein_id="XP_001680787.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649038"
                     /db_xref="GOA:Q4QJ61"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="InterPro:IPR028763"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ61"
                     /translation="METEMAPAPSASSPTQLQGDGHTRDTGETKLLYSEVIRVVTAAG
                     RLTRPISSPYMLEVLRPPAGGTDHGRSAHRPSMPTRQSLPHRLGNGGSGGGGSSKAAR
                     VYAFDYCAGPSTTQEEFFDMLEMPALCEAALTGETVTVLCFGQTGSGKTYSLSGRTLP
                     APATAGPVSDAPTPLVAEDGLQYQAVHYIARRLKELRRSSRRLKSKRGDSDCAGKGSA
                     DCGDDGGVSGASVGASASGATVVTAKCSYVELYQESLYDLLQPDGGDGVRCRWSAAAS
                     SFFVEGSLMVECRGREDFLLVLREGQRNRQRGSHALNLDSSRSHVVFTVFFEVRDEAV
                     VATSAEGVDSDGAPSSSPPPGASAPLSSTRYGRLVFVDLAGSERLKKTLSTSNAEAGS
                     INKSLFTLGRVLELLSASPPAPSTQVPTSAAPSDAMPPAKASTQQPPFIPYRSSVLTQ
                     LLMHSLDGHGRTVMVACVSPSALHLEESLRTLHYAERARHIRATPVVHVDAATQARMA
                     LEEKVQELRQENALLRRALGLPRVGKLQDGQVDARLEELHRAWAAAQLATPPHEASPR
                     SAATSPQLSSTSRKEPPPQQRPATWVSPSRPAVPLVSNGATAASGAVGLRTSSPQTVV
                     MSSTESEADDGSPSATGNADLPSSVPRAAAVSILDLLEALPDTRLMQT"
     gene            complement(<62776..>64539)
                     /locus_tag="LMJF_06_0190"
                     /db_xref="GeneID:5649039"
     mRNA            complement(<62776..>64539)
                     /locus_tag="LMJF_06_0190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680736.1"
                     /db_xref="GeneID:5649039"
     CDS             complement(62776..64539)
                     /locus_tag="LMJF_06_0190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680788.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649039"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ60"
                     /translation="MLDRSCRGGATSTLTNAEASAFYLTALVAQALRLEDYWVHLGHQ
                     IEVDQHVEFIQYCAREGFGALKTMHLLNWWRQYRSLVRGDADVCAETPITPLLLSDGN
                     PQRNTIPFHFHSGNASCGSAGGGEHGSAGGSALSHGKEGSGGRASKKGRRLSTITAAG
                     TMPSSEQDGLAGTAASLAAAAPTPLLYATHAEALHGELQRFVQWELEHEWAWRQVPRE
                     PVVSAAVALTLPRSTSLSSGPTRSTSGMTAAGVAKPSRAEKAKLQQLQQQEMEAEEQR
                     LARVAAMPPENIFLTKDELDGFLQFVVEEDLLSHTALHMCMTSHAQQPMNTLSRSARA
                     PVHFSVQVETPMSVLPLREAARLSALQRSSGSGNVSALSATRDEVAGGDATVGGAATP
                     QQPPRPTAAPGHGKPVSGRPRAHSKRAIKGASKDAAAATAAEAAAVAASNLPAAPELT
                     VPPTAMEALRAEQAKEAAAYQAAYEEELAQTAAHQRAEQHAADVHLFFEKPRTNEAVQ
                     AVYASIECALAARQQRILQRVVALERALGLSTPSAESDRLNSAGASPDGSGAAAAASK
                     PTTSRGASSSGVSTPRKRKAK"
     gene            complement(<66507..>67994)
                     /locus_tag="LMJF_06_0200"
                     /db_xref="GeneID:5649040"
     mRNA            complement(<66507..>67994)
                     /locus_tag="LMJF_06_0200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680737.1"
                     /db_xref="GeneID:5649040"
     CDS             complement(66507..67994)
                     /locus_tag="LMJF_06_0200"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680789.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649040"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ59"
                     /translation="MAPRTGPRVKVISPNSEAVTVSRSLSVASSAYSSGHVTPGTASL
                     LRSGFRRGEPQRGGDEMAYGGRPEVTGVALPSRRTALRAMDVNMLHETGPSHDKSAPC
                     SLAPSSAQSVTRTTTITTTASGCGSSGSGGKDAHPRRSLPNFFEEAGFSNNSGTERRQ
                     WPLKTSTSRSHSTFHHADASAVKQRQQPTSRQRAEDEEAVRRATAALEHAGGAVLRRP
                     FSGGNATRDEGRAATSALGGNTSSLPVQQPERRGLCLPPTIPITSHTRRHRSEYSDYS
                     GNDSSMGSTVSSYKRARSWAEPPPPPVQAASQQPTSASRPSFYVAQPAAESVAQRLTA
                     PRVCPGMFAGLSAIPVGEELFVGADALHPNCTSTVCAAPVMDAATASAAGGGPVQQRY
                     CVRPLWSLVGTFKTSLSGLVTINLKQECLQWSQRNPKGGKQTIKVPLASVLDVFTTRV
                     VQEDEHIEERQYTVVARTSTRPSQVVFGFATATEANHLRNVLKRR"
     gene            complement(<70595..>72634)
                     /locus_tag="LMJF_06_0210"
                     /db_xref="GeneID:5649041"
     mRNA            complement(<70595..>72634)
                     /locus_tag="LMJF_06_0210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680738.1"
                     /db_xref="GeneID:5649041"
     CDS             complement(70595..72634)
                     /locus_tag="LMJF_06_0210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680790.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649041"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ58"
                     /translation="MANDIEVDFVLVRGPWSLDRRMRVTLPSNGTPVTVGRATHCAVL
                     LDPSLLFSSQVQCSLFAMQVKGVVTAPSTSTTTTATDTPMTADASSTPNHSCAGGTAP
                     HCEDTPIDAADTPSTPLHQPTLRDGGHADRTTRVYITDMCSSNGTFVKGIRISGTDPT
                     ELNHGDVCIFGGMRDVAVGEALPPDAYDGPELVQWRVDLRLSAERPPETFAYTSTPLV
                     LPARSVLEVEERALLDTAQRSLAKPMLPSMRTPASATPAVSTVAAVIDQRSLDLAAGD
                     SAAHCLAAFDTRCDTPPRGVPQQLFTSPISHEKDATRETAVEEVGEAQKPSSSGRRSV
                     SLVASQDAQVTSMEAAEETSGVEDTANSTHTPLDDPVAIAVPADPPAAVVYDAVRLGN
                     VSYYARGVAREERDLEADPDADVDEDVESATPSGKRRLRDSPASATPQEQKRVRHEDA
                     AVVALTQLTFTPMHIKWTMPNPNEMWSRLQRSPSDKAAAAAAAAAAPHDSGGSGRATK
                     PFHVMLPVTSLATVVVCPERLGIAVELKDGCQLPLVDAAVLSGSAESRWVVWELSQRT
                     AAAPAPADEARSSGRGRSKVTKGNTRKFCKRTEKTPSVAAQPTHTAAADVVKSPLTPA
                     ARFEAWLMHFKLYYAAQKVPAPVVVDGAAFDVILSPSLAAPASAVSARAAAAAAR"
     gene            complement(<73565..>74428)
                     /locus_tag="LMJF_06_0220"
                     /db_xref="GeneID:5649042"
     mRNA            complement(<73565..>74428)
                     /locus_tag="LMJF_06_0220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680739.1"
                     /db_xref="GeneID:5649042"
     CDS             complement(73565..74428)
                     /locus_tag="LMJF_06_0220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680791.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649042"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ57"
                     /translation="MKHSTVAPSSSLELTTKPFLAEILRRAAERLCQKRLWRLASQLE
                     RLPSPAPADVVRDALRDICVFLSDEEDAHLCEAYAAGATDGRQPDCRMIDTSALLESL
                     STAPLTPRRKHVVDLVIRKLDPKGTGTISYMTLSDHYDVLRHPEVRNGARSEDDVLLA
                     FFDNFCAADGTPMVQLTAAEMRMYCVGVSMRIKDDTDFELWCTRAFCLDRPKLDQSQA
                     TAQLTGSRSHSRLSRLLGEGRQHPLYTTTNEEYGKELTPSDYKLPQHGRPQQFTRNLK
                     RRTGGATSMNM"
     gene            complement(<75154..>76161)
                     /locus_tag="LMJF_06_0230"
                     /db_xref="GeneID:5649043"
     mRNA            complement(<75154..>76161)
                     /locus_tag="LMJF_06_0230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680740.1"
                     /db_xref="GeneID:5649043"
     CDS             complement(75154..76161)
                     /locus_tag="LMJF_06_0230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680792.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649043"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ56"
                     /translation="MCTGVCMCRRLPVRAALAALCPSPLTFLPPLSLSLAHCQSAARP
                     TSTSFYLSKVFPCLDVKEQRNKGRKSQDAQCCNIQRKGNPPTRSPAYSHRHSTVLHHR
                     RELDKDTHTHTHAVIQQGGNMGIILNMSVYGLMIIPLAAMVKGHNISLRRLAKLSIVM
                     AAVQLAQSTITMAVPPDVVAAQVCVQGALLPLVTVAFCFFILNDAKAVKVMHLHDCGD
                     GDTGAAVATMWCLCYTVLFRWFPWYHSMSSRGFEAANLASGAEAYLTLITMLAMCRSF
                     TTGQPVAATAAWGLHVVGAVAGAAAGMPMAGTVLTTALMTAASATAFRAPAEGRGNKE
                     D"
     gene            complement(<76880..>79417)
                     /locus_tag="LMJF_06_0240"
                     /db_xref="GeneID:5649044"
     mRNA            complement(<76880..>79417)
                     /locus_tag="LMJF_06_0240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680741.1"
                     /db_xref="GeneID:5649044"
     CDS             complement(76880..79417)
                     /locus_tag="LMJF_06_0240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680793.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649044"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ55"
                     /translation="MHVKRHNAKLMEWYDAQLGIQLPFSPVFFELKQEERQAPLILLT
                     FCTVREPTHRMAITVEELYEPQTAAAYREASLGRIADCAKIVGQSTTRIGSKDHPAAE
                     YCYVDDHQAMNCVFSIFVVHRRLAVTVQYVAPTRVRSVMPTAVYDIVRFLAFATPSPS
                     PSYLLVSEPRLGLGYHLPLDFLVHEGLAESDGVEDRLFTSSMTAGGGGPLSTFPGGIN
                     APQPYTRGTAGADEAAYPPYCHPSCYYTGHAGGGGDEGAWMVPYATAMSRGGRRMGLI
                     ASYEPAGVATATCTLDGGGAAAATSGSGVPYAWQTYLEQQVCKAVRQLGLVLGSSDDD
                     CAPHVVFQAPDAAHPPSRQTLLVEPYPLSIALKGNFSAGDDAREEDSDAVALVTAFSL
                     FREVRVDVNSAYLTLVPDALESVAAAAAAARSRSFTGVADLTACTVKAYWSAFYVPVG
                     TACVSFHFIASALRHTSTEFVSFCAAVMNSVSLGNHYGQSVSVLYCNIRHDVLPFRLS
                     LPPTGMATVEEPMLADPLCVVQATYGVEKVGVTVRVFPLFTSTTSPVEDGSSGGGGTG
                     FAAATATTDGRPLTPSKALPPRPIAERRGTRQRSIFRQLQHMIRYYLSQFPGGVHIVS
                     QERTTVDAMPAIRVCFKPLWYAGDIGDGGAQRTGGGSGSAAPPASSVTSWDEACGGGG
                     GGGSSQATSDWVGARDALLEEEIGQLNPFAQYFPPPPPPASYLWGQQQQPQLTPASSG
                     TIGKASTSVTAASLRKAAVAGAAASGGAEASTRDDQESQPYYGPRGDELQHSQEELDD
                     PLRVAIVVCCEGNAFLFQASASEYTLGMSMQAVQTLAMYLAPIPRGN"
     gene            complement(<80948..>81784)
                     /locus_tag="LMJF_06_0250"
                     /db_xref="GeneID:5649045"
     mRNA            complement(<80948..>81784)
                     /locus_tag="LMJF_06_0250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680742.1"
                     /db_xref="GeneID:5649045"
     CDS             complement(80948..81784)
                     /locus_tag="LMJF_06_0250"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680794.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649045"
                     /db_xref="InterPro:IPR026157"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ54"
                     /translation="MDPLAGLTTGSRNVIDDFFRWSRLSLDKFKRDLTVEASAFQAGN
                     LWREQYTKAEVAQMLNGQLALMLGVVDTQMEGTTAASAELMRAVLREADRQRVTLDID
                     VKSVLNNAGGVNAMGEHGRQLMSGPTGRLAPLTVEEASGEAARQLAEANAEVKRLQAK
                     LQQVTDAYTQVMRGRSSDTENLLSMQDAMNDKERLAAELARRCQGQDPSLAATVQELR
                     AEVAEAKRELASRLHQSTQYQQVKHLLAQRNEQLKMMRERLAAYDPSFARYGDDINAE
                     DD"
     gene            complement(<83589..>88061)
                     /locus_tag="LMJF_06_0260"
                     /db_xref="GeneID:5649046"
     mRNA            complement(<83589..>88061)
                     /locus_tag="LMJF_06_0260"
                     /product="putative 5'-3' exonuclease"
                     /transcript_id="XM_001680743.1"
                     /db_xref="GeneID:5649046"
     CDS             complement(83589..88061)
                     /locus_tag="LMJF_06_0260"
                     /EC_number="3.1.11.-"
                     /codon_start=1
                     /product="putative 5'-3' exonuclease"
                     /protein_id="XP_001680795.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649046"
                     /db_xref="GOA:Q4QJ53"
                     /db_xref="InterPro:IPR004859"
                     /db_xref="InterPro:IPR027073"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ53"
                     /translation="MGVPKFFRWAAERFPSIITPFKDSPPPVDNLYLDINGIIHNCTH
                     PNDVDATRRSPTEKEMIQAMFVYLEKLFNAIQPRKYFLLAVDGVAPRAKMNQQRQRRY
                     RAGYEMMIAREEALAMGEEVPEEKDVFDSNCITPGTPFMVRVSKEFQYFITMKLSTDP
                     AWQGCQIIFSGHDCPGEGEHKIVDFIRRRKMQPNYDPNETHCMYGLDADLVMLALATH
                     EPHFVLLREVVAFGPGSRKERERQEEDEAKGLVKDKAYHKADEFVLLHINVFRDYLQL
                     EVKSYLAKAKSSVSVDFERVIDDFVFMCFFIGNDFLPTLPTIGINDGSIPALLRIYVD
                     NMLSKNKYLTHKGEIDWRSAEVWLNEVGKLEFETLRRRQQEEAEFQKNRARRDPTHEV
                     DTTSVIPITSILEFKQRYYGEKHGFAGGWDASSEDMRRLREHYVEGLMWVMHYYYQGV
                     PSWKWFFPHYYAPMASDMVNLPAIAANVSFELGKPFQPHQQLLAVLPPMSYLSMPKAY
                     WPLLRSPSSPLAKYLPEHIVIDREGARAPWEGIVLIPFIDERTLLAAYESVQKNVSPE
                     DAANNVNGPPLRFCYDGKMPLYDLEDEMFGSLRNVLVRRETYAFPHIDKFIPQLCSGV
                     RVGTRQLEGFSTLQSKRDLIQPVFEAGVVSIFGRPTKNDSLILQMRDFFKAKSVDQVA
                     TLVGKEVLVGFPHYKRARIASLKDAHKSITASYSKEGTFSGTEEHKNNRDESAAFVKE
                     ADTHARFMKSQLGLAVEQVDVLVYVHRFNGMQVTRKGHIERHFATTWTCYPIQLICTL
                     DSIDMQEDSRCIERDRSEGDSAFGARCVYIGPQPKSKKSQMDVYGSCGTVVTAGQHDT
                     TTQQGDQMTVRLKVFQEPLRLPAELLQFAAQRNWTALPQVAISLDILPHTLTSICSSI
                     VTSPQFGSRELGLCLKFTGRCIAKVGYAKLVQHSLNPWYVGNKDIFARMEKDTEDIGY
                     HLEMGEKGDFAGNSSSNRGGSGTWYFSRDAQELICDYVKRFRPLIQYIEAGGVNSNSV
                     EPQQFLTGKWRDRDVDDVLTEIETFLIESGLRETPMITATEEAFPQQLLEQLEASLQQ
                     QQNRSFKELSLRQVSRNQLYFPVTRSSCGHLVPLPLPQEQTFYLGSRVANCRATGIVP
                     FGTQGTIVRLLASGREAEVVYDTPFTGGTRLDGRLKDTRAAITKLSALLVLKSTDVQQ
                     PQPQPQTQSDMRAAATAATNGSAKLRELEFLLQANGIHVDPSGKSTVSPPSLPAAFQS
                     PTIAAARTAPADSGASHSSTAGAGTSVVPRPRSAVATEQTSAPATLGKRSTPASATAH
                     LSSTSSVTPITRETHGSPASLKITAAPGSSGISLQDLAKHLPASTSQRSPATVASPAS
                     HAPPSAAVAATTTAAPSGITIPAPKSVQQHQHPVHPALPSQSNESDETASDSNTRRKS
                     RDLHVIPDDFVSGRFKIKYTNTGSLFRSWLDTFTAEAVRKTLAELEAEGNANPV"
     gene            complement(<90349..>91287)
                     /locus_tag="LMJF_06_0270"
                     /db_xref="GeneID:5649047"
     mRNA            complement(<90349..>91287)
                     /locus_tag="LMJF_06_0270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680744.1"
                     /db_xref="GeneID:5649047"
     CDS             complement(90349..91287)
                     /locus_tag="LMJF_06_0270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680796.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649047"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ52"
                     /translation="MDSTYKEPSSAAVPTSYAVLSLPSKATMRRKGYNPDEVNYNGGL
                     ATHPLATWKTFSLPDGCTYKDAVSAVQTANAKPWGPIKIRLNFSDGRYEQFERVAPSV
                     MDSLQSTTTYSPNDAFKAETLSLSTMRRAQQQPRLRPLVDERGHHLSNKPIPRTFAPE
                     ELYKNCPPPVLSQPGYDFTPISYNTFLLNPQDPPHGVRNVQSNFMHSSCDYRPRSYLR
                     PEQATGTSHASRHCHCNEVFQVGDHTMDFACEGTTVDHRNRLVKKDYSPVGTLKANSS
                     IVGRRHARKPRFGCTGVADSQTVAAAVAPAADEETA"
     gene            complement(<91976..>94540)
                     /locus_tag="LMJF_06_0280"
                     /db_xref="GeneID:5649048"
     mRNA            complement(<91976..>94540)
                     /locus_tag="LMJF_06_0280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680745.1"
                     /db_xref="GeneID:5649048"
     CDS             complement(91976..94540)
                     /locus_tag="LMJF_06_0280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680797.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649048"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ51"
                     /translation="MWIVLFHDTPHFWLVGGESYRVGKANCHVVIQDDRSISRTHLTI
                     TVGLQSSTGARDAGEWAPQPISLLDSSTYGTAIVACGEDADDAETLDDTPHNGGDSHA
                     GGAGGAASPAPEMGVLGLCYAPAAAAAAAAPRKRQRSGSTSGRGAPQPALQLTKEVPF
                     HVPVYRSSWHQFTIHLGHHGAALKLVWLDVSALCEDVDVEVQPNLLHALHCCGVRQET
                     VSGSTQALSATETQGSAVGRSRTDGSGLSLSQRSAVAGTPSATPSPTAVTAAAAAVGE
                     AALSSRVLRCYNTVNFLVTSTVQPSTAVVAMLCRAVPIVTPAFFMAVCDRASPQIPLP
                     DPSRYLPPLSSWWRDFLTHVRPSADEPRHCGGDASVTAFTLTPPATTVTSVAGESAAA
                     AAAASHLRYFAPHPRRRELFSGITFLLLQWPLYEEVLSYLDGTGARVVWEDSGVGGLS
                     GPLCASTSSSRAALEALQSFFVRHQRHVLLFNETEPLLPWPGCMDVVRHGLSLCSVEY
                     GTLIEAIVTMRPLPLPPYPADAQMPRTFEEVEARVSAATALVSTLPAATAQEAAEEHT
                     QDSDEGRRTDAQPLFPELVGGSDAGVGHSHMRDTGVHRRPRKEDVDGWVSFERPATVA
                     PLATGLSTDKKPNGSATVRTVELLVGPYSLPPYPCFEDANAASADASATAAAAVGSAR
                     GAKLFVKQALPPPEPLVELEEHRARRQLAASMLTARVPTVDAENVVPEQVVMGNGGLA
                     SRVAEATSAAFNAFDTVAHHASSRRRGTAARRGGRRGGASAAAARTPANRLPRGGMAR
                     VASRCPADNIVSVEDEEDMTAGSFEATATRSGRGGDVPASAEDSAVFHIFDIDGIF"
     gene            complement(<96735..>97487)
                     /locus_tag="LMJF_06_0290"
                     /db_xref="GeneID:5649049"
     mRNA            complement(<96735..>97487)
                     /locus_tag="LMJF_06_0290"
                     /product="putative ribonuclease H1"
                     /transcript_id="XM_001680746.1"
                     /db_xref="GeneID:5649049"
     CDS             complement(96735..97487)
                     /locus_tag="LMJF_06_0290"
                     /EC_number="3.1.26.4"
                     /codon_start=1
                     /product="putative ribonuclease H1"
                     /protein_id="XP_001680798.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649049"
                     /db_xref="GOA:Q4QJ50"
                     /db_xref="InterPro:IPR002156"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ50"
                     /translation="MSASLSAATPSTTASKPLATTTTTSSPGAFEVVYVDGACSHNGT
                     SQARAGYGGYYGSMSDPRNFSCPVPLTESQTNNRGEVRAVIHAIVQAFVDAGAPADAL
                     EATHLVDPSAWRLVDLTRPLPHLIIYTDSRYVIDGLTRYAKKWVQNGFVLSTNEPVQN
                     QDLWRQLIRLRDRYNTLYARQQHDQQRACQWGDGHHSEADLAQLVRYTCQNARNDKSE
                     GVELIHVRGHSKVHGNEMADSLAVMGSRLHRS"
     gene            complement(<99853..>100356)
                     /locus_tag="LMJF_06_0300"
                     /db_xref="GeneID:5649050"
     mRNA            complement(<99853..>100356)
                     /locus_tag="LMJF_06_0300"
                     /product="MYND finger domain-like protein"
                     /transcript_id="XM_001680747.1"
                     /db_xref="GeneID:5649050"
     CDS             complement(99853..100356)
                     /locus_tag="LMJF_06_0300"
                     /codon_start=1
                     /product="MYND finger domain-like protein"
                     /protein_id="XP_001680799.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649050"
                     /db_xref="GOA:Q4QJ49"
                     /db_xref="InterPro:IPR002893"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ49"
                     /translation="MVLHIYHAAVGEKEFQFSTNINKLTQETYELDVNEAIEEVSSTI
                     LEQLTGEDALCCECKAAPATRLIHHTMLFAETFPPRVEDLPQPVCNSANCEAVAKSRY
                     LMDMEDATTAQGMPSPNGCFHCHKGARGAATVPLQRCSRCKVAKYCSVECQKADWKVH
                     KQVCAPG"
     gene            complement(<103880..>105910)
                     /locus_tag="LMJF_06_0310"
                     /db_xref="GeneID:5649051"
     mRNA            complement(<103880..>105910)
                     /locus_tag="LMJF_06_0310"
                     /product="putative folate/biopterin transporter"
                     /transcript_id="XM_001680748.1"
                     /db_xref="GeneID:5649051"
     CDS             complement(103880..105910)
                     /locus_tag="LMJF_06_0310"
                     /codon_start=1
                     /product="putative folate/biopterin transporter"
                     /protein_id="XP_001680800.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649051"
                     /db_xref="InterPro:IPR004324"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ48"
                     /translation="MAANYREDREKDNEFNSRLRVNLSAIDYIDNVNQADDKPDEVVG
                     EEGHYIHPDARALFAKTPCLEHIPIFGKSCQAYGPRCTLSLGLVYFLNKGLGYSLINY
                     ACFAMFTSRFGVSGVRYQRLASIAKLGFSIKAFAAMTSDSVAIFGYTKRWYCAAACIV
                     GAALTVGYGCLPKKESSADIAAGFIFLTSFCVANVDILSEGHYSRLMRRRPSSGPSLI
                     SWIWWFILSATIFGAVIQGPLSDKKLPQVGLFIAAATQLLSAVFFVWNWYGEGTNREE
                     QLADALTLKRELNRALRERQLASSFRATGSGKEEDKADSGLEKPMSAEAAAYYNPEGE
                     LSGDFALDTLHDDGETAEDEAPALSIVSCCGGIVEINKGICMRNWRIFVYSLLMVCSV
                     ITMMCVTILGTRWQLLYSCIAVVLACGTCAFWALPFLIAKVSIYFFSYAFLYLQLPGA
                     LDSFYMASKECYPEGPHFSYVFYNTISAVIGNLAGIAAVAAFPYLFSKHSLRFTLMFT
                     YFIQVLASAFDIIIVKRWNLYIGIPDHAMYLLGDAIVYEVSYYLAWMPTVILLSRICP
                     RGSESMVYALVAGFGNLGASMSNTVGSLLMEFKWPITTKGTCDFSNVPMLLLIGHILL
                     PMLIVPLSFVLVPAARICDDIDVSGNIIKQTAQSLHHKQRREAGEPINELPL"
     gene            complement(<106808..>109882)
                     /locus_tag="LMJF_06_0320"
                     /db_xref="GeneID:5649052"
     mRNA            complement(<106808..>109882)
                     /locus_tag="LMJF_06_0320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680749.1"
                     /db_xref="GeneID:5649052"
     CDS             complement(106808..109882)
                     /locus_tag="LMJF_06_0320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680801.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649052"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ47"
                     /translation="MPVSQCMRIAAYHASTNEADADELYASTISTDRCSSDDERAPDL
                     EVEASPPQHDGSTDVEGVRRDVDASYFSDFAGGEARCDEQAALPPPAPLGSEVEKEGD
                     ACSRKLLPHLCSDDNSVQVVTDVVAEGDADGFCDVDDESIMANHRKDSFPAPALALDA
                     AGRSAETIGPSPPMKSEGGRRNSWLDPLRALSTPYSKDVAAAHPKKPQLSEDVPVRRQ
                     VLPHTPARRPESRFERRTDTLPYHGGSSSVMVRGGTAAPSPPPVSELNGAASCTADQG
                     ARGYRQTNYASSSRASTLATIDAVHVLSLTDVLTNGNHKGCDGGKGASAATPTTPPRV
                     TPRDCDARVSFSPDDTSVAANSPPPRPITVTATPTAAQHTRGNDPRTRTMLPALETTA
                     LMGPRTRVVRDRPPRGVPLILQCTGHFPTRTRTILVDDTMMDDDEGDGEDTVTAGLHT
                     SVYKETGDRSDLSYSSSVSAEGVLLLRSGGRGGRGGRDASNGSPTPSPGVLHGRTYRV
                     ARSGSPLVSLTDAQFIGGDPATVAYQQPEPHHHDIDASPSLSPPKTWEEEEEVVDTMP
                     DLIDFSVQTEELEPSRQDESLILCGYSVEPICASRGASAPPEVRPRHRVPPCQPFFKT
                     SATDATASAAAFSKKGREGCAASQDVEQLQATGEGGEEGWAWPRGEASWLPQPSHLEC
                     DAVQTVSREWLPRTYTHRPSREANRAAGFDDDLPQASSPDLHDVRHLIESVEEAPAPG
                     RGFHPPLRITDMPCEGAEVRGGRNSTPSFRKSRHVNNSVECIQATPLSSSSATRFDER
                     SSLTLQRGRRKALHTLLARQMCSPNSSRCTTTSHEYADARASVRSARLIAPAADYVAT
                     QEQLRGQRLAAEEERARLSLVLDVCEAVRPHARDLLLMFLLLVEESNMRRRHGGRGQA
                     QRRSNPTSDRGTAYSSHLDSSVWEESRVTYGTCAEAVNCVLERHGVTRVRATRELCRR
                     VVAWCQHHHRGHSLLTQGASLLDSLRGTADEASVEYATFVSSVMEFAEQYPG"
     gene            complement(<111329..>114883)
                     /locus_tag="LMJF_06_0330"
                     /db_xref="GeneID:5649053"
     mRNA            complement(<111329..>114883)
                     /locus_tag="LMJF_06_0330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680750.1"
                     /db_xref="GeneID:5649053"
     CDS             complement(111329..114883)
                     /locus_tag="LMJF_06_0330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680802.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649053"
                     /db_xref="GOA:Q4QJ46"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR012317"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ46"
                     /translation="MPSWPILVTIHNLVNVPLSACENGLRSFVVEAHMVLRVSAYSAP
                     VATATFTTDDVVSTTPNLFEVRFDDVARCTSDGDGGGPKVWRCAVPELEVVVVVREIT
                     RSIRGSSSPYRPGRRADGDLDGTRVVGTSAPLPLNAKDIVEVHKLTTRIVGTEMGQVG
                     LSFTVDPGDKAGYRHRLESFLRAYNPQGLRLVPNVVEVVSELDTFTKLYRRYSIQNYE
                     ERLARFFDVYGPQYKSEIPSLLRQWEGREEELMRNLVLDNGPDVTTIDQHQRLTAYLA
                     AYQLDQNSPAVQEILAAHAGEKEASIPAGLFSALVQRYGPEPDPRTYLFATPRYTPAP
                     PSPPRTSGVSVGTGSHRHSHSSLHHGSPSLARSSAGASAAAAAAPQRCPPTPASERPY
                     VSVPMFPTPIPNREAPLETARSLDRSPSFAVDGGAPRGGEHKATVTGDRHETKPVTTP
                     KDQVIVSGTTIGASRRDVTALRDALWRKMCSMMQTRQQHSKPWREHLLFFLDQDEFAA
                     AVRALHAFSEAPDGGEVQVLVEEWSHRLDHAFRTEALGSGDAYYAAAVQEAVRLTGLQ
                     PLHLQVMSVSSFFHKEQYAGFVAYVEGQAKRAKTERLVLVGSWKNLMDVARFGLRAAA
                     DPAGRYGDVLASSSATVHDASATTGDSPFIFLREPFRHCTEKHSCALLVCEVAVGEMY
                     SCPTTAHAPRRPAADFLAKYDSCAYVDEANGPVVAVYFRQQVLPRLLLQCVVDPQLQP
                     CPAHPDRPVEYYVMESHAFACSRCVVMGAYKGKEVTPIEEAAVMARAGLAEVERTVSA
                     LKESMLAYANQLQNEESSMPTAPRRVEAEREIDRLQKETEERVRRIRRQVQLEDEAQL
                     SRINAERTEVQAALEAVDGLGERLTFAMQQRTPVAAVNALQHIQQERQVEQLMARAQE
                     RVPSAPLELVLPLDGPPAALPPRSSPTSRVRSKGSPVVVGLNESRLPEASADDGRESR
                     VPGSAAPHASRAPSTRHTKHASPLPGSLYAQYLAIADADGKKAAAEGSSRIEQPSLDL
                     STAVFASRPRPVPVPASDDRDGGGEMSALSAKEALTRGWALLRRGDVAAAHRAWTAVC
                     RVHGTNDVMGTKAHAYIAEAIEKDYAAAAQWYARSLQLDPQDRMTAYNYGVLLEALLD
                     KPQEALQLYDRAAALGDAVAGARARELRSRLVASTSRQ"
     gene            complement(<115615..>118332)
                     /locus_tag="LMJF_06_0340"
                     /db_xref="GeneID:5649054"
     mRNA            complement(<115615..>118332)
                     /locus_tag="LMJF_06_0340"
                     /product="oligopeptidase B-like protein"
                     /transcript_id="XM_001680751.1"
                     /db_xref="GeneID:5649054"
     CDS             complement(115615..118332)
                     /locus_tag="LMJF_06_0340"
                     /codon_start=1
                     /product="oligopeptidase B-like protein"
                     /protein_id="XP_001680803.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649054"
                     /db_xref="GOA:Q4QJ45"
                     /db_xref="InterPro:IPR001375"
                     /db_xref="InterPro:IPR002470"
                     /db_xref="InterPro:IPR023302"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ45"
                     /translation="MAALFPWVPTSNLGYSLSRRAVNKWCPQLRTSYPLPMLDGPLPT
                     EKPEGLELHGETQKPDPFRYMEDLFDRNTQEYTKKEMQHFSLISSKFDFRHSKGRLWA
                     ELDAKVVVSSREGGYDKGEERIGDYVYFTRVVPGHDSNAIGFYRKRFGEVDLLAEELI
                     NPLFLQQHFGYKDCSIGICRVSEDGRYLAYTLSVEGGDRYLCHIRSVDNATLFHVIRG
                     TNIVSIEFGSGNQFFYTESNELNRPHRVMMQEIRPGILEPPVEIYRDDDEQFFVDVRK
                     TKDNKYVTITSDSKVNCNALVVPASFPAIPTPLKSFFKEGKPLEIAGKSGWNWLDHYN
                     GNFVMVTSDKGPNYRVVYIRDEVALAYGKEAEWKELVPHRDNVQIDDVDLFHGRIILH
                     ESHFAFERIQHIRVIKCDGGLDAAAQTPRSEDVVLHFPPLSTVTPGLNKNFRQKAMSF
                     VYSSLIQPPRDCVFNFDSDITSSQARLCASEALFTQRQSEHFTPWDYMWPYSIYRDVC
                     VSEDGTEIPITICQRRDAFIQEATDFEAQPNTPKHCLIYVYGSYGEVPSMHFQLAPYM
                     WMLRRRWTVAFAHVRGGGELPNWAQLGKGENKIKSIQDFIACCEHMVDMGYTKPELMV
                     AAGASAGCVPIAAAMNMRGCGLFGNVLMRSPFLDIINTMIDSNLPLSIAEREDWGDPL
                     NNKRDLDLLKQYDPYYNLNDRVTYPGMMISACLDDDRVPAWNALKYVAKLRQQRTRKD
                     VDPVARPLVLRMRPSGGHYFWGDTENICEELAFLCSQLDLEGPGKMLNDMDVMTHMHN
                     LTVTGAMDHDDQQKVFLKWDNWERERIDYHVKLNSFNWEPNFRAVKARKEPFFWVPTD
                     SELDQKKVDEIFRAKERDARESVRSGAKVGGFGRATGRNLYQEEQRGKP"
     gene            complement(<119086..>120222)
                     /locus_tag="LMJF_06_0350"
                     /db_xref="GeneID:5649055"
     mRNA            complement(<119086..>120222)
                     /locus_tag="LMJF_06_0350"
                     /product="NAD(p)-dependent steroid dehydrogenase-like
                     protein"
                     /transcript_id="XM_001680752.1"
                     /db_xref="GeneID:5649055"
     CDS             complement(119086..120222)
                     /locus_tag="LMJF_06_0350"
                     /codon_start=1
                     /product="NAD(p)-dependent steroid dehydrogenase-like
                     protein"
                     /protein_id="XP_001680804.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649055"
                     /db_xref="GOA:Q4QJ44"
                     /db_xref="InterPro:IPR002225"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ44"
                     /translation="MITGGTGFVGTRLVEMLVERGAEKVVCFDIVPKEKAIGVWDHPA
                     IEYVVGDITSYSDVSAAIEGSDCVWHLAAAVGPFHPHDLYRRVNYGGTVNVIRACKEH
                     GVKKMIFSSSPSTRFNGSLFHRPNVDGLTEDEMPKLPLERYMQMYAQTKAEGEMAMRE
                     SIDDDFWSIAVAPHQVYGPRDNLFLPNMLEAAGTGKLRVFGKGDNRICFTHVDNYCHG
                     LIIAEKQLYKNSPYLGRFYIVTDADTHPEPGAYCIFWKEVDKAIVRMGFGSIMNKVHY
                     PFWFLYIAALFAELAGWVMGTTFKLNVFNVFVLTMNRWFRVDAAKRDLEFQPIIPFGD
                     GWNDTIEWFRLNWLPKFKKQDHSSIVGISSGSQQKINIQARKDK"
     gene            complement(<120889..>122244)
                     /locus_tag="LMJF_06_0360"
                     /db_xref="GeneID:5649056"
     mRNA            complement(<120889..>122244)
                     /locus_tag="LMJF_06_0360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680753.1"
                     /db_xref="GeneID:5649056"
     CDS             complement(120889..122244)
                     /locus_tag="LMJF_06_0360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680805.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649056"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ43"
                     /translation="MSQLQNKVKTCVDDIEDVLASSDSLFSNEVHDRLSATYQRFLLH
                     VWCEAPMNSADGSALATVSCMPIWELLNQHTSACALSATPEKAIAVQLLSSMYPKSKD
                     RRCVFQQLSCYGNNSQTAVPLSTHVPIQMLVPDNSNAEQNLEYVKAAQRILRIATVGN
                     YTNVKESAAVASAVRTFINTVLPRCTLISHRGELPKQTRGEVHILWDSPTCDWSSGRI
                     FLLTLWCLLVAAEYLSLPEARNLSLFLCSSRWSTRLVELDGRKVSYSELLSPLLDICS
                     LCLSVNPRSASASVDTVPLIDPRVMPFLMGSGIKEEHYEIGASFATEYSAKPATEGKK
                     SLTLRRADCVKEQLMESIPNEIGFMGTSSSCRDFDQLAYLCRDCLFVPTAKNIASGIS
                     ASRRRDMLFNRKRTRGISSSDGPCFIPVKSAVTNMLEKTDTDALVTLERLCCKWREDA
                     A"
     gene            <127991..>129601
                     /locus_tag="LMJF_06_0370"
                     /db_xref="GeneID:5649057"
     mRNA            <127991..>129601
                     /locus_tag="LMJF_06_0370"
                     /product="putative glutamine synthetase"
                     /transcript_id="XM_001680754.1"
                     /db_xref="GeneID:5649057"
     CDS             127991..129601
                     /locus_tag="LMJF_06_0370"
                     /EC_number="6.3.1.2"
                     /codon_start=1
                     /product="putative glutamine synthetase"
                     /protein_id="XP_001680806.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649057"
                     /db_xref="GOA:Q4QJ42"
                     /db_xref="InterPro:IPR008146"
                     /db_xref="InterPro:IPR008147"
                     /db_xref="InterPro:IPR014746"
                     /db_xref="InterPro:IPR027303"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ42"
                     /translation="MPRTLMKAAVDAVEAMDCSGIAFRLTGKSISVNIFRSCRKADPT
                     ELFPLCQIIKSMGDRHTQRSERGFERWHWVCVRMLRGGAATDESRCSFLCCTWLLDVL
                     PHLCHSSFNHVPFFNRYKYRQVVYYPLLRLGDCLKAHCSSPTTDNTATAATNSITMSS
                     SNKQTVRVTYIWLSGKDSHHDIRSKDRTMYLSQENVAKHPKDLLANGVFPVWNFDGSS
                     TGQAKGVDTEILLKPVNAFPCCLPRTSSKIPWILVLAECYLPSGEPTRDNSRATARET
                     FEQCPEEHPWFGLEQEYFIMGRDGRPYGWPAHGFPAPQGAYYCSTGSKSAWGRKFCDQ
                     HYEVCLQMGLNISGTNAEVTPGQWEFQIGPCEGLEMGDQLTVARWVLLRLLEEESLDA
                     DYHAKPIQGDWNGSGLHTNFSTESTRAENGLEVIHQYIDRLSKTVSKDIVFYGSENNE
                     RLTGKHETSKVSEFSAGVGTRCTSIRIPNAVASEGKGYMEDRRPAGDADPYLVTSRLF
                     ASCIGLETPSLDLASPTHEKDWMRNAFK"
     gene            <130403..>131608
                     /locus_tag="LMJF_06_0380"
                     /db_xref="GeneID:5649058"
     mRNA            <130403..>131608
                     /locus_tag="LMJF_06_0380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680755.1"
                     /db_xref="GeneID:5649058"
     CDS             130403..131608
                     /locus_tag="LMJF_06_0380"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680807.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649058"
                     /db_xref="GOA:Q4QJ41"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ41"
                     /translation="MSQLLPRLFLAFLFSPTDTLISFPSAAMIPQRQKPGGRIKRNWQ
                     KKKSLYDEYLADSGDSEGTGADEEREETFECEQYCVHMDVNILIQQTVQNIVQSVCLE
                     DPDGFAIFGDHELICFAAAVKHNSSIMSLQIRYLDVSDVSLIPLCKALEQHPSIRALD
                     LSGTHGGEGTSKALRQLVCTNPNIIFMRLEDTIVNPKDASIIEKATRYNSMPCPDPNN
                     NPFHLGLLRRMGAMDEEHKFHEQLHARPWLLGNGSSNQRRFKKTVLSTAASSHIGGEI
                     CAQFIQGRCPYGSRCKYIHPERTVALKNVVASSLYSRAEQSGGGDAVSTAFSTTSVSR
                     QRLQSRLRPPAFMLKKPEQCEREQENYEISMESPPAADVTSTQPPVSSWWAMSVTVVC
                     CCVIIVAAL"
     gene            <132561..>135284
                     /locus_tag="LMJF_06_0390"
                     /db_xref="GeneID:5649059"
     mRNA            <132561..>135284
                     /locus_tag="LMJF_06_0390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680756.1"
                     /db_xref="GeneID:5649059"
     CDS             132561..135284
                     /locus_tag="LMJF_06_0390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680808.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649059"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ40"
                     /translation="MAYCIPPRVVRRLCDSEWFKTEFVDKETGTVNNDLAVVSSQCRS
                     VGQASNHEYAQLISSSFRPFIEKVLPLPASACDSGAAECGGCWFWETYRHALFGENVL
                     IHLGGSGISLAEDRLDAQVELRLRMCASNNLALPPQHRTKALLHGSAKLEVVYALALS
                     VALHVAKQPLLEHGEGPQALVLCATKDQCDEIACALNEFCASLHLIVHNLFEPYPPMP
                     ADKRAEVVVATPPLWESLAKFAQHPSHARLSTASQNEGLEDLLLKVEGEGQVPPTYDL
                     TRWRPYSLTHVAQLVIFDVELQINMGFGALLQHLLGLPHEPSPVRCKSESSSAVGKLP
                     LSCQLYAVAGGDRFAVAADTVSSVLEAIRTNGRLRFNHGTAELSLISPCPVLDSDEDG
                     RAPLSHGVRKRQRTVDGVGDHSGEERPWKANATTSRHGNGTTFEGILIRSALSHGRLL
                     ADFTAFTDFVSRVMQEASTFWESFESGICDDSGSHGTPSPASSPLTTGNKVRDVDHFP
                     TSAASASFLQCARVELALICANSASPGSQSCLAASETYRAQEVGVWVHSAPSSPASLS
                     SRLTLLFQHLNDRLNGELFDGSVVQCVLASDVARLPFTLSPITASATDGQGSRLVQHH
                     ELFCYGPNLMQPALLCVARKSGDEAAAAAATRNAERIETLSVVEELTAVARGAERSPG
                     CVPRCCFLSTPPHAGQAASSSLASTVAPSDVSTVLVVRHVAPSSVALCGGERTTSSQT
                     RPPGEVKPLALYLLEECCQYGRVLSYYAYEATRTTVMDTVEDGQEAGGSDGEGLAAQT
                     ETAMERGQPCATEGQLTTASLFIEFASADSAVEAVRLLSRRFAFQHQQPQSQGATARL
                     PRARLFTNRTYYEGVLQELSSQKRYDGAMGRDQSSDDDSRFSDLHISLLAE"
     gene            135666..136618
                     /locus_tag="LMJF_06_0400"
                     /pseudo
                     /db_xref="GeneID:12981729"
     misc_feature    135666..136618
                     /locus_tag="LMJF_06_0400"
                     /pseudo
                     /db_xref="GeneID:12981729"
     gene            <138561..>139364
                     /locus_tag="LMJF_06_0410"
                     /db_xref="GeneID:5649061"
     mRNA            <138561..>139364
                     /locus_tag="LMJF_06_0410"
                     /product="putative 60S ribosomal protein L19"
                     /transcript_id="XM_001680757.1"
                     /db_xref="GeneID:5649061"
     CDS             138561..139364
                     /locus_tag="LMJF_06_0410"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L19"
                     /protein_id="XP_001680809.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649061"
                     /db_xref="GOA:Q4QJ39"
                     /db_xref="InterPro:IPR000196"
                     /db_xref="InterPro:IPR015972"
                     /db_xref="InterPro:IPR015974"
                     /db_xref="InterPro:IPR027547"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ39"
                     /translation="MTPLSLSSSRHSFKQNETQNMVSLKLQARLASSILGCGRARVWL
                     DPNEAVEIQNANSRKSVRKLIKDGFIIRKPVKVHSRARWRKMKEAKDMGRHNGVGRRE
                     GSREARMPSKELWMRRLRILRRLLRKYRADKKIDRHVYRDLYMRAKGNVFRNKRNLVE
                     HIHKIKNEKKKERQLAEQLAAKHLRDEQNRNKARKQELKKREKERERARRDDAAAAAQ
                     KKKADAAKKSAAPAAKSAAPAAKAAAPATKAAAAAPATKGAAPVKKSKK"
     gene            <140738..>141307
                     /locus_tag="LMJF_06_0412"
                     /db_xref="GeneID:5649062"
     mRNA            <140738..>141307
                     /locus_tag="LMJF_06_0412"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680758.1"
                     /db_xref="GeneID:5649062"
     CDS             140738..141307
                     /locus_tag="LMJF_06_0412"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680810.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0412"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0412"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649062"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ38"
                     /translation="MSHMTADLEYFKCDMCGVYMHREIFCDHRRDCHGLGSTQLKRGE
                     CQRIAEALGRETRELLLRKDGGGMRAASSSQGSTHAQTCAACTTTVTAGERKDLEAHA
                     ESTRDAEGAAAGSSGHVPLPSSAAVSSVRAGGAVPISVTLSTKAMEKRQEARTRRAVS
                     DRYQAGVDAKISSLLTEGKKAALLDFLNS"
     gene            <142073..>142837
                     /locus_tag="LMJF_06_0415"
                     /db_xref="GeneID:5649063"
     mRNA            <142073..>142837
                     /locus_tag="LMJF_06_0415"
                     /product="putative 60S ribosomal protein L19"
                     /transcript_id="XM_001680759.1"
                     /db_xref="GeneID:5649063"
     CDS             142073..142837
                     /locus_tag="LMJF_06_0415"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L19"
                     /protein_id="XP_001680811.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0415"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0415"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649063"
                     /db_xref="GOA:Q4QJ37"
                     /db_xref="InterPro:IPR000196"
                     /db_xref="InterPro:IPR015972"
                     /db_xref="InterPro:IPR015974"
                     /db_xref="InterPro:IPR027547"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ37"
                     /translation="MVSLKLQARLASSILGCGRARVWLDPNEAVEIQNANSRKSVRKL
                     IKDGFIIRKPVKVHSRARWRKMKEAKDMGRHNGVGRREGSREARMPSKELWMRRLRIL
                     RRLLRKYRADKKIDRHVYRDLYMRAKGNVFRNKRNLVEHIHKIKNEKKKERQLAEQLA
                     AKHLRDEQNRNKARKQELKKREKERERARRDDAAAAAQKKKADAAKKSAAPAAKSAAP
                     AAKAAAPATKAAAPATKAAAAAPATKGAAPVKKSKK"
     gene            <144860..>146581
                     /locus_tag="LMJF_06_0420"
                     /db_xref="GeneID:5649064"
     mRNA            <144860..>146581
                     /locus_tag="LMJF_06_0420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680760.1"
                     /db_xref="GeneID:5649064"
     CDS             144860..146581
                     /locus_tag="LMJF_06_0420"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680812.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649064"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ36"
                     /translation="MIPVLNMNSIHCHTTVAIPAVGGSGGAGLNSSGSGSGGPRLATG
                     RQISPRTSYLTSPGETSSLPSAHLQRRAADVASVLEMNPLQCHSVGDLQRKLIETAEW
                     VVKLRHWYTHQLQERDLWCENRLRGLEDSFRAALAASTAAGTAHATAGAGAVYTATEG
                     SFTEHAAPSTISASRAVASGAPAGSAIAATASAPADKEAGSGTPLRHRSRAHKNSASE
                     VSEAGANAAKSSHPVERNQAAAAAGTAAGVAGGGHSGDGCGSAPLRAGSPKRSALLPI
                     AQDRLTASAGSPGRQPLHPEDNEPPCTSVAAIVINRGESRPTLAARAVAVTTPGIVEG
                     DYDAPGVPHHPSASPHPRVSRAGSISFTSSTVRTQVIGIPAASAVRVRRDVHSSRIPL
                     SGRPASANALLSTAGAATESPGRLSARAGGSGGRRSDVAQSERRGYYASLSRTGSGSI
                     NISLPHCAQYLDANTSRNPIAAEVNTGNSATDVAAPAFHKTAPHFSKYLYLLTSGDDN
                     HSRKPKRRSLSSSGGRHVSRVYPTREVKQSATGHGASSQHRKGTGNTDASRHSSPSCF
                     IRQQSWT"
     gene            <148140..>150212
                     /locus_tag="LMJF_06_0430"
                     /db_xref="GeneID:5649065"
     mRNA            <148140..>150212
                     /locus_tag="LMJF_06_0430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680761.1"
                     /db_xref="GeneID:5649065"
     CDS             148140..150212
                     /locus_tag="LMJF_06_0430"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680813.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649065"
                     /db_xref="GOA:Q4QJ35"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ35"
                     /translation="MDAFSRSKSYSQAASTSTPPPSRSGAAAPGSTAAQQQQHVFKNI
                     LKSVESHVRIMSAVERTATSSSYTSLRVRQPDSDGVGDSRTASSSQSPQSSQSAGGWS
                     QPFNVTRVHRGGTTARFYEEVVAPCVSNCTSGQSYVFLVNGPPESGRSQTLYGSPHHS
                     ELGIVELAAADFLERMASRGKVIMRNHRDRPDATGKENEAASGTQSSTTANSGREDVS
                     EVATTGGITVTYAAFTTRGGKMLETETGEPVPLVEFPPPLGLVPLPRMRLLEDASKSV
                     LLPERKHVDTSCVIQFHVYAPVDTTGRRSMATLTFVDVAAIREPLCKEVSHLIETVER
                     VAGVSTSGGDPNFKETKLTTLLEPVLVGYITLVSITTVSGRADLYESTCTALRFASHL
                     SRIHQVLMLIHMNAPRWIFDTAVNLEQLRVRRDQLMAEHYARGVYDCYQRTSRWLQAN
                     VSDVGGSVDDLLQETARLRKDIARAVEDIAKELQATIEREDANCRAEVEAARTAYEAT
                     SQLFEEVRRLDEIITAQQQKISQTDMQSSQRISEMRLEISALEAKANNRQQQLQQLEK
                     EMRLYLLKSGEVAATLSKAAEDTQYVQSSYAMSHELLQIGCKRKRLEADLELASHVAQ
                     RTTDTMRVDRERRSRISRLSAMQQRVHSLRDTVCCSTSNPTAAPSQHPQQPPQRTFSA
                     GGRSGQTQ"
     gene            <151517..>154498
                     /locus_tag="LMJF_06_0440"
                     /db_xref="GeneID:5649066"
     mRNA            <151517..>154498
                     /locus_tag="LMJF_06_0440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680762.1"
                     /db_xref="GeneID:5649066"
     CDS             151517..154498
                     /locus_tag="LMJF_06_0440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680814.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649066"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ34"
                     /translation="MLHEGQPMYDTAPLSVLDTADAAERDMLASVDNTYSPCHSNLST
                     CQQQRHQQRMLRHSMSASGSCIAAMRCISSLPVPQGSVGSNPLSPPAAAQPQLPFAPA
                     AAAGTADWVDHEHSIPQQLRQLQERNPPLGVPPLAPAAEDFVHEILAMNTLAMEQCYA
                     GIAATNGATLVGAAVANSTPNVTAASEEPMRILSEAYMRVDETSAQDFPVPLLDELKT
                     TTLNNMGVVECNRGQPRQALSHFEAARQLEENNGMASPSIALNMCAAYNALRMFDKAT
                     AAALETIDLLRSLALQRRRNRRLNATATALLGGSSLPWHGSGGGAMDGAKDGDTSTTD
                     LLLEAAAAPKIADSQNEALWGAAWNNLAVAQINTARGTKDMSEYTNALSLFQNAMRAT
                     QELLGMQHPMSKAVVETFRAVRRALRYHGAFKQHRSLLRAPLPPVDPREQEWEERQIE
                     VMPGRTRHGTLQQQRQQLTITFRGEVTGGQKVVERVDSTPYPGAASEPYQKQQRMCGS
                     NSGRGNTAAATGSRNRSRSGSKKQPKEQSGISQLMRSIPLSSTLCHASAVYGNPHPLF
                     YSPPPSGQYAESAPLSFSGSVRMTVNQYDGFAAAPGRAMSAADSSRQGRDRGQHSHTT
                     RSRSGATGRTSPQRQRQQQQHPPATAATEKGGGKRNKSRRTGNHHFQMAPHPSSSRSY
                     PHDNVVSAAAAPPAPQPTRPPVSKTLPPIDMGAAAGGAAATAAALAESNEGYAGAAGA
                     VPLGYASGIFSDRSSKPTVTSVFTQHQPQRPSTITPSAPHESRSVSPSAGVAHSGAAA
                     TAHVQQSKMLLLATPSSGVATTTTYYPLEVPSEAVAKSAEHCGTMPTPATAQSAWHDA
                     GDPSAGTHELFRGMWVTADPHYVHRGPRVFGRPAYYTIATTLGVTEDGVGGGASVAGT
                     GAAASTTQTDPAPRPVLPTLTYSSSGSEEDNDAEGEDGHGCEGGAMDVRHHTSVSTDA
                     PSSSATPKRNTLAETSRMASN"
     gene            <156483..>157865
                     /locus_tag="LMJF_06_0450"
                     /db_xref="GeneID:5649067"
     mRNA            <156483..>157865
                     /locus_tag="LMJF_06_0450"
                     /product="hypothetical protein"
                     /transcript_id="XM_001680763.1"
                     /db_xref="GeneID:5649067"
     CDS             156483..157865
                     /locus_tag="LMJF_06_0450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001680815.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649067"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ33"
                     /translation="MPAHRRYSSVSSSSSRAFSEPSDGGTSSVNDSNSYYSEGSGSYR
                     SVSSVLASRSGAKTTAATTASSTSAVDSSSTNTFSDVLTTSSAYSHSSAPPRRAVTRP
                     AASRSEAVGHKTTKGASGVVVADHNNTGVGETLAQRTASTFTAPTTASSVTVDGTDGL
                     VRAPQSLMLQAALAPVSNRTANVARVKPCNVSEEELVHHPWAPVDCDTTVDASKEGGD
                     RGGLALNVLDTIHTVPIAVPLPPEEAPRRREEGSPTYPSRLAFRVVPSSSPLRHSDSA
                     VTEDKDGTGNGGGGAALGADGATAPRARKTSIACCCCCCLHGCGEKAPCNTKRYTATR
                     QKPHHPLRSHHVPLVSFRTTREHGIPMEGVQNVLPSVEEAARYQNLKVDMMGTEEFPK
                     LMRKAIQPRDRLAGGLRLEKSYAFGHGAGGGRGGAGQSAFVRDGDPQGFWIAHLHRCA
                     IVRLEPIGAE"
     gene            <160324..>164154
                     /locus_tag="LMJF_06_0460"
                     /db_xref="GeneID:5649068"
     mRNA            <160324..>164154
                     /locus_tag="LMJF_06_0460"
                     /product="ATP-NAD kinase-like protein"
                     /transcript_id="XM_001680764.1"
                     /db_xref="GeneID:5649068"
     CDS             160324..164154
                     /locus_tag="LMJF_06_0460"
                     /EC_number="2.7.1.23"
                     /codon_start=1
                     /product="ATP-NAD kinase-like protein"
                     /protein_id="XP_001680816.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649068"
                     /db_xref="GOA:Q4QJ32"
                     /db_xref="InterPro:IPR002504"
                     /db_xref="InterPro:IPR016064"
                     /db_xref="InterPro:IPR017437"
                     /db_xref="InterPro:IPR017438"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ32"
                     /translation="MRRMQVALCTSGDPYHVPSLARVALFPLHLDPPTKQHRELFRLL
                     LGAPDLAAGPSMPSSTASNLASPSSSISTAAKSAAAVAASSSPFPPQSPCVSPGFLSA
                     AAAPSHAKAIQSGVTARGLNMFDCSTEGTMSTSLPPSPVAQTESGGEWQQGIHFASAT
                     APTPSTDTASSSGISSVNDFDPISCGTSSPYWYMEAFATSLREDSQLAPFDYIILIPN
                     TRYPVSLRQSTHLAALAVLAARGLARVHVDFTALEHPDESMPIVYELICRYPNSVLVH
                     WLHDAYEVLNWSHFADFKSTVPMLLLQTQSYPPKALERQRPVGSVSRLTSRQYHSPMG
                     QYMRSPEEADYYRRAQRFMKAASKYRRRNATPMPTATADGVDAERRYESASVVDLESD
                     YFDNVPNVPSPRRKLDEDVPESGTEATSSSLQPEYAKVQARSPLLRGVDTTTRTASTA
                     SSSVSISTAGGRATGLKAGLPWRESSSVHGEPGVSYVNCAKGRWWNTPGGRGDDEVEV
                     SRSYWSSTSSSWLGGGTASSAAPPEWMEEEGVTTADHARERHQRRRVRDASTAAAEVH
                     EAGDVFETGDRSGENDQQSQKMDTVVSDDGFALMEDTPADEGVGVGVPRAGSKTNTER
                     RQLSVTKSAADTASTATRAGTAPAVPTSPEGREAADEDTRKRFLTREIEEVRAELKRM
                     LRPASAAAATAVSMITTGGVTTGAAAAAAGGNSPDGVAVAKSSPASGGRVSKTRASIT
                     ARLAAHCAAGPFGAEDARHEEHYPARRRNRTVRQLIDELYPPRAYASVSAGTSANAAS
                     AATEAGVVGATFATDSSHFFSSPHPMLKPRAEPQSCAAAMPSDQHDGSSHSYESGDRN
                     SSSCNAFMDLSAWLDAPMVEVHPITRSTGADVRQALWEQEIHPSFILTDCVQRYVEGH
                     GLYRDPRKATAASLYGSVGVSGDYGNGARSGSGGGGGASGLGGSAGAAGQMGGPDAGF
                     RDSAAAGVCGATSGVGGGMGSSAGGSIGIRRVVAPRDTATLSFPGLIPRLELHYDRNN
                     LLAREQYEKLRIFQCQDGEEPDLIVPIGGDGYMMHCVRKNWRRFIPFYGVNAGHVGYL
                     LNDRSTLEELFSSPLKLHFTTMLYCQAEKEGDTGERMLLSELAFNDAWVERSSGQTAL
                     IRILVNGQERIRRLRGDGVLVSTAAGSTAYSQALGASPVPVGAPLIQIVGSNVVSPAQ
                     WRPAHLDQEDQVEFEVIDSTKRPCRCYVDSVDAGNVTRLLVRSSRVAGVTLAFSKSCD
                     LQHKLYQMQFPKTL"
     gene            <165430..>168912
                     /locus_tag="LMJF_06_0470"
                     /db_xref="GeneID:5649069"
     mRNA            <165430..>168912
                     /locus_tag="LMJF_06_0470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680765.1"
                     /db_xref="GeneID:5649069"
     CDS             165430..168912
                     /locus_tag="LMJF_06_0470"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680817.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649069"
                     /db_xref="GOA:Q4QJ31"
                     /db_xref="InterPro:IPR022816"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ31"
                     /translation="MHTPEPRPRSGCGGAASTTPQVDSSNATPTPRAGFLRRGGGDGG
                     GHTLHDAIAAGPSVLFDEETGTAVAVNGSPQPTQLTQQQQQQQLYPGQTRLPRQRPRF
                     HTVQDLDVALNQAIEGKITSRNAWASKEASDLLEGITHTIETTLDNASTDDYAGFAKA
                     ATVVEGCSKVWTSRVDSTYQRSNQMVQRLLRNDDTPGKPPTGDRDDGEGGDGEEGEEQ
                     QRAKSRSRSVAAATAAAAATRTLAMEAAEINLDSKSRTALTQTHVNAQFRAITSKFDQ
                     GNAQGLLMNNAPMGRAGNIILDVDYSVMPVSDAVDGCSRQGSRCISGTSAPSPSGGSG
                     AEGQEAQAGTVTPSRVSQHASVELDTAVYETVADLPPYHGVTTAVPLTGQLRSTRGSE
                     SFPQARDSAGGVSSAGDARGSQASAIDPLLLLPHASPPRQDLSNLARVSLKSDAREGY
                     NGSGATAEANRESRSRITSHSDRTATAAGFDDAAMSAYDSQQEQEAEGGFATRGNGND
                     DGVDGDNADFDNWGGVGDDDDTDSRYYNNKADTSARTDSEGADRGAEARRLVSGAAEM
                     ELLDTLFHGHTQLALEAEDPTSWCPLSEVSANPLAGVQGLSALSRLHREHRFAQSPKG
                     AGGDDAARNRDGGDRGSNRSSPVGAQLQPPTRRVRKERTVVFQLPQSPSCGRGAGASS
                     VASATATFATESKLLLDDSALRQATTAARNITPLGKQLLFARNAAQEVLLYTQGAVQR
                     SKAEQAGLLLPEAPIRGKTIPSYMPFPVHTQDYFQPFSTSLTHWNLLRKSATGHLVDS
                     TAGARNNEGPSSSSVMAGGGSSSGIAGDRSSHLALATRTGDYFSADALDEDSYGGVGA
                     RYGDDNMPVEFFPGGAEVEAQDGGEAGGDYADYAELYGPDDNDSDEEEESRYVQGGFR
                     SSADARLIAEMELAAAAATSATASGDSSTRGSGTSTHALLADPLELLKVLSPPEATLP
                     NQVDVVKLRQLMWEALQGRLAANQQENAVDLATLRTGAAAAVSQMAEEDENGVATLRE
                     KRKVAMVKAHAQTALNALRKRVRTTDVGEDAQSANRTEDTVADPFLAAESAATSVAAA
                     AVTPAGVPPTRFSDVVRSVLPHISGVSSTNTLSPAFFFFSILFLANEHNVVLQSVEEL
                     NDLVACGIAGRVGE"
     gene            <169918..>170895
                     /locus_tag="LMJF_06_0480"
                     /db_xref="GeneID:5649070"
     mRNA            <169918..>170895
                     /locus_tag="LMJF_06_0480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680766.1"
                     /db_xref="GeneID:5649070"
     CDS             169918..170895
                     /locus_tag="LMJF_06_0480"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680818.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649070"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ30"
                     /translation="MPHIPRNHYLVVHDAIRKLLGPDAQLAAFVKAQHAFQCDMLVND
                     ARTDPEELTRAGARHSGGGIGDDAAAKAGVGELARGLQAVLGICDVVPHTRRVDVIFR
                     DRSLIQLALGAAKRDLPYALETGADVNQEPDWRLRNRLRISLGYDEELFLAQCTRSMN
                     VAARILEKCAFDYARYSALMSTNAAMAAMYEASGQRWQAVLPPVTYWQAHCYSLMKAY
                     PCRHYQQIVATVEHNFAAYYGEFPMTNPYCDGEDLNTIQVVRWLCEAFNAGAAVSHVT
                     SAASSPVTVNEWQTVDCSMPAAMEDGDAEKGAAVMDNMADGRSSQEGRH"
     gene            <172060..>173520
                     /locus_tag="LMJF_06_0490"
                     /db_xref="GeneID:5649071"
     mRNA            <172060..>173520
                     /locus_tag="LMJF_06_0490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680767.1"
                     /db_xref="GeneID:5649071"
     CDS             172060..173520
                     /locus_tag="LMJF_06_0490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680819.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649071"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ29"
                     /translation="MAAGGKKGPALAADPHHPSTPHGSAHGRHALTAFGARRGGELAF
                     YIQQGGDLTSQGRYLVIGDGLMAPFMALCLRVHGLECDLAHHPSQNDLDRGTVVLTPS
                     VTQLMGDVLNVSVPSGSVVGRVLTFDHVGNDMCDVDLNEFREKGESPTFFCCDRLKVE
                     SALMSLCRIGAHSCMVLPKPQIDKGGLEPLESGGVRVRFTSGLQQDYLGVICTARNQE
                     LVPELTITNEELQARAENAEKYRDTFSKSVRWMELCVPPLPELGKFEKRFTPGSQEIV
                     EILTPRDAKMTVRPTMMATKLFYNVTLTIPDGTADPRLKSTSTKLFWDDVVMHWTSGV
                     PGYISHTMFRPMFTHLQQNFTKSSALVYRTPLFLMPHWSEGGGRVIKVAHAAHGSCFD
                     AVDVSDAQGFTDCFTLARTIAGGEDVAAFLKERRLQVMEEMDHHSRLTYYGLKERGQM
                     AYMMSRFNMKIMRKYKKSWRSILQNYVTLMPKSIPR"
     gene            <174599..>176236
                     /locus_tag="LMJF_06_0500"
                     /db_xref="GeneID:5649072"
     mRNA            <174599..>176236
                     /locus_tag="LMJF_06_0500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680768.1"
                     /db_xref="GeneID:5649072"
     CDS             174599..176236
                     /locus_tag="LMJF_06_0500"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680820.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649072"
                     /db_xref="GOA:Q4QJ28"
                     /db_xref="InterPro:IPR001537"
                     /db_xref="InterPro:IPR029026"
                     /db_xref="InterPro:IPR029028"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ28"
                     /translation="MAAPASAFVLRCTRPLLAYNKSSGYRWSPIPKPPPPHYDRLYGV
                     HSVLNTLRVAAQRQQQQQETDPLRETADTPDSTSAATAAASTARHDAHQSSAAATPVP
                     LLHPHRAHLACLYVRDFSLEEGGKGVEELGGCNADDAVADDAVSSTDPGSRPDKHSHC
                     PGRGRHIRRKKVIPSRYTAVRCITALAKSLNVPVRFVPRAELVQLCGERRNQNIVLEA
                     SSYKPQRIRHLGEIWGAEGTAATTTAAASAGLVTVLFLEHIVDPANIGGILRTAFFFG
                     VDHVILSRQCASCTAAVSRTSTGFLEHLRVYQASTSSTAFLRASQQAWASAAPSLSSS
                     ITGASGLEVVASMVVSRTKVQRRDPNESAPALQSPASDECAPSEVSVESGSDHVRVCA
                     QQPNSCPPAVRVLLLGNEDAGLPPDLLQWCTHVAHIRSPRQARLRHTRTSMQGASHEE
                     EPETCVVDAAVGATDVQLSSNPLDSTAVASAASAEAFDKHQHNMRRLARLRDKEVSLN
                     VNTAAATLLSALCGVEGPLGNGGGQLGLVDVQPLCSP"
     gene            <176968..>178947
                     /locus_tag="LMJF_06_0510"
                     /db_xref="GeneID:5649073"
     mRNA            <176968..>178947
                     /locus_tag="LMJF_06_0510"
                     /product="hypothetical protein"
                     /transcript_id="XM_001680769.1"
                     /db_xref="GeneID:5649073"
     CDS             176968..178947
                     /locus_tag="LMJF_06_0510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001680821.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649073"
                     /db_xref="GOA:Q4QJ27"
                     /db_xref="InterPro:IPR003613"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ27"
                     /translation="MQTTNSPLVSRAVARLCAILGDELLPVVIWLSMFGATRLAPSLV
                     LHLSMSLPQVMDVPRLLLWRRRRGVYDGARNSSYLGTSISAAADAAAAHLAELIKSTP
                     PGSSSDGILLGGDSSSGGAYDAALRASWQRIYHQSLEVLVSLVTYPTRLWTYFLFQRG
                     QRASLRGAADAARSGGNGRAAVAELLVRLVTSFTSTWIHASGSMLLDTIVTYLSTRIG
                     SWGSGSVGGGSAIGGRGRRHSGWRDLLVASCVSTGLNFVLQTYWVEALTSMGELRALP
                     LATTAQEALSLSFSERIQLALSALSRLGSKEFLYRLCRVALQPQPDQRTSPAEGERVY
                     ASPPSPSNTAALQPRTPAADSSLLSFPASATPRAQSQPARVYLCGGNALVFALSGFRF
                     AYYGDPQQLTTAASNWFTDALDLVLRQARQRAAAQDGRVTEALLEGQVWRPPVSSSSP
                     SHTHDVVLAPAASLQLLPVYIANFAVGAGVGLVWRRRHLLTAARRVPLLRKVVKLLFP
                     LPPPPLRLPEALQELSPECHVLLVHPDGRVEVSGDAPLPESISKADAPAATTTMPDTS
                     SADASPSPRVTRIVAAQDLFCPIKRTLMCDPVQTADGFTYDRDSIEEWLLAHDRAPLT
                     NLRLDSTALRVNWRARQLISGLVLQYTAAAGMTSI"
     gene            <181486..>187176
                     /locus_tag="LMJF_06_0520"
                     /db_xref="GeneID:5649074"
     mRNA            <181486..>187176
                     /locus_tag="LMJF_06_0520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680770.1"
                     /db_xref="GeneID:5649074"
     CDS             181486..187176
                     /locus_tag="LMJF_06_0520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680822.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649074"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ26"
                     /translation="MASLPPSQPRCEVPAAVATHALRPLHSLPPLPTSAPAGSSAALY
                     EGVRLTPSALKSIIGYLPCNATATIGNTANVHSNGGAVISVRGDADGRLAYSPLIMAD
                     TLFAAAAQAPSTSAATATSAGAPLTPPVPVTATRPLAFMAASPQSRRGLEMHLTGGCA
                     LPPLGSLVLQVQSHRPSPVTAMRPLRVGALHASRRRMASPAQIAAAHRDERASAALLP
                     ALIVSSTNVAIPALPFQPARSLSSSPVTQPQTAAMQSTSSTPLPPAMAATLGDDDVRT
                     SGSFSPAPQPPPLPSGSAVRQSRRLPVVAATPPAGWSPFTSALVARTRTSPVSASRRS
                     LNTASPTSPAQEVFGAVAAGPDSKATFPLGASETPTTPACASTGASPSLRPARVTPPA
                     TPPPLVPPPSCKSAALQTLCHALWWVRRGPLPVSLSLWRYKQADMPFVWAMLSESPPP
                     LLQEAAGLVMREKNTEKPRPPPSSPMHERRGQAAHALDEPRENCHPTPAREGDDVRGF
                     RAPVHDPGHGLVADVSGAAVVAPSAEGVTDTTQSPGITEVTTTTAACSGHLCLACHSP
                     NFNPASTQPIWPPGAPEGEGAAANANNNDALAHRLGSPADTLLPSSCAPAAPANPMLR
                     SPVMQLHVHGKAADAALTELLPAHPEVRSLRLTHGTLSDAQLRHLARVCPDVTHLSLA
                     MNSRIQTTAFLCPPMSDTSSVSPSVTTVTTTATSRTATVGLPKQDFQHQLTRLHPGGV
                     YHTAATTAQTAPPVLSPLSSRPPFATRGVSDDASHARQRSLLRGAAAASDTADALGTR
                     SEGSRGTDASPAQSPSYLPHSLCPPYQSSQLDLFAPDEEGELEMRISLWQAAQTNAEE
                     RRQPVFIVRPQDVMLGRYGGAAGKDSSRPGASPTGGGRDVAAGATAAASSRTLQDSAI
                     EQWTASHQRPLPHTKAATVGGTSTSTESAHASRRAAPGAPPLMTSTAACPADVSGTIL
                     SPLHLSSAAHTPTLASASVWAHTDPRHGLRPRSSNASYPELVVSLRQPSAPTSTSVTA
                     AASPLALPLSTPPTAAAAAAADKAGRSATSDANQADGHAFAVPAGLPAPAAPVHPSSP
                     SSGSAMEPAAPSASPRHRSRERRRHCEGYAGSLFRPRPTYWADTLVDLDLSYTQVSDE
                     DATRDLPQLRCLHRLSLEGCMRLSQVTWAPLLLHLRELNLSLSSLQGHALHPLGRCPR
                     LVWLKLEGCSSFTAVHQLWNREADTVDAGAGGDGSGSSAAVARIVASATPLVRHTTIG
                     GIPAITVLPPPAGLITTSTATAAPTAAPALKTSPSTGARAATAAGGVAVADAHGEGSA
                     AAAVDEAMAAGSAEPVPLLSALCVLIATSTGLTDAGLRFLNRLVGLDCLVLDRCPGVT
                     DVNVAATLPSLHTLDASRTRVTSEGVAGLRLSRTLKQLRLQECLALSRLPVLLLEPGN
                     RETTTAGGAGDEASGPRRPEAKTPGISRRLFHKYPPLTVLDLSYTRQLTADGLAGLVG
                     DEAAVTAQAAAAVVEQLGRREVDSDDMGFALATDESLSPVSIFPHVRHVLLRSCDAVT
                     QLRPLRGFTNVVELDLYHTSVTEAALTAALASWTCLEVLNVASTRVRSLAAWCPYEPS
                     EAVVTVAATTGRGGDGGTAEGDGDLHAPLPPLPWHGRLPAFAATLRVLVLSNTDVTAS
                     GLAALTFFPQLEVLQLSSCPRLLSLQFLALAAGGAARRSALGELTVTEAAYLTNAEAF
                     PYIARCPGLRLLSLVGCVQLGSSGTAPSARGTQHKHLSSPTDDDVGVLGRLRGLAELN
                     LSSTGVNLLDLKTILYASTSPSLLTATASQHKHLYQRVSSSLQRLWLRGCRHLDEGAL
                     MSTAATALEDSEHPCDGSGSGSGRPMTCRLLPLLREVYLSHGKYGAAVLSGLLS"
     gene            <187874..>188764
                     /locus_tag="LMJF_06_0530"
                     /db_xref="GeneID:5649075"
     mRNA            <187874..>188764
                     /locus_tag="LMJF_06_0530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680771.1"
                     /db_xref="GeneID:5649075"
     CDS             187874..188764
                     /locus_tag="LMJF_06_0530"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680823.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649075"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ25"
                     /translation="MSSHALSSGSAPNVSSATTGTVAQQADSLTRNLLLGIPKEGLSP
                     DSPEAADLQAAEAFVSDIQQEILAYDIANAKAIELYAVRWWSAVPFFGRHAKRALAAE
                     STAAAAAAAGETHESTEAAAAAVAVDGSANSSEGHGLRLSPEEAAAALQSGGAYLHRQ
                     TSQTPRGFKVERTSALDPGQLSQLAGGASGASESKAVPVPKVNTWLFRRQHPSWVPLM
                     QRWWVPWLCCGSIVLIWTPDVWKLRTLYFCDHQYALLRQSIHKAYWWATMRPEDYAEH
                     IAAIAAERPSRVRGTSCPFE"
     gene            <190365..>192656
                     /locus_tag="LMJF_06_0540"
                     /db_xref="GeneID:5649076"
     mRNA            <190365..>192656
                     /locus_tag="LMJF_06_0540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680772.1"
                     /db_xref="GeneID:5649076"
     CDS             190365..192656
                     /locus_tag="LMJF_06_0540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680824.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649076"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ24"
                     /translation="MTPLNSTGVVPNMPAVSAVNEVYVRGLPYIDATTTASNAHSAAA
                     PEDDAGPLESRISSAETRLATAATADGSDSQQQQDHDQVDVTASSPRGVPTAAAAVAD
                     SQAWVISFAPKKPIPTRKMTKKEKETIEQLRLRSQTIGAGAPTATMTALAAGGGLGAD
                     SEGNTVVTLGVGTSAALPSSPLQVVHLETPAVDLGALIPTNLPTTRADLEERLVLRLP
                     RLLCVSKQYPRGCGIASLASVYNYLYSWLGESAVGANRAPHSQEELMSILGFEPPFGD
                     IAWGPFTGNATLIRWFHALNRHFGVRGRAYILYKAHGSGNTAHLYANNTEALAAVKAA
                     LRDPHCALIYHCYNHYMVPIGYQDIPLAQTDFLKPDVPESNCDTTIFIGEVSRGRHEA
                     MYARKWSQIVKDIECKSPFFFNIRHPEQGVQRRGPKKSCKEGVSEGAGAAAPHAITGA
                     TTAAAAAAATEATKEVEASQPPQPEPEGQGQKDRSSSGAYSAAATILVASTNAPPGSA
                     ATVPCDIDDNDVDVDVLENAARSTNSDTVEMMPFAAAATPSLPSAASPAPLQQPLSHS
                     SPTPGVSTRVVLKPDFAEPSGDAAGSLFVTAELQPQVVAEEELVAAECGATCEESAGA
                     SPATRSASLSLSDARGAPLADNAMASVNEAIGSVPVPSSPPASSSPRQKPTQLGNACA
                     GAGKTAEPPHSSQPARSPAKSKKGQGNLHCIICFRNDEVEPHLERYEDAPVPLAGAAE
                     EPLWRSLSLSSGDNSSSSNADDA"
     gene            <193555..>198750
                     /locus_tag="LMJF_06_0550"
                     /db_xref="GeneID:5649077"
     mRNA            <193555..>198750
                     /locus_tag="LMJF_06_0550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680773.1"
                     /db_xref="GeneID:5649077"
     CDS             193555..198750
                     /locus_tag="LMJF_06_0550"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680825.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649077"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ23"
                     /translation="MDTGRRRQVRNARRLRRHQRSGADGNDAQEMRTGSAADSGRSIP
                     PPPNSAPGVMMGAGAAASGAVGHRTLVVASRDEAQRLSERMKQQRQVKSRADQILSQR
                     EALIRERYAPNAVAATAHGQSQQQQQASAYAFDKDDLLANLIGESKANFLKLDHDLTE
                     DHTIATHRLHTSVFSHAKSFLLLFRDVDRASDLVEALKANVQGTKAAISSISKYSANF
                     VAGGSISSAGKLPGSTTADVRGCSAGSGSVFSAALGGTSSDGDPRWLARPSLVSRRIT
                     QRYASGGSSDMAWLNDGDIGLGWSTGGADRSSRTTTWASTVHRSVVADEEGAAADGGA
                     DAVTTNAGASRPTTRGLNVSSVRQWRHTIGMGIGLAARGSAGDREAAESRLTAPGRQL
                     RGGSGPRAKSRASTGHTTTAARSEKEAADTTAFVDILREEVNQLLTERRHVDAAELLY
                     RLADEATAKGCVPFLLDLEAALVSSVITNVVKIPITPMYVESLHVPLIQLLLRFGRSR
                     SAAAVYLTMHTSWLHSEVQRLQSRVDPRYASLIAVDFLVRATRATVRRQRTLGLALAA
                     ARPFMEDGGAGTAGAAAADKTDGGRPAVGASRAAASDGAGAATTPKPAPLRGATAASP
                     GSLIPPNSAVLLWVRRNVELFACDVLATHLLSFGSGTDGGDPTRLRQAALMIAQTSRV
                     MQTLSSDGFAGCDTLIMRQLTPSLVILEDDFTRLTGERVEHGGRAMMEQLIMGSLAFY
                     ETHAANTAAAATGAATTTADAKAATATPPLSPMRVQSAPRLDTPPYQPSRCDDVARKV
                     RVQCQGLVQLIRSLPLSGHSLLVQLLLAPASSSLFKNVTSAGSAAQGTSSPLRPGSAS
                     RSFGSASGATGGAAAYRARGGGGATALLSKAGATSAAPPAASLTTPLFSTAPPPLLSS
                     ECFRFLRYANGCSSTHVRLLQSLCGYVAALTGTDQLPAEVMASAAAQEQESTNSAAAM
                     AMRVQQAECVACLLTSAVVTESIDAVLCNLLSHMMVVLLRQRKALVRFLSSEAFLTNH
                     RRAFPSAAAKSAVPDAPFFSDPASSPAWVLDSTLCLLSDVLGLGTWVSFFTRGGAMAH
                     MLADAQFGFRTQHLERVQWEMPRLVQGWMCAALLLNADVTRANTVLAPPTTSVRASAP
                     STASGRGLPAPTPLLTPQQSILFGSQPPDRVDGRSPTLWSNSSVSFSAVAAVAATAAG
                     ATAVTAAKKASKAGADAASVLLSIPITSPSSATSLSAAAADKRDAITAPFFADAGVRE
                     ERVLKLIMAFLDRKYSTPAGYTVHRYVVDSANASSDGSAGAGLNGVWAVRSRLSSYPE
                     FPIGEMREHRGDEVFLFHWCVQVSLHLLTFFQERLITPSYVMNQRAAEAQGGMTSFLN
                     AGLPFPLEGCITPQEDTVLAGWCAGGGNYVTAVALLQFLVMRVLRDGLCRADTWSAVY
                     GCPMAQWRSDEAVLRQQLFFFSLFAYLWAPLFTGGRTPRARAAAAGSSPTKEETPVSS
                     YVVDGLPSLAVLEWMTCGGVLNPSTNADSVAAAMASAALATIPANLTAVDVLFATEGT
                     IHMSSGGGEGAGAGAAGAAYTATGGGAASWRAKAAGRGTTAPAVATGASVASPATPTN
                     AMLARRELFGSCASHIPDGPLRVLRHFFEEQLGESRAARAITSDIMRTRVERAMAEIN
                     LLDFVGTSLGVGDEGGSEDDATSSTATRSTADAGSANRMSSSSQKVTLQNLRDLIAVY
                     TVPLS"
     gene            <199672..>200478
                     /gene="DUT"
                     /locus_tag="LMJF_06_0560"
                     /db_xref="GeneID:5649078"
     mRNA            <199672..>200478
                     /gene="DUT"
                     /locus_tag="LMJF_06_0560"
                     /product="putative deoxyuridine triphosphatase"
                     /transcript_id="XM_001680774.1"
                     /db_xref="GeneID:5649078"
     CDS             199672..200478
                     /gene="DUT"
                     /locus_tag="LMJF_06_0560"
                     /EC_number="3.6.1.23"
                     /codon_start=1
                     /product="putative deoxyuridine triphosphatase"
                     /protein_id="XP_001680826.1"
                     /db_xref="GeneID:5649078"
                     /db_xref="GOA:O15826"
                     /db_xref="InterPro:IPR014871"
                     /db_xref="PDB:2CJE"
                     /db_xref="PDB:2YAY"
                     /db_xref="PDB:2YAZ"
                     /db_xref="PDB:2YB0"
                     /db_xref="UniProtKB/TrEMBL:O15826"
                     /translation="MKRARSANIPGAILHSLAELQDGLNAMIDPSWRAVRSLDNWALA
                     ITMESTELLDSYPWKWWKNLNATPDLANVRIELVDIFHFSLSGAMQMRSTPDDEIPAA
                     SLKPLKEVMTTFLPAKECTSDPYGFVFFPLTDTQNAIASFRNIIQLANAYRFDVIIEC
                     IIYAAEDLGFNLVAYYIAKHTLNCIRQLSGYKDGSYVKVNNGVEDNSLLHNCIKDVSL
                     DEVLDADKYVQAWNSIMANVYEAFQIKESDRKDAERWFALAKENRLAIKA"
     gene            <201829..>202266
                     /locus_tag="LMJF_06_0570"
                     /db_xref="GeneID:5649079"
     mRNA            <201829..>202266
                     /locus_tag="LMJF_06_0570"
                     /product="putative 60S ribosomal protein L23a"
                     /transcript_id="XM_001680775.1"
                     /db_xref="GeneID:5649079"
     CDS             201829..202266
                     /locus_tag="LMJF_06_0570"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L23a"
                     /protein_id="XP_001680827.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0570"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649079"
                     /db_xref="GOA:Q4QJ20"
                     /db_xref="InterPro:IPR001014"
                     /db_xref="InterPro:IPR005633"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR012678"
                     /db_xref="InterPro:IPR013025"
                     /db_xref="InterPro:IPR019985"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ20"
                     /translation="MPPAQKTAKKAAPKDAKATKVVKVTTRKSYTRPQFRRPHTYRKP
                     AMAKPSNRVTVESKDIAAFNVIRYPLTTDKAMKKIEENNTLTFIVDSRANKTEIKKAM
                     RKLYQVKAVKVNTLIRPDGLKKAYIRLSAAHDALDTANKIGLV"
     gene            <202726..>203163
                     /locus_tag="LMJF_06_0580"
                     /db_xref="GeneID:5649080"
     mRNA            <202726..>203163
                     /locus_tag="LMJF_06_0580"
                     /product="putative 60S ribosomal protein L23a"
                     /transcript_id="XM_001680776.1"
                     /db_xref="GeneID:5649080"
     CDS             202726..203163
                     /locus_tag="LMJF_06_0580"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L23a"
                     /protein_id="XP_001680828.1"
                     /db_xref="GeneID:5649080"
                     /db_xref="GOA:Q4QJ20"
                     /db_xref="InterPro:IPR001014"
                     /db_xref="InterPro:IPR005633"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR012678"
                     /db_xref="InterPro:IPR013025"
                     /db_xref="InterPro:IPR019985"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ20"
                     /translation="MPPAQKTAKKAAPKDAKATKVVKVTTRKSYTRPQFRRPHTYRKP
                     AMAKPSNRVTVESKDIAAFNVIRYPLTTDKAMKKIEENNTLTFIVDSRANKTEIKKAM
                     RKLYQVKAVKVNTLIRPDGLKKAYIRLSAAHDALDTANKIGLV"
     gene            <204682..>209166
                     /locus_tag="LMJF_06_0590"
                     /db_xref="GeneID:5649081"
     mRNA            <204682..>209166
                     /locus_tag="LMJF_06_0590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680777.1"
                     /db_xref="GeneID:5649081"
     CDS             204682..209166
                     /locus_tag="LMJF_06_0590"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680829.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649081"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ19"
                     /translation="MDFRRIVRIPGYRGCAPAAHGDALKSCPDSYVMCEYLSFSSGGE
                     HSSRDDQAAVVSRLHVLTSKYAQFQRSIEGCVFAMSSGISASLLGSAPAARQASSRSP
                     SEGLVPFSAADKGRAAAASRMGAIATSASTGSTSQVPDLESCWMSTSPLPPTAVLAAL
                     YGMTPLHRISWSGSGGRDPDAGAGENVRTVPTVDARNLGDTDSSTSSFELQWSLCRCT
                     TDAMAAQGRYQVTFRDAFAMTTVVTHMAASSADGGSSWQGSTSLLPPPSSSSSTSSYS
                     LAQQLRRASALLGMDSEGSLPEASAAAAPSTSLLDWPEEFLWNLLVSLLSSLALVHSA
                     GLHLFGQLTAADVMCVACAPTLPRQLEQTWADVAAATAAAASKEDVRGAVSGTVSSSN
                     IDDDRVSMHKEEDAIFQRFCSTAVPSVLLPQAIVTAATPCHHVFFVLHPSPELLQQQG
                     DGRAHVPRQSMSSLSAAPEAEQATPAQQAQHQASDLASVGRLMSLLMELRARWRQRRS
                     GHAEPAAAAPSSELAFLVGRLCECGGASAGLAAPRQSPTALQLLQLQALRLRTESWYY
                     RRLAEEACDRLLLARRRLDSTDATLPQPSWDTDTKEQSREAQLAARESKLNLLLGLYE
                     LTHEHLDALKLPQLPPAQGGTKLATLSSALPSAAAAAAAVHASATSTAHNGGTRGADG
                     VEAEQRMASQVSQEDSLDRLLIQTLLQQQHQLAGSAGALLAGAPAASGATPAGVRDGS
                     HLSPQATTTATSVAAADDELLGLSPLACCTTADDGLLSTSAATPSVVAETLPALTTHR
                     HVDVESVPGGGVATLTAAASTGHHPNNESRVAVVEVDLDAAENDGYGISMASQGSASP
                     TAIHATPAGGFETRAVCGWTPTTTSPSASLSTSAAATLRQGAHGSPPPTSQQQRQQRQ
                     LFSPPLHASPCQDMQTPMRTPALPNMGYVGGAAGGAVASPGAGFNGGGGRSHSKYSAL
                     SLLRTPPSARRVGTGPGAAADAAVATAVMRAAPSFFRSPSLHSPDSYRSSTRPHNAAT
                     VDVSATAAAASFPHDTAERFLPQPRQQRRRSGSRGNTSNNSGGAYTATLGGRSPRTED
                     HHQHKDGVAASWAHQQLTTLEEMQTALRAQQSSTPRSRALAAAAIRSRSADMAAPPRM
                     RSPATPPLAPRGAPRLHSASTLASSDVTPVRGTTPSYYGDDSAEMFRVESAHMRSSDS
                     RSGVRRGDDWGGSAGAARDFGGVVTAAPPRVLLSFTPPYNTPPTSSPYIYEAPTATTT
                     AAESGASLAYAATGPSAARDGAAGQHAPPQTQKPTATALYRSAPQEPDSSLSPQILAK
                     LVGSETVAATRRGNSSRSGVPNAFHASAPSARGASARGNGAADLHQRTPPHHATSSSA
                     IVSTVRAAASAFGVSAGISAQGTGGKGSHRSLSSRTASANATGHSAGGTSARGTTVST
                     SSGRASGGHGGGGGLLQRFGAAYSPSSSSASFAHAGASRTSSTTAVELLRRLRANTGA
                     "
     gene            <209806..>214116
                     /locus_tag="LMJF_06_0600"
                     /db_xref="GeneID:5649082"
     mRNA            <209806..>214116
                     /locus_tag="LMJF_06_0600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680778.1"
                     /db_xref="GeneID:5649082"
     CDS             209806..214116
                     /locus_tag="LMJF_06_0600"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680830.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649082"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ18"
                     /translation="MQEQYVRKACVTIASQIILVTAGDGTKHANTTTGNNSSRVMAAT
                     RMATTHPSATSAETKAVTGLDDLQRACDAVVRHAMTLYRLCRRPGGSTIDIVSVGTSS
                     GGSGSGAASATEEAAYCVCAAVMALEPNLWGSLVRRAQLLRPRKPSFLFVAPVAVPPV
                     VVKDVVRFFGRSRHLMRSTAAPTVLTGGTPTRADANTGAATLSLACTGVARAPAPATS
                     ASASPFATTSTAATFGLPARQAEAVAACFFFKTMSTAERLRRRDVFEVHVRLPDASRA
                     VGASADANTLTTAAALASAAVGAPAVDERDGVIASSSLRKLTGAVTAATAASAQEPTA
                     DPGKGGRRSGLRAMARGAAAPGDTDRSLHTRPTRSAASLLLSHLSATSMLFNDGLGGW
                     GGQQVAGSTHTNPLPLSSTRRPGCVDGAEDDAGVGGWPSGISSGSSSQSRGSSPGDGD
                     IGAGKAQGRHPLAVKGDSAHNQQAADTVAVLTRLYALALSAEDPAADLPLNTEAATQQ
                     QQQSSGGSDQHRVGDAAALSMGTHTLFSAAVPPAMLSSDSGLNLVALGASVTHACDAL
                     HWGRLQMLVRYPLLFRTIPAPAEASTTVALAGGGEALTVEAMARMSGTLGSACTAATV
                     FSPASETPPDSIARNCDGTPSPSASLLAYMSSVYGAADSIFSPARLRTSWPPLLLPPS
                     PSRVTDGFLFARLLICSAWLLVYADGLFGSDDNAANVEPTQSASSGRGRGGGVWPRVR
                     PTPAVQAIVAYCVAVVREAREMSAGVTAAARSGHGRLNGTVCCPVCDDLVKEKQPVLW
                     WSTLCDDRASWRAQVRSVLENSSTNGDEAEIAAALTDHLSCEGRGRRCATPLLSGSEG
                     APCRVTALQQRWGAYIMRADTSATDYRSTASTSVTRRGAEAKSVRVDAVEADADLRTG
                     GAAADARGTAGDSAKEVAASAEALWTALTQRIAAATDFCVFLSAHPTESATFDSPAAA
                     SVTSGRPKRPRAEYDEDAASRTFLRHRRQDKHHRGEHAVGSDDSGDGEWSDGDGTRAD
                     KASRAGVALRGSRHAVEEAEEWSRLLCRCGWANAAPPSGATSPRVYEEWALSLFLPSA
                     IPTPQQAATLRRRLSRYSLEEVVRKLVLGRGGSWDRYARLLFGDDVRTDATASPLCPP
                     PAMEVGAAATNDAPAQPMAQPPESHSPPRPRAPSLSLLEEPVPDAEGVYVPHTHVNPR
                     ATQLSPPPRQLIAAAQSTPHCSSGFALSPPLSSDAAPANADADANHAVAAERWAATPV
                     GKGKVPSIPLLVSPLTRQHQMRAALGAAAAPPPPLPSPADAVDRATSVEPECVSEADA
                     APARQKDASARMSLSVPLEQLRAQQAALYDLLRFRPRLPPLREEDAVLECASCFSLFH
                     QECIAPVQRNFMGQTFLCHTCRLRWARPYAAGCGLVHQAPEQHHDPEVAGSRCAADRP
                     "
     gene            <215136..>216056
                     /locus_tag="LMJF_06_0610"
                     /db_xref="GeneID:5649083"
     mRNA            <215136..>216056
                     /locus_tag="LMJF_06_0610"
                     /product="putative carbonic anhydrase family protein"
                     /transcript_id="XM_001680779.1"
                     /db_xref="GeneID:5649083"
     CDS             215136..216056
                     /locus_tag="LMJF_06_0610"
                     /EC_number="4.2.1.1"
                     /codon_start=1
                     /product="putative carbonic anhydrase family protein"
                     /protein_id="XP_001680831.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649083"
                     /db_xref="GOA:Q4QJ17"
                     /db_xref="InterPro:IPR001765"
                     /db_xref="InterPro:IPR015892"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ17"
                     /translation="MSLCSCGCPHPTKPTLDVPSMYFSTTPELLCNRNVSEPSANATP
                     TKEKLANLVGGRLVQSVQREQPPRGSGIQPLLDFNKHWAGEIVQLNPDYFVELAKQQK
                     PQYLWIGCSDSRVPANEIVGLYPGDIFVHRNIANIVCNSDLNALAVIQYAIDCLKVEH
                     VIVSGHYKCGGVTAALHEDRVGLADHWILHVSAVKKRHWRRMLTELPTRNHLNALCEL
                     NVLAQMEHIVETHLIQRVWSRRNAEDAAAKRENRPSQNKPENEVEIHGWVYGLEDGLI
                     RPLLTLNRRSNAEKELHNAADALFWRYGQL"
     gene            <217080..>220112
                     /locus_tag="LMJF_06_0620"
                     /db_xref="GeneID:5649084"
     mRNA            <217080..>220112
                     /locus_tag="LMJF_06_0620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680780.1"
                     /db_xref="GeneID:5649084"
     CDS             217080..220112
                     /locus_tag="LMJF_06_0620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680832.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649084"
                     /db_xref="GOA:Q4QJ16"
                     /db_xref="InterPro:IPR002791"
                     /db_xref="InterPro:IPR016965"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ16"
                     /translation="MKGIGRQSFLIVFDFDHTIVDCNTDEVIPAALGRRDMQRRMMLE
                     KNRIQWTKLMDTIIAPFDKEELRKAAQDSVTIDPKMPEVFQYLRDAQKQYVVVAPGSA
                     SPGDARAAAVQDHVPGFIEMNIASDSNLLFIDAALDARLPGVKECMSQIHSNPYYDLT
                     APGVSQHAGFDACYGAHRPAGSLNVNDEADRNAMHNPGMTRKSRVCWYEPYGHQCQCC
                     LAGGKPNMCKSIIIERLLQTTSLIDPTLIFIGDGANDYCPVLNVLRPRDYMFARRDFP
                     IHHILAGAPHPASSKNGGTGDVGGCCHIGLWRNAAELRELFQVAMEHPGARLPTLVRF
                     RDAAATEFRSVTMAKRIPSVLRRTLEDLRNASAVSEKGRQRVMELMRDVEANGMVPPL
                     PGQACVPAWLRNYAYVSEYDNVNATDVARRVSPPAAKGKEHLMVPRWGQLPWLHGEIY
                     FYHLLWQCLMMQDVAEGAAKEDATAAAGTAATFNVVTQHALHNPLFSQECRVTSTPGL
                     VSPPAIALQSARNVAPLVCRPASIAESVVVRRVQPGSDRPARQVPYAEMVRQPSGCAI
                     PPAATFFSQYRDIFAHEKHDVLMDFLKVRVVPMLACQPWGADRDYGGILLRWMLWGNG
                     IDLSMFTLDQLADSHGKAAGGEDKSHAGDVAALREAEKAASLAQDAKLVGNEVAKVEA
                     YLQRLLDPDDACIGTRQVDVVMDNVGVECISDLCFGLWYVNQAAKLGAAAAAGSARVV
                     FHVKSMPYYVSDVTPRDFDLTLAALEDSYTSEAFEPDAAKRMTLKAVLEPFIAQVRDC
                     FARGTFAVDADTVWTQPSEYRDLPPRVINLYFFTQCVSAPTSARDAATAMAGSGVAAA
                     LADTACPASSAAGLYRMNKAHVQARSGLVLFKGDLNYRRLVGDRYWNRTDFLATLAKE
                     ERPDLRKAPESYSAAEQSIVAELTQDTPATALMDAPTFAEVMSAYWPTQVVPVCSIRT
                     IKSECCLGVPGDVKARLDQELGLPWRVSGTYGEILFAC"
     gene            <222394..>227721
                     /locus_tag="LMJF_06_0630"
                     /db_xref="GeneID:5649085"
     mRNA            <222394..>227721
                     /locus_tag="LMJF_06_0630"
                     /product="hypothetical protein"
                     /transcript_id="XM_001680781.1"
                     /db_xref="GeneID:5649085"
     CDS             222394..227721
                     /locus_tag="LMJF_06_0630"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001680833.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649085"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ15"
                     /translation="MEEVVCGGSEAQGDRGRGRYEDARQMDGYMPTFDGSWTRLHSSS
                     SSWWLSHSRSSTGCNAAPPSATRRGVSGTPGATASAASAAVNPEVAPQNEVTLNLARN
                     AQTRWREHRLSYPTLREIVHQLAQACKEEQWMKHACLSAMRAAAAARYGGRTSDNGIS
                     SYRCCGGDGDAHDVANRTHNDASPKAAPAAATCAALPTLRTSLDWVRHLLYVPMYPIE
                     EAIEHLEHKQDDDILLALFYSPDLFSAYNYVQWIGLMVTTTCSLLRAGVLDPITHIRG
                     DDDVDGVFPSRFPPSNSTGAMRNSGNRRQPPLFCRDLALPSLEGMLSPGDTTHMRDNK
                     VRVAIIDGYYPLWNVTRTVRRHMGRDTFHVHERYWGFGSNDGDDSDHYAEAEATEAAE
                     TVEAPTASGVGSLGVPLDVEGHEELQAHASAAAFTGSSASTYSSTSDSTSTAPDPAGD
                     WGLTSAQYRSALLHLLAREGGRSDDICDALRSMSSPAQRGDATSMAETAEDEIHDARA
                     QCDQGCGDSRRDWREQQRNTHRPHAREDATVQTATVAEAKAGSSEVKEHTEAARKTSI
                     TAATADTSSTAAPFLSLHPFMRAEEARFCPSEGIHLLARHIIDESETFLLNRPSVLLD
                     ALQNSLHRVRHRRQLLVERIVSWSQRMTCRLHVNVSAQRIDALFSDHLGDARYQAMPH
                     ASGVTASAAGGGDTEEELEDEEAMGDDVVIDAGLVQSGLSARTSYFYHQRLCSSHMSA
                     ALDSASALQCGKKKRRYRRNGPSAPMSLLTEATATLSTPKLQPQQHTAPASPPPSVLS
                     FTHDSADESCESLDVRVADASVAATLTTLATATAMASGAQGDGGDSSGADNVSDDAEG
                     EDEVLEDEASGLDDDADDEYGAHELSAQDIDGMRELESEEKVFVVRRADEGAAGRPTA
                     EALSMYPDNGASVQGAGSACGGGDASGSATGTQGLSGTSTARSSATCGWCLLGTAAHR
                     HYLLRQSPPVLLFPRKQGSRPYLFPQTLLRLAHLRFPKLRGPPPPHEHARPMRSRWGC
                     MPVASSSTTEGVAGEPSMPCGGAAANGGGGGDSEDVRRGPNGAWAVAEGEGQPQGSST
                     RSGPRPHNGGDGSSVGAGAASSSASEAASPTLLPTPATYRVISVLDNPFSRIGVEHLH
                     YDFLLSGPSSPMSTVQLLVEESRQASAPGELEACTHCESVYRLQRRQWMEARAKAAEV
                     TAAASSDGKVDSDDGAGGAGSADTDSATEAVSRQLSSEMTEFFSHRRPTHATGASGDH
                     GEPRNTTDSHRLHDRLHRSRQHRLNSSVWTRAEAAETFFNHDASFRPDPDRFTESAPL
                     TLEFFLRTPMHIIEEAIIAPLRQQVKTLHQRLLDAIVEEALRYGRCEISGQRYMQLLA
                     DGSNAVCANGTRQPALAKRVTTPVAECSVEGALDAVTERSTSGGVLDDDETPAIPYGC
                     TDDGKLLLHSLRHSAALSVWRLTADLQQQLLQALRASRARTSASASHPPSNDDEMREP
                     IPLPRDLTSVVELLHQPHDVLHSSPPQFRSSSSSSCFSELSVLRTTDAADPATAPTSG
                     AGSTNAGEEDGDGDDDAGTPFFLAHLFGWEHDAMGLDMSHGGSAARHQTFLQRRQLQE
                     RLSMLQVAVRALLKRSSPWSMDSFFQLISVEPGAALLVETSPRPPEPAATTTPGDGSE
                     PSPSPSKPPDCLGQYNASYLAVAYLFFNGTAEAYFRTHSLNQRRMHLLHRLDEAVRLS
                     LRARLILLTATEEDYRARHVETAIQDAARRHCIFRRTRSSHEEKQSFPS"
     gene            <229849..>239277
                     /locus_tag="LMJF_06_0640"
                     /db_xref="GeneID:5649086"
     mRNA            <229849..>239277
                     /locus_tag="LMJF_06_0640"
                     /product="putative protein kinase"
                     /transcript_id="XM_001680782.1"
                     /db_xref="GeneID:5649086"
     CDS             229849..239277
                     /locus_tag="LMJF_06_0640"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001680834.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649086"
                     /db_xref="GOA:Q4QJ14"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ14"
                     /translation="MQPPQLKPALAGTADVTPPAAFAGPSMTYDVSSGKCENLDSNPC
                     SCEERDEGAGTYSADYRVHQQRPGDMHDATRRRSSSVGQLSVVQVLTSAAPLSSPPQP
                     MAARTRSSRLPHVDSTSADRSASVSLPPAYPDRFSTHAVGDCPAHHGTGSSWWCCGNT
                     CAKCTGEANGKVPPEGDGCSERFSPHRVGSALLSSTAETAPGYMLTLIGVVTGVLLFL
                     PWSSNPVHIALMVLSSVVGCVCGLLYWISERRWYRRWRRGFYDASGAAAASCSAGSAY
                     GWHVESAAGSAAPRYHDHDADDEVRSVDMCCCAGCMGHLIDRQHFCVVLPTVQLLLLG
                     IFVLVSPQVMATWTAPMASRTGRGGGAILADGGAGHEARYGATLYPVEAVWKTCLLHA
                     WIGMRFSLPLLWSLLVGLVHMAVLLAQCQHAGPGTLLTLVVWMSVPLLCFAFAMCITK
                     PRPAIVEEQQQHRLLRGLASGGGAAGYSASYGAGVGVPLPPFVNTTIGRGRDALEATC
                     TSVSYSSPPTVTPAAPAPATQYSAHPSRRAVLPPPPVAAYSPASYAQMLSAEGIVGSY
                     LARLKVGEFGSLVRGGGGGVGMAAARYPHANYGGLGTAVFSRYESGQRLIAPQRPLRP
                     RYNAAARSPAPCVQQGALLSAPEFLDSAGVPPRDDLIGLATPRGTTLPPQHGQARNPS
                     APLYSPSSPRAVREARYEPAHRPISTTVEVTYPTTSAAAMLPSSGDGTHPSLSPPQAS
                     RQLAPPSRLSIVSSSTPSTMFASNLEPAPQPRRQLRKHVQQAAAGEVEEAGAFRDDAV
                     DSDGAAAAIVPADSSHQETLQHRRTGSAAAEGQRTWSGVAPTAAAAKSMSAAALAADE
                     EGFANGVDVSNFPVNGRGDDGEEWDGEPPVPAGASLEDACAPYLILDAALVIVDVGPS
                     LCQLLGTTVDAILFRRLPDVLAWLDVVEREKAVMLVSAVARPLRTAAAAGRGEKCGAG
                     AHPTRDEKAKKKSMKGRHSGAQDGMQENHHDTNENRNAPSGAAKQLPKPSEKEVRDNV
                     VEGAPVRRITLRGHCPYYVKASGSTRESSAGRCSRRPPFALCFDVWAERLAAPAPCAA
                     GSWRKHRSSAVGGGQPVPTPFVIILRRPLLHGLCDALPLPVALVHPRTGEVLCWNRYA
                     ARLTGCTAYDMLGTPAYSSFVYEGLPGAATTAASQGGFSSTGRHLLPPPPSPSEEFAS
                     SAHRRQRSPNTAALSAAAAVGTVPDGEVASNGFAPPPVKSTSPTTAVLLLSSQQTAST
                     AFSPLHNARLQRQHGGAGSPTFVDQASPPPHAAGLYGTFTVAASQQHRDTPLPGFFYV
                     PCTRAAAALADVPLSAAGHSGELATTSASGGGGARPSSASSTSGGPHQISSLQLPWSL
                     AGRVGTAAAASGHADRLSSQLSTASQSPLSFGVDGGGGGNKNSTSGVAVGVRCPRPPP
                     PPPLAAGLERGTDPYAEAGVATAFETDGDKEAQGDGDEDVMAAPYCSSPVMVHGLLFR
                     ATLRPLRGVLCSEEGGVVENQLGGPLRTSASAVEGKHTGGCGAEGNPFFNQPPRAAVE
                     GEDAEEGQALARKNTQAYDDDKSGDDNSGEALLSERQPHHRDHRLHRTAAGARMRSSE
                     CQKDSGAEDQSVMDDDDDDDTPFDEDDLPKAMAGTMSGGPTLAATLEQLFATKAMACN
                     FGLDKESAAGPRCSAASTVTTTATAASGALLSSELLPQYSLREALKQLAASESPLLLT
                     FSEPPVYATACASAEALLQERRLSHRRVSSASLDEHGHSGVLTHANDNGVAAAASGGG
                     CTSGVPESYLGTPLVPFLRRQRPQVPALWGDGSASLKFVAAVKEAVDSYRESIEEDSS
                     GYTDLLGLLSLSGGNDGCCPSSGYAARNSASSLTPTSFGGAPDAAVTTAITADAVRQL
                     RLLKSLSDHLLQATAAYNRTRQSMSFATYGLSGGDGGGGGVAARVSPSSSASSPPSLL
                     LGLFAAPSVPDADAAHERHLHARRPRSAKTPSPYKDRPAGGPLGVSVHQSPFQPPPPP
                     PQLAFTAEEPGGAHRRLQGDGSHWRQPGEPAASASTGGSGAHTGIYRDPNSTPFSVAS
                     EDVTGVAPSAVGDSRNWALKEPPPPPHRGATRPRGSGGRRDIQDGGVSPVKSRPRHAA
                     KSSTASAPLKASRGRHTGARHGRRGGAGASTPAPSPPLVPLDAAVDVTKELRSFGYMA
                     EISGSTPPSASPCGGGGSGRTAAAAPAAMSSLNASTLVAAGSEPAMSTPRPHATGTGA
                     SALDVATPQTELHPSPRRCDTVVTSGEGEASGGGGGAGEDAAAAGGVASRLATSPRYR
                     GSLLLSPSLATAEMGELEASYGTESRHQQPQHRSSPNIISGAGSGSGATAAMRDASPR
                     RCSSAVYRRESSLDVLPSAPVGSGSFRGNGGLVPSSSSVSLSAGAGAGGQGTGSPSPH
                     PARTGSGSLNANATATAAATAAVRSTPRRPGEGAVWAVLVSRDEATIPSCCISVNLGD
                     EFRLGRSSKCTAVVSDSFVSSTQFSIVRTVSASTTAQDLCPGSGRSERGSRRSKAFTV
                     TLYDRSANGTYVNVKKLGKDKSCVLRDKALITFRLSTSQFFLGFVFMLTDERGVPLDD
                     RTGMGGGSGLRSLLDARLSPQPQTGRRTNASSAGGGGKESSSSQNTVMASPTALSTSA
                     ARRNTPRAVSTPDNSSFASGTPNGSRRAGGGAPRSSRHAHRETIEWKIGEEMLGKGGN
                     AEVYLGINLTNGQLIAVKRVRLPTFAHGSDAEQDPEAKAILQQYRSLQEEISVLSKAT
                     HPNIVQYYGSSQNSAYFNILLEFVPGGSLRHLLDNFGALSPGVILSYVHQALEGLAYL
                     HRHNIVHSDFKAANILITEKGKVKLTDFGTARLLNRPHATAARGGGGEAQSVTSRTTP
                     GQRKDDVVSAGAGGTLHIAGTLRWMDPALFHNPHSSGAADVTAAVAAKDSSNKLGGPT
                     KAGDIWSVGCTMIEMMSGEAPWFEYDFESEEQIVNLLTYTAEPPEIPECPECPDLVTI
                     AQTCLKMDPAQRPTCEELLRIVEEATARLQAQSTSPSVSPSREVSQLQPAARGSVSGT
                     GTGVRSNSTLLCPQTEPGTSHAFASLAANPAAAASGPGTDDRRRAERVGRPSDSTPLS
                     LAVGGDGGSPAPLSARDAASSTAL"
     gene            <240538..>243546
                     /locus_tag="LMJF_06_0650"
                     /db_xref="GeneID:5649087"
     mRNA            <240538..>243546
                     /locus_tag="LMJF_06_0650"
                     /product="putative lanosterol synthase"
                     /transcript_id="XM_001680783.1"
                     /db_xref="GeneID:5649087"
     CDS             240538..243546
                     /locus_tag="LMJF_06_0650"
                     /EC_number="5.4.99.8"
                     /codon_start=1
                     /product="putative lanosterol synthase"
                     /protein_id="XP_001680835.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649087"
                     /db_xref="GOA:Q4QJ13"
                     /db_xref="InterPro:IPR001330"
                     /db_xref="InterPro:IPR008930"
                     /db_xref="InterPro:IPR018333"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ13"
                     /translation="MHTNNGQSSSSRAAVSGSPTKPHETRVNGLTTSSCDKQRNRPRG
                     AVTSAADFVPDILRSFYACVAAIAQPYAAEHTSFVEYQRTLPVRTVVPEPPNTLRDYI
                     RRQLWRVGRTCLLFFFFLFTWPVWLTLHLLLKLLDVHQRRLRLQHHRAWVHPSMPHVR
                     ANVHKPSKEFPLDSWHLRCEDGRQRWYFGEPLREGEEHNELAMAQLCGLHTVGDYHAL
                     LRQRAASDSGGGDEAQDSRGSELNGTGVINSRVPWLPDILQEKCLKRSFVERYHIGLI
                     PASPPQPRTTSEAAMDDGIRFLVQLQDPFSGHWPNNYSGCMFLVAGFVITKFIVAGGE
                     TNRLFPPLPDHHHVRLDSSGAKRRSSGGDIPERVLGVPASEHAGQVGCRCGEATRQEL
                     IRYIRNHQNLDGGWGQHTEGHSTMMGTVLNYVSIRLLGVPASDPQATCARNWILAHGG
                     ATKTPMWGRVWLSILGVYSWDGVNPIPPEMILMPDWIPFSLGKMWCHSRVIAMPFSYF
                     YGLRWSAPAFPTTLALRKELYTEPYDAIPWRSFRGVACELDVYTPTSPLLRVAMGLFD
                     FYERHPIPFLRRYALEENWRHIAYDDESTSFICLGPVNKWLNMLVTWLREGEHSARFQ
                     KHCHRVQDYFYLENTGLSMSGYNGSQLWDTSFAVQAICACRREMMFPAEMELAHHYID
                     VAQVQMDPMAAADFYRHRTKGAWNFSTRAQGWQVSDCTAEGLRVLLLLPQYEFPVRRI
                     FDGVDEVLSLRNSGFGGDGGWASYEPSRGPAYCELLDCAELFKDVMIDYSYVECSSSC
                     IHTLSLFREHYPHYRRRDVDRAISEGIAYVLGQQQPDGGFYGSWGICYTYAAWLVADA
                     LQASKELPDMAVHPHCVKLVDFLLSHQGADGGWSEDVSASARQTWVDSPDGSQVVNTA
                     WAVMAIICAAGKAAHTEPTRQRNIRRAVDRGVQLIMSRQLASGDWPQERISGVFNGNN
                     PIHYPGYKNSMTVWALGKYNSWKREYVVAA"
     gene            <245142..>247181
                     /locus_tag="LMJF_06_0660"
                     /db_xref="GeneID:5649088"
     mRNA            <245142..>247181
                     /locus_tag="LMJF_06_0660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680784.1"
                     /db_xref="GeneID:5649088"
     CDS             245142..247181
                     /locus_tag="LMJF_06_0660"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680836.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649088"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ12"
                     /translation="MGCKSTKTKDKRTHEGPPGASAEDAGHEAVQYASTSELDEAIVA
                     ESAQPSATASTPQRRDEGSPRSLERLPEEAVAEQQADDAAAAVGAPDDSTQTTAEMSV
                     KPKQGDNAPAEADDASKSVGVVPRSSTSRTWTPSEQQKPEREVERVGSQFDFEVESND
                     SEEKAAADDWEVELSQPRSLPPSTQQQPEPAPVPPDAVTATLNDAEATTPVAMESVPQ
                     PIPKRESPRSLPDVANGQSTSAATSSNAPTPAPRRLSRKPSIASSSPVSVRPSQRPSQ
                     RKLLRPSTHNGGSMRAAQYVASPVAAAPPPPLALPRDKYCAAAAVPPSPTPSMASTSV
                     TRISNKALIPVGKPSERMEALHHGADTGRETVASQQHLNRFLYRESSVGLGTPYSQLP
                     LQPVSGQWRRGFRSPIPYRRGYTDPNPGAAPQRHRVSATTYMPPPTAYIMGAAGGAPP
                     RLLLDAAMLATIKASTTRLLEAHTLRLAGAHNGAAAMITGSGRVNGASVSVPRCVAAP
                     PMSVPLPSRLPMSHLSDPVSTLAASAAGAAAGASAPPSTNAGSSYLRGSQKPKLAMPA
                     PRAQHQHFFAALHAAEPSPVQHTSNRAGMPARAAVNRTARYDDDGVDALSADVSYGAV
                     QEPGVYGQQYCNTLEPCEDSVTTYEPSATDEVPTNAAALLPVGCDEGSSSIFQYP"
     gene            <249756..>253604
                     /locus_tag="LMJF_06_0670"
                     /db_xref="GeneID:5649089"
     mRNA            <249756..>253604
                     /locus_tag="LMJF_06_0670"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680785.1"
                     /db_xref="GeneID:5649089"
     CDS             249756..253604
                     /locus_tag="LMJF_06_0670"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680837.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649089"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ11"
                     /translation="MGGVCSCATTKRAPHDRGSAAGKDANPNHGSLPESPAASAALGG
                     SSSTHVRVTDRNGGAGNPEAGVSERLLSGSALVLPASVDARSSNASSDFTRNTDLLSG
                     KAMLRDTETKTSSVVTAISSAGGNLAPLMNNGGACPSSAQAGSRCDAYFPPGHDAGMR
                     LGADKYTGVGASPLSAFNSPDLQSVASTASTDKERKPCDQVAYPGMARPHENPMIFTD
                     DDTCVVETASSAFGTPRELRKSSSSIAGLPRSASIVSCGSMTSQQPHGYNYYNSTAIC
                     AEYRPMLPPASLPLSAATASLTPAAPKGSERQQLQQKSKLFSPGPHSRTTLANVRASQ
                     QVLATRSSGSARTPLTRESSIVGSDCFHSCCSYTDLTPATPAGAAAEADVHLLSGGYP
                     ASTASGASSKGRQLYTCRSAYTPSTHARSLSSPAAITHSQGGTMPSSARDASLLPPRS
                     PLLTPGSAAGPCSTPNAQQLYLRRQASLCSGIEDAPASEDFFSVPPTARSFFLERSSA
                     AASTPANHSALGRGFADTAAAAANAKKSRRVAKRSITSPESRYSRALDEAASRSSSKP
                     FSESFNSGSAPLSWTDASPLTEKTLSEEQQLSHTSAVTGKQAASHGTNNGGSRKGRRL
                     RKRRHSRGNFLLDLNPPPQAALEMAAAATSKANPSPSSASAADAMETPPLPSVTSNTV
                     ALVDNHGTEAAFVSSSTASKTSMRKSGADDDPVAARGVRLTQAYTETLPLASDAADAG
                     GSGGNTAALPTSPSGSMSSFSTVASSYQRDVLVRASWRGSSEVPRQLQRPESDTAPCR
                     RRHSSRGAGGGASKLRSKEASATFSDSVAHGGPASHAPAAKATRGAGAAAGAEATSAS
                     SVVPLTTNPKPWVPSGRSAAATAVRADPRSTAHVMTTAATTTGPPGDTSRRSSLTHGS
                     SPPEKSGGARPASATTAATGRRSLGGAAKPGSGKGAPRRTSTSGSLVPPSPTDARKPT
                     VKRTAAAAALAATAAAADREPSDAEKAESVVEYAIDIGDTGESEGSGMDAVHIGGGSS
                     DNGLQTALGATSPQPPLPQQHADRTEDAVKFNDINDGFPAQERVPQPCGSSADGADEP
                     RLAGFQASPDVSNATVITSLADSAFLQSYTEAQLVTIFGGSAAALRGCDNDYQHLWVS
                     DEGRGGDGAAQDGDDSEGDRAALPADMAVVVAHRAVSSTDSDGQGSYSVSATSAEEAM
                     LAATPSSAARSNAGSPTAKDRDALTLPKEDAVPPALAVSNGGNRCEEATECSPVNMSR
                     RSFSPGSDSHASEVQVTTPR"
     gene            <255246..>255977
                     /locus_tag="LMJF_06_0680"
                     /db_xref="GeneID:5649090"
     mRNA            <255246..>255977
                     /locus_tag="LMJF_06_0680"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680786.1"
                     /db_xref="GeneID:5649090"
     CDS             255246..255977
                     /locus_tag="LMJF_06_0680"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680838.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649090"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ10"
                     /translation="MGANGSKTASSSSAVPAATTTTGDNKGTVNRWYGAVSDASDADL
                     GLAPDVSLSSDISTPEENAAKRKAYAHLQSPYARHQLAASMKGRGSSGNNGAEASATA
                     HVNLIEQIYNEDFETIDHIQALRLPPMVSQQLKNTVRSEAERRCAEVEKTMARCLQDK
                     MWTSWKCQKERDTYYHCVEEIEQRNLRPDPTNPHWVDMLTSFRWKYNLGVFHGEIIGR
                     NNIMKQIWREHYPDRELPHPWVKDA"
     gene            <256726..>257940
                     /locus_tag="LMJF_06_0685"
                     /db_xref="GeneID:5649091"
     mRNA            <256726..>257940
                     /locus_tag="LMJF_06_0685"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680787.1"
                     /db_xref="GeneID:5649091"
     CDS             256726..257940
                     /locus_tag="LMJF_06_0685"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680839.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0685"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0685"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649091"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ09"
                     /translation="MIRVFAKTDVPVMDIIELQGKIVITEEALRAARDAKERRRASRR
                     ERRRRGAANSDTAVGEDASGTGDDLMPLSSAPSSSYPSSSCSSSRSSNSTGGDDDDEG
                     GDRATADPGELVDVVMPWYTSHNSGEQRGAADSTSTAASALRGTSSPGCPSPASPRRP
                     RPNSPTASRCAAVVEVPLGHVEQDRLDEKRCTLCIETLRVHGSRSSFKRPWLVLRECT
                     PARMRKLRRQMARSQISRDITEPRELLATGDGGGGGGGGAGVAEPADGASSSPTSETT
                     ILFSEWLGQHPEALSLNSLFLDDFATGDGDDVSTRRPTAADPACAALASASSGRSGNG
                     VGARKRPREAENVEGTVLGGPPFSPQLPQSASDVPSAAQTTRATAYKDYELVGVVRGS
                     VLFNSKPARVFQ"
     gene            <259883..>266953
                     /locus_tag="LMJF_06_0690"
                     /db_xref="GeneID:5649092"
     mRNA            <259883..>266953
                     /locus_tag="LMJF_06_0690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680788.1"
                     /db_xref="GeneID:5649092"
     CDS             259883..266953
                     /locus_tag="LMJF_06_0690"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680840.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649092"
                     /db_xref="GOA:Q4QJ08"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ08"
                     /translation="MRHHRLHTSLHYLAMSSGAEVPECAGGAYHLQERPPLLHSAFDT
                     SAAAVSGDRGGYLTRSRTCANNVRISVFPAASLRPAPGTGGVSSSSAPSPDGWSSSPS
                     TSSATAARASPTVLHRDAVHLRAQQYEPFDRLLHRYLERGHVAHITQRLLHHPDAPAP
                     AVLLDTILRHRLPAPSFVCQALLATIHTARRDRSTAAAAGLALDRVAVRLRTDEKARL
                     LYQTPQVRALLLEATLQESLFDTAVDVVTDMPVEWITPHAWSQLVVMAGKSKLPHSQL
                     LWRLLSLREGASSTLRSSCETPTSARPVLTRAGESALLGALRQRPLSASPSAVHFRDV
                     VATVAATAVPDGALDARACATVLAPANGAIGSAVFADATVAGEELPRDERGEESAQLA
                     SEGSEDQPSATPVTAVVPAGSAAGGSDGARWCAVGAVELGYAVEHHNGDATPAAGDFR
                     ATGAAGALYSHSSFQALLADVEREGMQGGGAAATSPAARARALWETTALRMINSRHGI
                     VYGLNATMAAQVMLRCGVSFAAQASPLLALHVLRRYLRSCHLLRDQVVAAQRLVEAQL
                     EAAAEGSKDRAARAATTTTTIASTENQPGSHHHGATVADADSYPRLARAVVPHPAPFL
                     VFFKVMRDARDVLAHAVYGGDEEDDAVAALSAARRYRGTAAAAAGRAHASLPMMHWEL
                     VWHTFQQLNRENPHWYTQLDVPEAGDLCLDAMEVLCHGADPWLTLNVARRVSARHIID
                     GVDMSLWLLNRLDPSHHTDEAREVARKLFRWLLVDVGVHVQPPLHRHLVPAARALIRL
                     GLQEELSTLYNAVLDNVFLFTSEHRDAFIHVLRDLICPACASVLPEVDVYVDRACPNC
                     MAVVPAKDPDTIPSFRLSAEHVERQRAQRKQRRQRTRQRLSASVRRLQQGGEGWTRSD
                     VALCPPPRDAADILRWHLKRDGTEQGGENGALDVSLSSALLMATGAAEEATLVPGVSV
                     STELALFPVAGEAASGVQVLGVRAAMEESSRRLELQRAARRHVLAQRGVRDVADDGAA
                     GAASRVVFATLPTKLPVSAQALDASTLKYLSTPANAAAAAGSTLTSAQAVDGAWVCVW
                     CHEHNTEWSSRVHCSACGAETGPAAPWRNFLYAAASGDAMEELRGRMSNCEARPVDAI
                     VAGYLLMLYRRTFQLRATPADQDRLLRLVEVLCRLQERVLAGYVYTRFIPVSQRRLGI
                     PLSSLAQACGQDVSPAYQALTQADLTRPDADDIFFNAVFGAQTCRVCLGQHDWRLCPI
                     VTRNFAVSASAAGEGRPRTAISLSPEEKQRAVLERLSQRIQQAVTSLAPSVADPESAA
                     SSSSSSPPVLLPPGKPSARLVVDAYTAFVSSPFREIFAELHSSDANRLSLLLSRVQQY
                     RRAAFVLCHVPPPQRATEAYLRMVHYFNVTEAEALALLERSSTPTTPLKGPAASGSSR
                     IGHPTSAARQVNFVQVTQTCCMCLDARHASHMCPRLDEWLKGVQRLALSGSRSTSSGA
                     AGESSLSPAAAALLDIEGDARLRRRLKAQVDGWTTAGPERLHAFYRYLIAHIDLLRPA
                     AFASTGAGQQPARRRADFDDPLVYAVNKTIAKLSAVGQCSETYRLYAHAPVECVSTAT
                     TATVLRMNGFSDESVRVLLTRASSSSTDGTAIASDSDSFASSHCSSLTQPAPLAARAA
                     AVPVRQYCLICFSPDHAYVECPELAAASTEVERLLLVLRNVAGIACVHDGIGAAAAYV
                     YSEYNRGRLSADMMRSHPELVTELLTLTRRCFATRQLYHGVRVLRRIPVEMVPPDAAY
                     VDLWRAAGLPEAEVEQKHAQLLALLDAEAVRPSIDPPPPRPTYTNAFLSKLSRTLHDD
                     LCRHCYEHGHTIATCPLFHAEVSFGRDYVAAYRMSMMSEQLDRAWQEAYLLKLVDFFA
                     AHYLFMPYHIAGVVNALNAIASMWSFRGEPGIALRHLLRIPPAYRRRQAFKHLLHCLR
                     VPPAEMTKLLGDFYFAPDGNATAVPPPQQKGSGPHNTSKYHAQQQQEVVMAQHLLLPK
                     PAIRDLARKQIFDQIPAAIAALEESEERMAEIRACHERRGEGGGSITADVRERLLRQQ
                     KREQPGRRSAEIGDADLPHAAASFHAPALRNVMQSGDIAQLREDFDPILSELEDAVGM
                     KLGSRHTLFTSTVDILSAAAAAAAASNPAPAPLSPSALSSSASSSASTGERSGINATA
                     SSAAAPSSPTFSQTPEAEVVTEVQTRHAPPRRPGSSGDRSHSFRQPSATKAPTTSSAA
                     AAAAGAAPLSEKIQHHAGEGDASKPAGASPGRSSDSKDNDRGRGNMSGRGSRADDGRN
                     ERRDARDWHSNRERKPRHRGGSQSPSHAYKHDRGSRSRHHGNHRNRNDAS"
     gene            <268040..>270253
                     /locus_tag="LMJF_06_0700"
                     /db_xref="GeneID:5649093"
     mRNA            <268040..>270253
                     /locus_tag="LMJF_06_0700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680789.1"
                     /db_xref="GeneID:5649093"
     CDS             268040..270253
                     /locus_tag="LMJF_06_0700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680841.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649093"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ07"
                     /translation="MPNAVVTLTIVKAEALVALNPGGTSNPFFTATIGAQSVTTPVVC
                     KTVNPEFNTTFTFYGCPLPAMLTLRAFNKIQFVDIEDPLGTATVTLFDVQPETSTKVV
                     QLSHGGVAALAQRALNGCGAVTITYSVAPMPAEEADPTVENSASKPSSLPSSTAAPLS
                     VPAAHNIDGTGPVSIPVASVPRESAAGTLGSVTHVGSSNLLASDPSATNPAATTARLK
                     PDEGATAAAMEGAAPSFPVLGATPQQKSQLTPPSLAPARPPAIATYLVPQVAPPPSSP
                     ATMHMSVKTVPTNGYESYAVQGAKLPPPPPMPEEAAAADQVPPSTSAESYYANNTAHN
                     ASAAPPSSAADAQSLGNLAMLPVAPNIPASTRFASLQESTSAALSFDTQQQTASASSL
                     YTSAAQAPATASQAKLLVIPPHISSAATPTLLHASQASSLEGSRLPSAAQLPASTKNP
                     SECFPAHVQPPPLAGALPVATAPRSPSLTSSTTSTLRSTPAAQSAHRPHHTVSFAASP
                     FPAENFVAAPASAWTGATATCRGVAPASATAGPQRSAGAAFPSGADHCATYASASVAS
                     GTTSPRRRSPRSETEPGAEASAITSASELYADKEYLFEVAATGADVEVFRRLRHVDPT
                     LTNGFLECLDYSGRSLLHIAAWNGQLRVLQILLCPQPAEPMIDLRSVVAAKSGNTILH
                     AAACGGQAEVAQWLRYSHPTAGPLLLSMRNARSMTAAECAMEAGFPHVARLLMPN"
     gene            <274404..>275990
                     /locus_tag="LMJF_06_0710"
                     /db_xref="GeneID:5649094"
     mRNA            <274404..>275990
                     /locus_tag="LMJF_06_0710"
                     /product="hypothetical protein"
                     /transcript_id="XM_001680790.1"
                     /db_xref="GeneID:5649094"
     CDS             274404..275990
                     /locus_tag="LMJF_06_0710"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001680842.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649094"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ06"
                     /translation="MVEKGRRERATRQDPQVSTDDTAKVAGRHTHTHMNRRPQRCESV
                     SRSRSLTISCITATATSFPPCYTTLSHVLTHVLALQLLWNLCRRLAPLLLDRFFTFIF
                     VSRPMSMASPGRRNSRTHNTRRGAQRVVQRLPLALVFSRYPGRACMRFPFSDHHIFFL
                     LLLLLTFVPATANPPPPTTATEATADGLVWLLRGPPLRADGDGLLHVQPRCPATSEAA
                     NDEGGGRGANTDSGGGDGSAADTVLTTLSPTMATETAAASRSSATAVDGTTQTRDLWM
                     PPLPLQDLVKQFTHPHHYGLTEHAPKALVGATAMVSAVADAAKDEAGSSNGELHRALE
                     DFSQYTHETVSVEFSVDVFDPIRGACVPYMHPLRAAAARTAKADDAGETASPRHASDL
                     SIVHGCSGCALHSLPGRRGASGWAAPVAAATSMSSRKANQRRRRSACLCAQIFNNAAD
                     EALSSLRGLQTAIATDSEGAAAAPANEDGGGRRCSCRPSLHCLLRRSKHQQVCRSLRT
                     DGGRAVVSPRAEHRASTPMQ"
     gene            <278906..>284203
                     /locus_tag="LMJF_06_0720"
                     /db_xref="GeneID:5649095"
     mRNA            <278906..>284203
                     /locus_tag="LMJF_06_0720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680791.1"
                     /db_xref="GeneID:5649095"
     CDS             278906..284203
                     /locus_tag="LMJF_06_0720"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680843.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649095"
                     /db_xref="GOA:Q4QJ05"
                     /db_xref="InterPro:IPR005033"
                     /db_xref="InterPro:IPR017956"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ05"
                     /translation="MYHPLPHGGGGSSKSVELHVDGRVSQVSLQAAAQATVADLLSTA
                     VAASSSTIPANTLSSRELARGFACTDTAGNRVNLSALAVSVPPQLVVTHIGTAGRGGD
                     GSASVVSTGAGRSGGSGRSVLSASAPGRGRGRGRGRGRGRGSGRGRGGAAAAAKAQIA
                     AGDEEDGVDGVDAEDGDDGEEAEPGGAFRGIASDGATAEDDESGSDESDGTSESYSSD
                     DEDSSEDEDSDNADSSLTTTNTSTTTTRSRGDHGGATTSAGRGRGRGRSGSGRVASRT
                     SATSSRGSSAPPTPTAASATAARRTRRRSASGSPLLLTPDGLPIKRKRGRPPKSQQLA
                     FATAAAAAADAAAASSGTMSTAAGEKLPRRTRRGVKEAPAEASTREVKPRRGGRRRRA
                     DAESEEVKGQQRASASCKLKGRSSAVTVASVDDITGTLSGSCRRGGWRRGVDDAATKR
                     SRSPSPPLQPSGSSSATTTTAAAPLFTASAVIVTAVDGTGGGCATPLAPGALTASASG
                     AATDAAGATSAPGARTIAPLEQQQEQLLRQQRRRVRLTYNAFYPSSTLHAAVPATMGT
                     HRGGGAGEGTAGARAHQAHSAAAAAPLEDPSARLMRPRYVWNGGDRPRQHSLSSAASS
                     SPVDDVQLGGRGVPTIFNEAWTTLCSCLSSATERRGASSAASASPTMVDPSHTASASQ
                     LYVQAQRIVSLWRAEQHRTPSMLLSHPYSPLLMPGLRVYQHPLPLLAATPAPLAAPAD
                     ANTATLSTDRLSAVKVEVDDEESNAVSRHRRHHRCGAAPHTASVAAAGPGAECGSSRV
                     HCYPNQTLVVPVVVGGCVQLVNPESKDKSHQWTVYVRGLWNGHPEEVAGANVRPPSSS
                     HVQQLRAFPSSPSSTPPARSNNSRVSLGDSSAAADRGGGGGAAATAAALGAMGDSQTS
                     VFSASTASPDDYLSDFIDRVVFVLDESFVPCVRTVSSAPFELTEVGWGEFIVSMHVYL
                     KVPVHTSASRRAQGQLLEYYCGFNGRTAMQTCDGRGTKPHDPVSTYVTGGVRGPSHLW
                     NALTTPPPSTSGTVPPTPALSLHELRHECHYDSLLDINSNSGARATYYRGPYLPVHLV
                     TCDATSSSASSQSSLSSSDSDADGGGGSDGARGRSGSEVSICGGSPTDSAHALSYPTK
                     SDMSGDGSFSSSCSGSVTPSPAPAPQHHANLSSQQHEARMGGSNTAHISSNSIADGLP
                     LAGIAAGVMDASSPHARPPPLPVPPVGRGTGRRPRRFGASRARSGTPRSPANSGAPGA
                     AGGGGVHRTFTEVHVGHGSNVVVLQHLLRFSHRPRYAAAVPPARDPRTQGVHPELLGY
                     TMVAEPVVTEQYDELVIPLEPFAAVAGRMRRQASRRRQTTQRKGGNTSPKKPDAAGVE
                     AKLHHLMAALGSLESHLRATLRRQLSLMGDDSPSQSCHALPPLSNSEAQALGHPGGIS
                     CWPHVLDYGNGIERDTSYTAAYLASIATSAETEGWLSQALAARRVALFGWPAASCAWV
                     NTVGDAEEPQPQRHGEAAGRCKTEGEGCDGVAKRLPGRVAIPSTIPNPTTTGTWLTAL
                     EYDMASALLRLAASTSVVTAHDIFFHVVLPRADDIGAAVWCNLHEGTHAALTRASAVG
                     DFSSDSTGATALRAEPALGCTTELQQEAKKGADVRMGQAHVDEARGGDELPSAPSATA
                     LSRGYPLCSLRPSDTGIAALRNVLCSNKGSGSVSAAHHPSQEAFMASLLRDGQSRGSF
                     GHDSDVAQLLTWKAALEDVIDTMRVEAARRQATAVMEEL"
     gene            <285502..>286518
                     /locus_tag="LMJF_06_0730"
                     /db_xref="GeneID:5649096"
     mRNA            <285502..>286518
                     /locus_tag="LMJF_06_0730"
                     /product="putative serine-threonine dehydratase"
                     /transcript_id="XM_001680792.1"
                     /db_xref="GeneID:5649096"
     CDS             285502..286518
                     /locus_tag="LMJF_06_0730"
                     /EC_number="4.3.1.19"
                     /codon_start=1
                     /product="putative serine-threonine dehydratase"
                     /protein_id="XP_001680844.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649096"
                     /db_xref="GOA:Q4QJ04"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ04"
                     /translation="MPTFSDIMAARKALDGYVYETPIIESNALHGKTRHESVLLKCEN
                     LQRTGSYHVRGMTYRVIRAKEEDLGINNFVTHSSGNGGAALACAASNFQSTAHVVVPE
                     DTNALITRSIRLYHGNFYYCKPDLKSRVEMEARLHSEFNKVAGKKRNQCMLVNPYSDE
                     AIIAGHGTTGIEIMLQTDCSVDCVVIPVGGGALLAGAAIAVKGMKPHVGVFAAELAVP
                     PDHYTVFKRGEVIEARKLKGDEKRPKGNKHGIRTELTDLANSYIDRYVDGVVHVSKEE
                     MCYAFRYVYERCKLVVDTNAAIAVAAVLACPQELSNYRRICIVLSGGNVDLNDVPKIA
                     TARL"
     gene            <288385..>291585
                     /locus_tag="LMJF_06_0740"
                     /db_xref="GeneID:5649097"
     mRNA            <288385..>291585
                     /locus_tag="LMJF_06_0740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680793.1"
                     /db_xref="GeneID:5649097"
     CDS             288385..291585
                     /locus_tag="LMJF_06_0740"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680845.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649097"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ03"
                     /translation="MPLFRRACGVCERLPPSLPAICEACEFSSPEHFVCAQPSLRACV
                     SCSLPLSRATPRVTTLSPYTFARVRACVSCVRRSRISTCPHLSPCWFSVRPPILCRTH
                     THTHTHTHTRTHARSLSLYLSLCKPFSRSAMMLSSSSSSSCRWWPPLARPASPQHPQQ
                     QQQGVLQGNAHFMSLLQRPPEGPPLPQAPAHNAVHAPRVAAALPPQEQEQQQQQQPSY
                     KSSSSAAAAALSPNAFVQAPPQRQREGEHPQHRRVPADGTSATATSGGGGGGIDDSSS
                     ALSAASVPASWSCESSVLPHHDEDSGRSSDGTYQFTTTSSTMTERRPVSLKHAISVGS
                     SDDTMRLADLRRRAAAQVEKRGPRHPAAPGAVGASAAVVSPSFSTSSCGCPTNCACRS
                     DASDDDVFGVSVDFHGRARPAWRVRPASRPRVASADARRDACTDCTMRAAQDMTLCSD
                     TSSETGTTPLQRSSEEDSDDLCSSCRQHRCVCGHPFFEWRPAQHGDGEVSLKLSSQGS
                     SEGDSGGGDDASLCRLCRAAARTRAVHQDGTAASFAHHEDPLSEGVREDRRCTGVPPL
                     LRLSIPCSSAATKRDSASDAATMTQRERADRRMIYVQSAAALASDAGGERRGAHDATV
                     AAARELDRCTGSTQTDAVVPAAATASLSDEQRRRHAEQEAAAVKSIAAAHCAEVTLPL
                     LQGELANFEARAAVQQQARFHVVESQLRVYLDEFRQRVQELSDLQMQQHADRQAEAEV
                     ARRAAARVDRATSPMDSALIADAADSTPQAAPSPVPPQRTVGTQHSDGTLELLTVVRT
                     EAASWMAQLLLSIEAERRDAVTQDETESRDRLLHVVEEPRRRQLLRYQAELLHWQQEC
                     AAVRHRASFVSDLRALELRERLARQELNEEASAVRRELGEVFERQRCQAAEAAAHSQM
                     KALEDELAKVRSKLSIVEAEHADTLEHAKQLRLQLIHALRMPTVTLVDCSGVSAAARG
                     AGDAAAAAYACPNAKTEMGRGDTLDMRGNTHQGCEDRAPKAHAASSTGSATGVAPWHT
                     VPNGIHGGWEDLPVHQRFARAHQEALRVTRAQCRTV"
     gene            <292493..>294502
                     /locus_tag="LMJF_06_0750"
                     /db_xref="GeneID:5649098"
     mRNA            <292493..>294502
                     /locus_tag="LMJF_06_0750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680794.1"
                     /db_xref="GeneID:5649098"
     CDS             292493..294502
                     /locus_tag="LMJF_06_0750"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680846.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649098"
                     /db_xref="GOA:Q4QJ02"
                     /db_xref="InterPro:IPR004254"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ02"
                     /translation="MQRGHGGSSLSSSDGPSPAVLSSAGSLWSRVGREVASWRRGTVS
                     IHEVDAWLRFNPYIRRGFRHRFLRKREALGSIVLYFHNETFNIVSHLAMAVLLVLLLL
                     WPPRSTAMSSGGGASEIYDGADGGYGLYTAAASAGGQGGGGAHFGEHAAGAPFRGHRS
                     EAAEVPSWLRGLHGLAAASGATAAGTDKDGAQGYVPSRDEAASPRHALSDAAAGAAAS
                     SPSFRVFASLSGDSAAPSSPAWIVSGIDTALPPPPMSVAARLSLSLTPLVFSLLLTFV
                     LSVLYHTFMPCCRSRRGYQQLLQCDVMGVVCAISGSAYAYFTCGMPCAGEYVQGWTAA
                     LMVVATLLCIYVVVLAPMWDVVADVCALALHLVQWVAAVVIAAVLEFLMGCPLPSAPP
                     CPPPLQRSGRERDRQPRPSPPPAHHSRQHLLPAWVQQHRHLSSARLGDPPTTAATAVA
                     ANTGVDPVPLSALQRATVVGVYCLLHLCVYVALVYPKSRAAMGGFTQATHYHNASYVW
                     LCLGGLINAARFPEVVVFHWTRRAARHTRRVAAAEAAARCAEALGRDAAVAEMDARGA
                     PAASSSSRGSARPLRASPGGVATELAAQAPSVLITSSPPATAPTLWDRLCVPKLMVTY
                     VVSASTLDYIGNSHNIWHVCTALSALSAILGVYHDCMEYDLVQCG"
     gene            <295611..>299147
                     /locus_tag="LMJF_06_0760"
                     /db_xref="GeneID:5649099"
     mRNA            <295611..>299147
                     /locus_tag="LMJF_06_0760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680795.1"
                     /db_xref="GeneID:5649099"
     CDS             295611..299147
                     /locus_tag="LMJF_06_0760"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680847.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649099"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ01"
                     /translation="MMFGLHHRHQPLARERLLPQPKPVQLHEFGQEVGSSPEASQSSR
                     TFSPSCNVAAARHSACPIGSDLVSRAASDAPMHPPAPKTTLAQLTHPGHISGCPPAER
                     PWSCTTPPGSDGATRVFLPCADNTSATTAATPSASRYPSAWQTLMAATQATAAYAASV
                     QQAQQLLRDFEGYQRSVGASPLNHDQRRAKLTPGCLESGRGSAGTTNCPRLDVDALGQ
                     RGTPSAIISTKARGSVPSVGTGHPAQPPRASPSSSPYLSFPLDPAAYELARRRSLQAL
                     HDNAQARAACIDQGLWLSRAVHAGLLKRPGTAIGDVVTMEGSSGHLKSTAVAHNDGQA
                     LPPAAGAGHAPPTSNAAAGQQKTDQPPIAAVPVMSVAERAAATAEAERALSLLCTIRA
                     VRRQTEELTVLLLHACGEWGCWSVPTAEEGVACETTRTPLPSSPLPGRIRHSQHLFAD
                     LFVAAPLAPTAFCTSSSVSLVGVSDGTAKADLLDLSAGEDADPARLSAASVFAKESAC
                     RRERACQALRQALQQQQQRWSLSTAAAATATLAAGAAFLEMALAPPQRAVPPPPPMSV
                     QLDLYAVQPCALQRSIQEWRPRAAQTTAAGATKAGGTSPPEEAASLHCSLQQLLHTLG
                     RQGPQLQSSYDVLHAAAGQRHRTNTRSCTDEQRGVPPREATTGVIKAAEARAVVHKTH
                     GTSAAASDAPQEVEVPPLPSSSSPLAVAPDTLRRTPSSLPRQHSSTTPSSSSQALPSS
                     DTLLSSPVQLAVDHTRLWADPPTPLQRADFSCAAAAAPTSTEISERGARIPVHQAGRS
                     VLEDASSHRTKGKPELEAHVEVEVIGGNADGSHAAAGASSSNSTQVTNMRRTSLSSST
                     FFHSPVAVDARGGVVGALREVYEASWQPCSNARPSTRPEAAHAVAVAEEKLASQHQEE
                     RRSRRCDRGGSATAVELEDSVRRHLTRWISQQPKHTASDAAASLSSLALSPHDLSAAA
                     GWLRSTSPRFAISQTAAAPPPAVVRILKHAFPDFVAPSSWNTLRAATTAAVVVEADQP
                     DGDEEPRAPQQPQGHPPSSTITSTTPSHPYSAETSSVPEAAKLPRRSLPQAALDGPAV
                     SHSPTSSMQSSQTPSGGNHTAAVAPPGRLLLAPVAAANPRPAPLSAPPPPPPASLPKA
                     KPTKDGGSAGVTKLPQRQRHRSFFSRLFRCGG"
     gene            <302980..>309006
                     /locus_tag="LMJF_06_0770"
                     /db_xref="GeneID:5649100"
     mRNA            <302980..>309006
                     /locus_tag="LMJF_06_0770"
                     /product="RNA-binding protein-like protein"
                     /transcript_id="XM_001680796.1"
                     /db_xref="GeneID:5649100"
     CDS             302980..309006
                     /locus_tag="LMJF_06_0770"
                     /codon_start=1
                     /product="RNA-binding protein-like protein"
                     /protein_id="XP_001680848.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649100"
                     /db_xref="GOA:Q4QJ00"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ00"
                     /translation="MERRETSRPNACSKGQLLHISYAMRATDDSDMAAPGGGDGADRH
                     ALGSPGEGVGGAGPQPHPLRGQFGLEECTDAFRSDEGYASAVPETASGAPLRGEVDVC
                     SSSLTATARHQNLLNHGLLGGDGEFAPTGGPAIHSAPSSEQELMASGPAVAATVTHLP
                     VSSAPSPSFSSQGQPLSAILVPASRSDDSAAAARCYIDPFAAAVGGSGSTSRSSSVGI
                     ARAGTSTGMDGLYGDHYVNPLLRSRSRRSSGSGGFFGGADDDEDGSAALQAAVDAAVR
                     FDDLASEDDVVSGGGERRTLLRAGPTTVSHLLAVASDTDDGALTCAHRAKTDFSTSFG
                     TPGGPGDGENERHPPHSPQTPGMPQCSRWGDRSADGCPQMPNRAAIGAAAVPSSAPYF
                     VASGSAIVSPLQSMQPLPSPVTAAADPATAIVTSAHPGYTAAHAQQSQQQPLYPYILT
                     SAGTVAKPSAPASLTSPQQPSIPVPPSRNEAQQLQQQPQLQQQPQLQQQPQPRHHHHH
                     QCSSSLHPSPHGRRASPVAVPRTCPAGTAAMPTLGDVDSFRYVSPPQASIAATHYHSV
                     GGASMCGSTAAQNSTDVGFAVQPDTAGIGTGTGMGGQMLSSSLLSSPNAQPFYLYQVP
                     QATVAMESPPPPGSTNVLLYSPPQAYVGSGQVVAAHLHPAPPTTAAATAVLSDSSRAR
                     STSTPSGSYERPAVTQQQQPQVVGGYTLTPSATAAAAAAAAAAAAATLSGESGRASRN
                     LYFRNLPHSWNTSMLRELCSRYGAVLSAKVAHHSTTNASLGYGFVLFEHKQSAVTCMA
                     MLNQAHVHAEGEESRTLLVRMAHATAAPGFREEGASDSTASSLRQPTELTPPSGSASR
                     AGAVGGRLPQWILQQQQQQTTTSGLRSPRTPPSGSASVMLLSPGSAPQFYSRELSGAN
                     VADAHRAQARRHSICDSSRTNANASSNTSCAGGDSLRCTSPVGGTGNNSCMAISRTSM
                     PPSFSEICNFMGGKGVAKASAPPLRGLYRVPSTSTTPSLLSPHQPHQLQQQQQQQQEG
                     SLSYLSASASRSATAGETVTATAMAAAAAQRAGCNFCSPLSLSPNDTASLLLLSPSVS
                     HPTVQLPQSFRAPCTSVSGKASSATPAPAASASATTSTRNVYITNLPLTWNTTKLREL
                     CCRYGEIVSASVAHHPETNGSRGYGFVLFAEERDAASCVMGLHQYRVPASSHVLRCRF
                     AKDKATPSIAHTLLSPSPESGRDSGGSGCGSPLPTATVGGSPTAATSRTMVPMIAVGG
                     DADVLESSLVSSGTGNTTRCSVKGAVQDAVCMPIDVFCTLQQRVHAQCVQYLTQKHQL
                     QRKDTEDNNEPTSAVVAAEVQSEELERMMQCCVVYGAHVPTEGYGCVRPMDCRKASFR
                     RAVARAPTAAVADDAEQLLSGPPAEPSTPASSGLRSVGSALSTERGDPSGEVLDATDT
                     AAPVTLSGTVVCTHAIAVGRAQPASPTLTGTTTMPAAPSTRRSMSDEPSCAPPRGVGV
                     SDAESARGVATPEVAAWPGALVALWYTGTLFTTEAAAAAFVRAAAEASSGSGATTIAE
                     RGNFGTHSGCVVEASTVPLSSNGRDTPADTTLPSPSPALDKTANLQQTRFGLWDQVMV
                     LSSAPLAVPAAPPSTSSANNTAANSTRLHPTEEPYSQHRPTATPPQQQHQRHHLRPSH
                     QLPPPTALRAQTRAGSAAASTTQPRGSSLFPATGIAAVAAYSSASTAELPPKPSQPPH
                     LQQQQLLCSPSPAETLLCSPPSHAAHYTSARVALTSPADGVSLTSPTPLMMVMGGDGD
                     GSSSTSSTAAPLTFPKDFVASASAGVTGRYPSATAAECAYLLGSPASTSPVSLSTGTH
                     ILSGSATPPLGVALNFPSASSGYSTLFNAAGAGIPSGHPASAVHAAPAVFAAAPSHMA
                     AAHAWRAATSGTTAAMSNVLSAPPPVTSGPSSLLSTEQAPPPPPPISYPFGSVIYAVP
                     EAAALTALATGGPPVLFSAAPISDVASPATPASSAQVSCATPDATSQRSA"
     gene            <314225..>322576
                     /locus_tag="LMJF_06_0780"
                     /db_xref="GeneID:5649101"
     mRNA            <314225..>322576
                     /locus_tag="LMJF_06_0780"
                     /product="hypothetical protein"
                     /transcript_id="XM_001680797.1"
                     /db_xref="GeneID:5649101"
     CDS             314225..322576
                     /locus_tag="LMJF_06_0780"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001680849.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649101"
                     /db_xref="UniProtKB/TrEMBL:Q4QIZ9"
                     /translation="MDGTLSNAKGGDGVAVSGPPPAQVTRLSAAPVVGASGSRRGNRT
                     RSPGLNAITSRVSRSNSRSNSRSNSRSNSRSGVTVGGAHSGVKSTGAVAPAVASKAFD
                     MRRHSGSDAPTSPLPPSVPSAPEAPLKKPRRGMGEAVASRDSSACVSSLSVGISIPSH
                     APGDTPPVPTKEEKSNEQTQQRELSGQQSPNWCAARTSRVHHGRIGVSAQLRRLSVTN
                     CNNHASLLSGSGSHIGCSPVLRELARGSFSHATASDDHAVKEGSACGQRGGTTATSSL
                     SSSSTAPRRHSLMPHNTDAKYGVRAALVPTPPAVAAVGASSSSPPHDIGGGARPDTHS
                     SAYHGSDAARRPSLLAGVHPAHVSSGGVGGEGSGEGGCAQLPSVNRAGLSSSPFARCP
                     SLVSSTNAGGPRGGPAKRSVAGCPFAAAQPTPRSPSVSFADTTTGANTTASSPGSHTE
                     STMTFGTSATVRALASATGTAAMPRLDNAAVKKPLMTSAVASPHLMVPQRLARLASGL
                     PARTCSAATTSIIRTATRNPKNICKAALTTSTTATSVTPTKGRRFNLRLSMFPATATV
                     ATTTAADCRLGSTLPDATHAITESAAVAVMTRASATAQYTVLEPLTSPSSSKFIASSI
                     TSAMSPDKLHPDRDSAQLCRRLRGSSELVASMPSMPSAPEHFSGRTPLAEVSTSTQGS
                     HQSSPTQLSRQSQPADDVSKEGGSTVDMPVLTGRAASAHIPAASAAPPPPLMRSPLSS
                     ACSSSAVNPSFVRRQGSMPLLSASHAGAAMTEAIEDDHGGQQAPMIAKCGSAASPLRM
                     PHHPRHASSEDGAASKTEVLEVRARRTASPHLRSTTITSKLSASGGGGTQYEAPLTLS
                     SLDIVGVGEDEEGGVDVDVAFVDGSSPLGGKPMSVPAHHSSGGNDREDALTLTPRLGE
                     AERGLQQQDGTTPPPTFSSHAAEVPALAACASSADGADVVARAKDAAAAKAMPPSSRS
                     AGPLAEVGLATTLRTVPGRPKPGTSGSRIDSRLSTPSFDTSFHESKAGRFICSSARSS
                     VPMASLVSTTQLQSNSATALLPTPGLATPRAPSAYPCGTHSSPKTLSSASSSAASSLL
                     MRGSAAKSPVAGASGPRPSLPHLAAAAAASTPSIASDIAPVALLALADVASRSPRPAS
                     LGDGNKVALAVTQHRRTLNALAAGTSRSTAGSVSMRQPSSLSPFPAARAPDDDTTTWV
                     TPPSGTNSGVAVSTQNPPQRADVFPSMPPPSSLSSTAGVSSLASHGVRPTTTANAHRF
                     CGCSDGSLSDVGGSILTHRFVPSPRLVFDAPTTPKPPLHTGTSAATAATAGAAGSSAG
                     VSGDDVTVAVGTSRGHDEPPAHDRLTLTEDAKGDERAAVGGGGNSAATVSTEAGCAAQ
                     NPAHTQKTESSLSSGRDNSTGGSGGDGGHHPSAARSFSGQATPTHRAATDNTVHHLSA
                     ACVMELPAYRPIACLSVEKKREPHCRHHDDSKQQQQQIEQMTSSHTVQSDSGAGRPRL
                     TSLSSMTASANGDPLHLSTSACSSSKGVPATPSQRIVMDGGGDSSRRLHKSKLPSLLT
                     VDRLVSWLRSTSANGKSSMVRSSAEADIGADGSATEGPGNDALLQASSTTAVATLAVS
                     SAKGTSLRGNASKTMSCADGSTSTNSPLLVRDGTRAGSSMCAPSLVKQCCFGDPHTTA
                     HIAPTVPNTAVVVTATALSLRLSQSSTVSVHASIPADVGGTLCDGNDALSRAPLRGMA
                     LCGSLGARGSVYPHAVPSLPAVCQPHRQRAASTLGCGGPHAKTMGSSEGVQVIVNKNA
                     SAAECDRETDDTRGAAAEFSASTAVAASQLSVAQGNHNPRSSSRLPVAPSAPSDTAKA
                     AEAAAGCCSAASAPALTEVRGAGDTHANGRCGGGPSRPLPLSSVMISDGHRTDAAASH
                     TQSQLHGSSNSSLPTLRSTFLGSVQGAIKRWAIAVLRRHRHSRSSGRCIGTEKDGAGS
                     EVSSSSSQVSSLRARAGEGRNHPPAAWKGVEVKSVRPLYAGQGQQAGNLVQSGVGVAM
                     ANGPGAAPLLLPARPLVPAASSLSEAPLPEVRGNYTSWSSSATSRSSFIGTASLTPLF
                     YSVLDYAAASADNGGPHTAEVSYSVLGSAARAFRRRFNSATAGGDGTKTAEHKRASDA
                     TTTSGSLASLRIRHAASPTSSTVVVPPGARNSVITLAAAAQRKVFRGTPLSRRTFRSV
                     LSGTTAPTLDAADDTDEISLAPPMPDLPACPVTTKTVSMLQPGSDQLSGRTSTLRVTD
                     STATSLSTTMTAPSSSSLRTTQPSSSFGAAAATALSSLSPEPKYTPTPTNAAGGAQSP
                     GSASRLLERRRRHHRSTGDRDNPLGGTAAHRTLKADKYDQQPHHSCHLAAARLSLEPQ
                     PQNTRAPATARRPFSGCYGEDTTTVASMSRRGSAAVTLEGCGGNTVVVLDAAHASPLH
                     TSLAPSTRCFATTTPTVAAKTSCGRRGGNRCFSAGRSPLHPLSAHERWPVPTEKAESA
                     SVAHDKMPLQSVLATAATTSTITTSTPYSVSLTDTSSGGGGFERGAAGDPVTADATEN
                     RACGTLSNSAAVPSSRQRSHTGSVGGGTVNVAATTSSRVIVRPLAPSSSLPFTDSAGL
                     VHRSSGSGGSIAGGREGAVSQASVITATAPSMGADEDRSDDDATNENAATPPPASTRT
                     AGANYSPPPVLSCDASPALFPLSSPLAFLHDCHESFTNGGIPVLMPGDHERNSQLSSP
                     KRPRSDTEVPQPAALCSAAARGSVSRQQQQQQQDRVVPVPAPLNSPARPSRAPSCAGA
                     TAVIPSPPAAASD"
     gene            <327515..>330736
                     /locus_tag="LMJF_06_0790"
                     /db_xref="GeneID:5649102"
     mRNA            <327515..>330736
                     /locus_tag="LMJF_06_0790"
                     /product="hypothetical protein"
                     /transcript_id="XM_001680798.1"
                     /db_xref="GeneID:5649102"
     CDS             327515..330736
                     /locus_tag="LMJF_06_0790"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001680850.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649102"
                     /db_xref="UniProtKB/TrEMBL:Q4QIZ8"
                     /translation="MWPSQTQQRLPRLLLVATGTATVATAAGETADGISHDFWWWLAL
                     GFSGFFIVLLMFTLLFSWSRSLDASASVPASSLHSRRRQEKQDSVGLFDSATSVSPAM
                     TAVRHASTGMVGTNHGSGEASVSLLQHADHTNRCENTEMMAAALEGGVMPLSHYGEPP
                     APRPPVTTTVLLEGHRPKKVTPASSRRSPDIHFRSAATVSPRAALDTPPAAASLPKQP
                     QSSTRAQRHRRPNDLGEVTPEADVDAAVSSLENPLTAAGLHRAGPKLLVDLVGGSTLH
                     STPGAAAGEGRGGNDTPRDFSLDEPTFSGVPALAWHGKPATQPIPPVPLQRASSQPQR
                     SSSSDAVKQYYFGFKRSQDTAATAACSEFMPRRAWHEAAHAPAQRRSSQARRRPVDVE
                     SEPAPGASREAPLTNAPFTTAAAAALALTPHDGAVFKPLTLTLATMCPFAARESGDAT
                     SLTELEPSPQRLHVAGEDGAAAAGAAACRSSPCELQHVSSLSPRRLRSELFRASGECG
                     PATVKAAVCRAQLDKRPVARLHSTDARPTRQLLILHAAPALANSKLRGHWRDRPLSSQ
                     PPVRSRSGASSSSAAQRTASAGSATAERSVSTTVTKGVPQLFFGKRGASPVRPPVAAA
                     SSQPTTAAAKGTRSGSGVAAARRPPIAKPLSVDYLTEALTPALVSPSALSSVSPQPAA
                     ASAARGSSTPTRFTATGGASVSPSGWAVAPHRGSFSSSMNGRSPLRNSPRRKRSASLV
                     TFLDKDDVRVGSGSRGGHAPPPLAQQVQLPQSCELSAGSPSSFYASLSVSGSGGAARL
                     ERLSDPAAGIAATGVDVAPVLRNAGVSVAQGHRSCTLPSAAAAVERRQVQSPATREPS
                     AAAPATPPHSATTATPLELATDVAARRAPAALGPPAFASTRHRGGGATAAAALTAGPA
                     EEGGRVGAEESCDGDDGDSVSSGASTIAAGMLPDAPRCRRGTFAIVPPAPTVASQQQQ
                     LHSTASGYSDGRQQLFCTSGIEVPRITHPTGVVQESPAPPSTLARDPRHCDLTHTASY
                     YPSTTSSRRLLAAHSNAALPARPHFSGVQVAQASATRSNGSIH"
     gene            <331818..>336572
                     /locus_tag="LMJF_06_0800"
                     /db_xref="GeneID:5649103"
     mRNA            <331818..>336572
                     /locus_tag="LMJF_06_0800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680799.1"
                     /db_xref="GeneID:5649103"
     CDS             331818..336572
                     /locus_tag="LMJF_06_0800"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680851.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649103"
                     /db_xref="UniProtKB/TrEMBL:Q4QIZ7"
                     /translation="MAATASNGTAGAAAAEIGPYMNPLSPPQESSTSVQQWQLVDADR
                     NFAASARPSTVVWSMDSFRETTLSSPRSDDVEPAMVAPPLSWKEERRQTSQATAAGRQ
                     SPLLLDDPLPLQDHAAVLHRPQDRRIRNRAQRQAVCSSDAKEDITAAGDGECRSFTRC
                     MAHSEATVEKRLVSAARTPSTAAPQPRLTGEHPQRAPPSQAQQPHPKQSLLPSFCQPA
                     PHRLPPQAAWVSGGGGGGRAALNSGDEPLSTTYTAAATSEANNNTSGIFSASQWIRAT
                     LGVTTTRSRPYKETVATSPSPPQPATLASRKSPPAAQVAAQLHERRVAAALQSQKEMR
                     EFMAIMRRMEAAGGANAARQRRRRRPCGGAENGAMACWRASRQASTPRSNSTVSHPSE
                     QPSLQGSAGARDGGRASMHGEGTDEDEARSSVTFSEMTELDEDDQIVATPSPYLRTDS
                     AARSVQARRVRGRRRGARGASEVVSPETSAASAEVAAAVTTSRMAVYKLRDRTARGWV
                     ALQHRRVARMRAGTPVLQREIQASQQRLLRAYKGNTEGGGSGARAQAVPRKAIVDAAN
                     TEDGLMSVAGLPDGTPKLFKIPVAGNLMALTVSWGGIPEDVQPDDGAAGSDGDSVDSD
                     FSSMKHSAANAKRVSQAPEVDGEAEEVSRMKNSGAGSGIGGGKDSDSLWVGGDAPLAP
                     IAAPDQRSTSLARSSSTLSNGTLRTANAQTLTSTSRLLGGDVATLEQAADSTTCLSAR
                     ASVAAAAPEAAAAAKEEQYLRNELQRRLAQASECTIYGLHNALCGARGGRPSKSVRTA
                     AAATSAGVVVGGAAAAPLSSPMVAARRHHSGQCATSPALRFSAQQTLSRSTSVKMPSI
                     IQTRNAVVTTPASAAAAGALERRADASLSPPDSCGSPNRRNRQSGAQLGSDATNSMSI
                     LSSVPAAPLSCVGGGDGTAAAARPRAVAAQTPAGSVAAAAVLPPPSGRPRRKKSVRKR
                     STLHRRKPLLPVIGVGEHSAVLLQQELLATRRWELEADEARAHDIECTCAMLQRLRPL
                     REQMMVGDTCPGTQRTGAAKRVAEEPADPLLLMRSRTLLSQMETPPDTALATPTPLPP
                     PPGLSNARLRSTAATAAGIAPSPPLQRNEADAAIARSHLPQAALCRQRQLIYDEAVRL
                     DTGNRLEARTAYLDALTQLAHKHVSSVSWPAVLALISELRDRLQREAQLTIGVSSATR
                     DGTASKPTVQAAAISSSSSALALTATKPTAKRRSSSSTMSSLLRTSAALQANPPALPP
                     SAQQYGGLQQLIATHLGVLELTQWPVQEVLQHLAALYSVPLSLLHEWIAEQQRRYSRS
                     YSYEERFLAIDCTIAGRAATTDTVLRLTLHRCRRPPLAPLQNSPRAAGSERMGYASGV
                     QQQQQPSGEEGGLYYIRVRSLVQSVASTAVPLSLTAAAPFSGAAAPLRAFSASPRKVA
                     HSSTVRSLSAMASDASALPPSSCARALNFLGQTLIVNLLSAAATASGRSRDHRRRTVT
                     RRTLVHRSNGSGGADADAETDDSVLAVELMQAGSTTPLACGALNLRKLGFNAHNPNNG
                     GGGGQMRAQNVQIALRRKGYRSAMLSATLEMM"
     gene            <339327..>349103
                     /locus_tag="LMJF_06_0810"
                     /db_xref="GeneID:5649104"
     mRNA            <339327..>349103
                     /locus_tag="LMJF_06_0810"
                     /product="hypothetical protein"
                     /transcript_id="XM_001680800.1"
                     /db_xref="GeneID:5649104"
     CDS             339327..349103
                     /locus_tag="LMJF_06_0810"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001680852.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649104"
                     /db_xref="UniProtKB/TrEMBL:Q4QIZ6"
                     /translation="MTMPPVPEADLLTGSTVPTPGGDAAAKRHDVESGASIHSADAAR
                     ASCDVEPLAHPSFPPPPPPPAPHPNALESLPASVDASRQLREWGKGTVPWTEPLAEAI
                     LLMCNKLDCEMRQMWVARAALLYLVFEEGKDCADALQPQPAALGAPASSLTRTPRSTL
                     NDKAQLALALMRTLEVHRRQSRLMREVLRPVTMRFAVHLREKANAAVSSDALGSRSEA
                     AAGALSELKSRDTRAAGVSGDGKVTTHVSSVPRAVAAPLPRREGSFVNLERYLADGLL
                     PLLYGEFVHYCRAVEQWHDCNYRAVVCTTVEATTAAAAPQQQHAPRPSAQDGRTCLPY
                     MSRADIETFSLLAAVLHRALGLHSVARCGDEVHFDLNGHSADAYTSVAPRSHGVASDP
                     SGGVGASADHLQCGRERLRGSMADAAPAGAPRPPRRPRCQPAVSLRALRLTIEAITAR
                     LDADGGPHTGAQELVSRNLMQQAGAGYDVRAYSPPPFVPPLHARGARGGGGGPSSSSA
                     SSPTSRFGGAAASSSARSPRTPSATAPSLEAMREGRCSGGKGHDCMTTGSGSPRSTAT
                     TPPLSDRFGNFNIGSFLPILSLCAHDRSFTIFVTTAADGTGVHAATTSATGSSSPASP
                     TPAAEPSAPSEEDVSALAAAISRLLLLGVYWAPLCRTYQLPAVLTFFARATTAELTHA
                     AAEKSTSAAAAASSPHPASSHPTAASRSTGPAREAEAAPVDTKVLQLVRDALLPPSDD
                     LAAPSSPFVQQLSRLVYSSGRYIEWLNFGTCATIAATLDRVLSQWPVHRADVATAAPA
                     RFLSGNADVGCGCASDDRGGGGGDVRVATAGTTPVADAAGTVAVPHATGSCVVFRAPV
                     AAGMATLHVFAAIADEFWSRERGRIMWQAISRQARQRLAVMSSTALMRAHSTRFLGFS
                     THTCTYTRLRVAVPKVNGDGTTTTTAAAANGVREILKAPFYILRLMGVRSAAAERMGT
                     PDEVLRVYRTSERAESYMAVLNALGCTTAARPLIGEYLRSDFMWRTIPNDTFVPLVTA
                     LVELELTSMTVPELLLVSGSLEHSTGAKHGWTASWSLPGRLAGCCSSHTMTSLNARVE
                     PHELRLLTADDEDAYTFCMETDARELQEMAGTDTRHGGGKLPLLQFTLRRISSDGRVL
                     DPPLSATTTSSAAHGHTGVRGSATPSSTVRQVSRQGAGGARTRTRFVGAPTCYNLESV
                     AKLLWEPAYSKSPNESARMPLTAFPPLLRSITLLAEAERRVGDAMLHDAADLRRDGAS
                     PGSSKCHAGAAPLRICSVELILRMAWRLLFSSASEASAVAAPTEAVSLEALVTLYLSL
                     TSVASQWTVSSNTRALDARAASRELAETSPAAGERARKIGGAAKALAPPSILLAVDCC
                     LAHCEVALRPRLMAIALHTAGSSAGDAAHIKPEHVATDLRVLLQLAVLTERLLPCPAN
                     MAAPATATAVAGMPVHELIHRQLFRELGASLREAPLQRIAGEVSRLPWWVTRRAHAEV
                     SGDGTSPLSPPTSWVETLLLREIGAQRLPVAERAPTAAAAPSAASCSSTSHHSFELFE
                     WALLPFYTKLEARQHDANAAATTADKAAAAPSQSHSTAAPMMDSFLCLEDAYRDCAAG
                     LSTGSPSGATTDATSVNGDGSTTAFQANDRSAAPHMATLEAALHALPAQCDSFHILLH
                     VVRQLFLSHPVLLSTAPDAALYYELRTARTAPDHATSIASATSSASAPEHVLGAAVGR
                     QAWATLPTQRVELPHDLRQRYVDALFRCFKRLVPHHSCTAEELVELLHLLWLADPHAS
                     RVASSAPSSSTKASTSQWASLFARCRDFVKGSMAELDAAVEMHDTNPSWKDGKDVGAS
                     PWLLRSVPDVLQTVYRTVHYGLTKSIVLKPREMHWLSVNAMALHPRSMVLFLHCLNIV
                     KGLEEQRQQCASTPQPPSEPPLPPRQQRAQHSLSRWHQSTLEFFQPFVVYAAITGEAI
                     SGVATMRYMPLMLGSLSEMDPQLVLVLMQATFAGAMWSGDAGKNPHGRGGGSSRRERA
                     NAVNTVFYRKMLAASQTGVGSGRIGQHGHLQPARALSDGGVQNAGRLSESIAATMAAL
                     LMVASHVQASSTVWASSRGAGGHEDAYSAMTTRAAPQQAPSAHIGRAHHSALIFLRNS
                     LYELLLMARSRRPLQCASAVTVVQVMQLAVVQESPRMVRLLDWLFLSLLIPPVQIIET
                     AIVPAATNGPPHRGSGLAAAPLEHLSSPATTTTAATLAHGDSGSDGESSDKHSLVIRA
                     DTVGATRFPAAHEAVLLLRLLPVQYWRSLLHRDVCWPRYRGYALQKFNRRWQSLAVAR
                     SGDYTADTMRHPTLNKWNQLRGSLSSLLLSLDVESIACLVAEAMGPMVLLVVTTELLR
                     VLARQRACSGDSPTTARKEAEGTPRAVCAAMRTVSRTDGCQRAQADEWPAGNAAQSDA
                     GDDTPSPASLTSFEVVRCYASPRSVLTDEAVQPWLEAACNVIDQLASTRHTDFVAILE
                     REAEWQRRVTEASSYRGAAAEEVPLGVFRQTAVEAMAAARAPTKGGAREPAAPVLDVG
                     EDGVTEVSDAVDRAGARDKAALGSAAGAPAAGDDVSALGGSDGCGAPTTDLFTTTATA
                     PDDAVGEWPDDSDTTAERPLVLDWRPIAEFVRAVREVDPGIVQRQVRLECWMRQPELA
                     VGAPAEARALPTARTRPFSPATTPAAPSASLAEAAVAGVMDDARDALHNAAGAILQHA
                     RAYWQAADRAHGVRPLLMMNLCDALNLYSLDAQQVCHAGDSAAGGQLVSPTYEGDAAK
                     DPSDTASSAARVSTRDSAEVVEQARWLEYVTGGSGFDRGNGPAASWSSLSTTMVLGLV
                     RPCPALSVPSICAPRAAGEATTVGEHKRRRIALLRRAGVLASAQEMAERCRAYGLRCA
                     MRHDGAHTWQARCATDFWRRKSWRLQREIFECVVGDEVVAAAARARLHASDSGVSANR
                     HAEAARQETAAAASAAGRPVTDGCMSDVERRARHRLQLLRCDDLAQLLLLMTAKTSAA
                     PPLPSAEAGANMETDASLSLLRLKMRVVIETMAELLPSASTNELMQVVLALLKLSISA
                     AATDASSTDATASQLLHYVCLEARRVLANVAVLVANDVERFTSGELLWLITRLHTPCI
                     RAAVPPHAQSAQQAEGGAAARSETFPRPTHDKTSGDEPLDVSMSFVSAAVARAIRVVI
                     EGTSDPTGSERGDSADPADEIGDGTDTPTNRTAAVDDEVPVNAQSASPVTVALWANAV
                     AAAEQLQGKSQMQYLLQLVERSAV"
     gene            <349846..>351039
                     /locus_tag="LMJF_06_0820"
                     /db_xref="GeneID:5649105"
     mRNA            <349846..>351039
                     /locus_tag="LMJF_06_0820"
                     /product="putative Qb-SNARE protein"
                     /transcript_id="XM_001680801.1"
                     /db_xref="GeneID:5649105"
     CDS             349846..351039
                     /locus_tag="LMJF_06_0820"
                     /codon_start=1
                     /product="putative Qb-SNARE protein"
                     /protein_id="XP_001680853.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649105"
                     /db_xref="UniProtKB/TrEMBL:Q4QIZ5"
                     /translation="MKRSIHTLEQLQLRLRSDAATTGGGSGRTGTTVEQRRTAEAAKQ
                     KRLATLTPYKQAEYRCVECVAELRQALRDVEEFEAALGRRTSAGVGRSREAEETGDAV
                     DADDDESMRLLRRQEGRQGSSSSTETALLEQELARSRQQARRAHQRLQQLQREAARLA
                     SRAAAKAPAVTSSAAVASVGDASAPSAALEALEWQRALPHVERAKGWYRGVFGIRVVS
                     SLDDPVLQLNRPAQPQQSAGSMAHFGRGANAVPSCVTAAAEGSSSPSAQARGSEARAD
                     GAATASPLLMLESAREDAEFREFFASVQANDELIDAAMDRISDGVHRLLENARGIQDE
                     LVVQEALLQQTEASAEAAEAQLTQMSRRLSRAIRELEDSSICMYVVCLLVLLLVLGLL
                     LRVAS"
     gene            <353047..>357402
                     /locus_tag="LMJF_06_0830"
                     /db_xref="GeneID:5649106"
     mRNA            <353047..>357402
                     /locus_tag="LMJF_06_0830"
                     /product="putative lipin"
                     /transcript_id="XM_001680802.1"
                     /db_xref="GeneID:5649106"
     CDS             353047..357402
                     /locus_tag="LMJF_06_0830"
                     /codon_start=1
                     /product="putative lipin"
                     /protein_id="XP_001680854.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649106"
                     /db_xref="InterPro:IPR007651"
                     /db_xref="InterPro:IPR013209"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q4QIZ4"
                     /translation="MISTLGGLFNLNHFDQSSCANDVIVIRHKDGSLRSTPFNVRFGR
                     AQMWSYVGRVVQVEVNGELTAAVMKIGKGGKAYWLQPTYGAFGEASHGAAAAKQPENA
                     GGGIPPAAAALAGVSGAGCAAKGDDEELDIVGTLVSAVEEVEALVLSTAELQHLPIRP
                     ESPPGLLSFSAADCDAWETGENAAAEVSPPSGALPPVQRHSATGAPRPAKESDVKLHS
                     RDAGCQRRPGDPHSGLQDPGSSLPLLHTADDGHLTIETRAIHSAGDAQEARLALRAMV
                     AAEKSRKRLSKMSFGDDPYLLKTAREEGHLGDDEGDDEGSDVGALGNEGAVGDDDDGD
                     HHLGGSRPEPPAVEIVVDAADVSPSLREATVRAAGGGRFAQASLIVTPAAADDGTDTQ
                     ATDQLVAQPATGTKEGESAGLAPAPSSPQPPVEAATAASSATSVTGSTDSYKVVDEDA
                     YFLDPMDTDPDYAALYGEEELALLKGASFESSVTSGVSLPDVSITLGTIAGDAATAHR
                     GSASASEGELCTAVEGSRASRISASLLLEPQTVEAAISSLKQLPLPSLPSPSQPTVEN
                     QVSSSAKDADKVAVPHASTGVPFTTVKGGTASSGVLNAPEEVTDAEGRPVKLTPTAGG
                     AGGGPYFIRTLIPVEADLWKLHLKEGCNTVRYLARKDKGDIVSISCNIFLWNWTDRLV
                     VSDVDGTITKSDLLGHFYAMLGKGADWTHPGICNLYSKIERNGYRMVYLTARSVSQIN
                     QTKSYLFTLQQDGVRLPMGPVLTAPQRFFTALTQEVSKQSHVFKIACLASVRATFPPS
                     TKPFFAGFGNRYNDVISYDAAGIPTHKIFIIDPSSVLHVCLVRQTYRDLGHLVDVTFP
                     PVKRHPVVLRAPRHLQRTQDTGASTSPAKDVAPGGCDRHVYTRSLLHRSSSALSSSAT
                     SLSSAASSSLDSLDLHGEASGGSSDRGAEGPPHHTSGSGASSGDGFVAGRHASAAFSL
                     VDSERVEMIAARALSGSAASPGEPPELAKGGGPTFTGLLSGTAAELFAAPVPTTASSA
                     AFSSRPPGAEKPGAPSTASALPAVKPSTSAASVHRPKYNYGRRTTFAELNDDDDDVFQ
                     EEEEVPADPEFSSFVYWRMDPRDLITVPAATWKSSVSATRANTKETSEKEKPGAAASS
                     TDAPKKVATTTTAAAASTEDNGHAKSAAAAAPSAPTQTGGAAFDTAISGAASPSGVAA
                     ASDAAAPRPGGGDGSCLSPSSLTVSNPGNGPPMQGATNSLDKGRARGSATGAAAATTG
                     MTSPDTLSATQKAQPRTSSNPGSNQAAAARPCDDWRGAAETNADAAGRSLPPQSLTPL
                     LPPPPPPPPPTTTTTTTTTTTTTTTTTTTTQPAAISPSTSGGGGTRGFFSAFSFGRSR
                     VVESPLSPTSQRAAQVRENAKQRALSHPDAQYYYAALQQQQQQQQQPASQLAPLPGDG
                     ASSTAKASAPAPPPK"
     gene            <358825..>359526
                     /locus_tag="LMJF_06_0840"
                     /db_xref="GeneID:5649107"
     mRNA            <358825..>359526
                     /locus_tag="LMJF_06_0840"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680803.1"
                     /db_xref="GeneID:5649107"
     CDS             358825..359526
                     /locus_tag="LMJF_06_0840"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680855.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649107"
                     /db_xref="UniProtKB/TrEMBL:Q4QIZ3"
                     /translation="MDVDSEVEPLLREMSRRLAVVRADLLPALRRLDEDTLLSHYSVD
                     EQARLYLSAAFALTLSLYSLDKITHRQVASGGGAAASVMAASPSVSSASTDTQLALKI
                     ERITEYIKKLQELVTLERQRRRAATAAASAADASTGVVAATAPGAKRSRQSASADTAS
                     IAATAAEQPAKKARSENGASVATAPARDEEDAFGDAQMFSVVSRVAGETGTLVSRLVK
                     QAKSSSSALAASKAE"
     gene            <361647..>372362
                     /locus_tag="LMJF_06_0850"
                     /db_xref="GeneID:5649108"
     mRNA            <361647..>372362
                     /locus_tag="LMJF_06_0850"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680804.1"
                     /db_xref="GeneID:5649108"
     CDS             361647..372362
                     /locus_tag="LMJF_06_0850"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680856.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649108"
                     /db_xref="UniProtKB/TrEMBL:Q4QIZ2"
                     /translation="MATTVSMESALPESVMSAPVAMSSSSSSLTRLRTCLAIGCGVGL
                     LLCAGVVLRHRLARPRPPPPCPCPMADNTIALLRDLHDGPFRFGDPTPFAVAARAEAT
                     RRIRRQQRERRRLRRRMRSQLCRARSSQQLPSWRAGATAAASAPVRNVLGAGGKQTFL
                     RTAENAPAPQDPLRQGRDTPSNEPTSGEAATAAAKEREGRAMAEVLSEREGSLLPFAN
                     SVASLCAVDYDDDDPRDNDGYDEGAYSANGTLMARSGGFRKMASSEVSFISSTTTVSS
                     SYDSDHSRSPSTSASSATASGSSYYSRISTPSLMQSTGSSVDSQGGASSLLAMTAGSV
                     ASPDGIPWVKATLDGGSVTWGGLHGSHDAPQPAQQHSQRHNHQPPPNDPAGSFSNIAQ
                     NMVCGSMSNPQSSSSPHSMPGAMAGQGGRYPAQPLWCGASSSAPSIRASGGMPWPGAN
                     TTSSWTFGGGGGGDSSGSPEVACAATFAFVPGPAPSLLASGRWGGGAEDEEPHRYTAS
                     ALMYGPPLFSTEMDVTDALAELRSSVCCSGDRQGSSCLAGGASSAINTTSSPFVNCNV
                     TGSGSGIMARINSSNNATSLHQQQLGMSLSSAHYRSQQQQSTHHHTWSHPRSQGYFSG
                     TSMSAASASVALPAYARHTVHYPGGGSGSSSVQPPKHQHHHHHSSSGYHRVSSRTSVR
                     RSANWSPAISQWLPETLSTVQPVYGYDSAPRGLGSGGSEGATGESTTSGGNGSFTHAP
                     TETPISQASSALRRFMTTGGRAHHSSVHGDINSNAHRSFRSVNSALRHLCQYGRHCCS
                     GRLRRCWRRCRRLVRRRVIVSCAAVQLWVTRILCAMRRGSSALGGGCARGWRWVIRQW
                     RESASAASGKVLAWLRRPRWSLLKTGAMAADETSCTAAASVPSSEAAKRHPGHTSTGA
                     DTAAEAAAAEAKRGGLLMTDTADEAINKIVQLLEPTPGRVPTVVVIRAPLGYDVSTDA
                     ASLWKALHLDSTSSEEGLIDIIIMEELKTGPLPPAQARAAAAATGTSSQVVSFSANPA
                     APPMPPCTGTSDGERAAATAAPAKPPTSPLQRRRPPPEPSQASAVVAAAATTAARAQA
                     QLRISFEIYPAHLFYSLIFRAAVLQEKDWALRRAAAELFGGSAEIEGSGKGLGASAGA
                     NASAGGGVSVTPGSPLSLVRALSFTFGVQAPAGDCGNNNNSMDPFSHHPHHGTAPVGG
                     SATGLENYCLSPLSPGHFCRVPVSPKLTTPSLHVGISGGGGGAAAAAAGVGVANASPG
                     MAGATVASPVTLPASAFSSVAATTSPQVVVRLSESYSFPAQPPQMVMSPPLGTQPGFK
                     APLGALPAGLRCSAYGGGGSAFSGVSPAGGASGTGVLPSSAAGRIISDNELLFYIHVL
                     RTAVGDGVNTTALPSSRASEVDDDDADANSAGAKAAGAQRGGADPGKRNPRTPSGISD
                     AALVSRDGRDAVEEDDDDSEDLTLLDLRQREIEPQVLLRYRFRVFQQGCRSRKALDAV
                     VLYTQDHVEPWYEEAKAMLQALPATESCQPLSSFSTPSLRVNGSSPALPPSDSVGRMT
                     SLSGGGEATTGVASGRPQRRSCPRPAGLPLLSLGTAALASTPELDRVDCRTTVENSGP
                     LQLPAWAMEVLIRRESMRETLVRDLKEKAFRVCAVPLPDMRVHCILPPAVPRYVTAHA
                     RGFPLSRTFAEEVLSQQRALQFILLQREQENQRAIAARIRQEQRRQQRRDRRRRERRA
                     REEASRRAQQERKQQKRSLNSQRRESGGGDSLKKCLTGTLNPATVVSRVVSMVKRASV
                     GSAGRDFGDLFVRVPPRGSDSVRKTCTSADAAYRQESRAPAPLGEPDAPRTSPPLLPP
                     PYRHGYPAASGGFYGASSPARRQSAAPEGSARAGVVLSHGESGRAGYGDAECRNTASA
                     ASPTVCSVRQHQRSTDEPSSSLQVYAVQPPRGLQGMHAPSTAAVTATSVQISPTLTEV
                     DIHFLGGSSGSVSVEVSADASLTANAAGVSAPSCAADAAPRSSERGAGGDTGGSDRGR
                     ALASAGAPSPSATSPTPYTATAPMMLLAPPQPLSGSPPPQSQTCQGDHSGGGGSSNSP
                     KPVSLASASSTRSAHWTAVHTATNANTCVTPPPPSSTASAAGSPAVHVSNSGSNGGGA
                     ANAVGHGHAQMTPASVSVALQNHFGSSPATTTTTSSSVSGANNTMPSFSSKGAAGFHS
                     GTTSMSERGFPLMPLPPPPLLLPALSSSSPPALGAGTTSSSCMLSVPDASAATLVTTR
                     DASLDVSAGDHGHHQDATVLSLPPQQLSNTSQPHRSVQNSASPAPDTSLLNAEGATHL
                     TVSGGTAPKHMSSRNNHSLQLPDDGGVPAASLTPMPLAVPNNSMYGTFDAYYGHSVVT
                     PQAVLLRQQAQVAATASVAPSSAIRALTSPRHRATANTAAPLPATVTLAAERDARKGE
                     LHNGGCAGDHDVRGPAGMLGSATSTPAAAGAAAAAAAAAGGNAQQLPPPPPHLQAPRS
                     GPRRTSSGLLPYTYSADSVSSMYGTTHYPLYQYPDDPSGAAAAVHTGVSPPTLSMPGA
                     AVMGGGSSATTTALAGSTHAGASGVHTYKSSGCSSSHVFGVSATGVTQVYTSPGNSAA
                     LLGIGGAGRPENWSSHSQSPRVPDSPVDVNASVIAPLSLPLAQDTHMNRLKQYNKLLS
                     DLLGVAGGPMRSGISFYYTYGDATALLYNASIRAPCDENILELLDRQQWEKQQELRQL
                     SRTDGGGGGAFSNSGGASDSSTSGGDKIPMHTSSGSYSMSSSATDNTGTWRVPVTLAG
                     IGASPPAAPPPAPQLQATLHGSGSAAGEDANAAGQGVCNAREDSTAARAAAAAATEDE
                     GCSYLEYGGLAGLQNTMDALESEQIEAQRARNTRFYSVFEHLHHAYHDTVLEAIGNGS
                     AQSVGLSPVTAATATGSLYTGLTGGVGTEYFFPSAASAAGAAGAERHTASPHCVGHAT
                     APGSVTPPPGLLCGGTGVADTVGLSRWRRRLWGRVCALVAWVGSLVGLARTPRADSAA
                     AGVHVAGGATDSGVGMLWRLSQLAPDGAKFGFDPAKLAEYFPGERIVTFGDEWCIASR
                     LDMHNGHFGLSPLQVWMATRYSRRFAGEVYLMDVIAAGGDPYYPAVRVLDEIVAHAVL
                     YYHNHSLRDFVEDLEAELGLVYVPQTLWGRRALGLPDDDAEVQELEGLLYTATRRRQD
                     RRRRQRAQEKYRQRRRCSDGAGGGFEKGRAATPRIPLPTTTGVSRSAAADGLRHTDGA
                     PPPPPFPPLAADAAREGTRQGGPTAGSRLDRRRFNSPQAPPISSAATQGSVGGASDAC
                     PLLPSPVSNGDDLPSVAAIAATTPANLSPPLQPYHRPRRHANARLEDEEMAEYTWIQL
                     QGKDQEEDEEVFYGATAAAAAGLGGGDINIAPHVYDAVMEREVYDERMLLRELDHLKE
                     FLVDNRNVLSSAMLTTAGSNSLEAVFGVPATVFPFLLCARESVPFVASIFESLSYHYG
                     PLTYDNFSKYAYDVYHRERPDVLRHTPRMFRMVNKSRRGCITYEELCRWMARKLSCGN
                     NVQPNGHLLATSMSLRLPLALVAESRDEWDAYRCVLKSLSDGDDEEY"
     gene            <373501..>375063
                     /gene="DHFR-TS"
                     /locus_tag="LMJF_06_0860"
                     /db_xref="GeneID:5649109"
     mRNA            <373501..>375063
                     /gene="DHFR-TS"
                     /locus_tag="LMJF_06_0860"
                     /product="dihydrofolate reductase-thymidylate synthase"
                     /transcript_id="XM_001680805.1"
                     /db_xref="GeneID:5649109"
     CDS             373501..375063
                     /gene="DHFR-TS"
                     /locus_tag="LMJF_06_0860"
                     /EC_number="1.5.1.3"
                     /EC_number="2.1.1.45"
                     /codon_start=1
                     /product="dihydrofolate reductase-thymidylate synthase"
                     /protein_id="XP_001680857.1"
                     /db_xref="GeneID:5649109"
                     /db_xref="GOA:P07382"
                     /db_xref="InterPro:IPR000398"
                     /db_xref="InterPro:IPR001796"
                     /db_xref="InterPro:IPR012262"
                     /db_xref="InterPro:IPR017925"
                     /db_xref="InterPro:IPR020940"
                     /db_xref="InterPro:IPR023451"
                     /db_xref="InterPro:IPR024072"
                     /translation="MSRAAARFKIPMPETKADFAFPSLRAFSIVVALDMQHGIGDGES
                     IPWRVPEDMTFFKNQTTLLRNKKPPTEKKRNAVVMGRKTWESVPVKFRPLKGRLNIVL
                     SSKATVEELLAPLPEGQRAAAAQDVVVVNGGLAEALRLLARPLYCSSIETAYCVGGAQ
                     VYADAMLSPCIEKLQEVYLTRIYATAPACTRFFPFPPENAATAWDLASSQGRRKSEAE
                     GLEFEICKYVPRNHEERQYLELIDRIMKTGIVKEDRTGVGTISLFGAQMRFSLRDNRL
                     PLLTTKRVFWRGVCEELLWFLRGETSAQLLADKDIHIWDGNGSREFLDSRGLTENKEM
                     DLGPVYGFQWRHFGADYKGFEANYDGEGVDQIKLIVETIKTNPNDRRLLVTAWNPCAL
                     QKMALPPCHLLAQFYVNTDTSELSCMLYQRSCDMGLGVPFNIASYALLTILIAKATGL
                     RPGELVHTLGDAHVYRNHVDALKAQLERVPHAFPTLIFKEERQYLEDYELTDMEVIDY
                     VPHPAIKMEMAV"
     gene            <376870..>378186
                     /gene="PRMT7"
                     /locus_tag="LMJF_06_0870"
                     /db_xref="GeneID:5649110"
     mRNA            <376870..>378186
                     /gene="PRMT7"
                     /locus_tag="LMJF_06_0870"
                     /product="putative arginine N-methyltransferase, type III"
                     /transcript_id="XM_001680806.1"
                     /db_xref="GeneID:5649110"
     CDS             376870..378186
                     /gene="PRMT7"
                     /locus_tag="LMJF_06_0870"
                     /codon_start=1
                     /product="putative arginine N-methyltransferase, type III"
                     /protein_id="XP_001680858.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649110"
                     /db_xref="GOA:Q4QIZ0"
                     /db_xref="InterPro:IPR025799"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4QIZ0"
                     /translation="MPPKQTSAGGAKKKTSTAATRNNRHAHPQADIGFLPPGAKYPAE
                     ASWNHHEHQQRNSASYNKQGDRDRNKDFDYRFEQHIFVPPRLRRVPAALVEAVNDFHY
                     AMMNDLPRNEFYYNMLKKHIVPGESGVLEIGAGSGLLSMMAAKLNAKWVVAVEGSSEM
                     ASLARSNIATNRLQDKVKVLNMLSTELKPCDLPEPPSILVSEIFGTLLLGESALDYIA
                     DARQRLLPKTAKILPQHGVQYAVPIECETLGQICAVSSWNGIDLSHVMALQDTTSVVF
                     TKQYGFRMSSVPFRRLADPIPLLTINFAETKRSTFKKVFPVEVPATASGTAHAWLFYW
                     ISTDGEEVMSTAPEDTLHNFSRDMQWGQALQLIDAGTNSHTPTALSMSAGEFYKFDCA
                     LSSDRVVMSLKYTGSSSAAALLKADANEAEKRRETESEQQWLPPSE"
     gene            <379674..>380924
                     /locus_tag="LMJF_06_0880"
                     /db_xref="GeneID:5649111"
     mRNA            <379674..>380924
                     /locus_tag="LMJF_06_0880"
                     /product="putative acyl-coenzyme a dehydrogenase"
                     /transcript_id="XM_001680807.1"
                     /db_xref="GeneID:5649111"
     CDS             379674..380924
                     /locus_tag="LMJF_06_0880"
                     /EC_number="1.3.99.3"
                     /codon_start=1
                     /product="putative acyl-coenzyme a dehydrogenase"
                     /protein_id="XP_001680859.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649111"
                     /db_xref="GOA:Q4QIY9"
                     /db_xref="InterPro:IPR006089"
                     /db_xref="InterPro:IPR006091"
                     /db_xref="InterPro:IPR009075"
                     /db_xref="InterPro:IPR009100"
                     /db_xref="InterPro:IPR013786"
                     /db_xref="UniProtKB/TrEMBL:Q4QIY9"
                     /translation="MRTTLKGMMTRCTAPLRNAKSADLGTFFGASMPAAQSAAGFSFG
                     LTEQQLQYQETARNFAKEKMIPVAAEYDRSMKYPHDVYKQAWELGLTNMHIPTKYGGL
                     GASVMDGLVVQEELAYACSGMATAFEGNSLAEAPLLIAGTDVQNAKYLSRMVEEPLLA
                     AYCVTEPTGGSDVAGMKTVAKKEGDKWVINGSKMWITNGGVANWYFVLARSEGGFTGF
                     IVDADTPGVSLGQKEVMLGQRCSDTRSIMFENVVVPEENVVGEVGKGFQVAMRVFDFT
                     RSAVAISAVGLARRATDEATKYARERVTMGKPIAQHQAVAFMLAEMAAGVEACRLMTY
                     RAGWETDQGRRNTYYASCAKMMASNLAEKCSTNAVQIFGGNGYNTGYPVEKLYRDCKI
                     FSIYEGTTQIQHAIIGRYVTGMRC"
     gene            <382783..>385122
                     /locus_tag="LMJF_06_0890"
                     /db_xref="GeneID:5649112"
     mRNA            <382783..>385122
                     /locus_tag="LMJF_06_0890"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680808.1"
                     /db_xref="GeneID:5649112"
     CDS             382783..385122
                     /locus_tag="LMJF_06_0890"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680860.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649112"
                     /db_xref="UniProtKB/TrEMBL:Q4QIY8"
                     /translation="MDVKLGTIISRFTFTLPSLYDDGRDDYDATVSSPDDAATEESCG
                     VAFTSGTHCDEARKTPKTTQAGSRSHVARFGAPASPTEKLDITGAYAFVSHGGAASSA
                     SLAAPSSPPPLLGRAAARGDRNNSTVAAPQHDVGDRGGGAVRYGTSLHLPDLVQLAAH
                     AWNVELHCGSTGAASHCVLRLPPFVLGSTLYRGPVVYVLASGVVRMATHGSVAATELL
                     ARRVRDALHEACKPLAVRRAAREELLLMRAVLEDSLSDMLEDEGGEEGPARHLCTAVL
                     KAEARLPSSGVSLSTALAADTAMSSQHGRRAAFGSSAAAARIGPMARDKAGHGLPTLV
                     STPSVLSARGCKIDFLQAVATPRWDEIVGLRASLFAPASAAPGSENSGGGGVAKADRD
                     AEGAPRVSVRRASVNVRGDAPMEWWRWYLGVQADDHGVGGGDGSGAARRGGGAPSAAA
                     ANSEEPFPGDCSGVPLLGSWLSGDASEGGNADARSSNKTTGFWTCAGYADASPENAAS
                     FVHFLQRRRALLAHHVASFKLRRQATQNSLQILLDWRTATPPTPPAPPAPLSAAAAPL
                     MGRPPLARALVGHPMAVAQPLPDSGTPSVPAAPTRTNISGNTWVTEASAANFFMESTF
                     IAESAAPFELESVRMPTDRMSSADPALPVSMALGDRNVANPCGSTALAPDSGCGSMSA
                     LLEPSVGHSVLRYDSSSSKDDRTAAKAAPEKRMRGVAAAQASAANRDEAASAAMEHVT
                     CLIHRTGRVQMTAASELALRQMCAMLLIPFLVATAEVEL"
     gene            <386278..>391851
                     /locus_tag="LMJF_06_0900"
                     /db_xref="GeneID:5649113"
     mRNA            <386278..>391851
                     /locus_tag="LMJF_06_0900"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680809.1"
                     /db_xref="GeneID:5649113"
     CDS             386278..391851
                     /locus_tag="LMJF_06_0900"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680861.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649113"
                     /db_xref="GOA:Q4QIY7"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:Q4QIY7"
                     /translation="MREAVPLAALSSPSSNSDASAGIAGAPLSDELAGAVVTAHERCG
                     LRAASPTAAPAGRHRSDKRCREPCVPRSLSHSTAPQRQDGGASETPSWRMSPEESRGS
                     AQKSEGGNLLELLTRVSSTRKDLDAVSTGVVAPPSPGIITSAQMKEPAACSQSLDAPL
                     GGALSVFDSPKVGDPARGGVAERATVDNLDADEYTQTPLFRVLSLPRGLIGDDAAPRT
                     RRSEVWQPAVAGSESKASIATMPAASGRALQETDSDDKDAPSLVLHGLVAPQLSPGGM
                     RSGDRGVEDCGAPAASAESTPLLPLCASVSSGGSVFVSRQLRAESPGTALTTPTDVAM
                     ATSAAARSRSVTSGTPLLDSFRIVLSPCPSSIAPAFSLVPCPTTPRVLSPVLVSAQNV
                     QQRWRDRVRARTRVGVGSGSGTSPLTSTTGALDPLGGHTLWTQPPLHPAHVAGFSGCG
                     SAVSDGDWHAASVTPLHDGAPPPSRRPGGRGDASGIAGPMPLSSSCLSAAASLSKEVP
                     GVRRGHVSSLLCGAPPCSGPGSGRDHADTLSLRLSLPRPICTSLDATPPPARQLQQHP
                     GSAHNPHASANTITQSLSPYLPAARASSPPSLPRQAEPPRSLRPDHGQRDSADSSDVP
                     PWPPTPVTTGHHHDGGFRTSPTDAASHSSNTCPLPAQPFVFSASASQRRLQPSAVTDS
                     VPSPSACAGLQPRARLYRESRHFEPLCVLGDTAPMRRLSPLQADSFADAAGRCVGDGI
                     TVLAAASLEQTDVEGLVSTCSTPPPSLTVVPPRPSLLFTSQRVSGRTSSARGEDVRLW
                     NATPASAQRMTLTSTSLERGSPLARATRASATSSWALSLCSSPTAVADVGGVGSKGGT
                     TPTCRGGRRPHGSAAPHTSPADGDGLGHFGVESKLRGLQRIRDAHPSSSTGVSSAVSA
                     CTGVVVGGSQQAAPFTLRVDSEIGGAGSNDSGSFGVYVPSALLPGPPPPLVALPAGQC
                     PPSTASLCSGDSAPPAAVTSTAATRATSSAQYTSPLQCPSPVLCTCERNTVLAAAAAT
                     NEALVEDNDVVTALEEGAAQADISAALDASLDVSATAAEGVPALLPASVPSASPATQF
                     RWAFSSLRGCRRRQEDSVMMVADLPVRVRRSTPAAPATATTAAAPSSTGAASEASARR
                     EAGAVREDTERADADSMSTQEVTATARHATNVRDEVVFACFGVFDGHCGDTVASLASQ
                     FFPEHFEHALQAYQRQLEQGQRNGRGASRGTDSSAQRRRGDLGSCSVCPEGPRAERLR
                     GHHETAPMEAVEFQRVVSAALVQALLHLDLTLYDLLHHATHGLSSQHRDAGSTASVAT
                     FFKLPTTSAPHHGGARAVVGSCTSGTLSLATGAGDAPSNGGGSAATRTPATLDELGPQ
                     GVPGEASTPPTPAAHAEDTYRLCIANLGDSRAIIGNLQTGELLLSTTDHRISAYPSEA
                     TRIQAAGGVVELGRVDGSLDVTRGLGDYRYKVSPAQWWSSTAPASATAVSASVSLTSL
                     AASAVATNAATTATLTAMGRSNSATATATSSSAPVKVVAESVPPASTPRHSDASEGCF
                     AVRGLRWQSCSSTLRSPTGDNMEGGGASTTVFLCGSNARCTDDEVKPVPAPPSQGPPP
                     SGAPESGAYAPAVQEQRWQQVPSPGPSSPISPPSPFSSWSPLASASAVTLTHNAVSNI
                     ADVYEWEVRRGEVLIMASDGVWDRMTSEDVLAFVRRELAAAQQQSKGGATRLTRSGGA
                     AVEASDGAGMEGRGLPEAGGADAGASNTTEVSLLLLREALERTPLRQPSPCDEQGCAS
                     ARSSPAAALCTPGGNGAAVCDQHDDEAADSLSSTTGSAPCFFAVQAAARRLTEHVVDN
                     LSGSDNTSVVVVAFD"
     gene            <392753..>393418
                     /locus_tag="LMJF_06_0910"
                     /db_xref="GeneID:5649114"
     mRNA            <392753..>393418
                     /locus_tag="LMJF_06_0910"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680810.1"
                     /db_xref="GeneID:5649114"
     CDS             392753..393418
                     /locus_tag="LMJF_06_0910"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680862.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649114"
                     /db_xref="GOA:Q4QIY6"
                     /db_xref="InterPro:IPR002833"
                     /db_xref="InterPro:IPR023476"
                     /db_xref="UniProtKB/TrEMBL:Q4QIY6"
                     /translation="MDYEAAVARLSSPTFFAILHAALGGAGEHEAATSAEVVRKPFWA
                     GFSVGFALTLVATLAVMKGFVASLFRRPLAKCRQLCSLAATGEPVKMVLVVRKDLKMS
                     NGKIAAQCAHAAVAIVEEILAFKSTTTKSPRSGLNPVSALWVQWYDAWRASGCSKVAL
                     QCPDEAAMMALAKHARQVNLPHYVIRDAGRTQVAPGSKTVVAVGPGPKSLVDEVTGQL
                     KLL"
     gene            <394120..>395469
                     /locus_tag="LMJF_06_0920"
                     /db_xref="GeneID:5649115"
     mRNA            <394120..>395469
                     /locus_tag="LMJF_06_0920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680811.1"
                     /db_xref="GeneID:5649115"
     CDS             394120..395469
                     /locus_tag="LMJF_06_0920"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680863.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649115"
                     /db_xref="UniProtKB/TrEMBL:Q4QIY5"
                     /translation="MTQKLLLAEGLDLLRQCEQHEYDVDRTKLRISSHNRYCSELGRL
                     LQSYDTVYHQYVRGIQILNYVRHTALADTNPVNAQYAKNLSEFCAAKITAYMTRCSNI
                     IRKTDGILVPIEQIDLITKEGYVPEDTIYLQDGITYPLSRKEKVIAKEFALTAGTYVL
                     TLKNRDDYTLAAPEVDVALVVLPQRGSGFEPSRVEMKLPCQCGWRKVVGVADVSTVQL
                     EIRYSGIRDAHVDVIFQKWCAIEDIGRSGGVVNGPGPALSPSAFDGGDYNSVCKSPPN
                     RGGSGGAAGGFSHHSCTPAHVSASDAGAPAHQQPQQWVNSLPQLPDDELATLANYNVP
                     SASLPTVPDRPADGSGAASSAAPSSAEDPWTALANLNVPYAPTTRNAPSAASVMQVPE
                     PVEVNPAGMTCRQRLDKIHQLMDAWPSIGVVACALPAEPQGFMQGVQALPFPRELSA"
     gene            <397594..>399786
                     /locus_tag="LMJF_06_0930"
                     /db_xref="GeneID:5649116"
     mRNA            <397594..>399786
                     /locus_tag="LMJF_06_0930"
                     /product="2,4-dienoyl-coa reductase-like protein"
                     /transcript_id="XM_001680812.1"
                     /db_xref="GeneID:5649116"
     CDS             397594..399786
                     /locus_tag="LMJF_06_0930"
                     /codon_start=1
                     /product="2,4-dienoyl-coa reductase-like protein"
                     /protein_id="XP_001680864.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649116"
                     /db_xref="GOA:Q4QIY4"
                     /db_xref="InterPro:IPR001155"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q4QIY4"
                     /translation="MAASFTSSTGSSAVVPAVASRLFTPIRIGRHIQLPNRFYMQPIY
                     LNMESELKCYGDEHMAAMAAFFGERAHYGAKLIVVGGIGTSRLGRWKKDALMLGTFDA
                     AKALSRVTQAVHSEGGYVLAQAFHAGRAARKRYFVSATSTPSPVQPIRNTHPYRIPGS
                     LIDYVVSEYERFARLAEEAGFDGVEIPVSEGSLLHNFLSSAVNTRQDAFGGSLERRLE
                     ITVRVLETIKNSLANPDGFVVALRLCLHDLKVGGTPMAETLRVAEVLAKSGRIDLLNT
                     SVGMHDSPVQTLSAYVPHGTFSRSCQLLRERLTEVGAADVPVVASHRLHTIELSEKLL
                     EKGVCDMVGVARPLLADPQYITNAAAGRSEESIPCIGCNHCVNRLYKHQRITCALNPI
                     SGYELQRGWRPAKYRKSVAVVGAGAAGVTCALTLWRRGHDVTLFEKESVIGGQLNLAK
                     RVPGKENYQAVLEYWTRQLRQSSINVRLNTEFTREEVTRNHQFFHAVVMTHGSVPRRI
                     SSHVIAGASECPLIVPFSRILDGSVTAGRRVVIVGNGAISHDVASFLLHDPRVSREVS
                     LYLDEWGVNLEDGSLLGSPELRMPRNNRVVTIFNKADKDADLSRGWGWTQKLWIQQHA
                     STVVKHGMLENFDAAGVHISTLPPDSRKFFVPCDTIVWCIGMLPNITYGTWIYEWMKD
                     GAKVRGEMIGDFSIYTAGSCRDSYTGDGHGEEDLLQCVHEGYEIGYKI"
     gene            <401504..>403285
                     /locus_tag="LMJF_06_0940"
                     /db_xref="GeneID:5649117"
     mRNA            <401504..>403285
                     /locus_tag="LMJF_06_0940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680813.1"
                     /db_xref="GeneID:5649117"
     CDS             401504..403285
                     /locus_tag="LMJF_06_0940"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680865.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649117"
                     /db_xref="InterPro:IPR006571"
                     /db_xref="UniProtKB/TrEMBL:Q4QIY3"
                     /translation="MYDAYRNCFQYRPDVQRKLVKAVQRERHLRHLAAPHAGDAATSS
                     AEVSAAVLRKEVMEMDSTCCCCALDAAHLFATPEDMPTPPLPLSRCELHEVLLALSPR
                     WQSYPWRLCFDTASDGFSLSSLYRCMEAVDAKQSQVKTVAFGLFFVHSREDAALTNAQ
                     TASPVDSLSASSTSPSYALWPPTAGAPHSFCEAHHSSSRRYGAAHGALQHSVLGCFTP
                     EVPCLGRHAANIYFGSTDTFVFRLDQLSCAPSRGAWMATDVEKKQSSQRAQQQEQQQQ
                     HGKAAEPHTCAPATSTRAVGAAPAYGYAKLALADDDIAGVPVPMPSRVTIEHAGDSKH
                     AVDKSMVHSSPLLPPSEVPPLLNPSPLRAAVVSSSNAAAMSSVHGAPDIVVPSPRGRW
                     HRLLRPVQPARVVPHAPLLEKFTWCGNMHNRKFIVCNPHFFAIGGGQSGAALYVDEAL
                     QYGTSSTWCETFNAPCLFGPRMGSADVSSVPSLVQSYMSGNDSPSGGPARPTSGLPHV
                     EFAISRVVWFSVTEDKRTLRMMSAADASLPSAEAHRCGCGRFSCASASHTTTLDPMST
                     EKSTAPSPPPASTFLHQCDLLPFAAPM"
     gene            <404101..>406113
                     /locus_tag="LMJF_06_0950"
                     /db_xref="GeneID:5649118"
     mRNA            <404101..>406113
                     /locus_tag="LMJF_06_0950"
                     /product="putative glucosamine-fructose-6-phosphate
                     aminotransferase"
                     /transcript_id="XM_001680814.1"
                     /db_xref="GeneID:5649118"
     CDS             404101..406113
                     /locus_tag="LMJF_06_0950"
                     /EC_number="2.6.1.16"
                     /codon_start=1
                     /product="putative glucosamine-fructose-6-phosphate
                     aminotransferase"
                     /protein_id="XP_001680866.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649118"
                     /db_xref="GOA:Q4QIY2"
                     /db_xref="InterPro:IPR001347"
                     /db_xref="InterPro:IPR005855"
                     /db_xref="InterPro:IPR017932"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q4QIY2"
                     /translation="MCGILGYANSNVPRTVEQILSILLCCIQKVEYRGYDSAGLAIDA
                     NIGSDKEDGTAASAPTLRPCVVRSVGNVNQLREKVFSEAVAATLPPMDATTSHHVGIV
                     HTRWATHGGVCDRNCHPQQSNNGEFTIVHNGIVTNYSALKELLKGEGYVFYSDTDTEV
                     ISVLSEYLYTRKGIHNFADLLLEVSRMVEGSYALLVKSVYFPGQVAASRQGSPLMLGI
                     RRTDDRGCVMQLQTHDLTDLSGPLEVFFSSDSNAFAEYTRDVVYLEDSDIVHYCDGAL
                     RFYNAAERQRSIIKREVQHLQTKLENLSKGNYAHFMLKEIYEQAESVISTMHGRVDFS
                     SGTVQLSGFTQQNIRVILTSRRILFIACGSSLNSCIAVRPLFEELVPLPISVENASDF
                     IDRRPQVQRNDTCFFISQSGETADTLMALKLCSEAGAMCVGITNVVESSISRLTHCGI
                     HLKAGVEVGVASTKAYTSQVIVMTLVALLLSSDSVRLQERRNEILRGLSEVSARIAEV
                     LRITHDPVKALAARLKESRSIIVLGRGYDLATAMEAALKVKELSYVHTEGIHSGELKH
                     GPLALIDETVPVLAMCTSDKHFDLSKAAVQQVNARNGAVVVFATEVDAELKAAASEIV
                     LVPKTVDCLQCVVNVIPFQLLAYYMALLHGNNVDCPRNLAKSVTVQ"
     gene            <407717..>408388
                     /gene="MOB1"
                     /locus_tag="LMJF_06_0960"
                     /db_xref="GeneID:5649119"
     mRNA            <407717..>408388
                     /gene="MOB1"
                     /locus_tag="LMJF_06_0960"
                     /product="putative cell cycle associated protein MOB1"
                     /transcript_id="XM_001680815.1"
                     /db_xref="GeneID:5649119"
     CDS             407717..408388
                     /gene="MOB1"
                     /locus_tag="LMJF_06_0960"
                     /codon_start=1
                     /product="putative cell cycle associated protein MOB1"
                     /protein_id="XP_001680867.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649119"
                     /db_xref="InterPro:IPR005301"
                     /db_xref="UniProtKB/TrEMBL:Q4QIY1"
                     /translation="MKLFGSSLFDSDKTYRPKKKHKEGTERYRLHNFARSLVKSGDLR
                     QAVQLPPGVDSNNWLSVHTVDFYNITNVIYGSLTDYCSDMSCPVMSSGPRYEYLWRNP
                     PEYPKATRVSAPQYLDLLMKWIERQINDERIFPSEDYNPYPADFKSYVKNIFRRMFRV
                     YAHIYYSHFTKIAELQEEAHMNTAFKHFMYFAWEFDLIPREELTPLQELLKNLMGDYA
                     KERLE"
     gene            <409596..>414569
                     /locus_tag="LMJF_06_0970"
                     /db_xref="GeneID:5649120"
     mRNA            <409596..>414569
                     /locus_tag="LMJF_06_0970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680816.1"
                     /db_xref="GeneID:5649120"
     CDS             409596..414569
                     /locus_tag="LMJF_06_0970"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680868.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649120"
                     /db_xref="InterPro:IPR024975"
                     /db_xref="UniProtKB/TrEMBL:Q4QIY0"
                     /translation="MQRADNGAQLQMLLRVNEYVQEQRQTYMTLSLGEQRRRGPLLLE
                     DLLTMVMHNLLLEPENSEGDDDGGVQRPRARAGMASGARTMEVLASSTNSLPFALRDV
                     PALANVAALQLRLTSTVMAAISTRAIVTVHELEEWVCAQEGVEHFAELGLGVGLQVLP
                     VVQEYFQLRANSVVFPVRARDVIAFLLSDTTARDMLLYGGGDTRDLLYRFAAFYERHV
                     LRNASPSSAPAAVRGQGRLLNVRQLGIHVQDYTALLAALTQELASAHQLEQQQYQRWI
                     ESCATAETEVTQTASTRDSAGVAVAKDSAAGEDALVRAASFEVAARRERNRALYERVL
                     HSFDSACAHAELVEGMRRTHEKVLCASLGSDADAVPRVRPAGARAMQFAVTLTEAEAR
                     TYSLPLSLWRTAPLDDEACSLLAGGNGWGGGVELRFHVGALTEPEVSRAAQGPAQGSS
                     ASTTPRAAPLDSQWTASAAKGEKQAPGQRISNDNISGVLPPPSSAMRRRRGTVVSDIP
                     SAISTGAPIAAAGAAATTETWRVTSPDAAPALVGAASTVPAVTAASAIPLLSSLLAPA
                     GSLGLAVTSSVTTVDAPPSVSPRSADTAVERAPSVEGKPSAADVVGSSVETPTEPKTA
                     LEKLGDLLRQHRRWSAATKRRDAPASEQPTVLSTGDTWLDLAVSAFETFAVGDVVPVK
                     LLYEAWAMCADCRGPAQPPPSPHSAEAHGATSGHFTHRRCIPLFHPFVTSVDRSSAGS
                     LSPLALLRRQLGAGDTGGAPPAAASTPDAEDGATGERKEIVHMATPVEVCWLSWWGPA
                     PPDGRPSREAAILTCACLERHYPSYLQDVFCGQLRVRARPTVAAWCTAAVACARRLCP
                     LSALTPSFADAYVASFACCVDADVAAWVAEVHQEGTPTTAPTPGSDSVELPFLQRQQR
                     TAQVALRRVLANLQESLAGASPWRVGLFPCNHAWCCGLDGLLYATPQWCGYGGVLLTA
                     SSPSLPAHTSVAAYLSQGGSANGAGAAPPLRVLSFRAHEPSWAVCSVLHYLGIRPLSQ
                     VAETRVSFHTTVATDASGVLHDKIAAIVPYVQAFCRASLPLWYGVVYVSMRERLRRLR
                     VVLTASASPVQTLRLHMNGHVYAHERQLRLGYVAAHNVVYGAAEATSVPMLAEVLLPL
                     FMPVGMSAEADVRQLRDVILRLLGALSSLDSSVEWRDGADTSPQQQQWRREQIEHVLR
                     PVAMHYGLTPFTGVSSAALPPASGVSAGGVGSAHDSDAHDAQAEAPFTLSSRAFIRYM
                     PNYPPGTDAMRQPRGSQQAHTGHRGGEASGTQSLTQASAQELVGHARPFSSRTASIAR
                     AGGGLMQRLGANGQLSVTLSLGGSTAVVTSTGAWSNFPMELDLDAVVAASVVVGAMDG
                     SGRGGNATAAACDHQGDGDDDSSSTPGSDGDVGSSAAVGGGEEEEQDSFLTFQYHRRS
                     GTASSALRGSGGGAESRKRLRAGNSHAAGHVRGRLRDDPAGRDVRAAGMWLRPPAASA
                     MTGTGGDTPEYAVAAERYVYELLREEYAKQVYQDGVRVIWMNESCEAGSPFDILVIKP
                     RRLSSISSGNAKVSCSSSVDNSRWDVVQYVEVKSTCTANREDFEMSMSELLFAARFGA
                     AYCVYRVFGASTDALHRMRHRVYTDIVQLWHRARLTITSDIRVTPST"
     gene            <415729..>418824
                     /locus_tag="LMJF_06_0980"
                     /db_xref="GeneID:5649121"
     mRNA            <415729..>418824
                     /locus_tag="LMJF_06_0980"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680817.1"
                     /db_xref="GeneID:5649121"
     CDS             415729..418824
                     /locus_tag="LMJF_06_0980"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680869.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649121"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="UniProtKB/TrEMBL:Q4QIX9"
                     /translation="MGCKNSSHTMSGSSSVAGTAPGAIEDAGSSSPVFGSGVHVGRSG
                     NADLSGRDLDVLGPQMVHMINEDELHRTATSLRLSNNRLYALAKELPLLSNLRELDID
                     HNRFQRFPEVLVRLPRLWRINASFNPIDSVRGFDVLPRLLSLRSLTVRDCSLKEIPMA
                     VIQCEVLEELDVGNNPEIKITGVALHRLKRLQKLGVANCNLGGRTLPNAIKRMRLTSL
                     DISGNAFTFADPNFFGRSMPHSLTELHLVGMNLTAPPAVVALLKKLNFLDLAENPIET
                     LDVLAGRVVKRLHHVASNGTVATAGTNGFSDAPAEEEDDDFEGDETATHASGGVASAA
                     TSHVSLSKASREGIVSHVTQPIPLKRLSLRACNFRMVPKYFHKLDQLEELDLSDNANL
                     DDPNMTLFSLQSLVTLNIVGCPFAEDPSQSRNEWFDIGKLRNLRSIQWEVWKSDHNMS
                     PYRTKIPIELCALRLRTLNEVQLRRNLFTGDIIETVINLLSDGYFKVDLSVDEMILHS
                     HVAAVKAFTEGERFFFPKTITEVPNLECGIDPASLGQVHLKIALSRYIFFLAIQAANY
                     DAVIIPPLDVMIIHYAQLTVHPLQYRTDCEAVCGRILDCNYRTFFAEQKKHQAEAKSV
                     VDASRRIWNLMVRSAQRDLAWLRYDFWDKRLRASAADGAAGAAFSGEHTAIPKTLPLL
                     VGKTAAEVTQDWQAMVFIDSAHDLAGVLDQAITSHFSEKGVEDFGASIRQFYEVNRCF
                     LCHEDSLWKADLDWNRYVKFLTLYAYRCAVLEVDTTYVVEPVADEEGNLVAPGRTTSM
                     LGKHYDSMHNFSFDDSGKYLPKPQDGGPFLPPVNSVCEHQAESSGVPQTRTTSGIVRP
                     SLSTLQKASKSNKRLTMVRRLEGNPVPTIGIIFMLHAHRTAHLKYYQSMSLFAIENVD
                     VVWGAAGYSILKQTQGAWMALYDEAYVSENKVMPFGYLVQNGVLMPTSDPCNAANTLA
                     GDGSATAKKWGGTSQQKHRYAYEADVVPRRSCIKARTRSADNSGRRVTFCSGDTEFGV
                     F"
     gene            <421157..>424795
                     /locus_tag="LMJF_06_0990"
                     /db_xref="GeneID:5649122"
     mRNA            <421157..>424795
                     /locus_tag="LMJF_06_0990"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680818.1"
                     /db_xref="GeneID:5649122"
     CDS             421157..424795
                     /locus_tag="LMJF_06_0990"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680870.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649122"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q4QIX8"
                     /translation="MRSSASATPSRRPRRPNAGASVSPSRTSLSRGASPAKSAAVLCE
                     RGGSVSPSTKKRVRPGIADDAATVHNGSVSASPNAGHATGSTASPSVTGVSLSHFAQD
                     GRRLEPNICETTFSFYGQYEHITVAHRTATLWCANTATGAMDLYSCVTGQFVTSLLPL
                     HEEVVARRAELSELPLNVPSAKGTNGSAKGATGGLLGSHWGSTALTPRSRGLVPTGGG
                     RRLSTLSSTSATAHHHHTASNSLSASSLASAWARVPEGDLRATALCATATHMWVGYTN
                     GTIAVYDALLLKLVTFGRLHTDRIVSIVALFNGQTVSASTDGLLILWDTEQGGFEAVT
                     RVTVLLDAVREGAGALCAMTSIPPATRVCCGFESGVVYNVRVASRPQEQTAPQSVRGH
                     HGRVNDMAVVRDVLFTAAEDNTVCAWYCGGAAGAQRLDGGDGGGSVPSSLFLRAAHDA
                     SRARLGPHKGGSVRMLKRIPVRPCVRCLLAEEQTRSVWVAYADGLVERWSANPDDDYG
                     VEEVVENALAASLSAGNGGVRALLSLSVTQTMQWLALSSNGVNKVWYGHRNTLEIDLA
                     HSISTLAQVVEQDTVDAAAWRERVNLLKQKELERKEKYVCILEQLSEQRVLLRHYDMW
                     KRSVFFFGTRRRRVAAIADTLEKKSRLQLVRRFFNKWGSFYDAQQRHMRVYVLSMALS
                     RATAQQQLQAYFLRWQSYLVHRQVRRNAVKSAQVLARMVDAAIMGSCFHRWRAAAAAT
                     TRRQRGRISAEQLALLAHKAQRQVLQRVLRQWVAHHDTQNELPRQVLTAAAEGAPRDG
                     LPVPETSALSRFAGHYARLQQQRRGRHVFQVWRRWTAWRARQASLAAVAALREQQLLH
                     EVRQRFFFRWCQRVHARRVDENTQQLRMLEVELRRAEAEHGDIFEKLQLQRQLDLVLE
                     RQAAEEARLAQVKEQLASAEQTCSDLRARQLQRTAVGSNGAAHAGSGGSSVKASSGAA
                     TGASAAVELADASRRSSVARFAGTDTDLSLSTTSEGLPLAQQQQQQQVVLSAMSRGHM
                     ASNAAWYRSMVDQQRLSPIVLSHMSTEEAVHHVMGQLKGNVVNLYTDLALFRQVKDRR
                     RAGISAVGILLEAFGEVKLLIVTTVRGTSANAASAAAARMGGKATRWPLSMEALDCIP
                     AHHCATVLSAIKTLVVAYDLLQPEDMISVQTTCEEVVVNADWIFLIARACYLRRKPVP
                     PANNRQLI"
     gene            <425736..>426203
                     /locus_tag="LMJF_06_0995"
                     /db_xref="GeneID:5649123"
     mRNA            <425736..>426203
                     /locus_tag="LMJF_06_0995"
                     /product="hypothetical protein"
                     /transcript_id="XM_001680819.1"
                     /db_xref="GeneID:5649123"
     CDS             425736..426203
                     /locus_tag="LMJF_06_0995"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001680871.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.0995"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.0995"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649123"
                     /db_xref="UniProtKB/TrEMBL:Q4QIX7"
                     /translation="MHYTTVLAVAAPLAAIALCVCAGIKDGAAHSLFLAAATFCSGFV
                     MWLRSRYIAALYLNELQARRQHFTDSLRRRFGDGGTAAAVREASAQHDDARAAEAYAA
                     PPPMSRPPRTVARVSPVLPAFLACCLFLISILSTISAALHAIAYVRSLDTEQP"
     gene            <426774..>428279
                     /locus_tag="LMJF_06_1000"
                     /db_xref="GeneID:5649124"
     mRNA            <426774..>428279
                     /locus_tag="LMJF_06_1000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680820.1"
                     /db_xref="GeneID:5649124"
     CDS             426774..428279
                     /locus_tag="LMJF_06_1000"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680872.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.1000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.1000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649124"
                     /db_xref="GOA:Q4QIX6"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR002893"
                     /db_xref="UniProtKB/TrEMBL:Q4QIX6"
                     /translation="MPRLRAARAAWYAGQELDTYLRQRAWHWTVKRNYALAADYCIRL
                     LNRHPQDTLGLVLGEVAGRHASQDIFVSKCAQALQDSCQRKGVASVTELVQGTLVTRA
                     TTPPSSSTTATASLTQLPSANAVLALQADEAKREADARDTGAHTGGLKGESLYVHNSE
                     PPDSINQAVRRSCLRSATPPLAELLEPVQSTYGRGLYATRHIQPRSSILCESPLLVQR
                     FDGTKCAHCLAPLSARRVSSITDTGASDPLASGVACPHCEHETYCSEDCRDAAWEQYH
                     ICSCASRNPELAQWTEGMRELLHRGGAGAASVASDQAGVVNSGSEARAALSCLTVAKI
                     CAMATVQQVHPLSLPGISCLRGTADYEPATALSEIGALAVALSAALRQPNLYMEEVLS
                     LFALLRMNEFFTGSGVVLYSVLSMLNHSCDPNCALVSAANSPVVGAHGSRRHKSAMEK
                     YLVALRPIRDGEQLFIDYNAALTTKLDYEERKALCAQRHFECYCSRCIRRE"
     gene            <429214..>431523
                     /locus_tag="LMJF_06_1010"
                     /db_xref="GeneID:5649125"
     mRNA            <429214..>431523
                     /locus_tag="LMJF_06_1010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680821.1"
                     /db_xref="GeneID:5649125"
     CDS             429214..431523
                     /locus_tag="LMJF_06_1010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680873.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.1010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.1010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649125"
                     /db_xref="UniProtKB/TrEMBL:Q4QIX5"
                     /translation="MLRYTPMWRCSAAAMQTLSAWLTDLAEESMAVPSATAADLQTRQ
                     NDGQGPTRKTPAQLWRELEDAATHANALRETDTLFSILQCLLLKQQYPTDVHAWARLA
                     KQLLPYSGIEQKSVLHYPGRSDASYRRDGHPGGSSLANLSSSSDPVLTDADGGFGDDG
                     ASRRGGGGARRGGEYAVPYSLYPSRETLLLSGGVVPLSARVPCGDGRAISLFVRGFTR
                     FVEGQLGVQPHTQLTSELLQVVKDVSGAVTEALAVNADSLQLELLLPALLDYMELLHV
                     LDLRTATVAACGPLATEEERRDAAGATVRDDEPNGHGRSSPPRPSKPTRFLQNMVHDL
                     AQNAMAGAARGARVVLYYLNECFAAVVEAYQADAAATFTDKMYWAQQRYLLTLTRACM
                     WAISQHYTSATTAALSAASGSVASSPSPHVQGLRPTVATADLVATAPMNAHIQALYDH
                     IDVLFQRNTHADNPLHLTDEEVAQLKEIHTAALLRALRIEEAAPDAYLRRALEVVDRV
                     PASMAIEGELIAGKVRLLELDSDTVDEEGRAAIYDDLLTSLRSLVEMRPRFLRHNGAH
                     HAAGGGAAAAASASTPADGGGGGGEEDEGDGEQLRLDAATQAILQRAHFDVITAFCAA
                     HKEEWSNEAYNILVAHKYHGVKITNDLIRPVLEVFSRRGDCRVFSLVDLCVLYSNEPI
                     DMHTIALLFRTCAAAGDHHRARTFLQLVNEIIHGFLVKCPASVKESLQELKLLDPPPR
                     HLFVSTEDDLVQSALGEQQRTVRRLPTGS"
     gene            <432196..>432888
                     /locus_tag="LMJF_06_1020"
                     /db_xref="GeneID:5649126"
     mRNA            <432196..>432888
                     /locus_tag="LMJF_06_1020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680822.1"
                     /db_xref="GeneID:5649126"
     CDS             432196..432888
                     /locus_tag="LMJF_06_1020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680874.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.1020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.1020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649126"
                     /db_xref="GOA:Q4QIX4"
                     /db_xref="InterPro:IPR000467"
                     /db_xref="UniProtKB/TrEMBL:Q4QIX4"
                     /translation="MSTDPNGTRWSNSEKNFGKALLKKSGWTEGTGLGKEQDGVVNHI
                     KVTRKDGVMGLGYQAGVQETWTTQSLGFADVLTRIKASTTAAISDSDDDGEASPSSSP
                     TTNGEAKKIGMSRHYKMYARRNALKTELIHGGGSAETEVKRLEILGSAAMKRRRDADS
                     GEDNDGAGQNCSQHTSSASTLKSPLLLRLMARSTKDEPKPTAGDMTPEQLITITKPHP
                     RPPKCTDTPFLA"
     gene            <434209..>436869
                     /locus_tag="LMJF_06_1030"
                     /db_xref="GeneID:5649127"
     mRNA            <434209..>436869
                     /locus_tag="LMJF_06_1030"
                     /product="putative kinesin"
                     /transcript_id="XM_001680823.1"
                     /db_xref="GeneID:5649127"
     CDS             434209..436869
                     /locus_tag="LMJF_06_1030"
                     /EC_number="3.6.4.4"
                     /codon_start=1
                     /product="putative kinesin"
                     /protein_id="XP_001680875.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.1030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.1030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649127"
                     /db_xref="GOA:Q4QIX3"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q4QIX3"
                     /translation="MSERVHVVVRIRPFIASDPPDAELNTLVLDPTHVSVGNGRVFKA
                     DRVYMMEDATEVIHAESVAPLITRFLRGFNASVLAYGQTGTGKTFTVQSLLPLLLTDI
                     MADKGLRSGAAGAPNAETSTSLMAKVPLLYLQYVEVYGEVIRDLLEGPAAAASRCDGE
                     EPSKIRLVTTTAPGARAASPSPERAGRQLFPIDERDAAVSPTAGCALVGATIVPIFTL
                     AQAAELIARGDTRRATGSTNVHAHSSRSHAILTLFHARYACRLDVVDLAGSEREKKTG
                     NVGVRFQESIAINTGLLALGNVMRALSRIHRAANGKEAGRSGGAGHQRSQHVPYRSSR
                     LTRLLQDTLGGNSATVLIACVAPDTYNRDETLRTLQYCSLALRILNEPLQQYERLRRA
                     QSPLCRRGSPSAAAAVSPLSLREGTHTAAAATRARRDSDAADEPKVTQLKVLELQSAY
                     ASLQQQYDEQAEVIASMCASHATTKERLALCERELRKDEGIFTQQIRAMQELVCENRK
                     LRRRLAKACAPTTTAAATAGRDKAAMAHDPLFRGGDDLPQPACTEMDSHHGDKNLTDA
                     VRHLLLAGDRDAAGRMGVSLQLAPSHSQGHRQQHSAAVAAAAATRPPLSAHSPHRPQD
                     VRDGVTDRTQYAPLEELPLAVVHQAGVRVDDGRGGAETPTYPAAEGRTEASHALDGMT
                     SGGAAAPTPAEPAQSFIRYILGLHGIDPEAEQAGGVDGGDGRGRAGAGAVAAAATSLQ
                     SSIRKSAATSVGGVALEPAEVSETTAGSSRDGHTRREGAPSPLGDALSRRADCFTASL
                     PPHTMQALSEGVHSSWERQVDRRGGGTDAAQQDGSTVLLLATEVLRCRGTNAELRNQV
                     QVLQAELDGKQREAALLRLELQEMKELFTT"
     gene            <437340..>439514
                     /locus_tag="LMJF_06_1040"
                     /db_xref="GeneID:5649128"
     mRNA            <437340..>439514
                     /locus_tag="LMJF_06_1040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680824.1"
                     /db_xref="GeneID:5649128"
     CDS             437340..439514
                     /locus_tag="LMJF_06_1040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680876.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.1040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.1040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649128"
                     /db_xref="GOA:Q4QIX2"
                     /db_xref="InterPro:IPR029652"
                     /db_xref="UniProtKB/TrEMBL:Q4QIX2"
                     /translation="MKAPAPPFHAPRPPLTARSDPNSIAVSRGGTAATAAMPETQVRR
                     QLAEVEMRLRDMEEEERRTRVLQEQEIANLERDNVKLRERLEAIRMEECMSLAEAHTL
                     QDRASHPLTGDAPAAHAESKLLGSTTLRYRSAKAEVQRRRRECAQAERQLAEARARLA
                     DVRKARKGLKGRSLAAEMSASMRVAAADNYRALIHERLRGLEEQVAHEQKRFNSIATE
                     AKQARTEIDTLLVSQTSNEKMYRYWYDALLVKRREMAFLMEVCNLLCEERQQVVAELT
                     EAQARMAEQSHQYEAAFDELTGVQGENAKAQTANREQLEELRRLIAQTRAEREALEEE
                     NRCAKTAMEHQRRHTVGLRLKDEANTRTTSAASRGSRALDEERGIVAAGEAERVGEDG
                     GAELQTPESESSIDGSQQQIRMFDDYYRKLSAIVQSDAIEDVAGFMDAAADERYKVFD
                     EMNAIERDMVALETEKAALMAQLSGVGGVRPATVPKSVQQPFTPTALATLAGADTLEA
                     LTAVTTAVAARKSGGTGTLGASTDGTQERCDRMADLLDDLGATRDLVFEQQEEQETSA
                     AVLEQVVAQVNQMFHGLGCSVDELRALTGMEGVQQTTLLQCLAMVEQRASEYLIAYSR
                     RQRKRSSQVVGAGVAPSPRNAARTILRRSDLQPKAHTHAVEATVMQHALPRSTDATTG
                     TPTVAALAIGGSFTLDDLVGERPLSTAELKEVVEARRILTQP"
     gene            <440536..>440937
                     /gene="PDI-1"
                     /locus_tag="LMJF_06_1050"
                     /db_xref="GeneID:5649129"
     mRNA            <440536..>440937
                     /gene="PDI-1"
                     /locus_tag="LMJF_06_1050"
                     /product="protein disulfide isomerase"
                     /transcript_id="XM_001680825.1"
                     /db_xref="GeneID:5649129"
     CDS             440536..440937
                     /gene="PDI-1"
                     /locus_tag="LMJF_06_1050"
                     /EC_number="5.3.4.1"
                     /codon_start=1
                     /product="protein disulfide isomerase"
                     /protein_id="XP_001680877.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.1050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.1050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649129"
                     /db_xref="GOA:Q4QIX1"
                     /db_xref="InterPro:IPR005788"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR017937"
                     /db_xref="UniProtKB/TrEMBL:Q4QIX1"
                     /translation="MLLVRKTLAVLLAVALLVVCAKAEIVELNPANFHKVVKDPSKNV
                     FVMFYAPWCGHCNNMKPMWLELADKYPTAEDVIIARIDASEYRGIAKEFDIRGFPTLK
                     FFSKRDKSGEIEYDGPRELSAFVAYVATNKQ"
     gene            <443184..>444152
                     /locus_tag="LMJF_06_1060"
                     /db_xref="GeneID:5649130"
     mRNA            <443184..>444152
                     /locus_tag="LMJF_06_1060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680826.1"
                     /db_xref="GeneID:5649130"
     CDS             443184..444152
                     /locus_tag="LMJF_06_1060"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680878.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.1060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.1060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649130"
                     /db_xref="GOA:Q4QIX0"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="InterPro:IPR027450"
                     /db_xref="UniProtKB/TrEMBL:Q4QIX0"
                     /translation="MTTAGPQDPTAGPQDPTARDGRGQSSLLRQRVAAGASFKNVALS
                     HAADILRSESARVDAQLIDDFSSILRGNVVYIHNFLCDEKDMRLYNSLKQELVAATGA
                     KMLGSGGLIDWSKHQVFDNPSDISQTFNEIIDMLAEYFDVDVYATRLNYYRDGTQWKP
                     QHHDSHAYGGRALREDFTVGLSLGATRSLLFVHEASQRDFNFPQLNGDCFAFTGEVNS
                     LFTHGVPRVHTPTGDRFSIIAWGRRRNLNERNGGVPSSAAAQVKGYRINTMEDAVEVA
                     KQLVAAEPGAAAAKKAMPPPCASGDASSGGVATATRPAKRHKRRLQ"
     gene            <445591..>446436
                     /locus_tag="LMJF_06_1070"
                     /db_xref="GeneID:5649131"
     mRNA            <445591..>446436
                     /locus_tag="LMJF_06_1070"
                     /product="putative deoxyribose-phosphate aldolase"
                     /transcript_id="XM_001680827.1"
                     /db_xref="GeneID:5649131"
     CDS             445591..446436
                     /locus_tag="LMJF_06_1070"
                     /EC_number="4.1.2.4"
                     /codon_start=1
                     /product="putative deoxyribose-phosphate aldolase"
                     /protein_id="XP_001680879.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.1070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.1070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649131"
                     /db_xref="GOA:Q4QIW9"
                     /db_xref="InterPro:IPR002915"
                     /db_xref="InterPro:IPR011343"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR028581"
                     /db_xref="UniProtKB/TrEMBL:Q4QIW9"
                     /translation="MCDHQSTAKVDLEMLLRPGRKGRLNDKILERVRFLAAELGLPEL
                     EEKFTHLKERDGAWRTGSASDNVDLSAYIDHTLLKADASHAAVSQLCEEAKTHHFKAI
                     CVNGCHVARCAQLLAGSEVRLGCTCGFPLGQMTPSMKVAEAAEGISSGAHEVDMVINV
                     GALKSKCYLDVFKDIKGVCDVCASSAVVSKVILETCLLSEEEIMDVCIMSVAAGATFV
                     KTSTGFSTKGATPEAVDIMLAVVGNAASVKVSGGVRDRATAMQYVQAGVKRIGTSSGI
                     AIVSP"
     gene            <448194..>448868
                     /locus_tag="LMJF_06_1080"
                     /db_xref="GeneID:5649132"
     mRNA            <448194..>448868
                     /locus_tag="LMJF_06_1080"
                     /product="hypothetical protein"
                     /transcript_id="XM_001680828.1"
                     /db_xref="GeneID:5649132"
     CDS             448194..448868
                     /locus_tag="LMJF_06_1080"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001680880.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.1080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.1080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649132"
                     /db_xref="GOA:Q4QIW8"
                     /db_xref="InterPro:IPR004026"
                     /db_xref="InterPro:IPR016071"
                     /db_xref="UniProtKB/TrEMBL:Q4QIW8"
                     /translation="MGNLCCRDEHQTAGKSAAGVQASLAFFDALPPDAQEATVDHVYD
                     GDTLTIREHNRMRVRLLGIDAPELKEREPYAKEAADYVKRLCPENSKVWLKTPHGDQK
                     DRYNRMLSLVFVSNPSGGPGFVCMNIAIVEQGLGTFYSPAGSQVDFRGQLLEAQQSAM
                     QRKVNMWKKQNVRKKVFCTPKGIAFHTSDCLTIQQTSPRNLRTLSAEQALSRGYSPCR
                     VCKPQR"
     gene            <450234..>452021
                     /locus_tag="LMJF_06_1090"
                     /db_xref="GeneID:5649133"
     mRNA            <450234..>452021
                     /locus_tag="LMJF_06_1090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680829.1"
                     /db_xref="GeneID:5649133"
     CDS             450234..452021
                     /locus_tag="LMJF_06_1090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680881.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.1090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.1090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649133"
                     /db_xref="InterPro:IPR026205"
                     /db_xref="UniProtKB/TrEMBL:Q4QIW7"
                     /translation="MPLERVQVRRPPRGVEAPGNDRGLPAAAVRGATAPATPTTESSR
                     SHSPTGTATSTASSSSALLQQGTLAQQARRYEDENIRSLLHQLPSSPRQLVRRLEQQQ
                     QEINMLKETNMLLKSREVEISSLTLRLQERINATQSQVDHIKTQVHLQLSNPITEEEY
                     QRIEALTEAQRDLVDVMKLGIYRQLGSLRASQQAATKRAAELSTSLAQLQQENSDMKV
                     RLAECESHGGTEKEKAEKTARQLENQQARIAELEGHIASLEAKNKSMYVDQEQFLSAK
                     LTAQIKTDEVARLSVRLEESEMDMQRYRANAECTEQKLDILKSEYYELKLRNGQRVLE
                     LENALKASEEKLKTLGDLEMESQLFISNLATSSQGDVAFSTGPADTSAGRPTDAYEGW
                     LALPRSRKLAHTLVVTKRCLHLENKVAALEHDLNFKEAQVARLQVALDGARDALHNIN
                     SPYVLVEKAMTELTDENEALKQKVNILEQDKKELQLKVQQYGSSLRTLTHHRQELLRV
                     KKLLRQLGLREGFVFPTDNEETGQMEGQQPETMKPRPTRSGSTSGGNFTSSTQPRVSM
                     GSSASEARRTSGKESPGSFGALRPIEMTF"
     gene            <453183..>454097
                     /locus_tag="LMJF_06_1100"
                     /db_xref="GeneID:5649134"
     mRNA            <453183..>454097
                     /locus_tag="LMJF_06_1100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680830.1"
                     /db_xref="GeneID:5649134"
     CDS             453183..454097
                     /locus_tag="LMJF_06_1100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680882.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.1100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.1100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649134"
                     /db_xref="UniProtKB/TrEMBL:Q4QIW6"
                     /translation="MLQTATHSNVLPLRGGRSALNHGYSMHTLARKRFRENTSALAVT
                     VGFVLPALNGVNKQLDKHVDAGTDVSMDELMQIFAKSGRDAVALYADRMARIACQTGL
                     ACALIESKSAYGNAAVYLWDLYPRLHQRYVGAVLSWLRIPVFVSSLLGPHPTTQDVAF
                     LQTRVSGICALEDSLRRDTITLFGDLLVDTARILIRRDVDNLSEAIAQQAVLRVTVTV
                     VGAVGAGLGRAAAGERGEYWGNIAGVMAGPAVAVQLWTAVRKMRMLRPRRSVDAAKSH
                     RHRHSTSEGSKAAAATATASGAPVTAKA"
     gene            <456396..>459722
                     /locus_tag="LMJF_06_1110"
                     /db_xref="GeneID:5649135"
     mRNA            <456396..>459722
                     /locus_tag="LMJF_06_1110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680831.1"
                     /db_xref="GeneID:5649135"
     CDS             456396..459722
                     /locus_tag="LMJF_06_1110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680883.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.1110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.1110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649135"
                     /db_xref="UniProtKB/TrEMBL:Q4QIW5"
                     /translation="MSSHSQRAASLGSSGAHEDHSLRGCHGTGCRGCVVEDFHGRPAS
                     CPLLPSVAPERPHPLSHGADSSRNLSFNFGEDARFSGSELYSCRAMAAPAATGKGGAS
                     ADARAALAGGCTAGAECPSRGGSNAAMASFASELHVTHNGIVIPPIHGMPCPGGLPSE
                     KLAEYAKVKDCQAPQRLRMPAKGAFSNVTSLAVLRRVQSLVNARQVEPAGWMPIDPSP
                     MRVGAVSDGDTAEEESVAQMHRRAAAADGKEPEVGRAARDARVSAAHSPSLAPHGFSE
                     ALLMPSDAMTVAEKSEGDAAVVAATHAMQHAEDRGGAKEKGTRVQHFMPVQQHLRQQQ
                     QQYHHEGRTTLAHARAPTRSTLSPARPCTEGDTQDDSDDEQSPHRHRTAAPIASARYG
                     DSMQDIAPCAVRTAALAQRSPTCTRASGRSQGPLSAYRPDRAPALTAAIATASADRKP
                     SSRMPRGFEFFVEKGQQRRAEAERAQHARAAESAGELLTAASEQHHSNGDTAPSTGDR
                     AATRLRMMSVMPLPRGYEMYARQGQSRRAKAEREEEERRTDDIVNCTHHPRVNRHGIV
                     SASSARSARALQRSPHPQLLTSAAAEGDGAPTVETLPLSVFERLTRKAEGRDQRLLQL
                     EECCAPSHQSRSFKSAAAAAAAAEGCSSGGGSMKGGSAAAHKHRATQQTGEGGAQRHK
                     GRGAGRNVFEDLHAQERKAAQAATAASASPRSLASKVYGRGAASGRASAMAPNKTGTG
                     SAAASEAAAEVTVHRRSQAEIEQHLAHMMSREAERCAKWEKHLVAQAAEEEQARHGHV
                     VLNPKTDELAERARTRHRIREERAKQEREREEVQEVAAVAKKVPQRSASLRRAPRSPK
                     PAEEGAQAAHKAVGGTEPTPTAATPVSCAAADDLYKHQLRAKERKQRHLEQVRLECAE
                     EELSECTFRPRINQASGKMAQRLVVESFQDGYVDNVPDRFASATSPWEEVVGSDGCAG
                     SVPQLAEYCDAHRDSLLVSSRSGSLFRELSQASVPAHYDVPSLSEMPRPRSAGRGFDS
                     CAGMDYDDDHIHSNTERSTYGVPSVASLGREVTTLPPHSSGPLVEQLRSLEEMLHEWK
                     EIERECSPIVKQPRKAGVVD"
     gene            <462386..>463210
                     /locus_tag="LMJF_06_1120"
                     /db_xref="GeneID:5649136"
     mRNA            <462386..>463210
                     /locus_tag="LMJF_06_1120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680832.1"
                     /db_xref="GeneID:5649136"
     CDS             462386..463210
                     /locus_tag="LMJF_06_1120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680884.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.1120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.1120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649136"
                     /db_xref="UniProtKB/TrEMBL:Q4QIW4"
                     /translation="MSRVVVVMALALCLAIAAVPAVTTVQRGSCIFLTSPPSYTFIGG
                     GFHMQLALEYPLPAKDVRLSFDLPKSFFIDEAEAEQLYRMEVLSADPMTQGTAAVVVA
                     DVTRAYSSLRMSSQYAFDIEAPVFKVNYTTNHVVLTFQQVGGDGAGSVLDAYLAEDGA
                     QAQVPFRARLVIPIHSRYEVLDTKMPFSLLRFITGEGAYVRRCLTRVDVAGRGDPRCS
                     AGTYRASAAVTTSEEKPHYKHCVDLPVGLLADLPYVYHVLMGLLVAGAALLILAIR"
     gene            <464063..>465052
                     /locus_tag="LMJF_06_1130"
                     /db_xref="GeneID:5649137"
     mRNA            <464063..>465052
                     /locus_tag="LMJF_06_1130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680833.1"
                     /db_xref="GeneID:5649137"
     CDS             464063..465052
                     /locus_tag="LMJF_06_1130"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680885.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.1130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.1130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649137"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q4QIW3"
                     /translation="MNGALTPRHEVQLSHAPALLYNNLQPHVGGAYVSYATNSAVHTV
                     RASTGAPCFEPLHFPCDQVQHLAALQDDAEQNIIVVVVLSACMAVIVVNGRQVHVLPE
                     KGGDTALTCAAVARVPGKDEMVVAVGASNGIPLCSRCTLGGHPVASVEVTAPVQAHAQ
                     RSITALDLEAMGEGSRVEMASGDAGGHVVLWVDNNPTHTIPPESDTDAVTCVRLVSVS
                     NAVAVAYGGGQIKLIQRSSGAVTIAIQAHSRWINAMVYSAALHWLASAAEDGQISVWD
                     VTSVDPNRVCIASGTVTDELPTGLAFLSNMGDLLAASYDVGKLRCFPLPGQRR"
     gene            <465208..>467751
                     /locus_tag="LMJF_06_1140"
                     /db_xref="GeneID:5649138"
     mRNA            <465208..>467751
                     /locus_tag="LMJF_06_1140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680834.1"
                     /db_xref="GeneID:5649138"
     CDS             465208..467751
                     /locus_tag="LMJF_06_1140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680886.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.1140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.1140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649138"
                     /db_xref="UniProtKB/TrEMBL:Q4QIW2"
                     /translation="MRRCSRSPAVAGGGGGEGGGEAFYAFRAAHTLQSNCIVASGNAQ
                     EYHTEQQIRLLDCHTHLQLCTSSRLFLFSSVLPLCSADDSSLPLLYRASMSLTDIEEA
                     ETVELLSEDSCSTMSASSEDVGATTVDTSLPLTANATEEQLRRRMLHECACIPELRPQ
                     PAWLEESGAAGDGPSASTTEMNWDVAHADHLVVAVRWRVAPTSPGTGCPSLHTTPWVP
                     YAVPLAKVIASRTMAATDTASTVTSTTSSSGGGSSATVQPLGSVQLPLGRSMFLLAAQ
                     RSSLVPRAWDSGVAAESLVNVAASISRAQCTLHLHYAAAKTPQAPSSLRTRPVCRSFD
                     VFAISPTTALLGIALQPHQRYHIKRKRGTGKSAHASEDQPCDANGVLTLRVGPYCHVD
                     VALDELPSEPRVSGSAGTCPSITINTYNGRHAHTTRSGQTQDSPAVHRTSACRSGVAR
                     EPPAAAMQLQHGSTASLITGDSTAVLATLSEMSDHVALSETSGHEHDGPVVAGSQEVA
                     AAPSHTSITGSLKRRRPAAARGRAAEAVVRRVGNAEAAEGGDVDEADAAVSHSVTTTP
                     SEIVLFTTGMRLSDAEEKTLKELGALVNPHLRLARYARVLAAQRPLVRSVKLLTVLPY
                     VQDVVHQSWLDAVLRTRSLDLPLEGFAYKERKLAGSIESENSFDLRETMRKAPTERQR
                     LFAQQHFWVHKSATPQEPPMNDLKTVVAASGGIITRCVLDADVLVLPKHKPTLSCWRG
                     IAQQLGGTGRASTSSASASTTPTLAQRKQAGVLFVVPDDIFKCVLQQRRLSASSVTLP
                     WQLLTEAAAARGTTGAARVGRRPSQPTRKTPRASTTQRSPRRKSCKRSQ"
     gene            <468233..>469762
                     /locus_tag="LMJF_06_1150"
                     /db_xref="GeneID:5649139"
     mRNA            <468233..>469762
                     /locus_tag="LMJF_06_1150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680835.1"
                     /db_xref="GeneID:5649139"
     CDS             468233..469762
                     /locus_tag="LMJF_06_1150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680887.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.1150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.1150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649139"
                     /db_xref="InterPro:IPR025487"
                     /db_xref="UniProtKB/TrEMBL:Q4QIW1"
                     /translation="MRRGLSVALCTSITLGCTTSVHHGCCIHRLCEAPVGPSSTNTNL
                     AVAPAVGGAAPRSTSTACSSPLFWFELDRLPPQLQREFDVDANQRALRHLWRPTRAGT
                     DTDGASAAPFNLPVTPSSVHPVVWRCTHCQSQWSARPSDRTNPQLADAHRCPRCYGGQ
                     RLPSGSLDTPAAPDAGAQPGPSSRPSTAATGVGFLCDAYPLLAAQWDPLRNQLLQNQV
                     LQSVTEVHTSSASKVWWRCPLCSSSWLESVSSRVSRYSLAVQCHSTHSKPSLSSTGTT
                     PGNDPDRPTGELVLLCPSCERRGASSSSAMNPASPRRWLADDALLLGEALLRPHQDPQ
                     RVSLTSETMLQWRCRSCQFEYAATVANRFLRHERCPQCSGRTKSVHNLLVVQRPDVVR
                     EVSKHISRTRLRYITIHDDVELPFVCRTCYAPYRMTARARCAVPRGVPACSKCFLTSS
                     QVLTEAQQQHQHGGAKALSARARRRVRQRALQLSRSHRHRERLAATVNELSHHDNALK
                     D"
     gene            <470302..>473601
                     /locus_tag="LMJF_06_1160"
                     /db_xref="GeneID:5649140"
     mRNA            <470302..>473601
                     /locus_tag="LMJF_06_1160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680836.1"
                     /db_xref="GeneID:5649140"
     CDS             470302..473601
                     /locus_tag="LMJF_06_1160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680888.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.1160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.1160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649140"
                     /db_xref="UniProtKB/TrEMBL:Q4QIW0"
                     /translation="MDVDVAYAESVPRYVDLALFLCGEALRLIKDELRQHAAAAAPLY
                     AWHLHKVCFLHALPNDGDACVDGAAAEDDANRAAAAAAAAARSGYTGPSSAAPSLGQI
                     DEETTWDVAPALSAQSSKEISFRRAYAQLRRPCGVDSWMGSKEKPDTHAAPTAAGAPT
                     REDASPSQVAGQVHPRSPREGEHRCVRVQVPQPLHRPSATPTDVGFALLCDFLQTAAQ
                     AGGAPLMQRLAAVLCSLVTRPTKRGSAPDAHLSRMRELPSSPTITVAQLSDLFDEDLF
                     DDELSAEAGNATRSFHIWVNYEWASASFARQTQLAAAVTKWLAALRRCRDGSPSGWSP
                     APKQRSAASALPPPLASAAPINVRWMQAALEGVFEGHACTRAMLMELSLTQRTPHLTD
                     NALAKLLALQGPPTSAMMARSELSNRGTQPILMCITSGMLLYAQYYISFRSLAVARQC
                     ARVALQVAQEVQSNAILALAHYTAHVVATHQGRPADAANSISIALQLTLPNGSGRGSG
                     QRGDPADESLSSLAPTLSGMDAQMASLAFAGAAQLLLFFPGAVGPALRSILSTGQRGD
                     SGGVGNGGAEAQHTGGAEDGRFAEPSDLVAKQSGAVTVQTVAQSIRHALLRAHVALLQ
                     ASPLEGRWIGVVASLQRETLLLIGAMYGMVSSPLVITTTTLRQLLEEVKEETSTASPV
                     YSHYQSRTLLWEVLRHAAHHALALQEGFLAPVKHAENDAGADAAASDALHCLHSALTA
                     VGDHYGASASAAANEIVFFSSVVRYCAGCRLYADGYVAAAYDVWSRLAGALNPSACTS
                     DMDGGQDRRHRADEKPADADASANHAGSLKETNEAHFWPPDHLLLYALVQRRRAQAAA
                     FLDYIAVPHRLQQELLAISSRYAFSFGVLTAQLMEAQVHQQHGRFSASLSVARDVERA
                     ATRIGYPSLCEAARALQVTAYGNSGCWREAQRTLARCRPTTAAQRTVFLLQQYAAHLE
                     PLLLQNPGSTGMVECLTRSWVALLVREGIVTAQTMRDDGDLRVCATAFGISAVDELCV
                     YSSLQRACALLGCRTNTIANQAANCLETLSARQQCPAPDVCIHGSCEEICRSDLYGGR
                     PCDVRKAMWQR"
     gene            <474255..>474662
                     /locus_tag="LMJF_06_1170"
                     /db_xref="GeneID:5649141"
     mRNA            <474255..>474662
                     /locus_tag="LMJF_06_1170"
                     /product="putative nuclear transport factor 2 protein
                     (NFT2)"
                     /transcript_id="XM_001680837.1"
                     /db_xref="GeneID:5649141"
     CDS             474255..474662
                     /locus_tag="LMJF_06_1170"
                     /codon_start=1
                     /product="putative nuclear transport factor 2 protein
                     (NFT2)"
                     /protein_id="XP_001680889.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.1170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.1170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649141"
                     /db_xref="GOA:Q4QIV9"
                     /db_xref="InterPro:IPR002075"
                     /db_xref="InterPro:IPR018222"
                     /db_xref="UniProtKB/TrEMBL:Q4QIV9"
                     /translation="MEQGAFNDVAKKALEFRNRYYKMLDDPQDRLNVAGLYAPDVPMV
                     CEWNGHPLSTVDDVRNYISALPKTSHQVDMVDAQPLPDNQDGDSFLLTVHGIVTYNDE
                     HRREFYQRMVIRRFEQRYYILNDYYRWLSERSQ"
     gene            <475857..>477224
                     /locus_tag="LMJF_06_1180"
                     /db_xref="GeneID:5649142"
     mRNA            <475857..>477224
                     /locus_tag="LMJF_06_1180"
                     /product="putative protein kinase"
                     /transcript_id="XM_001680838.1"
                     /db_xref="GeneID:5649142"
     CDS             475857..477224
                     /locus_tag="LMJF_06_1180"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001680890.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.1180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.1180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649142"
                     /db_xref="GOA:Q4QIV8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4QIV8"
                     /translation="MSQNPAAPGGDRVPNMSNARRGETSDDYARHKAAASRAFLENHY
                     QSLLANTRNGVGRAVGPRQKEPSFSDFHLFKCIGRGAFGEVFVCKYKSDKTDTLYALK
                     RLRKSDMITKKQVIHVRSEKDVLAEAAASNPWVVHLYRSFQDSLYLYMVMEYMPGGDM
                     ISWLCDKGIFDVESTRFYIAELCAAVASVHEMGFVHRDIKPDNILFGESGHIKLSDFG
                     LSKRFVEKRGNLLDYDDPPSSSNGAEASTDEKSAYESRADAPPGSLPGDDAGTGIAHG
                     RVREMFQSIVGSPGYIAPEILLRKPYGVGCDWWSVGVIMYEMLYGIPPFFSQNSNSTC
                     HKIKNWREHLVYPPQRHVPDDAVDFMKRLICEPEKRMTYDEICRHDFLKPMDMNGLLK
                     LQAPYVPALSNRLDTKYFPEIKEPSAPMQLSEEQKVREVDPRGVMFADFRFNYSGDQA
                     GPASA"
     gene            <478042..>478611
                     /locus_tag="LMJF_06_1190"
                     /db_xref="GeneID:5649143"
     mRNA            <478042..>478611
                     /locus_tag="LMJF_06_1190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680839.1"
                     /db_xref="GeneID:5649143"
     CDS             478042..478611
                     /locus_tag="LMJF_06_1190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680891.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.1190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.1190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649143"
                     /db_xref="GOA:Q4QIV7"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="UniProtKB/TrEMBL:Q4QIV7"
                     /translation="MYTARPKSVTSCHFTTTGTGERLHICVSSTRRASTSVPRMRRTY
                     HTKTTAVPLLAVALLLLLLLLGGTAHSAAAAEASRVVELTRDTFDAYVGGPDSYTFVL
                     YCVTWSRQCKTVTQLWDRLSITQSQKELRDVFTAAYVDGDKYPDLVKRMNVKGFPTML
                     FYTPLHREGLEYNGPRESYLLDSFVFQFS"
     STS             481075..481503
                     /standard_name="fk95g07.x1"
                     /db_xref="UniSTS:201785"
     gene            <481843..>483027
                     /locus_tag="LMJF_06_1200"
                     /db_xref="GeneID:5649144"
     mRNA            <481843..>483027
                     /locus_tag="LMJF_06_1200"
                     /product="hypothetical protein"
                     /transcript_id="XM_001680840.1"
                     /db_xref="GeneID:5649144"
     CDS             481843..483027
                     /locus_tag="LMJF_06_1200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001680892.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.1200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.1200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649144"
                     /db_xref="UniProtKB/TrEMBL:Q4QIV6"
                     /translation="MSAYPYVGPEDRNTQVQCTPPRQAGDAARILVPDSDNDDSLGLP
                     ISQESSPSVCVPAARTFSKRAARCAEALLQRHDAAASAVHKHRCMQQLGRLGGAYRAL
                     AHGQPVTIWVRYQDLNARVIRETEAFFEGHMADHLAHPHVTRKNGVLAAAPKAAFGFN
                     PQRRLPEGSLGCRAPLPSSPSPAHAAHAMLSSDGAVEAHACPPQAGYSLSRGEQCALS
                     LLFIEDTVDPNYTSSPLPTFTAHYTSDDRSQRMGLSESLCDTWSHGSYLSDTHATMPF
                     WMYGEDADSVRCSPTPAAHRGDSPSAARQHRKRGRGDTTGAEPQHLKGRRGERCTARA
                     LAFDELSASSSSQHATPREESTTARGGTPVAPSLSATVIELQNQRVQCDLLRRQSLFS
                     LF"
     gene            <483578..>485347
                     /locus_tag="LMJF_06_1210"
                     /db_xref="GeneID:5649145"
     mRNA            <483578..>485347
                     /locus_tag="LMJF_06_1210"
                     /product="hypothetical protein"
                     /transcript_id="XM_001680841.1"
                     /db_xref="GeneID:5649145"
     CDS             483578..485347
                     /locus_tag="LMJF_06_1210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001680893.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.1210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.1210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649145"
                     /db_xref="UniProtKB/TrEMBL:Q4QIV5"
                     /translation="MLVSERAQPVRLFNCLLLRAHKDDESDGAACALHKNAASTSPTT
                     DPIAAATAVGATRLYFTEGGPSSSLTALQRYLKVEEAHTTCPLLRVLQLAPQAPTGNM
                     QPLVYVELDTPNAVSLSDDAQGRREAVLTTCSGVCTQETMPSRWYHAPVKATLCVFQE
                     FMRAPTTSAASEPAFWAFLESVVRYHARDFYCGAVQVELQCVFVPTFEEKQNTAYSVD
                     VFGDYVNEKEGQAQQSSPAAGKGRTAMKICVKSTEAFEHVMAYLKTQCPLLEADFRSS
                     HLVVYAKWSSQLSAVRDSSHSQPPAADATGAVEQAACFVWLQDDAGGGGRDGVYADAA
                     LEALLDELTLAAASISTPSRAAAVLQEEGVSSFFEACCLTHTLKRVIRKHFQAVVLRQ
                     RPLFHWVISLPPYARLSRSTTSAAVTAMRFRDNAAVSRAVWGATQMLVHWQQLSNSAH
                     ALANEALKQSFGRGSGPSRQIVSAPARVPRQRRAIQQSALYGDTFSGGSALDRQRGKV
                     NVPHLYGADEGHDASISLSSAQRGSVMAASGLFHNLRSIKEDSFNNTSVLDAEDVFGS
                     NPKLTTRVVKRLAQSRTSVHTAQ"
     gene            <487114..>489486
                     /locus_tag="LMJF_06_1220"
                     /db_xref="GeneID:5649146"
     mRNA            <487114..>489486
                     /locus_tag="LMJF_06_1220"
                     /product="hypothetical protein"
                     /transcript_id="XM_001680842.1"
                     /db_xref="GeneID:5649146"
     CDS             487114..489486
                     /locus_tag="LMJF_06_1220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001680894.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.1220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.1220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649146"
                     /db_xref="UniProtKB/TrEMBL:Q4QIV4"
                     /translation="MKLFLTVVERHNSTNSSDVTPTDDVALFDPGVWSRTATSEMARR
                     NVSASYVAQQVYRHAALTQLAKVALSSAVCFRYGPRPPPHLDSFLFHKRCRPTGHGRC
                     GTPPAAAAPPVCAPSPLISSSSSSFSVNMAATSPGTGQQRSTAAGASDSATEYDSLLA
                     LWLRELLSGTDSSVTVTALLLFVEGTAIDMATGSKVHTPLNIGSGTARQLRTHEDAMA
                     FLHACESTLHHSAAEFPRCPYHVCVAVLVGTHGGSHGKNPVIFLDVAAAAPESAGAHQ
                     EVRLREQVALFGRQLGADATTATPHARQRTRKAEDEQWLSLLQSCQLSRASLVGLVYV
                     ACEAGHDPFGHSRVEGTDCDPFTLASVLRQRALLEAVNNGVLHPQLRKLSRARNRATA
                     RAVKLPASGATTRSRAPASPLKGRPSRGRQRPQQHSPKLPYLARDSVPPRRTQEHSIV
                     FYGVSRCGRSADLLARIEEEEHHARVALSSAEQRAWNLAELRWILRAHPPGKSIDAML
                     RRFAHNVDGVSRPEQQHPHSVPPRFLPPPLNVAQLATAISRPSTTATRRSSFASATRT
                     PESTSPGGTVRTRVTASMLPTSPSRLALTSTFFTRRITTPLFFREAGSPPQNQDDPRA
                     HSASSHVAVRGHNATELERRRLKSGATFSLATDSPNARACTTARRLSAIETALLARAH
                     SSSQRSLPSPSPCTGEVERLYPLVRAFHVEMCEQDALMAEELMMRSCIEHKEKNCRKT
                     LSVARAESVRRLSVWWPSETGTQPQREPQVPDSPRWRPAKPLPLRIFFQQ"
     gene            <490564..>491445
                     /locus_tag="LMJF_06_1230"
                     /db_xref="GeneID:5649147"
     mRNA            <490564..>491445
                     /locus_tag="LMJF_06_1230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680843.1"
                     /db_xref="GeneID:5649147"
     CDS             490564..491445
                     /locus_tag="LMJF_06_1230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680895.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.1230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.1230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649147"
                     /db_xref="GOA:Q4QIV3"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR012864"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="UniProtKB/TrEMBL:Q4QIV3"
                     /translation="MKSSGRRVRSACTPLTTCRPRMKRLIQSLQHFSVTSSEHVELFS
                     KITLRDFGFYVSDADAMRYVADEAYSIAERAFQLENALHQHRLSASTAQVSPMAWKSS
                     SNDTVGCSTLYQDEAVTLCWFVLPPGKVLPLHDHPGMTVWQRAMHGRLHLCSITREAV
                     SQTSTGASTAPINGTVVFDGELDGVGDAIPASDVLGFTPTDGDGGGMLHEIRNIDATQ
                     PALFVDIISPPYNQASSSMVCGYYTAEPLNATATLLPALAADCGVRHQLKAGDKVRLR
                     PRTNYSGPAMNAFLHVV"
     gene            <492204..>493688
                     /locus_tag="LMJF_06_1240"
                     /db_xref="GeneID:5649148"
     mRNA            <492204..>493688
                     /locus_tag="LMJF_06_1240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680844.1"
                     /db_xref="GeneID:5649148"
     CDS             492204..493688
                     /locus_tag="LMJF_06_1240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680896.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.1240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.1240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649148"
                     /db_xref="GOA:Q4QIV2"
                     /db_xref="InterPro:IPR002938"
                     /db_xref="InterPro:IPR003042"
                     /db_xref="InterPro:IPR018168"
                     /db_xref="UniProtKB/TrEMBL:Q4QIV2"
                     /translation="MLRRSLCMLAPSPAAAQGNEVIVSGGGLVGAAMMASLQQLRSHL
                     HRSSAAPLLASHLARLMLVDSGKRPVYDAANMMHTLRTVSITPVSSKIIDSLGAWDQL
                     TTKHPYYRIAVRHEQANSPFLGAGGRSSSFFMTSVLGNRTSCEPLLEFTDLRKPVGFI
                     CFNAELNSCMMDVVEAGQRALVDTDGAHDTLCFGAHLEGVQIPSQETLEGSWGSARLV
                     SGEASTDVAFGLLLGCEGRGSSLRDVLSTPSLQQDYAQTAFVCSVRLEKADDGNVCSF
                     QNFFRDGKIIALLPTSEDTASIVFSTTQQHAKELLASTREDLVAELNRRLSSFAPNDI
                     PRIRDVPQTTTPDGKVCRAQGSFPLKLNLATMPYAPRAILLGDAAHGIHPLAGQGLNL
                     GIYDLCALTSVLEQAIRSGQDIGSSIAVGQVFAGHMLSHTAPIITGMEIIKKLTHWTP
                     GLASVGMRALNSAPLVSTLAKDAILQVSSGALFAAQHKCCFLLQ"
     gene            <494749..>495195
                     /locus_tag="LMJF_06_1245"
                     /db_xref="GeneID:5649149"
     mRNA            <494749..>495195
                     /locus_tag="LMJF_06_1245"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680845.1"
                     /db_xref="GeneID:5649149"
     CDS             494749..495195
                     /locus_tag="LMJF_06_1245"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680897.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.1245"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.1245"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649149"
                     /db_xref="GOA:Q4QIV1"
                     /db_xref="InterPro:IPR018783"
                     /db_xref="UniProtKB/TrEMBL:Q4QIV1"
                     /translation="MLLPSLLLAYSSPIHITTGLAALLPTVLAATPIRHHAHAHTHAE
                     ILTYTHAMATSAEDGHVAYEALTNAQKAELAAWVRNQLDSTSSASEWRRQTQAMIRQA
                     MARRAASGAPLDAGDILDEIMPHVRSAIPPEVREGLFRRVTAQLHS"
     gene            <495906..>496622
                     /locus_tag="LMJF_06_1250"
                     /db_xref="GeneID:5649150"
     mRNA            <495906..>496622
                     /locus_tag="LMJF_06_1250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680846.1"
                     /db_xref="GeneID:5649150"
     CDS             495906..496622
                     /locus_tag="LMJF_06_1250"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680898.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.1250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.1250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649150"
                     /db_xref="UniProtKB/TrEMBL:Q4QIV0"
                     /translation="MSSVSNSEIAKRIREGNQKRREEERKKQQLEQEYLEVVTKKLNE
                     QRQSRSPTRFLPSILICLLFVSFPLCEQVVDWCLVGIFCVLNTFLAFAFTNPSEWLSI
                     ASTVLINFSLVRFSSEIYNIPQRLAQVPLILLVNYVAINLLIVAAAYFLYVSPRFLRF
                     SRSYGGKRGRQTSATHRGHHSNEYDMLEAFAMQKEEAERLDLLLCLLLLLNVAVLMYF
                     DVIPFHLVLQNGLNVFRLLK"
     gene            complement(<499408..>501369)
                     /locus_tag="LMJF_06_1260"
                     /db_xref="GeneID:5649151"
     mRNA            complement(<499408..>501369)
                     /locus_tag="LMJF_06_1260"
                     /product="putative pteridine transporter"
                     /transcript_id="XM_001680847.1"
                     /db_xref="GeneID:5649151"
     CDS             complement(499408..501369)
                     /locus_tag="LMJF_06_1260"
                     /codon_start=1
                     /product="putative pteridine transporter"
                     /protein_id="XP_001680899.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.1260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.1260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649151"
                     /db_xref="InterPro:IPR004324"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q4QIU9"
                     /translation="MASAQPFQETRNDGAADHREDDAAEAPHSEYEHPTATKWFKAAP
                     CLRYIPLFGEVTAAFGPKFSLSLGLTYTLSKGAASRIINVSRQPMFIVRYGLNVARYQ
                     RLATMYSLGWSLKPFIASIADVIALFGYTKRWYMALSAVLGTAAALAYALLPAKESSA
                     NAAAAFVFLTCFGKSNIDILSQGHFSRSMREHPQVGPSVVSWVWAMTFVGTILASCMM
                     GPLSDAKLTYVGIIVSAALQLVTIFFFIFNMYGEKKNRTNRRKDALMQFRELKRLEQQ
                     QAAKAVDGRVVESIADSGDVKELAAVEVAGDSPEDDDSDFVEPDIGSCLGGAVEVNVD
                     VAARNWRLIVYALIMTCGIITQACVMVLGTRRQLLYACIGIATVFMGGAFLSLPLIVA
                     KAAVFIYLNSLLYLQIPGALSNFYLAKPNCLPDGPHFSYTFYQTVGALITDAGGVTGA
                     VLFTRFFSKHRYAFVFIATTLLQVLGSIFDLIIVKRWNMYIGIPDHAMYILGDAIVYE
                     ICFVMSLMPGQILMSRLCPRGTETIAFALLAGFNSAGNSMSLAVGSLLMENFWPVSAK
                     PPCNFRNVPYLIITGHLCTPLLVIPLAFLLLPKARICDRIDIDGNIIAEDAKAVQERR
                     CPVVKPHEAFDGEGQGSETKQGDSRGRKA"
     gene            complement(<503119..>504024)
                     /locus_tag="LMJF_06_1270"
                     /db_xref="GeneID:5649152"
     mRNA            complement(<503119..>504024)
                     /locus_tag="LMJF_06_1270"
                     /product="coproporphyrinogen III oxidase"
                     /transcript_id="XM_001680848.1"
                     /db_xref="GeneID:5649152"
     CDS             complement(503119..504024)
                     /locus_tag="LMJF_06_1270"
                     /EC_number="1.3.3.3"
                     /codon_start=1
                     /product="coproporphyrinogen III oxidase"
                     /protein_id="XP_001680900.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.1270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.1270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649152"
                     /db_xref="GOA:P84155"
                     /db_xref="InterPro:IPR001260"
                     /db_xref="InterPro:IPR018375"
                     /db_xref="PDB:1VJU"
                     /db_xref="PDB:2QT8"
                     /db_xref="PDB:3DWR"
                     /db_xref="PDB:3DWS"
                     /translation="MSLAVEAVKDFLLKLQDDICEALEAEDGQATFVEDKWTREGGGG
                     GRTRVMVDGAVIEKGGVNFSHVYGKGLPMSSTERHPDIAGCNFEAMGVSLVIHPKNPH
                     VPTSHANVRLFVAEREGKEPVWWFGGGFDLTPYYAVEEDCRDFHQVAQDLCKPFGADV
                     YARFKGWCDEYFFIPYRNEARGIGGLFFDDLNEWPFEKCFEFVQAVGKGYMDAYIPIV
                     NRRKNTPYTEQQVEFQEFRRGRYAEFNLVIDRGTKFGLQSGGRTESILISLPPRARWG
                     YNWQPEPGTPEARLTEYFLTKRQWV"
     gene            complement(<505058..>505753)
                     /locus_tag="LMJF_06_1280"
                     /db_xref="GeneID:5649153"
     mRNA            complement(<505058..>505753)
                     /locus_tag="LMJF_06_1280"
                     /product="protoporphyrinogen oxidase-like protein"
                     /transcript_id="XM_001680849.1"
                     /db_xref="GeneID:5649153"
     CDS             complement(505058..505753)
                     /locus_tag="LMJF_06_1280"
                     /EC_number="1.3.3.4"
                     /codon_start=1
                     /product="protoporphyrinogen oxidase-like protein"
                     /protein_id="XP_001680901.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.1280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.1280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649153"
                     /db_xref="GOA:Q4QIU7"
                     /db_xref="InterPro:IPR026816"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="UniProtKB/TrEMBL:Q4QIU7"
                     /translation="MASQSPKCLMLYSTTDGHTKTIMDTIARQLADETKVRCDVVDIK
                     DGNSYVLADYEKVLLGASIRYGHFSAAFINYVKQHHSELSAMPSAFFSVNLTARKLDK
                     NTATTNVYTRKFLNQSSWSPQLVGVFAGALWYPRYNFFDRVLIQFIMKVTGGETDSTK
                     EIVYTDWAAVRRFASDFAALPLAVPPRPKANTVEKPDGILRSGSGAHCLLAIVGMSAA
                     VIVGIRIIAAKRG"
     gene            complement(<506919..>507290)
                     /locus_tag="LMJF_06_1290"
                     /db_xref="GeneID:5649154"
     mRNA            complement(<506919..>507290)
                     /locus_tag="LMJF_06_1290"
                     /product="hypothetical protein"
                     /transcript_id="XM_001680850.1"
                     /db_xref="GeneID:5649154"
     CDS             complement(506919..507290)
                     /locus_tag="LMJF_06_1290"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001680902.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.1290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.1290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649154"
                     /db_xref="GOA:Q4QIU6"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="UniProtKB/TrEMBL:Q4QIU6"
                     /translation="MQYVAEPSSIRVYYRGNKYDVPLEFATRMHPGGSSILMRYKDCD
                     ITKDFEKMNHSVDAAVILNEWLVDGKHFPEAYKSASSCKAGEDDESQQKKEYDKSKRW
                     NRFLIAFGIASIVTAVEMRKH"
     gene            <512080..>514008
                     /locus_tag="LMJF_06_1300"
                     /db_xref="GeneID:5649155"
     mRNA            <512080..>514008
                     /locus_tag="LMJF_06_1300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680851.1"
                     /db_xref="GeneID:5649155"
     CDS             512080..514008
                     /locus_tag="LMJF_06_1300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680903.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.06.1300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.06.1300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649155"
                     /db_xref="GOA:Q4QBZ3"
                     /db_xref="InterPro:IPR003492"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q4QBZ3"
                     /translation="MRGVDGKGEPGREGVEVDAVAGVVTEDLRKDGVVDNPSISLSQN
                     EPSGIEESDRYKRDAATVHRLFKRTIIRNSVFLWLVGFINNFHYCLIMSAAASLAEGY
                     GLKKLVALITWANIFFGIFARVLNMFIATRVSYNVRITAMALSSLLGIFFVSFAAPIG
                     GYNNVSAFVVMLIGVVLLGTASTYGESVMLTFVQRYPDSIVGAWSSGTGISGVAASLI
                     FLGLTSAGLTQQQTFLVTTPLCIIYWLCFMLGMVSPRKVLVATRTNGNREDIILYCPE
                     GEEDAHICLLHERALARHDVVSVSEDYTIKMVMNIRAVSWHQSPVVHKPEPSAEEGDG
                     LYYPCCRVICGCCSPSNGLRRWWRDVGPDLIFMHNTMAWFFFNLAVVYIAEYAAQLMA
                     PFSFYCEPEWKDNFWVKNSYVVCQFCYQLGVLISRSSLLIVKIPYVGVISIIQVVNAV
                     CWIVQARVMYIKSNTKSRQVGLSFILFAWMIFIGLMGGASYVNVLYLILKRSTTLRER
                     EEREAVEAYLTSKARDVSGRRYAEDTELRKKAADERAALVVAKLEGKPVSEIMPKPSQ
                     SDIASAAPQSQILGLALTQEERDAIKAIHCNLNDVWAARREMGMNIGALYATVGITLG
                     TVVDLIFTNTMLKHSKSC"
CONTIG      join(FR796402.1:1..516869)
//
DBGET integrated database retrieval system