GenomeNet

Database: RefSeq
Entry: NC_007249
LinkDB: NC_007249
Original site: NC_007249 
LOCUS       NC_007249             574960 bp    DNA     linear   CON 18-JUN-2017
DEFINITION  Leishmania major strain Friedlin complete genome, chromosome 8.
ACCESSION   NC_007249 CT005247
VERSION     NC_007249.2
DBLINK      BioProject: PRJNA15564
            BioSample: SAMEA3138173
            Assembly: GCF_000002725.2
KEYWORDS    RefSeq; complete genome.
SOURCE      Leishmania major strain Friedlin
  ORGANISM  Leishmania major strain Friedlin
            Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae;
            Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Rogers,M.B., Hilley,J.D., Dickens,N.J., Wilkes,J., Bates,P.A.,
            Depledge,D.P., Harris,D., Her,Y., Herzyk,P., Imamura,H., Otto,T.D.,
            Sanders,M., Seeger,K., Dujardin,J.C., Berriman,M., Smith,D.F.,
            Hertz-Fowler,C. and Mottram,J.C.
  TITLE     Chromosome and gene copy number variation allow major structural
            change between species and strains of Leishmania
  JOURNAL   Genome Res. 21 (12), 2129-2142 (2011)
   PUBMED   22038252
REFERENCE   2
  AUTHORS   Ivens,A.C., Peacock,C.S., Worthey,E.A., Murphy,L., Aggarwal,G.,
            Berriman,M., Sisk,E., Rajandream,M.A., Adlem,E., Aert,R.,
            Anupama,A., Apostolou,Z., Attipoe,P., Bason,N., Bauser,C., Beck,A.,
            Beverley,S.M., Bianchettin,G., Borzym,K., Bothe,G., Bruschi,C.V.,
            Collins,M., Cadag,E., Ciarloni,L., Clayton,C., Coulson,R.M.,
            Cronin,A., Cruz,A.K., Davies,R.M., De Gaudenzi,J., Dobson,D.E.,
            Duesterhoeft,A., Fazelina,G., Fosker,N., Frasch,A.C., Fraser,A.,
            Fuchs,M., Gabel,C., Goble,A., Goffeau,A., Harris,D.,
            Hertz-Fowler,C., Hilbert,H., Horn,D., Huang,Y., Klages,S.,
            Knights,A., Kube,M., Larke,N., Litvin,L., Lord,A., Louie,T.,
            Marra,M., Masuy,D., Matthews,K., Michaeli,S., Mottram,J.C.,
            Muller-Auer,S., Munden,H., Nelson,S., Norbertczak,H., Oliver,K.,
            O'neil,S., Pentony,M., Pohl,T.M., Price,C., Purnelle,B.,
            Quail,M.A., Rabbinowitsch,E., Reinhardt,R., Rieger,M., Rinta,J.,
            Robben,J., Robertson,L., Ruiz,J.C., Rutter,S., Saunders,D.,
            Schafer,M., Schein,J., Schwartz,D.C., Seeger,K., Seyler,A.,
            Sharp,S., Shin,H., Sivam,D., Squares,R., Squares,S., Tosato,V.,
            Vogt,C., Volckaert,G., Wambutt,R., Warren,T., Wedler,H.,
            Woodward,J., Zhou,S., Zimmermann,W., Smith,D.F., Blackwell,J.M.,
            Stuart,K.D., Barrell,B. and Myler,P.J.
  TITLE     The genome of the kinetoplastid parasite, Leishmania major
  JOURNAL   Science 309 (5733), 436-442 (2005)
   PUBMED   16020728
REFERENCE   3  (bases 1 to 574960)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 574960)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire, CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR796404.
            On Jun 1, 2012 this sequence version replaced NC_007249.1.
            Data release policy www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..574960
                     /organism="Leishmania major strain Friedlin"
                     /mol_type="genomic DNA"
                     /strain="Friedlin"
                     /db_xref="taxon:347515"
                     /chromosome="8"
     gene            <4056..>7652
                     /locus_tag="LMJF_08_0010"
                     /db_xref="GeneID:5649417"
     mRNA            <4056..>7652
                     /locus_tag="LMJF_08_0010"
                     /product="putative adaptor complex protein (AP) 3 delta
                     subunit 1"
                     /transcript_id="XM_001680978.1"
                     /db_xref="GeneID:5649417"
     CDS             4056..7652
                     /locus_tag="LMJF_08_0010"
                     /codon_start=1
                     /product="putative adaptor complex protein (AP) 3 delta
                     subunit 1"
                     /protein_id="XP_001681030.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649417"
                     /db_xref="GOA:Q4QIG8"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR010935"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029685"
                     /db_xref="UniProtKB/TrEMBL:Q4QIG8"
                     /translation="MFIKNIIISGFRSYREQSFPDGLSPRTNVIVGKNGSGKSNFFAA
                     IQFVLNEKFANLRTAERKELFHVGSGRPALSVFVEIVFDNSDGRLVIPGRAEEPEVRI
                     RRTVGLKQDEFRVNDRKFSASDVHQLLESAGFSSSNPYYVVEQGKIVSLVNMSEEERY
                     QLIKDVAGTKVYDARRAESEHILAETKGKQGQITESIRELQRLLKELEAETAELKQYE
                     EADRDKKCIEYCIFNAELEAANGALLKVEEEGNKQSSLLNKSQDVDEASEQKILDFSQ
                     KIMDISTEIARLEMERTAVAKDMAALTSKQAVVELDASEAAGRFARTNRELEALWKED
                     RELSATIQAVAVDIEKKKSLFHSSDEAAKKKAAEVETQRKVLERLQERRNRTKLFRNK
                     AERDRWLSGEMQKNEDSIRKSKEELHSVHLEMERVEKEAVALSKQISAPNVSTADVDQ
                     RLRDHEERIKAALCRRDQLNHQRRQLWQSLHGQESVVQRLDEASRNAKQQWERAVRQD
                     IRQGLQALSEVLHDLRNPALSAAVHGPLIDLIEVADGYKTAVEITAGNALFNVVVDSF
                     EVSTTLLAEMNKRRKPGRVSFFPLDTCSGKAVDIATTPECLPLLSKIKYDAHFKGVVT
                     EVFGRTAVVASLETAATMVGKMQWDVITVDGDQLGRRGGITGGFIDKRHMKLPLRERE
                     KELAAERQTARAKLDVLCQEVATVEQSITEVLNELEALRNQNMSTEREADVRLREARL
                     MEDRRSCLATLKSNLAAAKKAVESSIAAATERVGELKRELSDDFKSAWTPEDEKRLEQ
                     LTEEVAAARVASSEMQASALQLATEVQLLEDTARHVERRKAVVADRIRELGWSRHAGS
                     IAGGEEAAVKAEFELLSQRLQSIDHDLEQDGREREKLQSQLDALTSKRLAVARSLQER
                     KEVAERTQMQRSVLVQRRDDALQKIRQLGVLPQGVAKFESASLGKLMYHLKAANEKLK
                     GLSHVNRKALDQHAALQETMKALTSQQGTLSKELDSIHELMEHLDAKKEEAIERTYKQ
                     VQYQFEEVFKQLVGVESCSAELQLVASAVPNKKEDPYTGARIKVSFGLGNPVSHLEQL
                     SGGQKSLVALALIFAIQRCDPAPFYLFDEIDAALDAEYRTSVANMMARQSSECQFLVA
                     TFKTELLDVADKVLGIFFHNKMSRIQTIAREEGVRLLKQAALEDRKRAREAE"
     gene            <8651..>9472
                     /locus_tag="LMJF_08_0020"
                     /db_xref="GeneID:5649285"
     mRNA            <8651..>9472
                     /locus_tag="LMJF_08_0020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680979.1"
                     /db_xref="GeneID:5649285"
     CDS             8651..9472
                     /locus_tag="LMJF_08_0020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681031.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649285"
                     /db_xref="UniProtKB/TrEMBL:Q4QIG7"
                     /translation="MSKFFCDVDREEGSLQGPLLNAPRKRCREEDYAIDAYRRHLPPH
                     VRVQVAWENTTTFVSLRGHVLDAHGRFNSADFPGLAFFYNPVVACVASGTVTLHFDDS
                     TSVTERILREKRPLPCSVHGPFRCPCHIMHEAADGVAQLLREIFCQHSPFDVSIDCHR
                     SYPHICIDSQSKTWSVSLVGLPLPSKFFGPFPLGDITSPQSIKGHWLQYIEKSKVVED
                     ACIMCGIVSGIHCSRCLCRLCKRCGEHCANCGSYVCRGCSTAGENGTTICYNCFC"
     gene            <10510..>11157
                     /locus_tag="LMJF_08_0030"
                     /db_xref="GeneID:5649286"
     mRNA            <10510..>11157
                     /locus_tag="LMJF_08_0030"
                     /product="putative Qc-SNARE protein"
                     /transcript_id="XM_001680980.1"
                     /db_xref="GeneID:5649286"
     CDS             10510..11157
                     /locus_tag="LMJF_08_0030"
                     /codon_start=1
                     /product="putative Qc-SNARE protein"
                     /protein_id="XP_001681032.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649286"
                     /db_xref="GOA:Q4QIG6"
                     /db_xref="InterPro:IPR001388"
                     /db_xref="UniProtKB/TrEMBL:Q4QIG6"
                     /translation="MPIKYSCVNDETKLLAEHPAGEQPKLAETMQKVIATVPPKEYRH
                     KTIEDKDGGVNYNYISNGEGRIVACVTTSDMRMRTVFAFLEAVEPLVRGSVGPQGAEL
                     RNGKKLLQQKMEFYNNPQNDKITALNDDINQVVDVMIDNMDKVLARGDRIDTLHEKSS
                     TLADQAQQFQQRSTELKRNLCMKNLKLTLMIVGAVVVVLIIILMIACKPNFSRCR"
     gene            <12955..>13644
                     /locus_tag="LMJF_08_0040"
                     /db_xref="GeneID:5649292"
     mRNA            <12955..>13644
                     /locus_tag="LMJF_08_0040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680981.1"
                     /db_xref="GeneID:5649292"
     CDS             12955..13644
                     /locus_tag="LMJF_08_0040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681033.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649292"
                     /db_xref="InterPro:IPR006594"
                     /db_xref="UniProtKB/TrEMBL:Q4QIG5"
                     /translation="MDLTDNSIWTLVEEAVIEDRGEDEEEVLAQMVRSYLARRGLTDT
                     LAAFDEEHQCYRVLSTAPHNRDPDAPKPSAYAGVLGSTLAADRASANSAPARDEMSAG
                     MDKRKAAQRLCLQKRYEAAAALMEPSSLARIRLLCIQAQSLEDRPTAVFYLATHVAPL
                     VPFCIDPTMGHKVYTAALSSVLSPCRERSISDTELLAREVNDELCGREQRSSLHVLFN
                     WAYWQETSNSA"
     gene            <14714..>14941
                     /locus_tag="LMJF_08_0050"
                     /db_xref="GeneID:5649293"
     mRNA            <14714..>14941
                     /locus_tag="LMJF_08_0050"
                     /product="hypothetical protein"
                     /transcript_id="XM_001680982.1"
                     /db_xref="GeneID:5649293"
     CDS             14714..14941
                     /locus_tag="LMJF_08_0050"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681034.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649293"
                     /db_xref="UniProtKB/TrEMBL:Q4QIG4"
                     /translation="MTSIKELNDRLTKQPYVSGYTPSTDDAKLFSEIFGDNVNVVQWA
                     ARMATYYPSERAKMQPAPVESEDSSEIEDDV"
     gene            <16485..>17042
                     /locus_tag="LMJF_08_0060"
                     /db_xref="GeneID:5649287"
     mRNA            <16485..>17042
                     /locus_tag="LMJF_08_0060"
                     /product="putative phosphoglycerate mutase protein"
                     /transcript_id="XM_001680983.1"
                     /db_xref="GeneID:5649287"
     CDS             16485..17042
                     /locus_tag="LMJF_08_0060"
                     /EC_number="5.4.2.1"
                     /codon_start=1
                     /product="putative phosphoglycerate mutase protein"
                     /protein_id="XP_001681035.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649287"
                     /db_xref="GOA:Q4QIG3"
                     /db_xref="InterPro:IPR001345"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:Q4QIG3"
                     /translation="MAHIHVCRHGQDMDNVRGILNGHRDQPLSELGRRQAAAVADKIK
                     ESGVNYAAIYSSPLQRALETASAICAAVNVQVQVRADLIERDFGVLSGKPYADIPKYA
                     GDRVLQGDKVLYFLEVESCETFDKCYERAQGVLADMDAAHAGEHVLLVCHGDIGKMLQ
                     AANAKVGWQDGLRLPYFANTEVIEL"
     gene            <17651..>19540
                     /locus_tag="LMJF_08_0070"
                     /db_xref="GeneID:5649288"
     mRNA            <17651..>19540
                     /locus_tag="LMJF_08_0070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680984.1"
                     /db_xref="GeneID:5649288"
     CDS             17651..19540
                     /locus_tag="LMJF_08_0070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681036.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649288"
                     /db_xref="GOA:Q4QIG2"
                     /db_xref="InterPro:IPR007374"
                     /db_xref="InterPro:IPR009349"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="UniProtKB/TrEMBL:Q4QIG2"
                     /translation="MPPKRWARPHQKDASGENAYTTAALLQFICDEVRSNNCLGFSEE
                     ELTGMAAELVRVKTRAEVSEWAKTLMLSDAFAAEVTRRREQSGPAFEAESVLNAPSSS
                     TASAGGGEGGTLNITKRGTGGAKRGKRGVHVDQNRKTSTSAEALKPGRFECGCFATVH
                     NMRGSCANCGRVICEQEADDVCYACGLEPSRCIAYEISVQEGKLSEAAQQLNQEDYTS
                     AVERRDRLLEYAQNRAKRTTVIDDQSATLFSPQSAWMSPEERRAAEKSAAETERQRNI
                     ELMHRQCGAYQVHTEFVSQNLALGARKENSGGADGDGVVTEDGVEDEEPHDADQRVVP
                     TGAEPLPSLLQKIWYSPDGTRVESAASGKKDKSGGGRGGNAADLNSPAQEGLSMPMTS
                     RPTQRRFEEVSRRVQQSYFEDDVEVFAEETAEAEKTKSKLIVVPQALLEEDQDAAIEH
                     GTEAAGSSTSPPLVDPSAVASPSRFAVTSIMRNTDDGICLSMHQPWASLLVAGIKRHE
                     GRVWGTTYRGRLWIHAAASQPINVKEVEVQYSKFMSPGQVFPKHYPTKVLLGYVYLTD
                     CLDREACETAFKPEERQEESPYSFICVEPKALPFPLPMSGNHKLFSLEHRVHVAARKQ
                     LGEID"
     gene            <20993..>23050
                     /locus_tag="LMJF_08_0080"
                     /db_xref="GeneID:5649289"
     mRNA            <20993..>23050
                     /locus_tag="LMJF_08_0080"
                     /product="putative ATP-dependent DEAD/H RNA helicase"
                     /transcript_id="XM_001680985.1"
                     /db_xref="GeneID:5649289"
     CDS             20993..23050
                     /locus_tag="LMJF_08_0080"
                     /codon_start=1
                     /product="putative ATP-dependent DEAD/H RNA helicase"
                     /protein_id="XP_001681037.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649289"
                     /db_xref="GOA:Q4QIG1"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QIG1"
                     /translation="MNYAPIRTDFYVVPPDMTNLTAQEMRELLRELDGAKVRGQDVPR
                     PIRSWHGTGLPDRVLEVLEEHEYKCPFAVQSLGVPALMSGRDLLLTAKTGSGKTLCYA
                     LPLIRHCADQPRCEKGEGPIGLVLVPTQELAMQVFTLLDELGEAARLRCVASYGSTSL
                     SDNIRHAKVGCELMVATPGRLLDLLTVNGGKTLSLSRVSFVIVDEADRLFDSGFMEHV
                     EAFLKNIRPDRVTGMISATMPKELRGVVAQHLRNPVVISVGGKPTPASNVEQQFFFFD
                     EEVYDANNIKADMSPRLVKLVALLGDEGGDGQNLILVFTQRKEEVDELLGRLTTLGYA
                     NRVATLYSGMDPIDREFALEHFVPGKQFILVATAVAERGLDIPYLGLVINYRLPNHYE
                     AYVHRIGRTGRAGRSGRAVSFFTRGKDDDIAPELVEGLERAEQRVPEELYEVAEKVRA
                     LRKSGDARYNSGFFRGYRDAKAQRFTDRDKKEKMREAARAAGLEQFLSSSSESDSDAS
                     SDENANITAVPVQSRARAASAKEAAANAMALTLHRGAHSGALTLSSAQEDRISKALAF
                     AQKTTTATTMAADEATMVRFQSEYPINDLPDAVRGKLQSGTFMRSIAEETETSLIRKG
                     VYFDPRYKHSRRMKEGEKPLYLLIVGRSMEAVRAARSKLDEVKAELLSKQKKTGSVTG
                     ATI"
     gene            <24321..>27677
                     /locus_tag="LMJF_08_0090"
                     /db_xref="GeneID:5649290"
     mRNA            <24321..>27677
                     /locus_tag="LMJF_08_0090"
                     /product="putative adaptor complex protein (AP) 3 delta
                     subunit 1"
                     /transcript_id="XM_001680986.1"
                     /db_xref="GeneID:5649290"
     CDS             24321..27677
                     /locus_tag="LMJF_08_0090"
                     /codon_start=1
                     /product="putative adaptor complex protein (AP) 3 delta
                     subunit 1"
                     /protein_id="XP_001681038.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649290"
                     /db_xref="GOA:Q4QIG0"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017105"
                     /db_xref="UniProtKB/TrEMBL:Q4QIG0"
                     /translation="MSLAAFTQCSLAAVVRNLRSAPGGTEEEAVDRYIADTKNEVNVA
                     DPFVKMVAIQKATYFHMLGYSSQYADFRVVEMMASSIFLHKRIAYLAACLTFTEDTDV
                     IPLMTASLKRDLSSSNQFEVGLALYCIASICTPDMAHDVVADVVNLLGHPRAYVRKKA
                     TLSLYRVFLSYPESLRVTYVRLKEKLEDNNEKMDTDPAVRGAVVCVLCELARRNPANF
                     LGLAVPFYSLLSSVHSNWTLIKIVKVFGYFAPLEPRLGKKLVEPITNLINTTGAKSVQ
                     YECLLAVANGMSQVSSLKKLAAEKIRGFVEDADPNLKFLGLEALSLLVASSESRKLLA
                     DQREVVLRCLDDPDSTIRLKALYLLRDLTTRKTVISHINEMLDRCVRTPPDEEWSNAV
                     IRTIIETAQTDDYEWIQDFEWYLSVLLDLCVVELTVYTHGGFMEQELVCILSRVNGVR
                     RAGVEEIVPLLTNVRLLGGDRQHSTQWRILCAAAFICGEYPHWLPDIAEACRALLAEP
                     ITLLPAEVQLACVAAVGKIAAYVYQPCARHVQLCNGEEECRAAEEGEQRIVPSLAELT
                     RRVLLPEAEEAAARAHRGLRRFCHSAFPSVLERAHLVHYQVMEHPEVGPKLYEAVLPP
                     VAAGAQDAIELPEDVDLDAPFCENVAMLMALSGSDEDDGSDGGALGGYGGLGGSGDDD
                     LNADFNLEYRIEQQRRSELARREEMAPYYLRDSADASVVASEDFGAPSRPLRSAQPIC
                     CDGGLGSPAGAESRHRQHTRSRCPQKVFSINRQLSKPSDYEEKKAAQWRRSNSPEEDE
                     ATRKLRGIDVTRALRADERLPETLSYAQLLQQQQHKGKGGNELYADAMVASHAVEAVP
                     VALYKERPLGLYVTVTGCKVRRDGFHLSGTVECVNATSSSVVRDVRLTAMPTAAFAMG
                     DVTLRLEAVKSDVAEDASGGASVTVVERLKGSATVRVPIVVRLSHLPSSLADAPLSLN
                     LSWTAERKHHQVALTLPLEYVYFSKPVMPGSVLTSHEYLEDVVGKALAAAPIATAFVP
                     CNKTAIMTGVMAAMPQLRLSPIDVFKDALSMYGLLHGRKSELAHTHVAVLLQEQEVDG
                     SKGILVTVRCHYPVLSEALIVKLAELVGVH"
     gene            <29601..>30956
                     /locus_tag="LMJF_08_0100"
                     /db_xref="GeneID:5649291"
     mRNA            <29601..>30956
                     /locus_tag="LMJF_08_0100"
                     /product="putative dual-specificity protein phosphatase"
                     /transcript_id="XM_001680987.1"
                     /db_xref="GeneID:5649291"
     CDS             29601..30956
                     /locus_tag="LMJF_08_0100"
                     /EC_number="3.1.3.48"
                     /EC_number="3.1.3.16"
                     /codon_start=1
                     /product="putative dual-specificity protein phosphatase"
                     /protein_id="XP_001681039.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649291"
                     /db_xref="GOA:Q4QIF9"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR020422"
                     /db_xref="InterPro:IPR024950"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:Q4QIF9"
                     /translation="MGGGATPATACSQVVDLRALDPSPCPSRGSRSPLRSGHVHQRGS
                     RCEDVPATQILEFLYLGSVKDAQDAAFLARHQIRYIINVSQEEYWSVDKKVQIFTFKV
                     DDSATADIAALFQPTRDLITSIRGRYYRYARGESSTRPAVLVHCQKGRSRSATIVLAY
                     LIYTNGWSVAEAMKYVGARRPCAEPNIGFMEELRKLQESLSFEERTRRYSELCWFMRN
                     LNAETSQAHVRELFEKHIGMVRHVVTYVVAGGGAGSAGNSGTVGTCGDGSRVAVEGDA
                     RFPASWPAVPSTGDSGPADPLVAFDLGVAPGKQNDGVDEQRAAKDGDTHVYKDAGAAV
                     SLLRGRSTEKAMLCFVFFTCREDVLHGIKSGQFQQLLLQLPPAAGKQIKYATGPKLKK
                     IMTEHQSMSNSFVQDMAGFSDHLTTPTGGESAAADADGAVRTQGVVAPASKEAEVTLP
                     A"
     gene            <32352..>34283
                     /locus_tag="LMJF_08_0110"
                     /db_xref="GeneID:5649294"
     mRNA            <32352..>34283
                     /locus_tag="LMJF_08_0110"
                     /product="hypothetical protein"
                     /transcript_id="XM_001680988.1"
                     /db_xref="GeneID:5649294"
     CDS             32352..34283
                     /locus_tag="LMJF_08_0110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681040.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649294"
                     /db_xref="UniProtKB/TrEMBL:Q4QIF8"
                     /translation="MGSGLRGGLSPSVPAAQPYYNDIASIRDLSTVPLPHQRPSHSRA
                     HALVVDGTEVEVQSDVVSVSQAAPNLLAFQQECQSLLALLNASSHPRRVAPPPSNAAA
                     PSQTLPSPVADADASGALEPAVQQERQPVTIPVAHEPVSTLSSAEWSPPSLSVVSERV
                     GVGVAAAAHAHSATYAQLMQEMDDLAGLLNEEEEGLRGQHSAVSRQHSEAGATQAHGV
                     RGDYAAPIAPLPSVRATSSLADTPEKQRRHAVETHRGDRSQNPSLSPLLAPRAAQLVH
                     APTSPLWAAQLLKWIIYLVERRQSALQRIQAFEDARAPGRRGACAGTVAGKSAATAPP
                     SAIRATEGLLRLLRSLNTETGDVDKWAATEKRHMCTRIANLLAEMTATEEDAMADLLN
                     DAAAGATLEREITVTEPSATVSAAPPPSSAVSEAYRQDMMDTLTLLDQVSQENKTLKL
                     RVEEVQGQATRLGDEVERERTANMELGKYFDQLAADNSRLTAELHRMEAKLRQAEAVA
                     KSVSQEELLRNQLDRQTLHLRDVRAELDDVKDESDTLRKTILQLRDALVRHRAVIDLL
                     TRRRRERERAAAAASRRSGGRGALSPRLQSPSTQLIEDILSGVCDPPSSSSSSPPSAV
                     KYSCDDDAGGDSGALSPPR"
     gene            <36157..>36969
                     /locus_tag="LMJF_08_0120"
                     /db_xref="GeneID:5649295"
     mRNA            <36157..>36969
                     /locus_tag="LMJF_08_0120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680989.1"
                     /db_xref="GeneID:5649295"
     CDS             36157..36969
                     /locus_tag="LMJF_08_0120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681041.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649295"
                     /db_xref="UniProtKB/TrEMBL:Q4QIF7"
                     /translation="MMFRGTSCALARSFRANLKYPSLVSYNKLPWEVVSHDSTKLHMH
                     LAPNYEQLLTLAAVTDVPHLTLASHLIVPEAERLRVMPGVVYLLGGQAAHENPSSFTA
                     YRIADPTSLQYYGRIHHNLAPIRRVDMCASADLRLLCLAMHFDGVLTNTSAGSTLDGV
                     TTASQEGHFSLFYFFRPNRPANELTQPFEKFYRHRPSLASLDAFNAASPGKAESWTPV
                     LQVPRRTAEKARLTPAEPYRPPQNYLMGLAERLGVRPGNAFGRRSLMWGTWF"
     gene            <38404..>41844
                     /locus_tag="LMJF_08_0130"
                     /db_xref="GeneID:5649296"
     mRNA            <38404..>41844
                     /locus_tag="LMJF_08_0130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680990.1"
                     /db_xref="GeneID:5649296"
     CDS             38404..41844
                     /locus_tag="LMJF_08_0130"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681042.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649296"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q4QIF6"
                     /translation="MLSMFKNKKGFSVLFHGEEEARESDRVTVSSALPRHSAQLRDTA
                     ARPKRSEVAQHQCQRCLKRFSALESDDETEATYQCHRCQYPTCTQCREPAAGNPPWVC
                     CVCSSCKSMMWLLERTRAGPMLVTRIVEYCDPRGQRLMRLMFRFTLQQYQSPTPRPSI
                     TLVGRASDGRADSGAPSSSRPASQTPPARPTSQTWTSSRLSGERSSARLSHVPPSFSN
                     VRRSSPCTHPKRASLLHSVRRSNSDAALAFDADAGAGAEDAAKENSPAVERGVRGSEV
                     LRRIEEAVGVVEYSPESKWRIPGDAGTEAENSEDPLSLLPNGGARFSLLEDRCTAVAD
                     IYSAGTPHVSSVGSTLRAVVVESEAPSLHTRPSGHAAFQREALQPQLASTNCATTPTE
                     GEGAVLPATAAPAPEASWRKMTPQAQERCRLGHSVSPNSSGSGRSASPAPRFPTFGQF
                     LDEHVGMGAGDTHLPRDSNVLVTVSPETENSDEDSGGVIELGGGRCDDRLATTGGKAN
                     EGVHTPRGVQPQTSPSTGGAGSSCFRGGRRTSGLSEFTPTRVLDMSSARVTLHHRSSS
                     RRRTTRGSVQEIHAPHLYGNSSAKTSTAGNVRRSGQLHDSPYMYGLPTQFGPHGKPAG
                     PVNGQRRRQNAPLATRTAGRALGSDGRQRLVRQHSRTVAPLQRTASRNNELQRMPSRN
                     GALSRTNSSFAHLTRTASLHGYGASFARTNSCTSHALASTPAERAHLTGGVAGRGRLQ
                     RTDSAKPSVTGASYGAAARAAPQWTAAVERTHFGYGTPAATGASSWYSSPLKRTLASL
                     SPLKRTASHVCLRRDGSAPFGRRPHVGRFTRSATTNVVFVRTGSAAAARAGAPPRHAP
                     GAFTRTATGTNLFQRSRGHIHEGPRCRPVPTPLPSSAAVCGSGRGAPRICHRVVDTSP
                     VRRVPTAARTATPTMGRRRFPTSTALSRTATGTRNFERQQSNVPREPANRSPGVVRRT
                     VDPAPALVGATRRKAVGSGLHRTPLATGAANAVPATPRTPRRYIIASVSTAGTPAAVK
                     GGGSYSVSRPVLSSVASSHDSNASGGTAGYSSYTGSAHGAAEKAGVVEAGMGRASGQR
                     CRPLVGATTGKEKVPSHVATLNRRAAAATASAAATAHRRTGRAAEASPFTRQNSRLNF
                     "
     STS             42089..43052
                     /standard_name="ha2565"
                     /db_xref="UniSTS:515563"
     gene            44646..45888
                     /locus_tag="LMJF_08_0135"
                     /pseudo
                     /db_xref="GeneID:12982578"
     misc_feature    44646..45888
                     /locus_tag="LMJF_08_0135"
                     /pseudo
                     /db_xref="GeneID:12982578"
     gene            <47295..>51077
                     /locus_tag="LMJF_08_0140"
                     /db_xref="GeneID:5649298"
     mRNA            <47295..>51077
                     /locus_tag="LMJF_08_0140"
                     /product="putative DNA repair protein"
                     /transcript_id="XM_001680991.1"
                     /db_xref="GeneID:5649298"
     CDS             47295..51077
                     /locus_tag="LMJF_08_0140"
                     /codon_start=1
                     /product="putative DNA repair protein"
                     /protein_id="XP_001681043.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649298"
                     /db_xref="GOA:Q4QIF5"
                     /db_xref="InterPro:IPR006166"
                     /db_xref="InterPro:IPR010994"
                     /db_xref="InterPro:IPR011335"
                     /db_xref="InterPro:IPR020819"
                     /db_xref="UniProtKB/TrEMBL:Q4QIF5"
                     /translation="MSVEENVTSAVADTFRTCSEFIGAVSAREMPDNPSVQLCILSIG
                     FDVESVIAQLLHQRMARNKPHRRVYCVVVPGRLLPGVMTRFASAIEHHLALRHAGETL
                     PRQADASAAAASRPAPPIPVVAVEEGTGAKERCAVFQRGTVVVLTSRSLCADLLHRRL
                     AVELVGMAVLALPHSLLGSGRQEDALAPQTAFCAELLLRSGSGAAGGQRPPPIVLVSD
                     APALMQSLVQRHHLGAERFVQQMHVGDVQLFPRFRLELVRHFEELSHTPRRSLTVDRV
                     VAPVSASVLALDDLLAKIVLETLHELQRLEQQLHMQNSASGGDRAAGASAAGGSHPHT
                     WPFPARCAAAAAEADEDTGALRFLPRSRLTASTVNGHFDYSGYPRSNTARGTGAPSYI
                     RHGWRAATQRDAKGILFSGISETAALSVNVSDLDGDLRAVVRCHESHWPYRLLTESLI
                     DVRRLRRAARGTAYTFLLELESVLERRLPRRSVYGTGTTPPAALWTLSSHFHDVVTVA
                     THRIGTVVYKRSAASVALSAPTEGAATRPASSAEDGVVVVDSSSDSEEEREGLQDVVS
                     ISAAAAPPGQVATSAGGTMVPQLIPNAEEYETDVEVVVRLVVSWCRTVLRRAARKSNA
                     ATDASADRPTLLLLTLGTNAVARYTERLTNSLEAYQQLQLRRFMRVYQFKYGVELTEL
                     VEAHSAEAAASKLATELFTSAEDVDDASSDAEGDVATDEDSGTDSRRDSSAAASLRRH
                     VSSRGDRATAATRRDASPLYADGVGGSQGVMMNTGAGAFHDALLSQLPPLIATNGERA
                     DVRCDSEPRPAPPAPLATPLLMLERVREGVVTLCPDCRDANGNGSATATAPFERMPRV
                     LVFDASAMSATEMTMLLDGSHAALQLDAPSTAAPLMSGAPTNGAQGTDSVRACLRVER
                     VVLARQELVLLRQLEMAQDELPAVRLATIKVQLVTTSLAELDFKKAVEAEQQAFQSLA
                     HTKATLTGTLLVDQTSLRQTEEALESGTQVGRSRPGSRKGTAVGRLAGTLLYAPALPP
                     PALPRIVFDEREFRSSLPYHLYRRGMELIPLTLTTADYVLSPEYAVERKSAQDYFQSV
                     MSGRIQRQLAALARKYAHPLCLIEFHRGIPFRLMQSGVYAKTAALMAAYPRVRLVWAR
                     SPAHAAGMLVLLKKSVAVANVDPADPLLTGTSIDPGSAADVGGAAVTAAERETAHYAA
                     RVLSKFPGITHQNAPRVMQLCGSLIGLATISQASLVAVMGEEDAARLYNFLHSPFH"
     gene            <52385..>53707
                     /locus_tag="LMJF_08_0150"
                     /db_xref="GeneID:5649299"
     mRNA            <52385..>53707
                     /locus_tag="LMJF_08_0150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680992.1"
                     /db_xref="GeneID:5649299"
     CDS             52385..53707
                     /locus_tag="LMJF_08_0150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681044.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649299"
                     /db_xref="GOA:Q4QIF4"
                     /db_xref="InterPro:IPR019328"
                     /db_xref="UniProtKB/TrEMBL:Q4QIF4"
                     /translation="MLPPGATGTVGATEVLSPSLNVYRAGSSGVTLTIAPRTTVLVAD
                     HVTNTSAVVRLEQVDYSKAMRAYRVCRQEGGVVAEEPSKGWHAGSTTPATPLPPPLTS
                     SHGVSSSYAMSPTAFTGTASPKGRASYAARDETALGHDRAPWRVVFLRLFGATDMVLL
                     TVVVACFLVVVSRLSMIKLGRTDGQSAMSWSSLSWLKVALTALTSGRSVVEEVVAPSG
                     LSPASAEDLAQGVTRGSPATSLLTTATVISVPGTKGVLFTSYTQATGIPALDTSVTLV
                     LLLFSIFLLIKRLSCALSRVYVEEVLVMRGVGLQFSAYGIFNTLRYRHFVDLLMLRSL
                     VIHDAFFRYQPMFFLSSSVENKAERIVYFPDTLPRLAVLRPALNGIRGVLYGEPEEGP
                     SLGELEERWKKSASNIPDGNFSTEDSFAEDTVTTPDDACSDATDRDED"
     gene            <54952..>55653
                     /locus_tag="LMJF_08_0160"
                     /db_xref="GeneID:5649300"
     mRNA            <54952..>55653
                     /locus_tag="LMJF_08_0160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680993.1"
                     /db_xref="GeneID:5649300"
     CDS             54952..55653
                     /locus_tag="LMJF_08_0160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681045.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649300"
                     /db_xref="UniProtKB/TrEMBL:Q4QIF3"
                     /translation="MIRHRCRNCFAGRAPKPLSVTAWVERRGVSTRQAERLGRASSRP
                     TASGTATSHASPSGIRGASRAARGPAQRATKLSSPSAGASATSATAQSAASSGRAKPL
                     PGRFNRLVVQLGVLVTVYHYILGESINLFLTYLLHSHRLGIGDTGSWLGAVGVPVDRF
                     LNVGPTVYGLQLSPRLVLNYLVVNACMYPSMPLQLRLCIATAPILRGPFQVMGRLLGV
                     SKKAAVPKAPSATPS"
     gene            <61659..>63593
                     /locus_tag="LMJF_08_0170"
                     /db_xref="GeneID:5649301"
     mRNA            <61659..>63593
                     /locus_tag="LMJF_08_0170"
                     /product="hypothetical protein"
                     /transcript_id="XM_001680994.1"
                     /db_xref="GeneID:5649301"
     CDS             61659..63593
                     /locus_tag="LMJF_08_0170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681046.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649301"
                     /db_xref="UniProtKB/TrEMBL:Q4QIF2"
                     /translation="MLELLVSFSPQLPRAMLAAGPGARCATERRCCVGSKSTLSFMVE
                     RVPARYARERGVCLAPAVGVREVMMVTCCAAGRKDGAQAALEVGMWWVDRCLSTAVQQ
                     AGGGTAVLFCCLKIVDVAVERLTLYTSEDSPLSASAAIGSMRMPRHFFGLQLFRLGEL
                     RHVQLSPSVRRLVVEVDVRSCLRWPQSEVNNFLASLQSPLRAVRVATCSVSPVKLLNK
                     FHASLHVLYLFRRATTVRDPADTRAPVNMEDEEYEEEESNTSPSLTLAIDAPATAQHA
                     TQLHAAVHGVAQLSPTARTVAAQSTSTTSTTATGARSRRTRRLRLSSAAAAAPVLEEL
                     HVTGSARRSLPRWVETCTRLRHITLRNCAYNRVDSLRSARKLTSVLLDGCASFVGFDC
                     LCGFPELRSVTVKNCGLLRDLSWLPRLRGSLCYLCIHHLSPALATTFASASSLGMGLS
                     GLEELNLSMPSLHALRSFVAHSSATLRELTLFTCMNLSGFSDLPALPALERVVITGNY
                     HMQNFVWLSRSPRVVEVRATQCSQLMSLTGLNALHQLRLLDINGCQSVRTIAPLVECV
                     SLTYLDVSNCGVLTRVSVLEKLPCLQCVLMHNCTSLAKDFGWIEACPKLVELMVPGPS
                     WVEAARGVLRRLGRRNVVLR"
     gene            <69778..>70662
                     /locus_tag="LMJF_08_0180"
                     /db_xref="GeneID:5649302"
     mRNA            <69778..>70662
                     /locus_tag="LMJF_08_0180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680995.1"
                     /db_xref="GeneID:5649302"
     CDS             69778..70662
                     /locus_tag="LMJF_08_0180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681047.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649302"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR011004"
                     /db_xref="UniProtKB/TrEMBL:Q4QIF1"
                     /translation="MPRNATTVPGFFPYFGFMLKDVGSRLSMISHYMQTKRHPYPMMR
                     HQNVRAYRGMLPWTQDACFIAPNAFVVGNVVLGHDTAIFYHSVLRNYHTKSATILGDH
                     TVVMDRATLMGQIRVGQGTYIGAGATLDCCEVHDNVYVGPGASIALGAVVENGAIVAA
                     GSAVPKDARVYAGELWAGNPAQKIADVSPAQSSEVQHMVHDQIQVGKAHLQAIRDHVE
                     HTKELDVNWLKEAVAMMEAQQQQMSIKLPMEVPLEARRFLQPRVHMRRPEMHMRMSYP
                     VNRTAPWMPKSGDQTANV"
     gene            <71765..>74557
                     /locus_tag="LMJF_08_0190"
                     /db_xref="GeneID:5649303"
     mRNA            <71765..>74557
                     /locus_tag="LMJF_08_0190"
                     /product="hypothetical protein"
                     /transcript_id="XM_001680996.1"
                     /db_xref="GeneID:5649303"
     CDS             71765..74557
                     /locus_tag="LMJF_08_0190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681048.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649303"
                     /db_xref="UniProtKB/TrEMBL:Q4QIF0"
                     /translation="MRGFLSFEAVTLLLCWVALLILTKGLATTLLRHDLVAWVQSVLG
                     KPTMRSGTLMQDRTLDDALPEELMSLFWMRRAMSQPYSSWYLHSSEAYSGVPVPMRLP
                     KDVVAEGQILYPFHVLYLYACGVWLQWVRPELAIKLLTPREQPRLTHSDAIELRSTLA
                     WVSVGCVVLVGAPGAWLFAGALSRLLRHAVCDRERASRLHLPAEGCANVAASALVAAP
                     PAHAATASSRSPDETIIGREKELAGVAAREERDVAAFLGSLLTVLMGILPLLVVEVCT
                     MQPWCLCGSLLVWALVFVLQNELQLHAGAAQTTDAFFDMTTPIVVGNGVEFFALKQEP
                     SVCPLIGLSVTVTVMSLATPSCLSATLLLFLWCLSACWQRGYRRVLVKVKLPRGTSSP
                     SVGQDGYVRMGYSCYRDTLWMNRCFCSATLFAVCLVLAVTTPWWLHQQPVLTFMDLFA
                     SPQKPPSSAAANGEGAEPAIDLANLSFTGGHEMHAGCLAGPYSYYNCARPTPNMWRLS
                     EWLGFPWTSMAKALAGIFTMNQSYINAESALWLNYIVLVLLTLANAGSILVLAFYRVR
                     KPPLSFETPVVYAAQRAAQRAEHQAYWAAKRAGRCDGARPPAPPAPQPKLETASTAQG
                     SAGAKRQRVKVVTCLSREEYVVKQVVLLCWMLSASTISGAVLFLRNAPSSCVLVFPSV
                     SLLAAVSVVIRVLRCERPLAFHPVPQQAAKTVSGAWKLKKDASAPMQQDSDDSRPPAA
                     SRWCTTAVAPSLAHAADVPCLYLVFTASVLSTGALTWTIVPMLLRHGILLLLCWRTSV
                     SLVLLRTWAPVDTTCNIFARLGAVSCAALGLLLAAQAVPQSSASAGARRLARFTDKMG
                     DVYAHTGDNVLRALIYQCIASCFMYACGAVHATLRVARLALEPEEVHLVPIEEELRIC
                     KGSCDAAAAGHAKRQQ"
     gene            <76102..>78063
                     /gene="ISCL"
                     /locus_tag="LMJF_08_0200"
                     /db_xref="GeneID:5649304"
     mRNA            <76102..>78063
                     /gene="ISCL"
                     /locus_tag="LMJF_08_0200"
                     /product="inositol phosphosphingolipid phospholipase
                     C-Like"
                     /transcript_id="XM_001680997.1"
                     /db_xref="GeneID:5649304"
     CDS             76102..78063
                     /gene="ISCL"
                     /locus_tag="LMJF_08_0200"
                     /codon_start=1
                     /product="inositol phosphosphingolipid phospholipase
                     C-Like"
                     /protein_id="XP_001681049.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649304"
                     /db_xref="GOA:Q4QIE9"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:Q4QIE9"
                     /translation="MSHASTFAAGELPIRVLTFNLWGIFNSRMREARMKVFATKIEHY
                     DVILLQEQFSVEDFDLIFQNASPVVQRTYTFRRFCSSFYGSGCAVISRYPISQAFFHT
                     FPLQGYPEMVLHGDFFANKGAAMVRVMVPVTMADGGAAKAQEVTLYTTHLVAVYEKVS
                     QLSSWRRERYLPFRISQAISFADFIVSTSRPTDPIIIGGDFNCSQRSLEVQMMLILLK
                     RYGYDMHSVLPPPRALRDAAAAEQEREVGQRFFTYSDRNTFNSMKTSYFKLLKLEADI
                     PSQIDHMFFSRPAFALLQFADCPDVADGYPCVLQDAPNGLVVFTKNEVHVPPHSAWYG
                     SLWHQLFSGKRVPRGANATGQLAKLRCKAASSTEGQSADDAAHYYPMSDHFGVAALLG
                     MRVEKVDSTTAMICSSAGTGGTAALALTPEEARAVQTVVAFLEDYVRKLRSQAKTARY
                     MAVFSLLLVATNIWVLRRLSAKEEARSAAVLERIYDMAAAATRDTAMVVQPGKGLESI
                     KHGFNTAKDWVNNQAHLTLHIVSKFTGGTPAPGINACDTPEGSKQPAANVADPSEPVP
                     RTVPASTTATTAKRATTTPEGDAAARPDFRAIAEALTVRPLYASAWVSSAFNITAAVV
                     GTVSFAIGVFQRAGNANVLEEQAHQLKKL"
     gene            <79972..>81483
                     /locus_tag="LMJF_08_0210"
                     /db_xref="GeneID:5649305"
     mRNA            <79972..>81483
                     /locus_tag="LMJF_08_0210"
                     /product="hypothetical protein"
                     /transcript_id="XM_001680998.1"
                     /db_xref="GeneID:5649305"
     CDS             79972..81483
                     /locus_tag="LMJF_08_0210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681050.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649305"
                     /db_xref="UniProtKB/TrEMBL:Q4QIE8"
                     /translation="MPPRRRQLHACAGLALRSGRGCCPRPMATRTIYHLPNIPRASCA
                     AASRNHRGPASASEEPLHAIEVHTGAGEGRGGCDSGEGAAEEVVVCAAPPTAPQLASA
                     VTRGRGDGGAVRTLKRHLRPYEEEGSGAVLPERELDGTAAPPPRHICLKPAELDTDVW
                     HGSGDIEEVRPHTSADGRRAGRGRTATAEHRRGDCTSDYARGTRSRHCLPAQKKFRCD
                     ATPTPASCAAATHNFEERCDAAFAERGCVAVAVFSRPPDSRALEDARPSSPLLLPSSP
                     VSTNSSETSAPRSSTWAATCCRRRDSGDEDDDLFRCSTTTTTTSASEIDSDGRPEDGH
                     SSLLQGVLVECEARSAGSGSGLQLAMPRHLAVQQSSAGEVLQDRPLIAAPPSSEQNTA
                     APTNCGSSKIARLTNFYLEPRYRRHAQHMALHDLPLATSTTVSSLSSTPSSAFLPLFT
                     ASPPSCPVACGVKRDAASCTGDDEIGMRSPIWSIIMKYYAAHHERQLPPHAAL"
     gene            <82777..>85290
                     /locus_tag="LMJF_08_0220"
                     /db_xref="GeneID:5649306"
     mRNA            <82777..>85290
                     /locus_tag="LMJF_08_0220"
                     /product="ubiquitin-activating enzyme-like protein"
                     /transcript_id="XM_001680999.1"
                     /db_xref="GeneID:5649306"
     CDS             82777..85290
                     /locus_tag="LMJF_08_0220"
                     /codon_start=1
                     /product="ubiquitin-activating enzyme-like protein"
                     /protein_id="XP_001681051.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649306"
                     /db_xref="GOA:Q4QIE7"
                     /db_xref="InterPro:IPR000127"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR019572"
                     /db_xref="InterPro:IPR023280"
                     /db_xref="InterPro:IPR028077"
                     /db_xref="UniProtKB/TrEMBL:Q4QIE7"
                     /translation="MAIPPAAPSSVQHSPASRSTASPCPEGPLPAELRAKPIFVVGAG
                     GIGCEVLKVLVLSGFTQVHLIDLDTIDATNLNRQFLFRVADVGNSKADTARRAVLDWF
                     AAADDPAPEHVSALRGRRTPPSIVAYHDNVKADRYDDAFYRQFAVVLSALDNVSARQH
                     VNRMCMRNNIPLIESGTMGYNGQVQPILKNVFECYDCQPKPPETKTFAVCTIHARPTT
                     MVHCVHYAKELYEVLFGSDSSEMDGKGASAISDAGAAAEAGNGSATALQADKQQHGAT
                     RPSEGGELSYLRTMVSDWRRRQLPATSSTLDHNDGDDRSGREGSRASCAAALAVELLR
                     LLFVTKVEELLSLKSSWPTEPPEPLSRRDVDRVAAAHMSANATGASSAPLSGDHVLSV
                     QDCMELFVRSVTQCLARPTGLAFRKEDDAATSFVSATANMRAHVFHIAEQSLEDVRSI
                     AGSIIPAIATTNATIAGAVVHELISLLRSSSSISQPASTSAAQPAPLSQAEVTDVSAS
                     ASMQTSPRGRVVYARKVPQVRRRRVPLSPGQRHTTPALFMEYVGDGATSANESTSPSA
                     DHCAPLQAALALVGAERSTAYLLRMSGVAEGGGKAGGSVAVMDHYLVHSTAPNPPNRL
                     HCRVCQDVHPEVRVTLDLRSSTLGQLVHLVLESALKLEAPSVSYGPTVLYEDEDYEVL
                     ADHILAEVLRLPPAEAGWVAHQRQSYTLTADALNKDVPWSVVLTHDDKGAAAPAPSPS
                     TVFFQISGLEEAEAAEERALARLAAQQAQQEPPDAEDENGALGAPPGTTGLASSAATT
                     TTPVAVELIVSDDDEVLDMTPAMNAPSNVAAGEDIVLLD"
     gene            <86331..>87899
                     /locus_tag="LMJF_08_0230"
                     /db_xref="GeneID:5649307"
     mRNA            <86331..>87899
                     /locus_tag="LMJF_08_0230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681000.1"
                     /db_xref="GeneID:5649307"
     CDS             86331..87899
                     /locus_tag="LMJF_08_0230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681052.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649307"
                     /db_xref="GOA:Q4QIE6"
                     /db_xref="InterPro:IPR004147"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4QIE6"
                     /translation="MTFRFSRAARYGAAAAGFMGTSTAAILLLPKETIPPVLLPSRVL
                     FEGIGRVGRCVYAGGQIYCDYAFHVTQEDEQELWNEVHRRCAERLVDLAEKNGGLYVK
                     AGQIFANMSHILPYEYCQVMAVLQDAVVKRPYAEVVAVLEKDLGRPLSEVFSYIDPTP
                     LAAASLAQVHRGRLRNEDAEVAIKVQYIDIAQRFNGDMRTISLMFAAASYLFPGYDFG
                     QIIAKLNDTVAAELDFRIEGRNSDRAAADLRSCGWGERVVCPRIFWNYASRRVLVSQF
                     IPDAVKISDRAGIASMGLNVKEVATTFFEVIAFQIFRTGFFHGDPHAGNVLVHKLPDG
                     KPQVVLLDFGLCAELNAAQRREMSDIWTASTTHDTPKITEIAHRYDCDDYELFASCFL
                     QHPYEYFANSISSRLDKPYALEKMRETAKNRMTDLNGIVAALPKEYALVLRSIMATKA
                     INRELGEAANRPMCMLHYSLKTSYENLPKIQFLVLMAKAWFAECYASLLLRFTLWRHP
                     ELSEVLESSLQLSG"
     gene            <89260..>90048
                     /locus_tag="LMJF_08_0240"
                     /db_xref="GeneID:5649308"
     mRNA            <89260..>90048
                     /locus_tag="LMJF_08_0240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681001.1"
                     /db_xref="GeneID:5649308"
     CDS             89260..90048
                     /locus_tag="LMJF_08_0240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681053.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649308"
                     /db_xref="GOA:Q4QIE5"
                     /db_xref="InterPro:IPR000244"
                     /db_xref="InterPro:IPR020070"
                     /db_xref="UniProtKB/TrEMBL:Q4QIE5"
                     /translation="MRRSAWVFVAPWVPPPRHDVKVTMPPPPGGEVGGSYGVSTGYSD
                     RLARTPYWKRMALSTYALRMKENETRYPMSPHREGEYDLRYTVTAYPDHIKHRPLLEI
                     GEAHQIPTIEIPVIFLVNLWDEERLTWFGRQYETVYVNRNVAREELLPQRYAIYATEE
                     AYKLLGLPVVNHSIHEEIPKTPHAYKKLLEKQSYTEERWKYTIEYLFRKYEADPPELQ
                     DKSEDGWDGVEELATSATAGGAGDSLAKRKGPVKQRKARKIKLF"
     gene            <90949..>91398
                     /locus_tag="LMJF_08_0250"
                     /db_xref="GeneID:5649309"
     mRNA            <90949..>91398
                     /locus_tag="LMJF_08_0250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681002.1"
                     /db_xref="GeneID:5649309"
     CDS             90949..91398
                     /locus_tag="LMJF_08_0250"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681054.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649309"
                     /db_xref="UniProtKB/TrEMBL:Q4QIE4"
                     /translation="MDRQAVNTAQRGPNPHHVKRRLPPPTPPAPLRSSLLMNSLLMEA
                     MVKPLQRYPTLGATVGTGVLCAFTYWWYATSIRSTLLATQRSCQQMSDKAFHECREML
                     KAGERSWGSDIRSRDAQVRRLELQNVEQTRSVARLESAMKMCLIQNA"
     gene            <93081..>94397
                     /locus_tag="LMJF_08_0260"
                     /db_xref="GeneID:5649310"
     mRNA            <93081..>94397
                     /locus_tag="LMJF_08_0260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681003.1"
                     /db_xref="GeneID:5649310"
     CDS             93081..94397
                     /locus_tag="LMJF_08_0260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681055.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649310"
                     /db_xref="UniProtKB/TrEMBL:Q4QIE3"
                     /translation="MRSPPMQSPSKASAASLTALAVSTSSERAELLSVPRSDHPVEPL
                     GNRERPALTAAAAPAASSGHAQHAEPMTVPSPQATRHQSERCQHSRSSATATVAAGSN
                     KSATYKPYSLSSYKTLMADVAARKSGGLGPSDTDEQRAAREKRERAKTYARHAVKVAR
                     AALAGVGSCADEGKVDPGTINISPVSSPDPAAGARGSSSARSPSSDASTTATTITTTS
                     TSTSRSASAEFSEHRRQPPRGTACAAPPPRATPPQHTTLEPSSSAIPPRQLSAAGVDG
                     GEVTPSCTGAESTNAKNPKAVLPPLSAPPRTSPAVAAFAVAAAPRRQIMQARRRRERA
                     LTYAREVSQKRRRPTPAELEGDNSACAASAGAKSRTGPVVKSGDAEEDDVWLGGAAVI
                     SAPGAFRGAHMPDPDRAQRLQRLLDLEALHATKREAVEGIRRQLRA"
     gene            <95763..>98189
                     /locus_tag="LMJF_08_0270"
                     /db_xref="GeneID:5649311"
     mRNA            <95763..>98189
                     /locus_tag="LMJF_08_0270"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681004.1"
                     /db_xref="GeneID:5649311"
     CDS             95763..98189
                     /locus_tag="LMJF_08_0270"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681056.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649311"
                     /db_xref="UniProtKB/TrEMBL:Q4QIE2"
                     /translation="MSAPSQAPEERHHGSRDSVRAAAMREALCSRIRTLGASILAITQ
                     SAMKEVEELENEYAEQQQRLAKRQSQRQSSPRPGKATAKPSQPQSRVRRTCGHEPKSG
                     APTGAAEKNEKRSEKRAESSTEEDGSGYTRSHLWQADAAVMQLCAAAEANFQRVVAKR
                     VLQGQRSLRPAFTGETAGGACAVWGDDDCDEGGQPRVPRNWRRGAPLYDLSNAAITAQ
                     YGRGVDGVEVAEDVRDNGVQPSNTSSGTLQRADGGLASPVITAGGAIPLSARAPAAAS
                     QLSQQAEQEALAALDIVPDQRIDIGAAEASKKEAVPAEAGGRTSQQRQAWSSPCLAPE
                     RSYYHVVYIHWLAPPCKLCGSGGSGDDADLAAVCGHDKEGACAPQRRPTARVLRRAAT
                     TSSTAANTAGEAPLTITSYVQAMYAVDRSDAAVRKPPASPDTEAAPLTTAAPALMSGD
                     TALVQLELCVPPQRLGRNGSSQLEGAPLMATGTKPTGVEFSSSTADRVSNSTAGTAVA
                     SAASVAAQRDEGAETQRRIDREVAAASTVADAQIVAHIESIEDWRRDRHADVEERIRR
                     LRRSSVVPAGWQGEYYYYANPGGATTTADEAGMPTSLPAGSSGTADTAATIERKDAHR
                     GTPHQQQTQGHPSPRPLSRPCTVASPSLIGKTTTCTVLLRTRPQLLKPLDSSSEAKTG
                     VVTDASWKSNSSQAQAHQPPQPLHKITAQGAATSTLSPKAALYPPLEVVVANTYNSIE
                     WAFGGAARRALTTAPDSAHGESPLASASLLWAAHQKREQDNEEQRRWNARTRQPHGLD
                     IHTPIDLCIS"
     gene            <100679..>101821
                     /locus_tag="LMJF_08_0280"
                     /db_xref="GeneID:5649312"
     mRNA            <100679..>101821
                     /locus_tag="LMJF_08_0280"
                     /product="putative ribosomal protein L2"
                     /transcript_id="XM_001681005.1"
                     /db_xref="GeneID:5649312"
     CDS             100679..101821
                     /locus_tag="LMJF_08_0280"
                     /codon_start=1
                     /product="putative ribosomal protein L2"
                     /protein_id="XP_001681057.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649312"
                     /db_xref="GOA:Q4QIE1"
                     /db_xref="InterPro:IPR002171"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="InterPro:IPR022669"
                     /db_xref="UniProtKB/TrEMBL:Q4QIE1"
                     /translation="MASVSPLLMPCRGVKLVNPIGKQGSQHYGLEPKLEAGRDTQLKH
                     TEMYDGYTDDFGVFKEGPPVTLRLEYVRSPDHGYSQHILQKDIWSPFQVGANMMSYTP
                     LYYDWKGFSSRDYFGHRSGTNPGSKVLLGHYRRDEVRSWGYRIMVNHKPQKRIPKWLA
                     CVVHIPRKKTFLGFFLYANGAYVAELLTYKQLPRIIYNKAFQGCLPTIGQTVSLTEVT
                     YGKEIHSVEMYPGHGGVICRASGTAAVVLRGSEPNLVPLLLPSKEVRLFDNMCHAVFG
                     RRAGVMYNKQRNFSKRSVEENMPHRPKVHSKTKRVSSHPAGGGNGGSPNLLTPLDWRI
                     HPRNCVKTKYWLSGYILRGRQYNRNQTVADLKSKTYSWANRDPVYR"
     gene            <102575..>103267
                     /gene="FESODA"
                     /locus_tag="LMJF_08_0290"
                     /db_xref="GeneID:5649313"
     mRNA            <102575..>103267
                     /gene="FESODA"
                     /locus_tag="LMJF_08_0290"
                     /product="iron superoxide dismutase"
                     /transcript_id="XM_001681006.1"
                     /db_xref="GeneID:5649313"
     CDS             102575..103267
                     /gene="FESODA"
                     /locus_tag="LMJF_08_0290"
                     /EC_number="1.15.1.1"
                     /codon_start=1
                     /product="iron superoxide dismutase"
                     /protein_id="XP_001681058.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649313"
                     /db_xref="GOA:Q4QIE0"
                     /db_xref="InterPro:IPR001189"
                     /db_xref="InterPro:IPR019831"
                     /db_xref="InterPro:IPR019832"
                     /db_xref="InterPro:IPR019833"
                     /db_xref="PDB:4F2N"
                     /db_xref="UniProtKB/TrEMBL:Q4QIE0"
                     /translation="MFGRAPMKAATATAAVGFSCLCYHTLPHLRYPAELPTLGFNYKD
                     GIQPVMSPRQLELHYSKHHSAYVDKLNTLGKGYEGKTIEEIILATTGINESKVMFNQA
                     AQHFNHSFFWKCLSPGGKPMPKTLENAIAKQFGSVDDFMVSFQQAGVNNFGSGWTWLC
                     VDPQTKELLIDSTSNAGCPLTSGLRPIFTADVWEHAYYKDFENRRADYLKELWQIVDW
                     EFVCHMYERATK"
     gene            <105277..>106035
                     /locus_tag="LMJF_08_0300"
                     /db_xref="GeneID:5649314"
     mRNA            <105277..>106035
                     /locus_tag="LMJF_08_0300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681007.1"
                     /db_xref="GeneID:5649314"
     CDS             105277..106035
                     /locus_tag="LMJF_08_0300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681059.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649314"
                     /db_xref="GOA:Q4QID9"
                     /db_xref="InterPro:IPR000868"
                     /db_xref="UniProtKB/TrEMBL:Q4QID9"
                     /translation="MADTGGSSTFCDEAPAAAVRPTADVTVPQRRRHTTQLLRKFTEC
                     RTLFMCCDIQEKLADKILGFNETIRVTNNITLFCEMLGATYCNVLATVQYPAGLGPLY
                     HEIQLPPNAPVFPKMEPSMLLPEVLPYLYGDAEHGILPVQQVVLWGYETHICIMQTAD
                     ELLRRGFRVAIATDGCAAQRRLDHDVAIMEMSKWAGLLLTNSIGVYTMIVRVDDIVWK
                     PVMQLIQDGAHAFKRPYKRSEDPTVPLQERERQS"
     gene            <107202..>108137
                     /locus_tag="LMJF_08_0310"
                     /db_xref="GeneID:5649315"
     mRNA            <107202..>108137
                     /locus_tag="LMJF_08_0310"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681008.1"
                     /db_xref="GeneID:5649315"
     CDS             107202..108137
                     /locus_tag="LMJF_08_0310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681060.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649315"
                     /db_xref="GOA:Q4QID8"
                     /db_xref="InterPro:IPR000868"
                     /db_xref="UniProtKB/TrEMBL:Q4QID8"
                     /translation="MRTCITHRLHSCSPLLSRRCVDFYSESSALPRQHKHTFSTHQNA
                     RTGPPPPPMTTLSAHSRLIQKFDTCRTAFMLCRVHLRADPHSSSLHNVVHATNAMAAV
                     NQLLGPERSVFVATEVQPQGVGHSCHGIQLPEDAIIAENVRTSMLVPKVRLHILGDAE
                     RGIPPVQQVVIWGYETCGCILQTADDLLTHGVRVAVLVDGCASRTKEVHDTAVLQISR
                     WDGLMVTTVPSAVMQLTRSDARFVKPIIQIMKKFAADWCTTQPRPELRDRGGSGDGEK
                     ATAASDARAVPSALATATAADAILAANSACCRTEH"
     gene            <109022..>109699
                     /locus_tag="LMJF_08_0320"
                     /db_xref="GeneID:5649316"
     mRNA            <109022..>109699
                     /locus_tag="LMJF_08_0320"
                     /product="putative mitochondrial associated ribonuclease"
                     /transcript_id="XM_001681009.1"
                     /db_xref="GeneID:5649316"
     CDS             109022..109699
                     /locus_tag="LMJF_08_0320"
                     /codon_start=1
                     /product="putative mitochondrial associated ribonuclease"
                     /protein_id="XP_001681061.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649316"
                     /db_xref="GOA:Q4QID7"
                     /db_xref="InterPro:IPR000868"
                     /db_xref="UniProtKB/TrEMBL:Q4QID7"
                     /translation="MAAMASRALISSPSHLLQKFDSCRTIFMCCDIQEKLRNRIPNFQ
                     AAVDVSNSMATIHNTLTPKHSTFVVTEQYPKGVGHVAKDITLPEGTPVIEKLQPSMLV
                     PEMMPYIDGDAARGILPVQQAVLWGHETHVCVLQTADELLSRNIRVAVLVDGCASQQQ
                     LDHDVAIQEMAGWENLTLTTTISVLLQLSRGDRWIRGALMKVVKPKWADPSRFPSLPA
                     DGERPKA"
     gene            <110669..>110956
                     /locus_tag="LMJF_08_0330"
                     /db_xref="GeneID:5649317"
     mRNA            <110669..>110956
                     /locus_tag="LMJF_08_0330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681010.1"
                     /db_xref="GeneID:5649317"
     CDS             110669..110956
                     /locus_tag="LMJF_08_0330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681062.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649317"
                     /db_xref="GOA:Q4QID6"
                     /db_xref="InterPro:IPR004217"
                     /db_xref="UniProtKB/TrEMBL:Q4QID6"
                     /translation="MQAQMMLGQALEHYAMMDFANLVLEQCWDICYDSQLTRPELAGG
                     ALPDVKAQKMDACARKCVARHFEVLTLLSATRELREKERMQGLPPGTLTSM"
     gene            <112338..>126593
                     /locus_tag="LMJF_08_0340"
                     /db_xref="GeneID:5649318"
     mRNA            <112338..>126593
                     /locus_tag="LMJF_08_0340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681011.1"
                     /db_xref="GeneID:5649318"
     CDS             112338..126593
                     /locus_tag="LMJF_08_0340"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681063.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649318"
                     /db_xref="UniProtKB/TrEMBL:Q4QID5"
                     /translation="MHAGMRGPSAGHALRVHRTGSRTPTWSHRTTYATHAGSTRAAAS
                     MFLPCFVDDDERRSSWGHESLSSLGPSSWPQQPRVARRLAAAWQRACAESYRQAHVGH
                     PMRTARRSSRCTWAFAAEAALRAHFQRALRWRSETAAPSAGDEELAAEAELRSMAAFV
                     VETYVSLCKKPASGCRPGAALMLATRHSWGSSELQWKLLVLLVLADEVCAALGDSAAC
                     STRASHWVSGVSEFSAVYECIIVVAAAQLCALRHAGCQRDVAGVAGTDTRHSEADAWE
                     ATAVAPHSVHMVRATRRLVEGVLAFCTKQNEGAILLPTRTDASDVDSLNSWFGGQLCC
                     LAETSCCSLHPVRVHRDQRAALPEPLLLLLRLLVQSASWRGNCAAADVNGAQHLRHVC
                     AAVLLIEHLLERASADTLAPCIDEVRGALWLSRRFTCGDEGAGDTVRQPTPTPRQAAW
                     RRSLSSYKDARLDGGTAALAAATGRFVCQVLDGCPPSISRLLLLPGSAPQLFPSTMGG
                     PATPLDREVLVEEVVLLAPGMALSAAWRLRHACAVGPLLRTSPTASAPALEHADAMDV
                     AGARDGAASKCSGVGDTDSGEHGLLLQRRDTLEQVWSRLCPSSTCAAAALLPASWQAL
                     SSQFLSSILSQVDPPAIARMAEATLGTLRRLPPLLSAVHHEERARARRSAGAARLGAK
                     AGVCGGTREGAGVAPSRSAVLALQCMLASAPTDAARAEASQALLSRLCTALTATASAQ
                     SDEEDNVDLTTERVHGAGVCLVVLLACASTSFRDQAAATHNFLAAVTSLVDSRGHPQH
                     GRRESSDVYSALRSWWPGVMGSIMLARHAQLARGASRCAVPASTEHGSGEEPRRDPLA
                     SLSPAAQLALWWEEQSSLQADSAAPLPRLRDSCYWTGMRIMRLCNTAAHLAATWTTTS
                     SALSSSQLPFSPAPSTADAEAARVACTAVYNMLSLEHVCHLAIASAALPGPGEAREAW
                     NAVAGSSATAAPSPHTAHSSCACALATADAGVALFEGDLSSGDRVTSIFTHAMTAARE
                     AGGGALNVLQHRQGRLLNDQQHESLVEAMRDFSKRRCVKEAVALFYAHERQYRRLRLA
                     EVELFAETAKRAPLPFLVRLLLYVPPPCESAVLARAVIAGAWKAYQRALHRHSRRVAA
                     AAAERRRGSRRENASLASRMHRQSCRRVEQAWYESLAVARRALALLPSAGGTDGCDEE
                     AQCNVLALLQRFLCARPRSMQTRASPQRASSSSTGATLFADEWDSDAVQSAQLLAALL
                     PSPSPSLSSSGSRQRLHVLRGASARGSMEELYQVVQLCDANNDPATAVRAYLRFASAH
                     ATSPPPSRLSRASAQDARKRSSPTVKANDGRVVPLLSLDTCVTLLRLASMHVVAACDE
                     DAATYGVPVTASSLTRVPLTALLTYVEAHHVPSELSSPEAPTGSEEPRGGAVLLQNPS
                     VRNAAAEDAEMTMLLHMHAALEESAAAPSDIVAEAATAGIGSTSKPVDDAMLGGSGYH
                     AHVKGTPACAVSAAAAATSRAMTYATNCIAAVQRLSPTLPASLRCVLHSDSAAIPLTA
                     VLHDALRWCRLRPQSVLAREGAATAVDGLDAAALHSLADRAHSDDPATADVVARLLAA
                     VFQLDGAEMAEMVDAARPRPMHALVVTAAAAVTAADVAPAMADVAAGDVTSSVVVTRH
                     TFACRAARANQDFWCLVRHSDALLSYVWDYLWELYRLESTVLWISPAQQQRAYLAVAE
                     CAQVILAALQALDVWAAEMRAHEAPERVSSSSSGSDGDGDYQAHEQASFTGGRSCVPM
                     AASSEWRLGSSVDEWRVQLRSGILQRVRARLFDEGDLPDVTSGPRDETASTMLPCSLS
                     SSGMPDTTSAAIAYMTTVMQHSSTAFESCAPTTTLMQLAGDPIAAASPVPSATSLSGS
                     VVRTEGATSPREVRELLSRTTQQYYDALSRLASPSLPVSGGAGPLRPVHLSHLAMDSL
                     SYVLRCVTATAAAAPPRRPHTIGTVAASEAGGTTALLSRVAAAEGMLRHVASLVQHAS
                     VLMEATDAAPRTAGVELLRTLWCLSGALQYAAALLDECMAWWTLLDLEAAAAPASELR
                     GASDACSCDVGSVFPCVNGSLVARSALTHIRTQLQRLVASFADLYVSGWCGSVHSRLP
                     EVTRARLWSRGESRAQHLRVCLVLQHLASVSGDAAVPARLVRAGEALQQALARYPSSF
                     AAFTETKDARALQQSDFMELDELVDGEHRDVTESVDCTAAATVRTLERTLLAYLTRST
                     PPDGVLVIAPGHMTAVSITALEASFQRAVMTCLSPSHAALLWRLFTALVDDGCHPSAA
                     VEDTTHEGSPDVPRPMRCERDAAAEGSLGVMCAVPTTLWRQLQRLGEESESDAASDVL
                     RSSGACTEAPALHSERLAVYAALLSRHPLVLMGVVRHPLVRHHQLAEARREQWPPVQV
                     GAGSGRAVGTSQAPSCEWLKKLLLYGEEDDSVAEAKVAASDDAGEPALSSAWTAAGRT
                     LSRAGGSGLLRTSSAGALALLPAQPLRERFVSALILAVLRDASLMCDGPSCAPVAFVS
                     LSVAAAVAAQRRECMLLELVQHLGYVAPHAVRTACRWITCTPYPPAACSPASSFPADA
                     LPPARLKCNALSCTDATTLRRLRVALLSCGPWPTTVARTLLEYATRVQRAATQEMAHA
                     GDGETPTMPFPEALELYQRQQQQPESKRRKMAEAPQALMVTAQHQVDAVRGVRDRNGS
                     GSAPPCGRGASASPPVLSTASDTVPTVHARGGRFAVGPSRPLPPAPAAPSSSLGSTRY
                     GRCTGAGAPLSAIQLACEEGARLVKALRTSTAPAVWDAASRIVLRMCDLATAPSHPAC
                     VGLLSDAAFMTDLMALPTKRVAATVMLAWRTLLVRAAELDCREQNWDSAGDDDGVVAA
                     EVHSRTRSLSLREAGSRDRRCMTVLDVYAMFFLIASRACDRLTASTPPLPRAKGRQWL
                     VSGQRQLGSLKRELAAHWVAVLADEVMASQPVFQCSATSEAEAIRARIEAFCRSGADR
                     GATRSPTLGLVTLEEHLRRAQARLQAVSQEPLTSSSSPRNSYSSGAADDKAAAELSRL
                     QREASAQLRDAGAWLTSLPRPVTAEVSPRLAKEAAHASPERAWSLWPPAASETYQLRA
                     CMRKSSDENTLVTVTVRHPVSAVTYLCAWRREHVSAPQTRRSGARAERCPDSARTATV
                     RPYDVKGATCVLLPAVCLPPSSAAQGSRQPGTSRGRAQSASQSTAAVSLTDVWRAADA
                     YVRRGCLALVCVPRGGHGVASGCGPAGGSAVGAVEMDFSQAEVDSTATGTTPAGAGVV
                     MQSLLGLVSLEDARLQQEQQQSRRQHAGLRSQSAVSGDTLQLLSVLRQLRQRLLSLAP
                     AAAATVSGAHGMEGAVTTVTAEDKGDPTPAESPWAVFMPLSCVRGPRALPARRGGELD
                     AAGSAWHSYLHVLLLCGDSLLCRVAQRRGRRASSSVAALTRVTHQLQRLASLSALDEQ
                     VTPSLVSSAFRSRLVDGQDAPRILCFQLRGLQHIRDHVSLLGWTVEQHRELQLAQQSI
                     VSAVAAICALQHRSHYGQQCLQREDGWDAAATARIRLSTRVRRQVTAVMHEGPVHPVE
                     QATAVCFYPALAHLLRQLSVTYPPSTVSATSAEELSSSRQRSPVEDREPRADDAAAEV
                     VTEFAGVVATSARRRHRPLHPRAPQTTAATATAESDNAAAALLSTVYGALCEAHEQQR
                     SGPTDRRQNIGGAHTSTTPTLTPADSCGELHALLSAVVAAVQRRSRDADPRLLLEFLS
                     GNEHDALLPLAAAAEASYLETLMKAVALGASAPLPNDDSHRVVEAGLTLFALLHPWLP
                     LSASARATCAMEAALSLVTLALQQRERLDNKRGAGTIVKSSATSLWYLVQVVLVSILH
                     HQQPARLSVRSLVLLGVIYSQLRNLEKERGGVLDTVRSRRSSRTALQADASVLLWRIL
                     SALSALSEKDAAEVRDAWMSGRKVGVVARGPSIAEHAFARATDGAALTSVAESIHLRT
                     ETGDAKAEVCSGAHVIEVLYHGSLQALGEDGSGGGATEQVSGSWTWPLLLAATRLRTW
                     LACEDVTAASPIRATASSRDSAAGATLHPCTASRLVLPQLCVLEEALCGMLKGVDEEA
                     GGADNRSRTGRGATSGGVPVPLAVRRRRLACLRAYTLYAEMKRTCSAPLWRRPQGCLR
                     NHAENGDSDSSRHDDDRSRRDGVGDVASLVLELAVVAALSAADASPHSRHSRAVSDEH
                     QLALLSAFVRCCDALGTPLPSLPCSQPLPRWGQECSSATPAVASVASPRATGLGRVGV
                     DAHAAVRHLATTLLFRLAEDAPLSAPSAQAVLHDWRAVLTPLQALRRVTFAFPTPGAR
                     LPEVDVGADVGSGHGSVWLLSTSSAGLQWVPVCQADPSSAKLAGCLDVSSSDADSGDG
                     DASQPTGQQPQPQSQRRHCHHDQSLQGIYYTTLRLLWRGGHLAKLPLPVLLKELLRPL
                     AELERAAAEISIRSPTATEAAQRTVRPTVRGRDDGAAGVNRKTANRLAALVDVAQQLS
                     MHPVLSASAATAAAHDGDGSLGAGWTSACLVFKLLTQIEAALSTRCGKSQSRTKGSER
                     AACAKTPCVSPSHAFAARYADLLAQRGTCAPDYLAFMLVVSRHCPELLPTHGGGAPGE
                     SEAHEERRRLLRHAQLRHAVALAAPAPAVGAVMELFQLRTAHCRCAMAAAQHFDAAPA
                     TGSAAAVERNTTRQGQRVDGEGGISGEADSLLGALTPDEQTLLQRLHHLLQTSRGKAA
                     APLRNRGTK"
     gene            <128336..>132772
                     /locus_tag="LMJF_08_0350"
                     /db_xref="GeneID:5649319"
     mRNA            <128336..>132772
                     /locus_tag="LMJF_08_0350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681012.1"
                     /db_xref="GeneID:5649319"
     CDS             128336..132772
                     /locus_tag="LMJF_08_0350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681064.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649319"
                     /db_xref="UniProtKB/TrEMBL:Q4QID4"
                     /translation="MLSASALSVPAATPRAASATAPTAAKGLTSGSWPFFSVVDGYSI
                     SPKLAELLRAAATREDEDAPFLNIPAELLWLGGCRDAPSALLGRRGEPGTATPLKGVA
                     RASPSSRVLMSAAEALMVDPDAPRPGRRRLRYKITPVSREGTRAAFASATLGSLTPLS
                     GSTGSTTPFISLFTKDDAAAIASPLAVAGITAVPPSSGGAMLCFATPKSPLSGAEPAA
                     TAALLRGSSFATTGSLRSSDAPSALMAAIVTGSSHTGPDALPPLSPFTPSDSYGGSGQ
                     QVELPLCGFQGVSAYSHHVLEQHMPVSSRGCSSRAASAAATTSLLRLARRAASVASAQ
                     SVSDCTDAPYHFEDLFGYAAASSLGEDGDVLRDTPCAGNFSCDVFEDGNMCEAVGGNG
                     CDEDSSCRGLIQIRGRRVVATGAMPSAAGSASRLSPRQQLTRLQGQCDVHTCATAALK
                     AGGPAARSLTAAHAPSGRTARRGPMSLMHTIAGSDSVSSYGSVVGGSTGLSTFARSTL
                     TAPQQVLAWPGVLPRPLSTETQSGASGSDHLLGGSGSVTTESSISAPDLPVFVPTSGS
                     ACLLGAAAFDSGAGGRPLHPQLGRRAAPARKRELCTAADTIARPAQRPHSSHWHAGGD
                     GRSGRSGGGSLHRPLSDPQGAPAGTQDCIKQTQSSSVAEGRTRSAESSSDVSGWGRVS
                     DGGEDSNGQNATSGGGKNGRCRPCSAPWVRRITCPPPLHLRSLSGRSWKLAKTPPAAA
                     EDSHAADAHAGDGGETGSREIEAFAALLPPTPSQTSPSLALATPSTTVAAVAEGSQRG
                     WPPAHGSTAPSPSSRRHREDRRSYHQHELQQNWHFRLLCVCAPYSVFVVLLALTTFVA
                     THVVSEGVGSTSPGERHTYGLPDLVACMENVTLPSTLPNEICTCWHIEDSDRPPCAAV
                     KFADHAESLAALSCVFPTASGPRNEAHCIPLRRSDKLGNLSAVAAATKQAVPITDNGR
                     RDDRESGHKPLVSRPARLSGENSRIVLRGDRDTVQATRTRRSTTGGHLPPFAGERTLS
                     RHTRPSATTPSKLDESTHEDLPRRREESTAGAAEAGAAAPFADVEVPSGYAFGGFGYA
                     TQFLAAAYLDSEHANERKEANTPARVYAIEPNLRDTLSPPFPLTKAPSAMSGDGVPRM
                     AHALSIVYSWRKAITRADGSNSRVSRWRIVSEPYEHCSGMCVHPLYGRGRAESSFLSC
                     RLDADALLLGYLELDAARATPQARSRVALLVPRRPTKSLRPDAGTPRQQRGGGEQHDS
                     MEVGIFARRWVIHFQQPERRYRKLCKTQPTDGDDPPSSNISGAASADDDAVGGDEGAV
                     PPGGGKVCWMPCLCPDSGASVPTILNVSDDIVAAALRVIDLHSCTADVHHRTQEPGIN
                     ISGPDADVDAHGTAACFSCGSRGSLNTSSALPAARQYERLLGGGRRTFAPAVFREFLA
                     DGQGTAVDVSSVRVSSNFTAMVVIGAAPLRRGRGGRHKVAKR"
     gene            <135042..>137198
                     /locus_tag="LMJF_08_0360"
                     /db_xref="GeneID:5649320"
     mRNA            <135042..>137198
                     /locus_tag="LMJF_08_0360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681013.2"
                     /db_xref="GeneID:5649320"
     CDS             135042..137198
                     /locus_tag="LMJF_08_0360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681065.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649320"
                     /db_xref="UniProtKB/TrEMBL:Q4QID3"
                     /translation="MRIRTADNTNAPPPNPHLPPLLPYHASSALLFAVVFTAPPFHVV
                     RRCHRGLCCSRRGLPPPAAAGALRVPPCCRDCICVALSRYPHVRAHIVGARADLRAAI
                     LFVFLPHLSFQLDCPRSIVLCDDVSTPSLPPQRAAPSATMSTTTTTTQYTRSAILAWA
                     NDVLETSYATFQNIPSYEVGLLLYGIFHGCPSRGDATANRRGDTTDAAAAATATSSVS
                     VPLLSAAELHRHHERHHETCMRYLQLLQFPSMPPSTAPTNPAAVVLSGTAEASAPSPG
                     STPASLLPPLPDGHSGATSAVAQKRNAEHVLAMICALSAEEAELSRAEASETRTSGGG
                     HTASVVLLLGPSMTPAAWLAGSAFVEELKLWRWVRLMAERHRRSARAIRRAICAYLQH
                     EVGVAAVAPAPAKDSQTGTASCVQSRGASPAPRSPVVMMEMSDVAEVELGDARGGLLP
                     GKSTRAFAEDESGDTVLQEMKRMRPEMLPSTSPVPVHAVAAATTARPATSSVTPLVDS
                     VSPVHALLSPIKEVAAAGGARTDGCSATGLSWTTSSSSVHAASEATITPYVAQATELQ
                     SALRTAQAALHKELALHRAQQQQCPLTLPTSTSGSTSERSSGGDVSDDAGAMHKVAPL
                     LAPATNVCDALEASCRQRMVNTVCAKTLGDRGDSSPLSPVPDTLTCDVCPSIMAHAIQ
                     CNLAAIDDLEDVRARAIAACLRKDSVALLAALQNIV"
     gene            <138663..>139325
                     /locus_tag="LMJF_08_0370"
                     /db_xref="GeneID:5649321"
     mRNA            <138663..>139325
                     /locus_tag="LMJF_08_0370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681014.1"
                     /db_xref="GeneID:5649321"
     CDS             138663..139325
                     /locus_tag="LMJF_08_0370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681066.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649321"
                     /db_xref="UniProtKB/TrEMBL:Q4QID2"
                     /translation="MMLRRSCGTAILTAATTASTSPRCSARCIASEFKDIRPRSGGAA
                     PPPSISNNEPILPMDFNPHIEWFEYPKEIFDPKFPYTREESIRMTEESWESTMDEMAS
                     KYGMRLNMSSKPTFWMAWFIMFFYSWYTLWGCYRAMGTEPGWSHFKNVVLNHPTVPVL
                     EEDDIYLDQWMRPEMREKFSRYDRFWNWKPLVKRDGAKTTWSIPMQYADESEWRHMTS
                     RF"
     gene            <140468..>146134
                     /locus_tag="LMJF_08_0380"
                     /db_xref="GeneID:5649322"
     mRNA            <140468..>146134
                     /locus_tag="LMJF_08_0380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681015.1"
                     /db_xref="GeneID:5649322"
     CDS             140468..146134
                     /locus_tag="LMJF_08_0380"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681067.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649322"
                     /db_xref="UniProtKB/TrEMBL:Q4QID1"
                     /translation="MAFTDSSVSPAASHTGFPALGKAANDDGDEVGTQDPFTVTYPSS
                     SLPSSHSNMIQCVLGRPLPFLSSPLSRNANLRNGSGLSVGGRLRYGTDPMSCSGSPPL
                     SYDASVAADPSSLSHTVAHGSSDEASTPGDDYILKEVDISELLHGTLSVPTALRPSLS
                     PTGAAPVVRTGMPAATVLLRHSHGGKTRLLYADGHVETVVAGGAAKPPSKRTHAPSAA
                     SHRRMCPDDKRSHLRTLPLDAATREKAAPPPPPSASGRWLLESFNAVAQVHQQQLPAL
                     VEPIVTLQAAGTASSASPPSHAAERSAACPVEAESSRQATKLPSQSFVTVEPQQQQVA
                     VNITLPSPSRQTPPRLPSHFSEGTGKTDRSSEPAEAEGDEGGRGHIGGFRDLIPAYPP
                     PITTAAPCSCCDVNEKSVLTAVGSTVGVQPSRNASNVGEATLSKAADDPKTAVAAVQR
                     GVRAELAAEQHAGAQAFASRYARDVSASPSLFSLRFPFRPLSELYAFADRPDHEDAAA
                     AAAASRAARSTDEPRASFLEHREAVSPTRGVEDAPAISPTRAPPPPPQQQQQQQTPDV
                     LLPYAQVTTPSGFTVPELLQDRLLPRETPALQHRLSKLYAVRGLIDARDSTACRFTVS
                     FMWFVLLRCRKARREQSLVHGHRLLSIAFSDAFPHVSLDEALPPLDVLEQLLVELLTC
                     LRYSVEVQSATNTATSAAAASSAARAASASRCAGEPPTADGLATLTRTSGREASTSGR
                     LANATPTSAPASTTHNTSDAPGAASVAAAPSKVPLRLRLHEHAAYFPLLLSPTWSKLV
                     NTGAVDAGSADGYQESNCTQQQEQPHSPRRQEAQRMLPSEDALAMLCKMYQDLWLHHS
                     EYVQLCLYEELLQKQLALQFGTVATQLQQGAVSAEASTVASTKASFAAGVSQGLRPSV
                     TWRSSAVASETSIAGGEGWGALRASRSGAPTSGGDLRAWKRRSNTAMITSTAVAPAAM
                     DGILESLLLLVAHATYYNCVFCFANDVCAGMFDEEFRADVVRWLFVCCHGVYLAHVQV
                     RHWPMPAKGDYTDAQLKRRAATELEISALGLLPTCEQQTAGLVHAAVVSGVQGKSSHT
                     AIAEAVRSASLVMAAEDGTFDVGDVEANSEARVVYQLDRYGRSAVLHVAELERSMALL
                     QRRHMTGDRYGSYNSPFGPRGVSCSSRTPANSRGSSACSAAPAPLPFNAYPNLIEMVD
                     TEAGSHRSAARRQTGSKASRHQKHSNAGFSRRTTSGSPTTAAEPLSQCAAVDARSSSS
                     RGAMKQGASIQSGCGTQVPRQRRTPALATASSRHSHREEEARAQYRTSAAVTVGKSLV
                     TLAAELSRGSHKGSVARATWKATSARAPHGAGASVSGNAAAAVWAAASEKRSSECSSS
                     EVRAHRRELSAGSLLSSNPLCVSPAPIRDYWLTMLLRAPFWWTTRTAMATAAAVTGVG
                     AATSPATLQQQSAQLVLWSSVPIGADGEVVPPQDLCRLQLEPWRALLAVAALPPISKQ
                     AQQAAHQMRVYSKIVPPQQVRLRRMAERQKLRHRRNRQMRLQEGSQELPVLTLPSLTS
                     AVNAAKTAATPNGAAPSAAGAAELEEPAGSVGGAADSLFMCSAMLPLTPPNTPEDAAA
                     LEASTTTATVVSANAPAVVHPQRRSTGETYEGCTSSFSEVCFPSLIPASSRPSCMSEH
                     GKGGERIRWGAQQHRVHLSVAGSSNSCLDSPDVTTLTTAATPISSTFWSMMPSGALAP
                     PALANMHRRTLTNRSLTAHNTAIVTTLLTCPGGAGASSNGATSDTRGTRNWPGDSLSV
                     MPAPPAEPKPPSRRLAPLKKEALRRHVQLLADLDTIGKRDQVVRQHYVVQHLQLSSAM
                     TYTESEAMMRRYRAQSRLALERLICGEVGDATAARAVTERTKEFNF"
     gene            <147890..>153394
                     /locus_tag="LMJF_08_0390"
                     /db_xref="GeneID:5649323"
     mRNA            <147890..>153394
                     /locus_tag="LMJF_08_0390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681016.1"
                     /db_xref="GeneID:5649323"
     CDS             147890..153394
                     /locus_tag="LMJF_08_0390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681068.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649323"
                     /db_xref="UniProtKB/TrEMBL:Q4QID0"
                     /translation="MEECDGAEVQPCIRVDTDPTAGVDSIGLVSSIFVSRSAATAASR
                     TPPQESEVPPAAAVQRAQSAPLQALAPAAATAAWGPAATPTGVAVNTGVGGTLWQQAF
                     AAHAEALLHETQQQVGELRRYRQKAVREAQRADAVAAASRALEVQLAEADAKRAEERT
                     AHERAVKALSQQVLRLEEAVGVLRRTKLELQRQIKGAQTAAAQQEAMHRRELREVRSA
                     FESEIQRMRAEHHLQADEWRHERHRLEEKLVECDVTGVAVSMQHMQLMARRAELERKH
                     EAVAAASLVATPTPAYEAEAERAAAVPRVDAATSTDAVALPTAQAMPQEDDASPYTRV
                     HRDVLAQQQLREQTMLSELSIADARIQQESKQRRLAEERVVELLEQSEQLREALTDAE
                     AAAMNTERVSEVARQETAVAVTAEAADGRGNAGHQMGRRDAVAHGTEHDPRAQEKLLQ
                     EIQDEYATLRRESSVFFGRHREQQRREMERWAAVRTAVGAVLHVAGLHDVRRTLEDAP
                     AAAAAADTSNLSRLGEVFADSSEASLNATLVALDTLASTLRSQQEQQRRLSTLEEALR
                     VAEAQNEVRIASLEATEAQLHESQRELSAWQRRHNDLAARQDVHDAAWQAAKVQLKQI
                     IGILRRALREYAQPLPASLTRLSSLGEDADSAGRRVTRRRDARAMKQRSRSSPASAAS
                     LDGVEDIEGHAAMLPTTADAAPVWVSDGDAIADADWKDLLQDAFVLPKVACEGDKVVD
                     RPETVADGEGESLSRRRSTRTASLPLSSAATLVVVKSTDDGSDAAHSEVRRDMAVVVW
                     GLLKLLTAWRDRQHTLVGARKALQRQLADVTAKSTALAAEKRETATRCQRQLRLSRAV
                     EQRRAQQLEQAQNELEDAKRRHMLDSAQALQKAAEWEGERDALRRRLRVTEEQLNHAE
                     QALVEADVDHNAQHASQEALQHVLNDVTAARDRLERRQADLCVHIEDLEARLSVTERT
                     QTDLHALITTSVAFIVRLLADHQQLQEHYRVLRTLAWTDAQSARMVERVLENCCPERS
                     EQATARAGERELPWSTGAASGVSASPAGAAPHSETSAALFRIAGHVVRAVVRLSQLLA
                     ARQRLRSNAGTRRSDGALLSPSAAAVEPASLQPLLLALSSAFAWGAATPALNSAAASP
                     HDNRLRRYTARPDSCVLPVVRLPAPLELAAVAHTEAAEVEAGGHAGLPKVRFDFSSRA
                     CEDEETHIGADHHHQQQQQLVQLLSAAQIDMHAPTTQHLCAGVLAASSASARATVELL
                     QLAQVREALSATLLSHRDRNRLSLAKPQPMLPVPDLRPLLPDRLAALLQSHLQRAATQ
                     ARQVAESHMLVQRLMQHNETLVSALKQRTNEHAAASAEVRCLTSQLQLQQAERAERTA
                     MQERLVEVRASLLRERELRRAVEARLAALQQARLQWLSDREQYKREVYSLNMELANTS
                     VGSAPPAGEEACPLPPFADGGGAEPALTTSALSIQVDNTTMSDAARRPAAPPSHLDTL
                     ADSVMERRALCEQDSAHGSHPQVWRAAASAAEVDYQRNSENVYYYELLRNGLERDSHA
                     RAGHRHGGNTGACMDAPKWSSAHGETPPLRTLHYRPRSNLPTPQDLAESGSPDDTRSA
                     GGAPAAGGAAGGVRSTSDTDASLSNEQRQPHGPSCATGLPPTAASMATLKTTTPAERP
                     PAPQPLLTSANALELYVPSVVRQREKPRSHNAENCEERRLGTTAKTTQARQKTFDNEG
                     FGVVSHATATASPSSSFPADVPAPELDVCAATPPPLLPPPPLRSAETPGEGRRGSTRQ
                     QLRRSAAYAVEPPSAVAATALSIERRECLCVGRHAHRGACIIEEGVYLHW"
     gene            <154431..>157997
                     /locus_tag="LMJF_08_0400"
                     /db_xref="GeneID:5649324"
     mRNA            <154431..>157997
                     /locus_tag="LMJF_08_0400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681017.1"
                     /db_xref="GeneID:5649324"
     CDS             154431..157997
                     /locus_tag="LMJF_08_0400"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681069.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649324"
                     /db_xref="UniProtKB/TrEMBL:Q4QIC9"
                     /translation="MQSSAAPILTPSHGLTSLSSGSTVSVEGAQPHVFCLSSQASTVE
                     RAVRGSHATCGAGRTFRPLEPPAPALGNEEFTTRCKSTCDTIAGALPTIASAGVFEEC
                     DELARDTAAHFTDGALLDALPSHFFSSAELLTSSHLADLLLHAQESCAAAAPMSMCAE
                     KTATSHRPLTSSPSLHSPSSAAPSFPPAVPSEAAVLNVSQLASLGVPVRSATSRDADE
                     TEDTEARDTLSSGLMLRRPAHSMQETNSSSAAHQDNQPHFTPAAEHDGERTDTPVGTP
                     PPRDPSTATLPPQSLAKEEACATLVTSSSVDSAAPCTLATHPLTVNNACADLPASSSR
                     TPFSSPSPPEPAPTSRLDPGMNAATPEGDPAAPVPFDELCRRWMRLLARTAVPHEQPL
                     CIDCWRGTCLAPLQQCTRLSLEGMKTLATIISSTPAEKFRFFTMCYTDPAAGPLRGAF
                     ATAAGSRRGVDEVENRQAVGSMATAENLSRTLPLISLDAVAANLFGANEQGLLSLLEA
                     LSAPHGRYLPPTRGDARLLKPLQCASDAPLELRGASHAEYGDDAEQMMAELERLRAQQ
                     ASLERQVAVLRDVLHSLESTTHPHSNRGKQFRDTVAAPPSAVTPPGWKELAVEHNIRE
                     VQRAFTVGDEAAERQHAMEDLAKRFAYVSSTPIDAFCFPIDVSGPVGLIAGLRLGLVP
                     PYSGSSSGRTDSGDGNVRGGGASVASAMSALPPLAHAAVPASEESMHLEGFVQRQLGY
                     AQLLLSGNTSADGDNHSDAVKKRSSERSRGVNGSLSCGDAAPTAAAASSAPASTAAAK
                     VIMRVSPLEVNAACGYLLLLLNYLAHVNGFSFSTAVLRPAGDRSTVALLKRVPASASG
                     ANGCGGAAAATKSAAFSPFILSYFTGRGAAVTQAHGDAKSARATTRSSVARVVDREVD
                     FYLTDRLLAWRTFGAACVAVATCVKELADALHESLRCWRVRESMVCRPAPSAGPAAPS
                     GTVKSTEDASDFGSAPAAAADAGCLEGAQACPDGAAACKQPRAPVPLPQLLQDLASTN
                     DHLTSTVTALSSRAPHMSAAALDTLGSLGTTPAEGGNDLRKSASTSSRPQPPKEAQST
                     QRRSSPVVGERFPLQPPFQTRGDTVDGFSVRHGSVSEAIWTLGMKKLLANVQWCMEAT
                     AELERLYVVTGEAANDDASAQVREDDGEIAMQGDTIAGMRRE"
     gene            <159354..>163577
                     /locus_tag="LMJF_08_0410"
                     /db_xref="GeneID:5649325"
     mRNA            <159354..>163577
                     /locus_tag="LMJF_08_0410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681018.1"
                     /db_xref="GeneID:5649325"
     CDS             159354..163577
                     /locus_tag="LMJF_08_0410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681070.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649325"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q4QIC8"
                     /translation="MALSPTAYVSPGCSAQCRQCVSAKPDSFAFASVQSISLYRVSTA
                     NVTIPTSASSTQAQAQQQHQSLETIAITDYPLATLFGHGVNAAIAAFSYNDDYMACLT
                     LQNKQVLLWRLKDAETLTAKKITSTALSDTFKREGNPSTMCLAGRHHVLCGTNTGRLI
                     SLNTNLDNAEPRSVAIPPSQQRGNAQQPRSPLSPGNAYSVPAVAGPPSSRHPSGTSSA
                     AAAAVESVECIVAATARPEAVACGTSDGTLCLLTLNASTGLLVTASLCPFPAKEKSDT
                     VLDVNPLPVTSLAFEPTSAQYLAVGSQDGALALCDMNKNAIVQTFEASKLPEKHISSI
                     AWIPGEAGAFYTASTDSPVLRKWSVSSKSAVGSVSIMVMQQTPQQRSSGARGAADASD
                     YADAEHSSSSSSRIGIRSVACIDQTRVVTGLTNGSVKVYDVAQQRLECDIVTGHTDAT
                     LSCKLSKHDRDQAATGGVDGMIRVWNLRTLSQQYSIPVGPVMVHSVDWSPNGKHLIAA
                     LGSGEVVMYSTSTNRESWRTPVFSELVYRVCWAAGDSSLIAATSRSGVAVLSSKDGKV
                     VRRYPATRGAFYGVDIEPAKSKMIAVGSHDHRIYVYNLSSSSEHPVHVLAGHTDAVCD
                     VAYNPTALNYLLSGSYDGTLRVWDLSSNDAHTISVSSRALKGHADRVRSVAWCSLAPY
                     LVISGSADASIRLWDIRNGVAITTVRGHNADVVAISSHVDRPLTFLSAARDSTLVAWN
                     VALLRQVYLDAALGTLENCIVADPSSLMGVAASNVTVSQVAGAAVQRLAKELAECASR
                     PAERLQKLVSFFESPNGAAEVAEMALCAVDPAAYQVAVAEGKTAATGLVVPARSLVEA
                     ARAHATYTNERAHGKSVNAAGPSYRKQRLLEAADELLRVGQLEAHCNVLMEAEEWDRA
                     IAASPAISRAYWRSVCQKAAEAMEAAGDARAVAYYIIGEHAHKAAQVLTRLSQRHYDA
                     ATVVCQTCPQVADDPQQQQQQQQANEPPHNTTVDVNSVTTATQQLQRHRAAVLKRYAN
                     PQLFAAVLLAYGHHDEAVNVLEHCGDVVLAHLLVHTVPLREQASIDTAFRLSMLQSAR
                     QQRWDTALACATRQSNPYDALATVLALFQTAQGRQLTGKSTAPSLTSGNLSTLQGVSE
                     RLKTFYEQVRGECGKLQLPFDAAAIQQRHAHDGLASQNQLAAMVLVADPSSGPMTDGA
                     ILQSLSGFMESLLTVALKEIDGATTPFYLRQAYNVSAYVSLPFETPSKAGGNASVSLS
                     ASAVISSTTPEHKRFLALVFIVAALMAVKVYRFPKLLNSAFAKARELAAASGSASLST
                     ILTNTQGALGTYSPHSKEVDCSSVGCTLPALSSEGRQIVSVLTGDPVCGAVQVLEDGS
                     SFISKSEALAWMLCSHFSPLGSGARLTAL"
     gene            <166490..>172084
                     /locus_tag="LMJF_08_0420"
                     /db_xref="GeneID:5649326"
     mRNA            <166490..>172084
                     /locus_tag="LMJF_08_0420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681019.1"
                     /db_xref="GeneID:5649326"
     CDS             166490..172084
                     /locus_tag="LMJF_08_0420"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681071.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649326"
                     /db_xref="UniProtKB/TrEMBL:Q4QIC7"
                     /translation="MQPQVYGQGTEARGEGEDDAPMFADYRGPIDGERAERYNRRLQQ
                     QKQYDDIPMPPDDADPQEVFAYYRKLIGLVHFVPPRHWREIRFDLPANVAELRLYPQR
                     RERVQDREPIRPTSCIAISLKGMLPENTTPSEYAAQMVQYMFDLLNYQNASTAITELR
                     FVKKGTELLQMVVTLGKDIRLAGRVLTELQAAGLRAYYGKPVFEFPPNATFQVVDYRR
                     TLHDGKGISAEDVTFLLEPIRQYNTVDINVIEGYEPGVFYAPVKRPETVYSFLWNYFC
                     SYKFQADLFRRYGVLVTMAQCPHEFLQKGIPYHIQKQQLEEKIRAELQRKGMEKREYD
                     GSGGGVGAGGVDDDDDSDDGMNGGADGATGEGPPPAWAANAADEVDIFGSSTPASRVQ
                     KQQQQQQPLQPTSAAVSDPFGYGPGSSRAAATATAAATANTVATAIIFVDEDGLEDVD
                     ALLKQYNAVTEPPPSAGKKKEAAAKGRKGKETTSAASAAAVDERAVGEGGVAPPDAGP
                     QGGAHILPPPSVEGAGWGGGHGGYGGDPYGALPGYAPEQGVHGYPPAPQYYPSSGPYS
                     GAGRGAPPESYYGGYQGVAPLSRADPYPSVAQRSSSSYAAPPYAYRDRSAIGTAADTL
                     PATAASGSGAPSAYPLLVDEADDEQDVIQHPLPQEQQQQSSALWPGDGSGGGYGNLDG
                     QQPQQPPLSSQAIASVPHEKDMLLSWSMDEGLAHNAGSGYAATGIFSPLPPHRSQQGP
                     VNAFLPEGEEVGGMQGYGSNWPAFSDSQQQLSAYEAGTAVGGVLGDYDPALPSYYAGG
                     DVSSYPPPPPQAAVPWSHADNNSGAPLRYGEPVPMPMPPHVREAAEIAADLEERIQAA
                     FPATWATASDASAQPFLLDGEVLEGQDVQSTSEEANCVLEHIPDAAAAAVADLPAPTT
                     EIEELLSFLQRNVSLVGRLLHKTTTTTVEQAAEVAVFRARVARALLIGATVTVGESES
                     PASPEAIRAAWERRGADGGTVPAPPAAANDGEAEEPAEAEAAPVETQLPALLPYLLRT
                     SAGVDLAMLLAFHYPRAFSRRFLPYVPAYLFDENVVRVVLATALRRDTQAANVLVRHV
                     LAHWCPLTQWLLRVAHHKAAVKRDGGEASAAVAAAGESGNTMAAMKHLVSSIGSSMDI
                     VLAALSPAQREFCRASSDACNYVDAFAEAMHATGVHDPAEYGCALPLLWGPDGALYRS
                     LVRLYVNADVCDGAQMALRMLCCGRFSSSATSTSLASADVCLTRDHYYYCIVLLSRSH
                     TAPVLSRETASFCGAFLKLLELQHTRWQQQQQRPATEGGGNATRAPSVREKEAEQLLE
                     TAFKAMQTIDVYTTLRDAYLAVEVPITRFESVLARLSPAEPSAKLQLQVPTLAEWYNG
                     SNSNNGKGKNNAGQPPRKRGTEAPAIPSIFYYRAPSRRNARWNQLQQRQPQSSHVTLN
                     ASGASGGNGPTSIASRWRQEWTAAMRTYPPSGVPFAALPEGWTSQPSREYGHYCFTPP
                     APASSTDGAAAPATAPTHKHPMDGKEYPVTPQALLLQEAAASGNTSSVTLDQVRTRAN
                     AMHAEEAAAIGLPPPAELTAADAEAWASDQRRRNVFLDIATMELLGIKYRPSGRAHTV
                     AADAASTSGVKRGRDAGATAPTQEQLQQLLAKAIPNSYPAVGAPYPVVSRGWAVYLNS
                     ARGQYGFKGPNSGPSQPPLFVHPKTRKHYFVSPQAFAQQRKVNLDLVARDAGVEKKDV
                     ESWMADQRTRHPAIDAAVVKLIPIIYSDVDKAMEENAAVEVAGDSAAAPPVSSSRDGD
                     HQHQHTSSSRHRSEREGHSSNSGRKRRRYEGGGSDASHNDDDKRENGDESRGRRRRRD
                     RSPRRRGGNGGGGGGGGDRRHR"
     gene            <173458..>176235
                     /locus_tag="LMJF_08_0430"
                     /db_xref="GeneID:5649327"
     mRNA            <173458..>176235
                     /locus_tag="LMJF_08_0430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681020.1"
                     /db_xref="GeneID:5649327"
     CDS             173458..176235
                     /locus_tag="LMJF_08_0430"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681072.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649327"
                     /db_xref="UniProtKB/TrEMBL:Q4QIC6"
                     /translation="MSGTSKLRWAHYDGVYQPALHIPTEEITETELPAGYSAVYLLGL
                     DSTVMVPDADLSPYDPHDTAKASHPAVALGVATAQQILDGFHAIEDGSAAGTQHPQQW
                     PHNDEAEGPSDTLLLEDDDDDGGHAHGRSSASRSRHEEKQQRKREKKAAKEAKKAARA
                     AVKREREEVTSAPTVQHRDDGDSDDELLVATTIENKYRQARDRGAAGEGDNAGASSGK
                     KGKSKKERDDGAWAALEADLFSDEEAGDKESEGDGAGRYDARGAWRQQRGVHAGNRMG
                     QALSALNVTRAAPDIPGLSTSCPYAYPYLMEIDYEYRQLAQEAASQGLLLTKQEGEVV
                     REIDAELRRKAAERVYLQSVLEQRLQQQEKGQEGGEASTAASNEVDALSEAIGKLDAP
                     LSVADVLRRLVSKQVSASTAAFDRDAAARARRAVQRRTRTFQDTSVITLLEQLRAVAA
                     TPREDAAEVMRKYVQQRRQHEEMKSNMRGLTKTGFYAVPKPMEKWKRGRDMMLLVNAG
                     SEAQKVRPTSYISQTYSTMRERMRDHAEKCFDRMAVAARDGASFLDPSSFAGTSTAFM
                     SSSSTPAALPLSAQQHLIQHQQQQSRLNAAKAVHRREAFFQFHSLRCDTAAPVTLESV
                     PLNAGFAAASTLAPGLLESVGETIAPGSRAASLGRGGEDASIHTEDGTSLSYSTHSAA
                     PSSYPYLFDHEPRSRRPHQRRSSRGSVSGLSSDLEGASVNTSRATSVASAYSGNGEDD
                     KAKEHRRAGCSAGKRGATTAATQNGAAATAPADWRSNAKRSIMEQLTLYRRGKHGKPA
                     VLNDEQCREMCRLLLDRAMRAEAERQGMSLAVQSNNIAVRFTKVTEKRLKKSVDHYLE
                     RQMQQGTLFSKAAASAGGAFGASAVGVLGDGAVLQPGILPIDNNGAVLPHDTATEARQ
                     RAVADTPIYED"
     gene            <177637..>184941
                     /locus_tag="LMJF_08_0440"
                     /db_xref="GeneID:5649328"
     mRNA            <177637..>184941
                     /locus_tag="LMJF_08_0440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681021.1"
                     /db_xref="GeneID:5649328"
     CDS             177637..184941
                     /locus_tag="LMJF_08_0440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681073.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649328"
                     /db_xref="UniProtKB/TrEMBL:Q4QIC5"
                     /translation="MIACAALQRLERYGSLGLKRHSTEDFVSTSLKDPRRANIYALTL
                     LSTWKEALQAVRGDDANGVADVSKAPARYTDALVYAVSFAVALTTQHVFEVGTATAAA
                     TVAGMSGSSQPAAAGTGGKTKKAAWQSSGSGCSSKGDATAASLIFTDASAQALELLTL
                     LKEVTIAIGSGRALRSNASSDDFTKAVAHLLTSSTDLTLLLLGGVSISSGAATQEGQE
                     SQPGSSSAEQQQQQQREAILAQALVLVAATAQMLRRVQASYPINDLYHTRPCAALLKT
                     VVNKHKQLQQRLKHVSGSSDAATEQTGRAAPALLDVLHRYIQLCARRSISGNQQQSAA
                     APSASASAASLFSIFSLFQRLGMLHGALGAVTALPKGFTAQLCSACEDVQYWLSQLLS
                     STACNRATRYVVYFREDELRLMQHNVRQTSEYALYTFATTPPVDPGLVEPLLRDGAAA
                     DSNDEATRARAALVLAQWCVSAPFFFESFCQGESWASFAQEQRRLVLLQQSRVRRGLE
                     RASRRQQRKERATKKAMHLDEEYGNRSSSVSCDSSDAASAHSSSSDSASSAGGRQQRQ
                     RGNGSGGTETASLLSLPTASHANHAGCSVCGSATSLASRVSLLSTLSQHSAASYLSFI
                     SVLRPSITAGSAAGGTGAGGSADGDGAAGAGQQMHESEDGNTNLPLILLEQLALGLHR
                     FMEAYPAELLDRYGLRSVSWSSIARMFATVEKSLVNTTTTAGAAAGAAAAAAPRQANH
                     FPNDQEPPQPLFNLAQDIRYNKGMGYECLGLLFAKVVAPLLDPASSRAIASTSWSPPQ
                     QHQLRRSTGEATGTEDDDGSGGGARSDGGGTQEEFFANAAAVAATVGRAVLTIDDDPA
                     TRASVEAALSRCLTAYETVAPQVVDMNLPTILRLAARTAATSAGSTTSLRASASPSSL
                     SIVLVDFVRDITARLGRGNDLPHLVDALLQRGDFAANASATAAASAVVDGSGDKASTI
                     RSLRAVFSLPPVRQAVMEAAGTSLDPESLLRRLSGVAAELEEDNKSSSSSSSAQDEKQ
                     VELSSTARSCRKHDDARVQRMLLALELMEALLAGVTPTCVSASAVLEHTTQLELLLSS
                     SFMAAVEELKGVCGEALDDRRALMIQHMYTIRQCRAVTILCLQDLGTQQVHDYLRMLE
                     DALWQLTSHVGNLVGSLTLAELQPLLRPHPARYGGSEVLAPSPSALEQLQVQLLPSSL
                     ILQRLSLARAVTVALGTHAGPAEELRDMVSYLWDCLGQGGHDADEETTPPQRRSGGVS
                     LWLANQMTSEEWVSLVALGKEKHARSSMMALLLRSAALTSAATPETPAWLSRCLQCIP
                     GTVLRALVDAFVSLSVDDFCDASLANSSLPSARRRLELAQRQWMALTTSLVAAYAVVG
                     HNPYWPSVVAHTVRSVTHVARVWRKHAKERLGSAIETPAQAPHHTTAAHVFALLTRQL
                     ISLLLCTLRSEPRAAEVLRRVLLTLARESAVGSSSAAGTSVPVLSRSGMSVAYVKALT
                     VPAASLGDLSTPTMLTTSDPTTAADGGGTPEVVAALKELTFEDEVRDVCTELFAASFV
                     KRIFTVTDLCSDSAAEAMSVPLATATAAIRASMMTLALLYQVCVAAAQASWRAKATDG
                     SLEALVQTPAVVFLHTLAASFHARGAARVSGSGASSDAAVDGVLAAFLEQFCAHGEEH
                     SEQHLFVHIASAAAAGEKRRRTRDMTDAGAGDTDRAAGDSSPLRTAIVAPASALEAVE
                     DLWCEQLRWTACTVMRLSHAADSEPSSCATALQRACLTFRQLFACMWSSAHFRKHQMS
                     KGVGGRIGGGGSDSRRARSNGDSEPTARQSRLAGDVNAFLAAVLGSPRAPGGGSSDGA
                     TRVTGNELRNQLADFFGVPVTATDGAARGVERSRHPCDRIWMQLSSVGGEAGVCALWL
                     LWKLQCVSAALTDRPAMVDGVEDDSQTRMRTFLGAYYDLNASVEGDAATAATTATAYT
                     RLVTALRASPDTLRILPAEEEPPLLHEHVQDLLTRTIPGASPRASAAASSFALAAPAA
                     AELIVHLFSVRPRLPSGQLLPHAQHLLVWLSHASSAAASLAAAGVHGAAGPSLASLCI
                     RVCAAVAAHPAVSGASDSSALIAAWASSLPPAQQQLDACRGGWQPRNGRSTAQELLDN
                     VWLLLLSLLEESRAPLRATAAASSAPLLREGEVVQMILLFTKTWLGQSARQQVLWSRP
                     AMLPPLMCALFTCVMRGMESQQFSPRVLSVLASGLAAMAAHVDAATANEGDAEVDSVD
                     GDDDEGEGVGERKAEAPASSAPATKGDERRRPQKRRLEAGTEAWVTGTATPAHVKRAA
                     LAAATSALFEVAHHYIHIFTAFSSDMDFLFTDFLRVLSQHFLPTVARPPIAHRVGVRI
                     GSTVRSDVSFADLAYTCVGNAESKSLLRQAALRMEEEGLMDSSSAGGGIAGEGKRGSA
                     LTDGSRSIFRVA"
     STS             184007..185460
                     /standard_name="ha3057"
                     /db_xref="UniSTS:515633"
     gene            <185817..>186359
                     /locus_tag="LMJF_08_0450"
                     /db_xref="GeneID:5649329"
     mRNA            <185817..>186359
                     /locus_tag="LMJF_08_0450"
                     /product="putative signal peptidase type I"
                     /transcript_id="XM_001681022.1"
                     /db_xref="GeneID:5649329"
     CDS             185817..186359
                     /locus_tag="LMJF_08_0450"
                     /codon_start=1
                     /product="putative signal peptidase type I"
                     /protein_id="XP_001681074.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649329"
                     /db_xref="GOA:Q4QIC4"
                     /db_xref="InterPro:IPR001733"
                     /db_xref="InterPro:IPR015927"
                     /db_xref="InterPro:IPR019759"
                     /db_xref="InterPro:IPR028360"
                     /db_xref="UniProtKB/TrEMBL:Q4QIC4"
                     /translation="MREHIDTLLSLRIRDVVQQVVTISLFLSVVLVGWRGAAVITNCE
                     ASIVVVLSGSMEPGYHRGDVLLLHHRPEYPVEVGDIIVYTLPGQDIPIVHRVHRIHER
                     AEDHKRLYLTKGDNNMNDDRFLFHDGREWVEQDMIIGKTFAYVPRIGYLTIVFNESKT
                     IKYVALALLGFFMLTSTQEL"
     gene            <187443..>188333
                     /locus_tag="LMJF_08_0460"
                     /db_xref="GeneID:5649330"
     mRNA            <187443..>188333
                     /locus_tag="LMJF_08_0460"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681023.1"
                     /db_xref="GeneID:5649330"
     CDS             187443..188333
                     /locus_tag="LMJF_08_0460"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681075.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649330"
                     /db_xref="UniProtKB/TrEMBL:Q4QIC3"
                     /translation="MRPVTRSPLLVAAVVVAATLCLNGDNAILSLSSGVRLAHANGPI
                     TKDQCFILNPQPTVTSCNAYLPPIVDLYGSLPYDTTPDYADCVKERCLCTGAATSTAI
                     KTSGFFCNSSGWMESGYTTCNVLVDCFSKFWRCINRALYMRYLTDRENLDSGEVDLIT
                     DLISHGSHPGEPFDITDTFRSCRLMMCAAANSRQNCGLVTCLPNYTQCDEYIRPPPLP
                     YTHPLCTQGCRAALLMMALTIAAVSFSACCFCCCPAQVRISEPVLMEEVPAHKVELSS
                     MRSEVEAQARRHRTNDPYTQ"
     gene            <191166..>191519
                     /locus_tag="LMJF_08_0470"
                     /db_xref="GeneID:5649331"
     mRNA            <191166..>191519
                     /locus_tag="LMJF_08_0470"
                     /product="putative small ubiquitin protein"
                     /transcript_id="XM_001681024.1"
                     /db_xref="GeneID:5649331"
     CDS             191166..191519
                     /locus_tag="LMJF_08_0470"
                     /codon_start=1
                     /product="putative small ubiquitin protein"
                     /protein_id="XP_001681076.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649331"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR022617"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4QIC2"
                     /translation="MEHPEHSNQRPEGNNNTEAPAPVKAEAAAAVSAQQISLKVVNAD
                     GAEMFFKIKRGTQLKKLIDAYCKKQGISRGSVRFLFDGAPIDEMKTPEDLGMEDDDVI
                     DAMVEQTGGSAVRQL"
     gene            <194197..>195045
                     /locus_tag="LMJF_08_0480"
                     /db_xref="GeneID:5649332"
     mRNA            <194197..>195045
                     /locus_tag="LMJF_08_0480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681025.1"
                     /db_xref="GeneID:5649332"
     CDS             194197..195045
                     /locus_tag="LMJF_08_0480"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681077.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649332"
                     /db_xref="UniProtKB/TrEMBL:Q4QIC1"
                     /translation="MAQLTRNEVHTYAEAMIAAIKTPAFQERVRAAMSREPTPADAEA
                     VMKRYEEVQADYFTNHYNAEAGGICSSASAGAESRGTGGAGGRAKSSQDASEALAQQV
                     DDMNLQEASDAPKLDGVEIVEQLKNAVRVYKEKETVRLITELCLLIESQVTALPATVP
                     ALRHLYSNSVYGSSAMEHAQAASAQAGGGESVLPVAQPSPQVMSMMGMAMRTLNPRQR
                     ETLERVQRAMMNGSPPLPEDMQDMLLIQRQLGAFMQTMQRFGQMPSGRGCGSGGRGGC
                     GGQGGQ"
     gene            <196277..>197470
                     /locus_tag="LMJF_08_0490"
                     /db_xref="GeneID:5649333"
     mRNA            <196277..>197470
                     /locus_tag="LMJF_08_0490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681026.1"
                     /db_xref="GeneID:5649333"
     CDS             196277..197470
                     /locus_tag="LMJF_08_0490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681078.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649333"
                     /db_xref="UniProtKB/TrEMBL:Q4QIC0"
                     /translation="MLQRFSNVSEQQNARGMSPPHLASTPPPSPPRAFDDTGDAERAM
                     HVSPAQHGGGAAVSLERVPVSVPPVCASNKTAGAPSPARASASSQSVRTFSPALLSQL
                     LLAEAARAEAAAAAVAQQQCNGSVEDGSYASAAPFYAPRPVQDSQLPPRMTTTQTTRL
                     FRHHRDSGAASLHEPRPVSPSSVAASPSRLPMDYLTVSIGVVPLPDSEMPHGSAAPRK
                     RSRWWPWSLTAPTVTPNAETGVVGEAAGDTASRITRADGNAAEASWLTVHGNPTVSVH
                     QLHPLRLYTSGRQHTAGTTAGRSSTSPTLKQFTGVTATVVADNVVSIEPSRRTMDVLG
                     WSGVFADVPLALPGARLTNRPGATGVVMKGSKGVHARGGDRDGSSQSEALFCSGAASI
                     SVILA"
     gene            <198293..>199381
                     /locus_tag="LMJF_08_0500"
                     /db_xref="GeneID:5649334"
     mRNA            <198293..>199381
                     /locus_tag="LMJF_08_0500"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681027.1"
                     /db_xref="GeneID:5649334"
     CDS             198293..199381
                     /locus_tag="LMJF_08_0500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681079.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649334"
                     /db_xref="UniProtKB/TrEMBL:Q4QIB9"
                     /translation="MPPSRHARHAAAVQEPRRPAKQQQQQQQHSPSPDHAVGDGSSVS
                     AWTSTGVTACAAPRLRKGKGPLRSVASPSIGASNPRQDASAATTWRAQLLHLATQEAY
                     TAAALLRLLRSPAPADARDGVQPNQLLLDTAAPPPVPSGAGAAGGARVQTAHTARRSA
                     HDASPPTAAAATTEAASPSTHTVEWTSYGELWEGLLARLPLVNGANDAAKPTPATGGN
                     SDDQGSTGGGKRFGGKPAGHRSDKKAAVAAALADGGAKAGAMSSPTTDVSPMLCTLSN
                     DWRSFFLHRRLSGSAMAGGRTRTAVPAQGHQAAARPQRRRLDNLRCSPYMTHAEQRAI
                     RRYTAAAIAAVPSGAQRGLSTVCVLDFL"
     gene            <200093..>202603
                     /locus_tag="LMJF_08_0510"
                     /db_xref="GeneID:5649335"
     mRNA            <200093..>202603
                     /locus_tag="LMJF_08_0510"
                     /product="putative ribose-phosphate pyrophosphokinase"
                     /transcript_id="XM_001681028.1"
                     /db_xref="GeneID:5649335"
     CDS             200093..202603
                     /locus_tag="LMJF_08_0510"
                     /EC_number="2.7.6.1"
                     /codon_start=1
                     /product="putative ribose-phosphate pyrophosphokinase"
                     /protein_id="XP_001681080.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649335"
                     /db_xref="GOA:Q4QIB8"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="InterPro:IPR005946"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="InterPro:IPR029099"
                     /db_xref="UniProtKB/TrEMBL:Q4QIB8"
                     /translation="MLKTGKDLSQGQAFHRQLLSEYNTEITLDNYVSYFELKPIAKKI
                     EHIRQALESTYHNRYAHRGVVEPSPTSTLTITEPLQVVPVQPCLYETSVAVTPTTQRD
                     DKEFPASPVCGTPVRRQQHITTTMFTDPLSPLFFETPGFQALKETDKELATLIQSRVQ
                     LQECFFEKLHESYVRVKRYLIKLERDFVNAVAELRTFNEDHIRNELPRNYIPSLYLKL
                     EVIVKYRAVNLKAFRKILKKFQERCACDSLELLQRVVNIDRLIYASNISQPSIDFRSA
                     ALDLIVVYGTVFRLTYEQAVRHMKRYENRTGVNAQRILPNSQTFFVADAFPHHERPGT
                     FAVRVLSGTCSLFCEKMITEVLQCPRFPGNSCGRFANGEVSVNLQAPVRGDDVFVVQS
                     MVALESENLSNAGALMELALLVHSAQLAAAARITAVIPYLAYTSNVASISAVAEMIEL
                     VGCHHVITVDMHSDQVEGMFSIPIESASAMYEFVRYISNLLESEGNTFENITVVAPSG
                     EFLGRAKEYADALMRYNNLDSATQFVSVCTAVRRVETQPLACTTRANRHNYEIPRVMA
                     ESRRCIGLSSSGEVAHECKLQQQQHGPVAPSAEVGTPSSSTAASVATSHINVNTPIDA
                     QGKQYPHSPATPHAADAVMSELVAIVGSESQAVSFSTHSHYATAHGGTHNLLLQRHGE
                     PDMLRSSSTLGIEKALRQQEEGPQALIMRKETASNEYKKYVLVGDVKDRLCIIIESVI
                     DEAINITNVARCLQEHGAERIILVATHAVMSGKAIHLLVESPIELVLVTDSVNQDELM
                     KNPALARKLRVVPIAPLLARAIEKIHTENTLATLFDKS"
     gene            <204628..>211611
                     /locus_tag="LMJF_08_0520"
                     /db_xref="GeneID:5649336"
     mRNA            <204628..>211611
                     /locus_tag="LMJF_08_0520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681029.1"
                     /db_xref="GeneID:5649336"
     CDS             204628..211611
                     /locus_tag="LMJF_08_0520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681081.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649336"
                     /db_xref="GOA:Q4QIB7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4QIB7"
                     /translation="MGTSRVHSTRGTAGARWSAISPGPRSIASSTRGPHGLQRRHGFR
                     VLRFMLTCVIALHAVTAPLSACNAHILHATAPPSIKAETPASPSFFRPNDLPPAVPAA
                     PWRTLNESLLPYPVFYPAIALLNNSILLLGGCATANCATPVGASGTRVAASRRQASAA
                     TSVNSPYHERLLSLNVEKGNITTPPQLTLPAGLGFAGRYAAVTLTDSVYVARSCTMST
                     RSPAEVASMTAEELQAMQAAYAPVVAFYPEGTAHASTRTGGPDPPPAVNLTYFNVPAD
                     RVRVNASCTALATENKLLIVGGFLLSRKRVTASVDSFNVVTRKYDADVAFLTTPVLQP
                     SVATSTGFAAVAGGWTYEADTTTSATREARALQEKCRVSRSSSVAASGEPLHLAQELA
                     TPPGKLSASPRSDTPSSPPSRPVPSPAPLQPVARYLFDLLFFEPDRVRGGARAAPRGA
                     LQTRGSICVSPVDSSTLPRTAVEDILLSPNGCHVAVFGGQVVLVDHNLGHIATLDIRA
                     RLAQAFAARAPLVLPPPPVVTLLRTAKPNTAARAFAGAESAASWNAQASSYQNDHAAS
                     TAVSASRGSSSAAPMTSSTSSSSSATASSSSSSASLPEYRYSWMQPTLIPLPYARRPS
                     PAAAPGPPVMADTILLYYALGGENVWSEVVTAAGDNAADEDLLDPSGRQHVVPQRHGD
                     PSTLRATGKGREVVVRREPTLRWAQRELPDVRYDRDRPELLAVTMPTPLWPDALTLQT
                     NSEGIIHLAFPDLNYTRYCRWNRLAYNDDDNVVCAVRLSSRRDCVGNTAGTLDSAYDG
                     SPNATILFSASGSTTPVYVCFSYVVRPTLWPTCRIRQSFSILNPMMPLRILDNSHTTS
                     APTPTPRPSPTRDPADNTTSSPLFMLAVGLSVVTLLVAVLLAARLQHVPEDGLLVMSL
                     LGRGDGAGDQHASPRIRGRGCSGAARHNGQGRRKRPLCGSDEPNKAADAEDDDEAGLC
                     PISTYAEFLQVVGSAEEDSEARMLASAADVLRLHQHRYRVLSRIGQGPHSLCFLALRK
                     APPPPPPLRVQPQRVRGAGAGINRRVRMSDGAARPVARSSLFTRPPPSFPAVSTTLSP
                     GVPTPATTLPSVAATSSLWAARHDQRTAVVVKYTQCPDDATRAAITRLCERLRDLRAD
                     AVTEALGAAGVYRQHRNSAPSRHPRRLYRPSDTSATVSATAALRPLDVPTQLACDIAH
                     NVASGGRSSRGGAAAQARKTDAEDATAPPASRRGCSAVIVTTGSRAGCQPLPLLFSPA
                     SKARIIDGDDDDDDNSCAWLDAHEVNVVLSLFLLLPEDLFVSYEVSVLQQQNSNSSSQ
                     HAHVNRSGRLTPLSVSRAAVEWNCRHVWPGTNVEPAKASHHRQRHRCTPMLSAGQSFP
                     EQLTPRVCWAACVNPLQPSTVRPWSLCLVMPYERSGDLAGFILRSQQAQLLPADVTGA
                     KDMKRTGLRSRTSASPACVPPVYYCWTESLLCSILFQVCTGLQLLHAQSPPILHGNIK
                     QTNVLLREPVSFSVARRRVVVAGTPAALTGMKTGVSSDRGGLEDANGDLDMATATVRV
                     PGAQQAREEDSSWQDHRLEAGMAAAARPLSAHASFWRASSLVAAATAVWQAGSPVLRS
                     PLSIGSPPSLFRAGATVSPPTAAFSHDAPQEGQRQLQPYEDEQLSTQEPARHLLSAHT
                     YLPISVTDGGMSWWLTVQLPLRLRGCFGLTTRSTLRQTPAGLCWLRRLDSPPSSPPPP
                     TTTKRSVLPSDGCLAALADFLFTFIDVPTHVAPELLWGRLCTLSQSDHGYDGSGAAAG
                     LAVLGSSLTQSSSSLHSTRNRREQYVASSRRDGHQRGDGDSLTHRRCGDVAREPAASP
                     ALGSANPLRATTSDELGANATGDKQALGVLPQQQQQPQLPRHDDPCADEDMDDRDAEL
                     DIDEDGIFTCEEVNALTSAMWKAEGLTRVPRSRRHHRQAPPQQRTSAAAVDSLQPGPL
                     AASTTTPGGGSVTDVTLQPLLNTTGEDGGHRSLGGDIRGLPSSFSNAPLFASATTTAA
                     GLSSTSSPQPTSQALHHHHNDVDRQLGGNSNTSGRRMAGGGGSVGGEGSRSSSSVYEV
                     LIQRVLAMDTASDIWSLGVLLYGMCADTADAQQQEEQQQHQASASTTTPTLNPPHATA
                     AGSSPVRAHEGVAGTLPPAMPTCTCASRLAQRAFAALLGDLYDLAVTGVPSGDRGNNG
                     WSCDGVDVEQLDEAADDHLRWPRSCALEEEVMQAIGEAGYTHVFASVLASMLSPVAAR
                     RPSAGDIVNQLRLVTTGAPATLASNIMRGGGGGLADADDEYSVARQSPPPRIQHSGGA
                     SDATSSVMLHEQTACMALRQR"
     gene            <213371..>218266
                     /locus_tag="LMJF_08_0530"
                     /db_xref="GeneID:5649337"
     mRNA            <213371..>218266
                     /locus_tag="LMJF_08_0530"
                     /product="putative protein kinase"
                     /transcript_id="XM_001681030.1"
                     /db_xref="GeneID:5649337"
     CDS             213371..218266
                     /locus_tag="LMJF_08_0530"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001681082.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649337"
                     /db_xref="GOA:Q4QIB6"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:Q4QIB6"
                     /translation="MVVYNTTHNSRYRLLQRIGMGAFSSVYLVQHKTTGKQYALKYIL
                     CKGDRERLAALRECEVIYSLQGHPQVIRIVDMFMSYQFQRASPSPAVAGSPTAVTTNS
                     ACKEQASGQQGLRSFPDVPSSAPAATAAALAPSAIAKPALAPASAAPATTNTVSVAGR
                     FKGLDDAAMTKTAMDSSTESRAAAHGEDDNGHVDDSCVDSHRYSEGRRRGSCPRVRPS
                     FERVACAAYMANADHVSDVENEESAYSEHQQPQQQGKQSMRAPSGCCPRPLPYSVQHT
                     SQSSSCVPAQLGAAAGGGAQGCGHVPLQSAHHASTTALATASAARAAATGALSPPRNK
                     AHADQPHLCCHATDVPDAVVHDESDATLSRSSEAGQEPGTLEDYDSGDGVHSGSDSRR
                     IAEHGQSATVERAKPAVPSRRALSEDRGSDGADDGHADIDAGREERWTELRGGADADV
                     KRSRKGSDARSGATSSSGADEEPVQPIHRVFVPPPYMHPPFKGMAAAPRSCSICSNNI
                     VSYTGTGNGVASVLQPQNRSYATGGGSPTAHHLYSVFPTAAASGALAVVAPATANCSA
                     APAPVRRIPERPDVASLPATASPPPFAAASASLTSSSPSAAESLRHAAGSLVTTSTLL
                     PHHQQQQQPQPTPSSVTSYAPARAAVSSADVKSAATGAPAVQVPIRYKDFVLSPTTVT
                     AHAAAPWTPVPATQASALVHGQVHRKSADHGGSPAPPPCAAAARAGSGAAGAGAIGLA
                     VDRPTGESVNPYLERARGRQPVPPPRTSYAPGGGVRYNSLAVAYAAAPTTLQAATKGL
                     PAQSSSPSSSLTLSASGTGVSAFDDRKAGAGQGWHFEVTGAVSSSQDSDASMPAPQAA
                     RLTASRSLPSTAPAVATVVRNTYAPLRYGNVVQSNAASPATSSMASSSLVPPPSPSLQ
                     KQLPQPPSAACPAAATAADSDRLSVFGVLRTARAGQQGEREDWDESKPGVSASWPAKD
                     AGLVSTQAPPLLPLPGLARQASGAYFLRSVGRVNGAGAVPRTAAPRALYEEGRPPAAA
                     AAQDDAPSSTKPLYTNLGVLLADPSMPADPATVTTMHLLRTGVQPPSPRHPRSNSYAG
                     GDADRKQQRGYGNVGSTGAAPSPVRYANAGNPNLWSTYNAGASPASAASAAAVSVLTG
                     LSSRIGAKTPTAAGAGESDTNDGKSSKTTRTNSSSSPLQDAYDTGYLCLVMEHHPMGD
                     LCRYALRAQHELETRRHRQQQSESQALARSSLMGMGILQPITSQNRTCASERSSAQQP
                     QAPAKNATEGDGGGAGAEAGEPTSLLSLRPLSLTHGWAAGSAAAASSLLAAAADATWT
                     VKMPMSRTDLHPALSAGVGGRGNTSGSHTAGVTDGDERASNFDARRAVSVAVDPTSDK
                     PLTEAQLLSIAYQLASVLDHMHQQNPPIVHRDLKPENILIKGALADYLDLPLSAFLAS
                     TSSTVRCGGKDDALDTSSVPSMTPPFTTPAAVIDAAASSLAPLPPIRITRAVVPIVLT
                     DFGLAILQDTHGRPHGSRGGGTRPYIAPESWKGGTCTASDVWSLGCVLYALATCRLVA
                     GDVRIMSQEAKRDGFASRMLKDIIAHKYSLAFASFVVSLLVVDPAKRPTAAQAARCFC
                     VADGDICFDLSSPFFSNVLDL"
     STS             217203..218434
                     /standard_name="D11S4088"
                     /db_xref="UniSTS:54059"
     gene            <218906..>219964
                     /locus_tag="LMJF_08_0540"
                     /db_xref="GeneID:5649338"
     mRNA            <218906..>219964
                     /locus_tag="LMJF_08_0540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681031.1"
                     /db_xref="GeneID:5649338"
     CDS             218906..219964
                     /locus_tag="LMJF_08_0540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681083.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649338"
                     /db_xref="UniProtKB/TrEMBL:Q4QIB5"
                     /translation="MLRISPACFAPLQASHPLLLFSWLRQSRGRRGSAAATWRTDAKK
                     TFISEGAMGLGGGDVGQPMANEASEALDGTGTSTASYRQAGLKGTVGRGVGNGQAFQA
                     GGGAAPGSTVPKQPIDDVLIERAAHLTGPNRRPLAYDLEIHRAARAREAAQKQASQEY
                     LLHFDEQNMPRNPHDPNRPRASWEFTPTPEHKSLVLLLYRNVLKGLMNYKSVRRRSMI
                     AYARMCFRRRAMATEKLLIDECIEECRRSIYVLEKHHNFTKTGTYEFDSMTLPKDTGQ
                     DVKTYMEEVYDPEQSRMQFQNFTDVQPGREHLHRQGLGPTSGSHHWKDQKTSEGFKVE
                     IRDEDRALRPPPPPGMAS"
     gene            <221469..>222506
                     /locus_tag="LMJF_08_0550"
                     /db_xref="GeneID:5649339"
     mRNA            <221469..>222506
                     /locus_tag="LMJF_08_0550"
                     /product="translation initiation factor-like protein"
                     /transcript_id="XM_001681032.1"
                     /db_xref="GeneID:5649339"
     CDS             221469..222506
                     /locus_tag="LMJF_08_0550"
                     /codon_start=1
                     /product="translation initiation factor-like protein"
                     /protein_id="XP_001681084.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649339"
                     /db_xref="GOA:Q4QIB4"
                     /db_xref="InterPro:IPR002735"
                     /db_xref="InterPro:IPR016189"
                     /db_xref="InterPro:IPR016190"
                     /db_xref="UniProtKB/TrEMBL:Q4QIB4"
                     /translation="MMREAGRQRRRNADSDESSSEDEQQQTTTTVQETTAAAPPARVR
                     AKAPAAAVVSAPSMTLHADPTATQVTAPSAVSAETADSEGGSNEDAPSSAAAAAPPNE
                     FSEEMEAIDYDALTYAALLDIMNRASRPVIEELMAQREQQVESTMQQQQNQRVERFLD
                     VATTSSATAAEANGSSAEEEAAEGYRYNTMLTRLFEALNRNNEGSAMTERNQLPVPIL
                     ERMGKKKTVIANFGRICDAFHRPMEDVKDFIEKELSIRGNLDSNNALILKFEIRKQTD
                     FDRVLIKYLDEYVKCNSCHRIDTTLTKDGRRLELRCNVCTATRTVTAAGTATFSAQIE
                     KRSRQRAAMIL"
     gene            <224523..>225236
                     /locus_tag="LMJF_08_0560"
                     /db_xref="GeneID:5649340"
     mRNA            <224523..>225236
                     /locus_tag="LMJF_08_0560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681033.1"
                     /db_xref="GeneID:5649340"
     CDS             224523..225236
                     /locus_tag="LMJF_08_0560"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681085.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649340"
                     /db_xref="UniProtKB/TrEMBL:Q4QIB3"
                     /translation="MQPRRMAGHFNPTPQANSLAATHYAHTPELRHMADGAAMSLSGQ
                     RIPLLKPTLSKWSRQLRSDIYDELLKLPLRYALHDFRTLQAHIHAVPATATNASCTAA
                     AGERLPPGVYHASSGLSSASPDAPAYYAVAGRDSAVGYAPPLGPADPVDVIPFFVHRS
                     SNGHLPGKVYSMNAKTLMPAFYMRIQNIEGDMFRFEEELMKIFPTKKIFVRSHSVYVY
                     NVNLDGRAVLHHWLLGLGF"
     gene            <226490..>227029
                     /locus_tag="LMJF_08_0570"
                     /db_xref="GeneID:5649341"
     mRNA            <226490..>227029
                     /locus_tag="LMJF_08_0570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681034.1"
                     /db_xref="GeneID:5649341"
     CDS             226490..227029
                     /locus_tag="LMJF_08_0570"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681086.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649341"
                     /db_xref="UniProtKB/TrEMBL:Q4QIB2"
                     /translation="MTTPSAMMAVAQGSASAVTGICSYAVWVTTLPPSGGAPIVYPPG
                     AVAYQPQNHTIPPANFFLQHWYVPIILILCAVCGFYILLALWVIYRFDLHAQHQAKKV
                     VGESYATKGYFNLDGEDGHGAPLPTTALAGAHAARSRGLSLSSVQSSSYSDDSYEDES
                     LPSLSEADDSIIEMNPLQR"
     gene            <229872..>230375
                     /locus_tag="LMJF_08_0580"
                     /db_xref="GeneID:5649342"
     mRNA            <229872..>230375
                     /locus_tag="LMJF_08_0580"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681035.1"
                     /db_xref="GeneID:5649342"
     CDS             229872..230375
                     /locus_tag="LMJF_08_0580"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681087.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649342"
                     /db_xref="UniProtKB/TrEMBL:Q4QIB1"
                     /translation="MTTPVPMDGTEVEFPSNSVVYQRVKHRLPAKSFFNTHWYTGIII
                     IVLVVLAAYMVLALWVCYHFEYSEQRKAKKVVAHAYVTNGFFDLGRGTTGLRAQRGRR
                     SSSNSSERRTTVLNAHPSASRDEREETHIWHSGSDSTTTSESDEYVVLHVNPLQPQGV
                     VLRTRAT"
     gene            <232538..>233959
                     /locus_tag="LMJF_08_0590"
                     /db_xref="GeneID:5649343"
     mRNA            <232538..>233959
                     /locus_tag="LMJF_08_0590"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681036.1"
                     /db_xref="GeneID:5649343"
     CDS             232538..233959
                     /locus_tag="LMJF_08_0590"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681088.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649343"
                     /db_xref="UniProtKB/TrEMBL:Q4QIB0"
                     /translation="MVSTHHADHAARAHRQRIVERQRAPPLAVSTTSPLTESLAILSY
                     VIVFSLYFAGFAIMVLAVVHHRRAVRRGRAPRKPLHPPPASLVAARSEAAYTMTGMQS
                     DASPARGEETSKATPTAARGSLQMSDLTVYRLMKLQNCMESDEDDGENSAQGVRGETT
                     TAEAVSVLGRTPLRLCAHRCGETSSGGSSGADTKQRLSDWVDNTALAVLKMPTAAKLL
                     PLGDQEPAAAADENSDVSLTRKMKADPVHAMRSLSLSPAASWSPCAASDACATLQAPR
                     RRRGGHHRRERCSDGRGSCGNVNAITAAAHVADTTTWFAPSSESSTYLSSESSSASPA
                     GNRAAANTSTAAVAAKTCPSTSPVLVPYVRLCQVHSSPTPVLPGWPSILDMGLEYETD
                     AEVDAADVFVAMKTAPVPLDPRSPGTMHAAATAAAAPANSHGSSALLALADAERSVSR
                     ASRQKSRLVPLLPSFFPGSSRPP"
     gene            <239072..>239503
                     /locus_tag="LMJF_08_0600"
                     /db_xref="GeneID:5649344"
     mRNA            <239072..>239503
                     /locus_tag="LMJF_08_0600"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681037.1"
                     /db_xref="GeneID:5649344"
     CDS             239072..239503
                     /locus_tag="LMJF_08_0600"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681089.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649344"
                     /db_xref="UniProtKB/TrEMBL:Q4QIA9"
                     /translation="MEAGHGCGAARQRKGPLSVLFVAAALLATLGGALLFAQANVETP
                     KPTPYVRRTYEAKVPFFTQYWWVGFVIMILVFLLVVMVLYAAVQHHFKHSEQLRRRKE
                     IEMSRTRIESSSVDDKARSQGADQCSRSKQSSYSNPLHTPL"
     gene            <240005..>240160
                     /locus_tag="LMJF_08_0610"
                     /db_xref="GeneID:5649345"
     mRNA            <240005..>240160
                     /locus_tag="LMJF_08_0610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681038.1"
                     /db_xref="GeneID:5649345"
     CDS             240005..240160
                     /locus_tag="LMJF_08_0610"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681090.1"
                     /db_xref="GeneID:5649345"
                     /db_xref="UniProtKB/TrEMBL:Q4QIA8"
                     /translation="MLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLFVGFGFFLLEFC
                     FFILRTK"
     gene            <246481..>254949
                     /locus_tag="LMJF_08_0620"
                     /db_xref="GeneID:5649346"
     mRNA            <246481..>254949
                     /locus_tag="LMJF_08_0620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681039.1"
                     /db_xref="GeneID:5649346"
     CDS             246481..254949
                     /locus_tag="LMJF_08_0620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681091.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649346"
                     /db_xref="UniProtKB/TrEMBL:Q4QIA7"
                     /translation="MGILPSRESHEYPGAFHFALSGSHAMAILPLTEHFFPSVDSLAF
                     RQLYAGRDMQSAKYNFSLISPELLRKYRHRSMEQRRGKGRVGDEAMAPPAGRNKPQPY
                     LRHGQPPGDDSDADGKWIGVDTIDASNYGQFFKDDTQCVSPNDPTSLSPDGDEEVCEE
                     LQWPNPVAHWRTHDTAKQLIQDRENELGFTDELNYVSLDGKGGGLRCLPSSLSLPCSS
                     GQCPRYGQTHNASTEAGTDSTAATAHFTAEERDLVNRFFARSPEALYNALVVEPNKGF
                     LVDTNKEMCRLYAAEQRWKEARNVVRAYRRQCKQDAAAGDAAQPAAGESPNAPKGEPQ
                     RRITKEEAEKAATVPPPPVFLRPVPQVIMVRMSREEEEATRAAYLAEQQRLHSRSGQS
                     QQSQSGGGDDAAASMSTSAAAAGAAEGSDVLRPLLMKPVSHLHVPTTRYHSFEDDPKY
                     KDGRIHLVEEDGVLYMFAYNTAYVDPRLRMRQQREELLKQQRQGKEREQQESQGGSLE
                     RGEACRSPSSTGAAVAGTAANVTASGTTASSPGSCSTERNAAASPTTDSGSGDGDGAL
                     CHASRQTSSFYHTVSAFGNEEDEVGLEEHGSQSKKAKGASPRRVSSTEGSPVVADTTS
                     AVAATRTENTAEEADEEEDTTLSSAPREPGGHQRRQSAILADSSALLQRSDGKPSTSS
                     DDDDDEDGDEQRKGGSASACSVGMTATTVNGVTSAAMREKRARVVQQLELVTAAPFIL
                     PICPVRIVGCNGYAESSCRGTPWLRGYEDEPEEDAYVESLPVKPPIMSGGGFIDANIG
                     DKILSRAYLLGFQVYRNVCLDAGLPKTLTRPFWTLGLLSNIPLLQISREMRFRMRAAA
                     AEVELGYRGLRDMIKGTENDLQSYIYGFLDILPYLQRVSRVRVKLAEAEAKAAAAAEG
                     GDGAASSSLLPIGHGASETPEEEAQESQSLQVPPAIPTRSSQSAVQHNLLFPLNEMEF
                     YTQFTIRGNQSLSRVRCEAQESFFHLIAEATAPVSTSLFMKPLELSTYDYGGAVRLHL
                     LCNRVTGADELQVLPPPRNLDQLLSYHRRRLQLRRQPPASADGNAAAAAPPYLVYAVV
                     HPSGKARGPSLEHYKKNLQAPEDGADANTLDEAEAAAAATDGTGGDRQYAAHQYTYPP
                     GSFVDSDMVIYNVHKGRWEHFEYFHHQQLAQRRARKLQAQAETAVGEPDGNKTPAQSN
                     KDTADAAAAKQAAESGEACRGALVPTRGGGFNANDDDDEQDIHLEDILLCWIKRRLQS
                     ATMRNRTDPGWLRDSEGHIVQEGRYYIWGFEQDGQQYFYGLIPKFAKEKKNKRHNTVG
                     GNAHSQHHQDNHTRRITAHGSVGGPSSALNSHSRPQIGSSSSGGGGGSARDRHGTLPE
                     TLAPASQQGPVSGSINGQPTDGRGSGRMENTEVRSGPASAGESAKDHPAMAPAVSLTD
                     VKGGAGSGLDTRADAPLNAACPDSHSRRQHQQQQQQQHPRSPGAVGGGGGRGTTSSSS
                     AAASANTAGANRLSNPSNATSGARLPAQTSSAPRAGASEKSSPPTLSSPAAASASSST
                     SSPVAASTAPPAFAYNTPGVASRRAAGSRGAASPPPSAPAALVIPKESEAALAGRSGA
                     AAVGRGGPSLAGVSLAQSPPLSVVLGGAAAEAASSSSNPRTLPQRQDGVSRISGRDNV
                     SRGQQFSSSATTTAQFSRQSATAPAAASYTSAEEVGYRQGRGERRGNGAESAYASPHS
                     QQRQQQQQQQGCRISDPGAVVLGYKGALQNRYHAPPHQHEYMQAPSSAAYDNSSNATN
                     YGGGSRANRYAATSHTSGHSYSDVPPPPPPPQSPPPPPPLLPAGAENAAYEQSHEGYP
                     APVEQQHHQHQQQQQPSDSPPPPLHLHPPTVYMNTGAGQASQRPTLVLAGPRVPSPRH
                     AQQQPQQQQQQQQYASYNTRPHQPQQHVSHQPSYKTQPAMAKAVSGARVQPPEMAPGP
                     YHHHTQQMVMAMSAPNVGPAAPPPPLVQANAAMNTSSSRYAPHPRMVASGAGAAPMQE
                     QQQLAPVTVVSVAPPSALAGGNSMYLDVSAASVAPSGSRSASYYPTSPSQVSYGTSSQ
                     TATAAMHPAGPQGNAASPHTGSGPPVLPPLKQQQQPAYPPSAMVDASTAGGQGSVANR
                     CYLQQKKPQSPPSGPASAAPGGARYGQMTSPTSQQHAYQQQMGTRNASYDERSSGHNY
                     GTYAASTANPNANSSFNRVGLSLSASAATVKAVTGVAGTSMLMSNTSASLPSTGSGMG
                     RGTHGYAPQPSGYPTSGSTSFTATPVVAMAAGATAPASSTMSGAEGSAVNAFPSYQAS
                     PHPQQQQHQQPSPQQHQQQQQQASVGGRTAGVPSPAPHQYRTTPTAEQQQQQQRDSRY
                     PLQVMTQSYSNDYNVNGGVPAMTTGGRASRGVAVDNDVLESSSYDDAVMHGSRGAQAA
                     AGEYQLSYQQQQQQYQQPYPQWQQQQQHSTSASSQPSSCAPTPLPVQQQYQQQYATQA
                     GNGSDSNGSRVHTHTQASRASATGNMNAPSAYAHEQQTSPYPQHAGAPPASPAAAAGD
                     GSDRGAAAAVTPPAAVAHLSTPMQSANSLNSNVAAMTSAGSCESTQASSAAAQLKRSS
                     DSYGYRSSRSGPTSPYLQASPQQQQEQQEPQRYLQQNQYPQQQQQLQQQQRSATRTTA
                     AAGPFPRGAGGGLRPKAMMSAGGAPSASLHHAYTLHHHPQQQQQRATHSSPAPGGYYQ
                     QQVLAHPQQQQQLSVASQRLTATPNASGTLLRVSPGSQQRYNQQYQRQQQQKPTSPYT
                     STKEEVEGQMQTSGNYNNHNLYNSNVGVAEASYESSNNTTAQRFAHNPYAMQ"
     gene            <258307..>264873
                     /locus_tag="LMJF_08_0630"
                     /db_xref="GeneID:5649347"
     mRNA            <258307..>264873
                     /locus_tag="LMJF_08_0630"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681040.1"
                     /db_xref="GeneID:5649347"
     CDS             258307..264873
                     /locus_tag="LMJF_08_0630"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681092.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649347"
                     /db_xref="UniProtKB/TrEMBL:Q4QIA6"
                     /translation="MTDHYFPSPHSLAFRQLFHARNNQSALYCFDMKDVSSVMPEDVA
                     AAFRTAQEEDWGAEVDEVDPSLHYYDDEIRQKVLEFGRTADSICEDAGAGAAVPRAPR
                     IGQHLRPSIEGREELYRVLVTEPMEGTLVDTDSEMCALFEQEQRWRAALPHLSNGQQQ
                     QGSHSGKRCNANGGHGADEKDADNAQPVACASATRQQSRDKAVKKGPGAAVANGAGFD
                     ESAAHSQSIIGSTMSSASPPPPAKFLYPIPRAIALRLTREEEEEMRAEYCRQHRIPYV
                     APAFHSVGTATGNRADACAGGFSAQQQHMAPPTPLPVVERRHYHFESDPQYRDGRVHL
                     VEEHGVLYHFAYFAKRQFPTTAAAAAAAAESSRGSQKGVMTGGAAPSGVLTAGKTSIV
                     RGRCLHDVVYCEKPSASPASSSKHAAASSSGFAGSEPEVAPPVRYTWCARCGERVTQR
                     MDYTQLRRLKSTRAHRRTVRRRLPNGDQDSPREKDSVDEVASNTERVDEEGEEEFIIN
                     IMPVRVVGMDGLLPSRSRGTPWLRGYEQESEAAEDAYMEQLEQKPPVMRVCRFIEGSV
                     GDKIVNRAALVTLLSYRPMCLQAGLSDALTRPIWSMCVLSNIPYLQMVRETFFRAKAA
                     VAEVDDDDLLLRNWLDVVDRENNFYNFINANLHMTRNFTPPERAVRQREQTDDVASAG
                     TASRRRTTTGGGCGVREGGSVGIDPAGSSSVTSPSLLKTAVYSTVGDNSSPAESHAAR
                     SAPLASGAATSPSRRGAALTAAVAACESAETAGQTTDAAAQGVCGKRQHKDGDLKPAE
                     GDGADLRSRHLTRALEDATIGRPEGHDPRDQVEEDEDDEDGADEEGGERGASDGVGVG
                     ESDAAAKAAARREKGKKKLQHKDLGLPSLCWSTASPPASSTDQSAADPAAASTSPFTE
                     DTNQVRNDDRGNTVAASVMGGLPAAVGSHYEAHRHRSGRNEDGEDASGEPPATTTTTP
                     RLLPNSASARSATGQGNSGVGDGVRLAVNNFDDDDDPDLGTEEERRRARVSAARISET
                     SGFSLQRPTAPSRVAGEAPSAEKQPHQQRLKLPPRPNFQLFSSRLEPHAPLSLCTLFD
                     YDASADQAAKRTVTQLAAAVAAGVAADHTNGVGSRDEDGVGQATAASAAPEAATTVWP
                     SYVQRDILRENERQQAEPKATRRPSHALYECGMLATTRGRNFLFLLREDCVRALLFYC
                     SAAAAPIFIGAYIEPVDTTSLSYGGAVRLRRPSTVDIPLHGGDEDGGSRTAPARNYDG
                     ERVVIGQVEGMEVMAEYFKSKGLITCFSVSDLDKAAPGPSAAHRLRKMILPTTSLSTT
                     YAQRRSSRSSSSSSGGLAGEADSLAAQQARELAQYGHVFTYAADEFCDGDLVVFNFEM
                     RRWEHYEHVQLRRRFAARAATDTADAVATAASAMSVRTDEPTFTGNVAVAADGSWSCA
                     SSVVDLSMSARLLCVGLDELLLSWTKWIVDNRFYEDRTDLGWLTLPDGSPIQLGGRYF
                     LWSFRHNHQRYFYGVIPKFAKGRLRRQKMVERNRSKKDAEAPCQQAQPLAGILTSPVG
                     AQRSSDVSVAPSAPSSPELVTVVAATPSSPPRPSGKSPWRTNHTLEAQHEGEPRRRGG
                     DIGTGSLHADPALGDQASSSPPHPGLGVSPPARAGTTQQSPLPREQQSTSAATQAVST
                     AAASSAHPAAVRQRQRHSSPHLQTQQPIAATSAPLPLPHRMNPLYTDSISYSASDANI
                     TLPQQSMPQWANTNATASRVSAAPATAGEQAQQGNFASSLNSAGGFSVHVGSDAARST
                     LCSPKIATESLTAAAATTTTTKATTAVRRAPFLNPPPQQPLSGTRNRLSAPGSPAMYR
                     SGPPIGFGGGPNYYYQYGGNTFIQDGKQQENEYYPPLPMSTPFHPVTAITKLVPLPHP
                     KTGRGGIPAIFRFWGPIGSPAPRTPVPVPSLPNAGGVAATVFLAAIPISLVPQQMHPL
                     SPRHPATGGSPAASSPLGGGESMGMSLVEVHHHSNGSSLGAGSPTAPAITPAPATAAA
                     GASAVNLTVRVRRRTGGGNTAAIRVGGGASLAPLQLPSQGTSSLGASLTTLATTGPAK
                     GPGTPFKHSPITPSNLPPAPLFAQSAPAQLLVDDSGSQRLSPTSMLPTNLVNEGSKTK
                     GESVLRVDEDTYMQREAFRWNPYASTKWAQNRSNSTGASTSDSRGRLPVEGGSGSG"
     gene            <266775..>267674
                     /locus_tag="LMJF_08_0640"
                     /db_xref="GeneID:5649348"
     mRNA            <266775..>267674
                     /locus_tag="LMJF_08_0640"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681041.1"
                     /db_xref="GeneID:5649348"
     CDS             266775..267674
                     /locus_tag="LMJF_08_0640"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681093.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649348"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4QIA5"
                     /translation="MASGSTHLALLRSGVVLSAVAAALCLCATAGLPIFRLNVDVLNS
                     SITQSLWTTDMYTPAGEKHIAVKTFVKDCSDLALAFQVAQVSTLVGIGALVLAFVCSG
                     FHMLSTFTRSSYRVRAVCGAPICLLLTVAIAAAGLNCYIMHAMYENNWCEKNATVCME
                     ATEPAMGFVVKPSILLAPKTLLREVSTAHRSLTPSVNMKIALSREADILAIPLVKATA
                     TGSTGGLFGDCNPFDGCISSFRKMGFTGAEGWQTAWAALASAVAGFFAETLVVIIGSR
                     RTSEAGLGESAVALLQGEDERLL"
     gene            <273028..>273888
                     /locus_tag="LMJF_08_0650"
                     /db_xref="GeneID:5649349"
     mRNA            <273028..>273888
                     /locus_tag="LMJF_08_0650"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681042.1"
                     /db_xref="GeneID:5649349"
     CDS             273028..273888
                     /locus_tag="LMJF_08_0650"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681094.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649349"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:Q4QIA4"
                     /translation="MQTFYDVLSVPMSASQDDIWHAYRRLLVRFHPDRCYHDNDSVAY
                     NTTRELDEVRMNLLNKVYKVLSNPQRRCEYDAYLTRQLRSNSSAYHQPPQRVRRPQGT
                     VQPQVLAFGGGANRSVSGMAGVVKAVMATAVDGNAAPATAVAAPASGQPVSAEEGARG
                     DAMHPPYANPMTRALGTSFGVGGEATTTVSEGGVDFAKSPTSNTPSSVSIVCTDSVSV
                     RAIKAGPRTVGLVVVTDGGVVTGSAASTETPEAPQQQPSAAAAAAIPSAVLDVHLPRR
                     IRVIEEHLVL"
     gene            <276224..>280078
                     /locus_tag="LMJF_08_0660"
                     /db_xref="GeneID:5649350"
     mRNA            <276224..>280078
                     /locus_tag="LMJF_08_0660"
                     /product="putative protein kinase"
                     /transcript_id="XM_001681043.1"
                     /db_xref="GeneID:5649350"
     CDS             276224..280078
                     /locus_tag="LMJF_08_0660"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001681095.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649350"
                     /db_xref="GOA:Q4QIA3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4QIA3"
                     /translation="MDVCWTVFYFVFLVCVGSVSSSISYRLVSRSLIEAWHSLHENRI
                     TTVNKLIDQSMDRVHDMAGGLLTLYMKTQFLMQSEKTLSVLCALLEKYDEARNYRVFS
                     VISLEQLEMISCWRGSAEADAGGQLIGAISHNHTVNATYYVNRSNYMFNRPLQVSAVI
                     PEENGTVAALVGSYAASELVEYTQAYYKGSIDTVDIRLRWLQPSSHPHLIYYNYPAGL
                     IYRSLKLPTNVSITDCTQVHIDGARLALNTIGEAKLGFLLAVFINQSLADADPLIMSN
                     NWGQQTVHDHIILPSSEHAPTTYLKSSNVSHPLMREALKHVDLSRMQDPGYKHSVDFR
                     YKGARAVITVWAYTSCHGLTLPLVYVNSQNIVTGPYLRLHDTLNGVLAAVMVLVSLVF
                     WLFVQLYFAAPLREITRLLDCSVQRGARALYRAGKHGIGALVEVRALGNAHNAAMRQL
                     REVDAFVPVAVREELPRGTLPVPLTVPIETTLTGLNVVMGSPEQRAGHLARHLSTVVY
                     ITVRPPQPPSVASHGSSRTPAPLSTQPAGHDAAAITPRRKQRLSAMVQRAVHTVNAIS
                     SGPFATPAALDSFANVVHELAHTHRGTVLRLLPDTCILHFHAAVRAQLLPRQEKQLVN
                     AADADVATEELAQQDARNAAAFALALLSWVDEQQTAEGRLESPRMPDVRALLDTSLFT
                     CGQYRPANSEQTMTVALGRDVLRDAGNVAERVGVRVAMTEETAARVLRGGRGGSGDSG
                     TAAVSAIPVEALCTGRSEHDADVLVLYEALYSRVASDATLQLYARCCFDGFARMRQGD
                     YAGALIAFCGVAAIADLEPGLLPPCLRREVAASDATGGAVSVQVARLMRECERCVRAG
                     VADGFQRVPRRPPGMDAVPRDDITPLSTAAPVPPVSAARSGVPAASAKPQRMASSFTA
                     PPWYPEVGDRHVMLLSNGAVTTRVVVPTPPAWVRDNHGMHWQLACRKSDGTPPGLWTC
                     RILALGSAGAIASVNYIMYREVHPVVAKAIRDAPPGPISDALRCATPVCGPTAQQDAA
                     IKRLIARHQELRHPNILAPLAFSQSVEGGVVLIWEFCPGGTLRQLLARYPQVKSITFA
                     CFGLQMLSALSHLHERGVAHGRLNLDNVMVDSNGHCRLVGQFADHALEREIFHFKPSC
                     YLSPAMAAGALPTPSCDMFCYGLLAMEAVTQQPCWRWATAAEYRGHRDSKPPSAKELA
                     DLMATGGQRFADAVVQGRVVLNLEQLDAGPITEHHNDIMISVCRRLLSLDPASRPTAA
                     QLREENKTVLNLLGITMEEDTR"
     gene            <286603..>287217
                     /locus_tag="LMJF_08_0670"
                     /db_xref="GeneID:5649351"
     mRNA            <286603..>287217
                     /locus_tag="LMJF_08_0670"
                     /product="amastin-like protein"
                     /transcript_id="XM_001681044.1"
                     /db_xref="GeneID:5649351"
     CDS             286603..287217
                     /locus_tag="LMJF_08_0670"
                     /codon_start=1
                     /product="amastin-like protein"
                     /protein_id="XP_001681096.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0670"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0690"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0710"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0730"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649351"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4QIA0"
                     /translation="MACKLGVAIYVVLQLIAFVAVMVGTGVDMFYNKPEHSSGARVCI
                     TLWGAKTDCRKPKITNPSSVRWALCPIRLNNFRLCQVFAIISILVYGAAFLFGFLLLY
                     CCSGFRWLCLALNIVGAATACVVWAVMVVTYRLPEPKCLELSDGYNFGVGFSLFVFAW
                     ILDIVDIIFLMLPWQIEEFVEGEEPSEKEEEEQSENSKEYIEQE"
     gene            <292482..>293096
                     /locus_tag="LMJF_08_0680"
                     /db_xref="GeneID:5649352"
     mRNA            <292482..>293096
                     /locus_tag="LMJF_08_0680"
                     /product="amastin-like protein"
                     /transcript_id="XM_001681045.1"
                     /db_xref="GeneID:5649352"
     CDS             292482..293096
                     /locus_tag="LMJF_08_0680"
                     /codon_start=1
                     /product="amastin-like protein"
                     /protein_id="XP_001681097.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649352"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4QIA1"
                     /translation="MACKLGVAIYVVLQLIAFVAVMVGTGVDMFYNKPEHSSGARVCI
                     TLWGAKTDCRKPKITNPSSVRWALCPIRLNNFRLCQVFAIISILVYGAAFLFGFLLLY
                     CCSGFRWLCLALNIVGATTACVVWAVMVVTYRLPEPKCLELSDGYNFGVGFSLFVFAW
                     ILDIVDIIFLMLPWQIEEFVEGEEPSEKEEEEQSENSKEYIEQE"
     gene            <298369..>298983
                     /locus_tag="LMJF_08_0690"
                     /db_xref="GeneID:5649353"
     mRNA            <298369..>298983
                     /locus_tag="LMJF_08_0690"
                     /product="amastin-like protein"
                     /transcript_id="XM_001681046.1"
                     /db_xref="GeneID:5649353"
     CDS             298369..298983
                     /locus_tag="LMJF_08_0690"
                     /codon_start=1
                     /product="amastin-like protein"
                     /protein_id="XP_001681098.1"
                     /db_xref="GeneID:5649353"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4QIA0"
                     /translation="MACKLGVAIYVVLQLIAFVAVMVGTGVDMFYNKPEHSSGARVCI
                     TLWGAKTDCRKPKITNPSSVRWALCPIRLNNFRLCQVFAIISILVYGAAFLFGFLLLY
                     CCSGFRWLCLALNIVGAATACVVWAVMVVTYRLPEPKCLELSDGYNFGVGFSLFVFAW
                     ILDIVDIIFLMLPWQIEEFVEGEEPSEKEEEEQSENSKEYIEQE"
     gene            <304253..>304852
                     /locus_tag="LMJF_08_0700"
                     /db_xref="GeneID:5649354"
     mRNA            <304253..>304852
                     /locus_tag="LMJF_08_0700"
                     /product="amastin-like protein"
                     /transcript_id="XM_001681047.1"
                     /db_xref="GeneID:5649354"
     CDS             304253..304852
                     /locus_tag="LMJF_08_0700"
                     /codon_start=1
                     /product="amastin-like protein"
                     /protein_id="XP_001681099.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0700"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649354"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4QI97"
                     /translation="MACKLGVAIYVVLQLIAFVAVMVGTGVDMFYNKPEHSSGARVCI
                     TLWGLKTDCRKPKITDSSSVRWALCPIRLKNFRLCQVFAIISILVYGAAFLFGFLLLY
                     CCSGFRWLCLALNIVGAATACVVWAVMVVTYRLPEPKCLELSDGYNFGVGFGLFVLAW
                     ILDIVDIIFLMLPWQIGEFVEDEEPSEEEMEKSKNAAQE"
     gene            <310119..>310733
                     /locus_tag="LMJF_08_0710"
                     /db_xref="GeneID:5649355"
     mRNA            <310119..>310733
                     /locus_tag="LMJF_08_0710"
                     /product="amastin-like protein"
                     /transcript_id="XM_001681048.1"
                     /db_xref="GeneID:5649355"
     CDS             310119..310733
                     /locus_tag="LMJF_08_0710"
                     /codon_start=1
                     /product="amastin-like protein"
                     /protein_id="XP_001681100.1"
                     /db_xref="GeneID:5649355"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4QIA0"
                     /translation="MACKLGVAIYVVLQLIAFVAVMVGTGVDMFYNKPEHSSGARVCI
                     TLWGAKTDCRKPKITNPSSVRWALCPIRLNNFRLCQVFAIISILVYGAAFLFGFLLLY
                     CCSGFRWLCLALNIVGAATACVVWAVMVVTYRLPEPKCLELSDGYNFGVGFSLFVFAW
                     ILDIVDIIFLMLPWQIEEFVEGEEPSEKEEEEQSENSKEYIEQE"
     gene            <316001..>316600
                     /locus_tag="LMJF_08_0720"
                     /db_xref="GeneID:5649356"
     mRNA            <316001..>316600
                     /locus_tag="LMJF_08_0720"
                     /product="amastin-like protein"
                     /transcript_id="XM_001681049.1"
                     /db_xref="GeneID:5649356"
     CDS             316001..316600
                     /locus_tag="LMJF_08_0720"
                     /codon_start=1
                     /product="amastin-like protein"
                     /protein_id="XP_001681101.1"
                     /db_xref="GeneID:5649356"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4QI97"
                     /translation="MACKLGVAIYVVLQLIAFVAVMVGTGVDMFYNKPEHSSGARVCI
                     TLWGLKTDCRKPKITDSSSVRWALCPIRLKNFRLCQVFAIISILVYGAAFLFGFLLLY
                     CCSGFRWLCLALNIVGAATACVVWAVMVVTYRLPEPKCLELSDGYNFGVGFGLFVLAW
                     ILDIVDIIFLMLPWQIGEFVEDEEPSEEEMEKSKNAAQE"
     gene            <321867..>322481
                     /locus_tag="LMJF_08_0730"
                     /db_xref="GeneID:5649357"
     mRNA            <321867..>322481
                     /locus_tag="LMJF_08_0730"
                     /product="amastin-like protein"
                     /transcript_id="XM_001681050.1"
                     /db_xref="GeneID:5649357"
     CDS             321867..322481
                     /locus_tag="LMJF_08_0730"
                     /codon_start=1
                     /product="amastin-like protein"
                     /protein_id="XP_001681102.1"
                     /db_xref="GeneID:5649357"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4QIA0"
                     /translation="MACKLGVAIYVVLQLIAFVAVMVGTGVDMFYNKPEHSSGARVCI
                     TLWGAKTDCRKPKITNPSSVRWALCPIRLNNFRLCQVFAIISILVYGAAFLFGFLLLY
                     CCSGFRWLCLALNIVGAATACVVWAVMVVTYRLPEPKCLELSDGYNFGVGFSLFVFAW
                     ILDIVDIIFLMLPWQIEEFVEGEEPSEKEEEEQSENSKEYIEQE"
     gene            <327755..>328354
                     /locus_tag="LMJF_08_0740"
                     /db_xref="GeneID:5649358"
     mRNA            <327755..>328354
                     /locus_tag="LMJF_08_0740"
                     /product="amastin-like protein"
                     /transcript_id="XM_001681051.1"
                     /db_xref="GeneID:5649358"
     CDS             327755..328354
                     /locus_tag="LMJF_08_0740"
                     /codon_start=1
                     /product="amastin-like protein"
                     /protein_id="XP_001681103.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649358"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4QI95"
                     /translation="MACKLGVAIYVVLQLIAFVAVMVGTGVDMFYNKPEHSSGARVCI
                     TLWGLKTDCRKPKITDSSSVRWALCPIRLKNFRLCQAFAIISILVYGAAFLFGFLLLY
                     CCSGFRWLCLALNIVGAATACVVWAVMVVTYRLPEPKCLDLSDGYNFGVGFGLFVLAW
                     ILDIVDIIFMMLPRQIGEFVEDEEPSEEEMEKSKNPAQE"
     gene            <333620..>334234
                     /locus_tag="LMJF_08_0750"
                     /db_xref="GeneID:5649359"
     mRNA            <333620..>334234
                     /locus_tag="LMJF_08_0750"
                     /product="amastin-like protein"
                     /transcript_id="XM_001681052.1"
                     /db_xref="GeneID:5649359"
     CDS             333620..334234
                     /locus_tag="LMJF_08_0750"
                     /codon_start=1
                     /product="amastin-like protein"
                     /protein_id="XP_001681104.1"
                     /db_xref="GeneID:5649359"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4QIA0"
                     /translation="MACKLGVAIYVVLQLIAFVAVMVGTGVDMFYNKPEHSSGARVCI
                     TLWGAKTDCRKPKITNPSSVRWALCPIRLNNFRLCQVFAIISILVYGAAFLFGFLLLY
                     CCSGFRWLCLALNIVGAATACVVWAVMVVTYRLPEPKCLELSDGYNFGVGFSLFVFAW
                     ILDIVDIIFLMLPWQIEEFVEGEEPSEKEEEEQSENSKEYIEQE"
     gene            <339496..>340095
                     /locus_tag="LMJF_08_0760"
                     /db_xref="GeneID:5649360"
     mRNA            <339496..>340095
                     /locus_tag="LMJF_08_0760"
                     /product="amastin-like protein"
                     /transcript_id="XM_001681053.1"
                     /db_xref="GeneID:5649360"
     CDS             339496..340095
                     /locus_tag="LMJF_08_0760"
                     /codon_start=1
                     /product="amastin-like protein"
                     /protein_id="XP_001681105.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649360"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4QI93"
                     /translation="MACKLGVAIYVVLQLIAFVAVMVGTGVDMFYNKPEHSSGARVCI
                     TLWGLKTDCRKPKITDSSSVRWALCPIRLKNFRLCQVFAIISILVYGAAFLFGFLLLY
                     CCSGFRWLCLALNIVGAATACVVWAVMVVTYRLPEPKCLELSDGYDFGVGFGLFVLAW
                     ILDIVDIIFLMLPWQIGEFVEGEEPSEKEMEKSKNAAQE"
     gene            <345364..>345963
                     /locus_tag="LMJF_08_0770"
                     /db_xref="GeneID:5649361"
     mRNA            <345364..>345963
                     /locus_tag="LMJF_08_0770"
                     /product="amastin-like protein"
                     /transcript_id="XM_001681054.1"
                     /db_xref="GeneID:5649361"
     CDS             345364..345963
                     /locus_tag="LMJF_08_0770"
                     /codon_start=1
                     /product="amastin-like protein"
                     /protein_id="XP_001681106.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649361"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4QI92"
                     /translation="MACKLGVAIYVVLQLIAFVAVMVGTGVDMFYNKPEHSSGARVCI
                     TLWGLKTDCRKPKITDSSSVRWALCPIRLKNFRLCQVFAIISILVYGAAFLFGFLLLY
                     CCSGFRWLCLALNIVGAATACVVWAVMVVTYRLPEPKCLELSDGYDFGVGFGLFVLAW
                     ILDIVDIIFLMLPWQIGEFVEDEEPSEKEMEKSKNAAQE"
     gene            <353594..>355123
                     /locus_tag="LMJF_08_0780"
                     /db_xref="GeneID:5649362"
     mRNA            <353594..>355123
                     /locus_tag="LMJF_08_0780"
                     /product="putative tuzin"
                     /transcript_id="XM_001681055.1"
                     /db_xref="GeneID:5649362"
     CDS             353594..355123
                     /locus_tag="LMJF_08_0780"
                     /codon_start=1
                     /product="putative tuzin"
                     /protein_id="XP_001681107.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649362"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QI91"
                     /translation="MEEAHLSPIADVSTRVYVRVGRTATNEDRIAGGIVGRVNSNGTL
                     GVLMDNNSFEAQVSQDDVILVEGRSRFTREKGYNDMVEWVRSAGVHRRADRERLCCLL
                     YQRGWRVDKLYLLKPSDVHCMRYLRKSVRRMVLEKAEWQRDHHAEMRALLRERVKERV
                     WRYFIQKYSGFFSANWAGLGVLSVFLWNYKRFRRQQRSFQVKHAVNTLTHTDHRSSSS
                     PAVPRQFVERAAEERWTRQMLRRLSNTHPRITVVTGFRGCGKSSLLRSAVRKEHKPAL
                     FVEVRGVEDMLTCIVKAMKVPNLESCGDYLEFITDTFTKAAKINGEPPILVVTLRGES
                     ELSRVYNESVVLACDRRLCHLVYEVALESLSISNVLLPRLDFYSVSNFNVRQALQYTE
                     HTVDAVAMQHFIETMGTNSNDIDELLAAILHRKVSIAEYTEQKLWRAMRQVETAWAGS
                     EKRRAALKKLAEADCYVGQESGTDALRDPALKEMVLYDPVSDRWVFTHKVYHTAARCC
                     L"
     gene            <356429..>358336
                     /locus_tag="LMJF_08_0790"
                     /db_xref="GeneID:5649363"
     mRNA            <356429..>358336
                     /locus_tag="LMJF_08_0790"
                     /product="putative tuzin"
                     /transcript_id="XM_001681056.1"
                     /db_xref="GeneID:5649363"
     CDS             356429..358336
                     /locus_tag="LMJF_08_0790"
                     /codon_start=1
                     /product="putative tuzin"
                     /protein_id="XP_001681108.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649363"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QI90"
                     /translation="MLSQRTRRCLFTAVSSVPNTTAATSLGGVSREVAASAVRRSTFA
                     QPGLEGLRIAAYAPTEPGVPSSQRRLPVAIGHIVAQLSSLVFAVDFDGSLPPSAVSLG
                     SRVYVAYEREDVDPASQQGDGGVSGALNRTFLVGGLVVRVNPNGTLGVLLDHNKVDLA
                     VPPEKIAVTAGVCKFLNHPKYLRVVEWVRSAGLSGTDDVESTACILYHRGWRVERLYL
                     LEASDIRSMTHLSQSARMSLMEKAEWQRDHHRQMRNIHRERVKERDRRYMSAKYAGIL
                     SASVAFCGAFSLFGWNYRNYLTHQRSYQMRFAVKTLCKKVPPGSVAAISAPPAATGVE
                     TSTSSSATHRMSTHVSRVVQERWIRQVFHRLDTAHPRIVVITGYFGCGKSSLCCTAIH
                     EEGMAGVFVDVRNKEDTLRSVIKALGVPHVEACGDPLDFISEACYKAKSITNGKAPVI
                     VLKLREGDSLTRVYNEALTLACDRRACHIVVELPLESLTPTNTLLPRLDFYTVPNFSR
                     SQAYEYIQHRLDALGMEVFLDTVGTNSNDLDELLAVAHQHRVSPTEYTSQKLLKAMRQ
                     LQTAWGDDVQLKAAVKRLAQLPYDEGQHEGLDDSRLNHPSLRDVIFYNSVQDVWLFKN
                     QALHTAASCLL"
     gene            359325..360511
                     /locus_tag="LMJF_08_0795"
                     /pseudo
                     /db_xref="GeneID:12982579"
     misc_feature    359325..360511
                     /locus_tag="LMJF_08_0795"
                     /pseudo
                     /db_xref="GeneID:12982579"
                     /db_xref="PSEUDO:CBZ05787.1"
     gene            <361647..>362228
                     /locus_tag="LMJF_08_0800"
                     /db_xref="GeneID:5649364"
     mRNA            <361647..>362228
                     /locus_tag="LMJF_08_0800"
                     /product="amastin-like protein"
                     /transcript_id="XM_001681057.1"
                     /db_xref="GeneID:5649364"
     CDS             361647..362228
                     /locus_tag="LMJF_08_0800"
                     /codon_start=1
                     /product="amastin-like protein"
                     /protein_id="XP_001681109.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0800"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649364"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4QI85"
                     /translation="MACRINLLLYVISQFLAFLFVLVGTPIDMFRPHNTSRIGNTPCL
                     TLWGGKEECYSTKYDVRSDDLWANCTDRLLQFRVAEALAVISIFVYGLAFILGFIALC
                     CCFCLRWVCLTLNILGIGTLGVVWALMVVVYYKDDGLLCPRKKPDHLFGAGFILLLVA
                     WSLNIIDIVFLLIECQCTDAGFFEASPQDSNEQ"
     gene            364432..365632
                     /locus_tag="LMJF_08_0805"
                     /pseudo
                     /db_xref="GeneID:12982580"
     misc_feature    364432..365632
                     /locus_tag="LMJF_08_0805"
                     /pseudo
                     /db_xref="GeneID:12982580"
     gene            <366464..>367027
                     /locus_tag="LMJF_08_0810"
                     /db_xref="GeneID:5649365"
     mRNA            <366464..>367027
                     /locus_tag="LMJF_08_0810"
                     /product="amastin-like protein"
                     /transcript_id="XM_001681058.1"
                     /db_xref="GeneID:5649365"
     CDS             366464..367027
                     /locus_tag="LMJF_08_0810"
                     /codon_start=1
                     /product="amastin-like protein"
                     /protein_id="XP_001681110.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649365"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4QI88"
                     /translation="MACRIGLLLYVISQLLAFLFVLVGTPIDMFRPHNTSRIGNTPCL
                     TLWGYKSECYSTKYDVRSDDLWANCTDRLLQFRVAEALAVISIFVYGLAFIFGVLMLC
                     CCFCLRWVCLTLNILGFGTLGVVWALMVVVYFKDDGSSCRKLSDQYHLGAGFALFVST
                     WCRDIFSIIFLLLPCLSDDSGNQKDAD"
     gene            <371281..>371862
                     /locus_tag="LMJF_08_0820"
                     /db_xref="GeneID:5649366"
     mRNA            <371281..>371862
                     /locus_tag="LMJF_08_0820"
                     /product="amastin-like protein"
                     /transcript_id="XM_001681059.1"
                     /db_xref="GeneID:5649366"
     CDS             371281..371862
                     /locus_tag="LMJF_08_0820"
                     /codon_start=1
                     /product="amastin-like protein"
                     /protein_id="XP_001681111.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649366"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4QI87"
                     /translation="MACRIGMLLYVISQFLAFLFVLVGTPIDMFRVKGLGRFANTPCL
                     TLWGGKEECYSTKYDVSYDELWANCNDRLLQFRVAEALAVISIFVYGLAFILGFIALF
                     CCLCFRWVCLTLNILGIGTLGVVWALMVVVYYKDDGLLCPRVSSRFDFGFGFILLLVA
                     WSLNIINIVLLLLPCPLVDSGTPKTRPQNPTEQ"
     gene            <376101..>376628
                     /locus_tag="LMJF_08_0830"
                     /db_xref="GeneID:5649367"
     mRNA            <376101..>376628
                     /locus_tag="LMJF_08_0830"
                     /product="amastin-like protein"
                     /transcript_id="XM_001681060.1"
                     /db_xref="GeneID:5649367"
     CDS             376101..376628
                     /locus_tag="LMJF_08_0830"
                     /codon_start=1
                     /product="amastin-like protein"
                     /protein_id="XP_001681112.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649367"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4QI86"
                     /translation="MACRINLLLYVISQFLAFLFVLVGTPIDMFRPHNTSRIGNTPCL
                     TLWGGKEECYSTKYDVRSDDLWANCTDRLLQFRVAEALAVISIFVYGLAFILGFIALC
                     CCFCLRWVCLTLNILGIGTLGVVWALMVVVYYKDDGLLCPRKKPDHLFGAGFILFVSS
                     WCLDVLGIIVLLNLC"
     gene            <380916..>381497
                     /locus_tag="LMJF_08_0840"
                     /db_xref="GeneID:5649368"
     mRNA            <380916..>381497
                     /locus_tag="LMJF_08_0840"
                     /product="amastin-like protein"
                     /transcript_id="XM_001681061.1"
                     /db_xref="GeneID:5649368"
     CDS             380916..381497
                     /locus_tag="LMJF_08_0840"
                     /codon_start=1
                     /product="amastin-like protein"
                     /protein_id="XP_001681113.1"
                     /db_xref="GeneID:5649368"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4QI85"
                     /translation="MACRINLLLYVISQFLAFLFVLVGTPIDMFRPHNTSRIGNTPCL
                     TLWGGKEECYSTKYDVRSDDLWANCTDRLLQFRVAEALAVISIFVYGLAFILGFIALC
                     CCFCLRWVCLTLNILGIGTLGVVWALMVVVYYKDDGLLCPRKKPDHLFGAGFILLLVA
                     WSLNIIDIVFLLIECQCTDAGFFEASPQDSNEQ"
     gene            <385732..>386259
                     /locus_tag="LMJF_08_0850"
                     /db_xref="GeneID:5649369"
     mRNA            <385732..>386259
                     /locus_tag="LMJF_08_0850"
                     /product="amastin-like protein"
                     /transcript_id="XM_001681062.1"
                     /db_xref="GeneID:5649369"
     CDS             385732..386259
                     /locus_tag="LMJF_08_0850"
                     /codon_start=1
                     /product="amastin-like protein"
                     /protein_id="XP_001681114.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649369"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4QI84"
                     /translation="MACRIGLLLYALLQFLAFLFVLVGTPIDMFRPHNTSRIGNTPCL
                     TLWGYKSECYSTKYDVRSDDLWANCTDRLLQFRVAEALAVISIFVYGLAFILGFTMLF
                     CCFCLRWVCLTLNILGIGTLGVVWALMVVVYYKDDGLDCLRESIDHQLGLGFILFVSS
                     WCLDVLGIIVLLNLC"
     gene            <390598..>391470
                     /locus_tag="LMJF_08_0860"
                     /db_xref="GeneID:5649370"
     mRNA            <390598..>391470
                     /locus_tag="LMJF_08_0860"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681063.1"
                     /db_xref="GeneID:5649370"
     CDS             390598..391470
                     /locus_tag="LMJF_08_0860"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681115.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649370"
                     /db_xref="UniProtKB/TrEMBL:Q4QI83"
                     /translation="MPDDRRRASRTDDALVAHRPADSASPVERRTRVDPRTHTKSLYQ
                     RGRDGSEMYASYYNSNDDPAFQERFNRHSNGNAFVQSAQFTYVSHGGCGGRNHTVVKE
                     RQRPVVVEEPDDADRHEASTDSGNNANVHAKHKDKEKRRSSKQDPIVEEPDSEDDYND
                     ADSRAYRRGGKKGEFGSHPDALEFWRDPWGMESIMAEMMQPPLGFGDAFPFTSRRAPA
                     QRRLKSPSVSNESKWQLSPHTRGGVMSSPFTGDLFGTGGPESPFRMMEAMQYHMHQQR
                     AAMFGGVDPFRHFM"
     gene            complement(<395194..>396393)
                     /locus_tag="LMJF_08_0870"
                     /db_xref="GeneID:5649371"
     mRNA            complement(<395194..>396393)
                     /locus_tag="LMJF_08_0870"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681064.1"
                     /db_xref="GeneID:5649371"
     CDS             complement(395194..396393)
                     /locus_tag="LMJF_08_0870"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681116.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649371"
                     /db_xref="UniProtKB/TrEMBL:Q4QI82"
                     /translation="MQKLRADWTKHFDSEKASMTAFRDYDFERRVNDMRRLQNAVDHF
                     DHAVRQGMMAMKEIASAYEAVGQAFTELTLTNNNPVPGPGEAEEPNPYPTEADVQYMS
                     QPNAGAAAADYAASVASTRMPDEANSQVRRLAKTFAEEARRINEGPPFQSYNAGIHRD
                     VHNRLLPVLEHLKSINEYRHKHIEALERYNKYKAEVEKVEKHYTKKGKPFCDSKGHKK
                     YTEKRDEAWKEYITRRDKFNKTFGMLMEVNDHAAAQIIHRYLVLNHEYLQQLVASMDR
                     VLPAMAEVYPLNNEYNSLQNTLILEAVANAKTPFADHSKIRSKQADSDKSDGAGDERH
                     EDVQEAMDAHYEAQQSTLTSMSSDGGSNLASGSRLEDSVSYDAHVNPSTALESMEQPP
                     DPEQDDV"
     gene            complement(<398134..>399678)
                     /locus_tag="LMJF_08_0880"
                     /db_xref="GeneID:5649372"
     mRNA            complement(<398134..>399678)
                     /locus_tag="LMJF_08_0880"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681065.1"
                     /db_xref="GeneID:5649372"
     CDS             complement(398134..399678)
                     /locus_tag="LMJF_08_0880"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681117.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649372"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:Q4QI81"
                     /translation="MHSVVPMSSYIHPTQVSIGAAPRMAVQEMHPDAKRKGRRVVATM
                     ELKPGNAIFAAPPDIAVLYSPFARHICARCLVADVRACAEPLKAHHHHHQHPHQQPHA
                     TLSRSPVGASSSPSSLSSSTAAPAAAPVRPYCCPNCDQFVLCAPCVAQLLLDSGVDVT
                     SAAGTDAVQTTAPLLQRRGEGKRGVSVVDERLHLHPLLRAHAISCAWYTSLPASIRAP
                     GNDTDFLRFCLDYGARAYLGDTAMMRALATLDTNASVQSKESMQLCEVFARDRVVATF
                     GKEPKAVTATTLATAASAKHMGIDPLSNQAGTHASGGIHRGGNSDGVRCRGSAAVSPF
                     PPRYPISWTDLRDTLLRTRCNSIGFPYNTEETTGWSLHQTVCMLNHSCVPNAAVIMLY
                     DSADAMAAAAALAARTGASHTAPPKERTQEAARRKASERIAAFRAVATSSESPYSTSY
                     SPSLAGWIGIEATRPIAAGEEITISYVDLGSLGDDLQTRSRHLLEQYRFLCTCELCMR
                     QRSLKR"
     gene            complement(<401089..>402219)
                     /locus_tag="LMJF_08_0890"
                     /db_xref="GeneID:5649373"
     mRNA            complement(<401089..>402219)
                     /locus_tag="LMJF_08_0890"
                     /product="mitochondrial DNA polymerase beta"
                     /transcript_id="XM_001681066.1"
                     /db_xref="GeneID:5649373"
     CDS             complement(401089..402219)
                     /locus_tag="LMJF_08_0890"
                     /EC_number="2.7.7.7"
                     /codon_start=1
                     /product="mitochondrial DNA polymerase beta"
                     /protein_id="XP_001681118.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649373"
                     /db_xref="GOA:Q4QI80"
                     /db_xref="InterPro:IPR002008"
                     /db_xref="InterPro:IPR002054"
                     /db_xref="InterPro:IPR010996"
                     /db_xref="InterPro:IPR018944"
                     /db_xref="InterPro:IPR022312"
                     /db_xref="InterPro:IPR027420"
                     /db_xref="InterPro:IPR028207"
                     /db_xref="InterPro:IPR029398"
                     /db_xref="UniProtKB/TrEMBL:Q4QI80"
                     /translation="MLRRTFLRRDHRENIIRIFQEMADLNNALGEKYKVSSYHRSIES
                     LKTNLDKPLNTPQDLKAFSGFGTKLLKKAEEIMATGKLEELESKTKPKLKAIQELTQV
                     HGFGPRAAAALFDREGIFTVDELLQKADSIPSLTDQQRVGIKYFYDINEKIPMQESVL
                     HENYLRDKCMEVLGKDFSILICGSYRRRHPFSGDVDAILSRTLDAPPLSEPVAATGVL
                     GHFVEFLESLKYLEATMAQGPLKYMGMGRLPPRIVRDKAGRENTKVYKARRVDIRLIE
                     TKSVPTAMLTFTGSKNFNVIMRQAAISKGYLLNEYGLFKLGTPEEARALYERIGIRGK
                     NAGEELGVPKDELEDKRVEVRSEQDVFDVLGMPYAKPENRDP"
     gene            complement(<403727..>405748)
                     /locus_tag="LMJF_08_0900"
                     /db_xref="GeneID:5649374"
     mRNA            complement(<403727..>405748)
                     /locus_tag="LMJF_08_0900"
                     /product="putative mitochondrial DNA polymerase beta-PAK"
                     /transcript_id="XM_001681067.1"
                     /db_xref="GeneID:5649374"
     CDS             complement(403727..405748)
                     /locus_tag="LMJF_08_0900"
                     /codon_start=1
                     /product="putative mitochondrial DNA polymerase beta-PAK"
                     /protein_id="XP_001681119.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649374"
                     /db_xref="GOA:Q4QI79"
                     /db_xref="InterPro:IPR002008"
                     /db_xref="InterPro:IPR002054"
                     /db_xref="InterPro:IPR028207"
                     /db_xref="InterPro:IPR029398"
                     /db_xref="UniProtKB/TrEMBL:Q4QI79"
                     /translation="MAAAASVAPVTEPAKVAEVEDPASDAEREADVAAAMATAVELVS
                     KPAVIDDEFSLAPQADDDAAANATSASHSPSAFAAGRASQQQQQELLQSAGVSKVASS
                     ASGGSSASGSGNHAGSSGGSSGGKGGKGANSKDTLFFPDYRERVVQIFEQLTQINSAL
                     GERFKSQLYGRTVECFKRGDKVFQLLPPNLLPLPEEDPKKKAIIEALYKDDPAAQKKR
                     VEEVERNRAKRSLVLSSDNLIPGLGTKLREKVIEILVTGGLEELHRQEAKPIIRAIRE
                     LTQVHGVGPRTAIDYFKKYGISTVAQLRDYAIKAGELDMSNKDSGKPSNLVVCADKSK
                     FHLNDAQRLGLVYYEDMCHRIPHEEGRLHEAFMKLRMRKYLGKDYELVVCGSYRRQVE
                     SAGDIDVLITHRRSAAEGGGGSSSSSGGRPLLPPSKVLGAFLAGLKADKYIEATLAQG
                     PTKFMGLCRLRATVTESVSAATGKGKAAKANGKAPTKFRARRLDVRYVDSDSFPAAML
                     YFTGSKNFNVIMRSEAIKKHCVLNEYGLFRKPTRKQMQHYGVVQKNPDMSFHDMITRL
                     ARFDLSAIKDEENELANGSSAEAGGGASGATAAGSGASGDADGAASKKVTAALTKIKK
                     KGRGKTKQELAELHEMAKIVERQRVKACTEREIFEALGMDYVPPKDRSV"
     gene            complement(<410228..>416599)
                     /locus_tag="LMJF_08_0910"
                     /db_xref="GeneID:5649375"
     mRNA            complement(<410228..>416599)
                     /locus_tag="LMJF_08_0910"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681068.1"
                     /db_xref="GeneID:5649375"
     CDS             complement(410228..416599)
                     /locus_tag="LMJF_08_0910"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681120.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649375"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="UniProtKB/TrEMBL:Q4QI78"
                     /translation="MLHYIQLLGSDTPNGYGGCCYYGPLDHPALHASTLSSATGSISP
                     TGEVPPASRHSYAVDVEATVSAPTLVSSGNASAHETLHRSSPTGEVAEPAVPSSWNWS
                     SYLTAKRPTWPRAGPFHASTLLHPQPPSPSVSPSAVATGSAPHVTADTGFSGSEGYIF
                     FNCPEGAQRFSSEANIKLKKVRGFFFTRWSSSKTAVSPLPSGNVASSVEDEQHSSASA
                     DAVDAPADTTALGMPVGAASAVMGLPGMLFTINDAGVRHATFFGPSAALDGPPQPAHM
                     EGVTRAGTRNGDGGSEPHNSNSEQAYVHACRSPCAGDSAATSSTGGSAVAAPGAHLPS
                     PLSSAGLRGFLTALRFHYFQYRPMVFRQLHGLVRHATDQAAVGGHTVDATIAAAIAGN
                     NQLHFVETVGEPPTSCGAQPGRPLTGLSPFVHATLPLSPQSLLVTFRVSGGHRGGESE
                     SAATASAATRDARMSLLRPTSSSAVAEDEQQRHQLHHAYFAGHIERADQRADAETAAP
                     TVSFTAPASHDVVFGYVIIVAPGSSFDAAKARALGVRSGPKYGQLKLGMSVEADTDAG
                     VVDVSATSMPPSQNATVAFGHTSDQSPTPTQRWVHPHQVMRPTAATRHAYISLVLDGD
                     RPEDVRESVARLLGSSVGGDGGPPSRSSAAACKEAEEDDKTCHNAAAGERGDGVLQRL
                     LREHFPHLAYYYEEDDEMGEGTAAAPPHSQEPRLRRRPRQLTVRHVVHVQPTSYFAQF
                     ERRCRHDALLYSPFLREDRVQARPKTLPPSLHREVGEPGVYAAYNAYIFADVAGQHDP
                     LHHRRVCAAADHGEEEAVAARVEAGGDVVVATNVSSPPRPDSSKSLSAVQLSLTPLLS
                     FTLDDMADTADGDAGMGNRVECESGSTRIGEAHRCHPPPPLLHGTPPEAGLPLHKTWH
                     LFTSYVQRHFTAFPTALVHRYHLHHLAPSLFPNVGAAALMQGAGGAGNATGDRAARSG
                     TAVGVAISTEASGSGSAVRAARAKPNVSNSSSSSAEDVVEYWPYSLKLRCIPEATLQL
                     PYKQHATAKKTTQAQQRAEMAGSARQAPSTVNASLGHDAATAAAVPSPHLPAPRKRER
                     QVSSSGDSASAPAYTVHASASSSTATAATPRVLPPPAAAARTRPPSAPPRRVAVVDGV
                     TSLLPYPTPASALALLSTTFLRSLRTSSVVAAAAAAAAGTGEVPATPSTLTESRADWH
                     GGFAASHQRVDVPSTGMVGMGGGALGFLGTGSAVPSKYRNVSGTFLELHLPAYCFPGG
                     GCPVKPLLHDDDSAHASGAAAVVAEDTPSATSASPPAGEAACARREGDAVLGFGSADS
                     STYSCGPATVSMDESQKTAPRRWSSAPLKMDSQQLRRGVVILDFGEGSAGQLASLCGR
                     VRGGSACSQGPPCCFLSASPLHAALEGHRGNGRDRREGAGDHAEDAGAYTSSPHAASA
                     ENVTEFEDDADARLGQFVLDIVLVFISHAHADHHLGLMSLLTLRHEYLQRGPSALPPA
                     PKLLVVCPTEVYAFMMDAWGSTPPYTTWLHEECVFDLMPPPVSGLRKEGRWPDALAAE
                     EGDAAPSGRQEKCQVATAVAGSNVPDSVDGTERDQDAVGDGGVDSRRAASFTHRFRHN
                     RHALHASNNQPEQQHVVPMPLLQAHLTAWNQAITAGIRHHQRQTLSDSPLPSSSEPLA
                     DTSVTTAAASVKGNVWWDAEVITVDHPANAHALLLRFPFCSSMKEEQGEHGVLGEAAE
                     GGGPRTADPDAAEAATGRQRRQEPLSRVPDSSRVLLFSGDTRPSSFLVERSWAFAASA
                     PSRLPRRADSTELTSQDGLVSDEADSGSALEGVRAALVSKANAGGSIDRVRGTALARL
                     PTSTPPSSLSSPVFILLHEATFGPGFEGEAVRKKHSTLPEALRIGFAVRAEFIVLNHF
                     SQRYPKLPGLSEEQLGGRSADLVCQRRTRASAAVAATSAVTAAETENPADHVSGGLAS
                     ASAPRSSSPGEQQGLARTASSTASRQEGGRSKWERDADQTADASRPLPPPHTATDDAA
                     ALPYANMSFAFDLMLVSFSDMQRGLVPRLTPTLVRLLEEYDSWGSGTTQRMRSGGGGG
                     DGGGGRLQKQQQQRKSSATPSTTASSAPASIDGATSSAAAKKATYDESA"
     gene            complement(<417727..>418341)
                     /locus_tag="LMJF_08_0920"
                     /db_xref="GeneID:5649376"
     mRNA            complement(<417727..>418341)
                     /locus_tag="LMJF_08_0920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681069.1"
                     /db_xref="GeneID:5649376"
     CDS             complement(417727..418341)
                     /locus_tag="LMJF_08_0920"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681121.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649376"
                     /db_xref="UniProtKB/TrEMBL:Q4QI77"
                     /translation="MFSRGAAATAMAKVSRLVSPRLRIIHRDYLTRRGGRTHQRCSAV
                     AVDYTPTYFATYKSDPGQCPRLIDAEAVHGDEQAFWSARRDFYRGGASRSYYPAWDRQ
                     AQALIMLTREVPRIPQEAAFRLFTLGLKMMLLPRLVAGVELMLPSWVTMNAESVLNEG
                     LEGKVAEADGDGKATGAAADAAALPSASSAGANEDSGSANAEKR"
     gene            complement(<422688..>426143)
                     /locus_tag="LMJF_08_0930"
                     /db_xref="GeneID:5649377"
     mRNA            complement(<422688..>426143)
                     /locus_tag="LMJF_08_0930"
                     /product="putative protein kinase"
                     /transcript_id="XM_001681070.1"
                     /db_xref="GeneID:5649377"
     CDS             complement(422688..426143)
                     /locus_tag="LMJF_08_0930"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001681122.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649377"
                     /db_xref="GOA:Q4QI76"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4QI76"
                     /translation="MNAVDELNLLLGIGPSRPQLPLTLRKSGYVPVRSLGKGSFGQAL
                     LVFHEPQQQYFVVKHLNLASMSSRQRHDAHNEINILQKLHHPNIVRYVEYYEEHLHLY
                     IVMEYADGGDVYSLLSSAQTERRLGATGGYGSGSASSARLLGSSPSSAATAGLLSEAQ
                     VVNLFVQTTMAVKYMHDRRLLHRDIKSSNIFLTKNHVVKLGDFGISTVLQSTVAMAST
                     MCGTPCYFSPELCQGRPYNSKSDMWALGVLLYELCAGHVPFESTTMKALMRDIVHKQP
                     PRIPAVYSQELWELIVQLLQKDARRRPDAGQVLMSPVLMKHVPDLINQLADNMTNDGN
                     PAPGGVSGACGGEAPPASAAAPPPPPPRQAQQALPPPTKAGGDGVASCAPTAAAAAAA
                     LPLSSSPALSSQARTAGKQTPSPPLRAPPKRNPSRGGGEAGAFSIEELVARFDAQKQQ
                     IAEAKRRKSGVQAETHGTGGVPHASGADERPRLSPGAVAALRQQGRKGSNAGGGGRGA
                     PTRPSAGGTSPVAAAAAPSRAAFMPPPLPAALRDVGAVDQRRPVELPINPSPLSQQRD
                     SAAAAPAPTAGDADATRQARGGHLSAPGVRGQPYQAPPQRRHIGGQLDENSAPPSAAR
                     GAVPALDELSAVLSELSTWRERSVLRQQRQDGHRAHRDDTSRKIGVEAKPQHAGAKAD
                     AHVPSPQPPTSPSAATTPPHQLSKCAEQADVHQPGVAEGAPTHEPNGNAASQGKQLRG
                     GGRGAKAGEAHAAEVEMQRVRAAFASPAANRRGSRGDDTDGDESITQSFVDALGTALD
                     VDAVQAASAAAQQQQQQRLSPPPSSAEAGSASCLSGRAPFLQQSMRKTFHVTSEKIDA
                     LQPTLMASTVFRHPPSTALLAGTMRGADAAACAGEADTVADVHFTTSCLCGRAATSRG
                     CLSMIYGSFVCSCDACVRFTGSVHGVEWLHLPEVAYGLPALLSLPTPSDAPGGWSTKA
                     RPSAGAGAAAAAALRAKAEEAPLNHNQAAEAQRKGGMDGCCAPPPPAQSPGVWPPSSS
                     AGSGAHAGDDTTAALGEANIRAYRHCFQVEAPLQLGEAALRQPAPHTPEGSQRTGGAA
                     ATGQRAVYVIYTCLACGSLVGMQHDGVEGLLLPKVTLDAQSLEILSWCAQTVDAEAAE
                     LIKLG"
     gene            complement(<427086..>427889)
                     /locus_tag="LMJF_08_0940"
                     /db_xref="GeneID:5649378"
     mRNA            complement(<427086..>427889)
                     /locus_tag="LMJF_08_0940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681071.1"
                     /db_xref="GeneID:5649378"
     CDS             complement(427086..427889)
                     /locus_tag="LMJF_08_0940"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681123.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649378"
                     /db_xref="UniProtKB/TrEMBL:Q4QI75"
                     /translation="MPQRIAFLPPLAASLSVNKRFASTMGDRADARGTCNSGKFNFVG
                     AYRAFRRERSANRSMQYTTLSMYLDMLPPGFRELLLWSPLFALLHFMCRQARVYYLDE
                     EEPWYCVALPRRWRCRVDGEGSGATGHVSSLLERAPPSSTPTTSVVVEAHNPSATSSL
                     PNTGRGTAIEGSGSTTTIVTTVYAFRAASVQDAAAAVAGAPLAGSPPVASFHEVRVRR
                     VHADQGASPETTASTPPPEETYRYGVWGAPLIVIRNPATQRVIGYTTAG"
     gene            complement(<428706..>429155)
                     /locus_tag="LMJF_08_0950"
                     /db_xref="GeneID:5649379"
     mRNA            complement(<428706..>429155)
                     /locus_tag="LMJF_08_0950"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681072.1"
                     /db_xref="GeneID:5649379"
     CDS             complement(428706..429155)
                     /locus_tag="LMJF_08_0950"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681124.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649379"
                     /db_xref="UniProtKB/TrEMBL:Q4QI74"
                     /translation="MAAMLRLTFALRLSSKQLSHGPLATHTRKQSFRQSKTALQVSRL
                     RSQTQRANFNLQQELNRDFGARQYAFAQGRRSMQRAAEDLMYDRAYRAERHRGRAGEV
                     YRTTKDRAAEVATARQLLQMQESTRRLMKKGRTQRVEAFRAQKQWNR"
     gene            complement(<430583..>432280)
                     /locus_tag="LMJF_08_0960"
                     /db_xref="GeneID:5649380"
     mRNA            complement(<430583..>432280)
                     /locus_tag="LMJF_08_0960"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681073.1"
                     /db_xref="GeneID:5649380"
     CDS             complement(430583..432280)
                     /locus_tag="LMJF_08_0960"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681125.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649380"
                     /db_xref="InterPro:IPR007858"
                     /db_xref="UniProtKB/TrEMBL:Q4QI73"
                     /translation="MDSAYLKNHVGMLLAKGVAETVTAQPSNPQEYLALFLLHQLQEE
                     ERKADAARRRRKVDDLRQEWCQQRALHEKVAVDVIQRCFHRFQDRLRRKRAAEGELRE
                     AYEAAEAEAEELLDEEEAIKAEKGGEYAAEDGAGATSERESASRAAAAQEKEAVMAEA
                     RREFFKAQRFLLTLSKSAVGQLKHELEEEAERVRIAQDATLGAYHRAAAQEAALVEAT
                     TAPSMASAAPALSPAAAELAERLAEHRDHRCICVPYVKYLVFRCLCYLLLNATPKATN
                     SAAKVAALLKPSVLVQHLRAFNPVASYDRGVALKLERIVPELAESAGGDEGNDEGDGA
                     GHPKQNGASAEEEGSSFPFTQPTTRQVRRAARILRTCWLDGEYHCEVDPEEFYTEEMI
                     EEDAARAESDSEDGEPRQKLILTLADEIEAAAKVRERVEELRNVVETQVRQRGGTVVY
                     ALLRFVSAAVAYRQARDAVVQQRQEMGLPVDTFDELPEDEAEDPMNDEALVEEETGEL
                     DAAGVQVLQERIGVDTEEALAKIWEARDRRQREAYSMKAISLQRQLDPSGEEEEDED"
     gene            complement(<434097..>435929)
                     /locus_tag="LMJF_08_0970"
                     /db_xref="GeneID:5649381"
     mRNA            complement(<434097..>435929)
                     /locus_tag="LMJF_08_0970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681074.1"
                     /db_xref="GeneID:5649381"
     CDS             complement(434097..435929)
                     /locus_tag="LMJF_08_0970"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681126.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649381"
                     /db_xref="GOA:Q4QI72"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="InterPro:IPR019537"
                     /db_xref="UniProtKB/TrEMBL:Q4QI72"
                     /translation="MQSASTMTSSSWIRNKKPKFWALVNEAGADDVEAGGSGERLATT
                     ATASTAAGSAAPASPSAKTSPSTSTAVSAPLTAMPPTLAGEASPSAKEPSQVRAAAEP
                     MKAASDVATGSSPSSTAASAVSTAAVGARMDADSSSSLEATNRAVTAHSIRISTSVSP
                     FRNRYKRDVAHMLSELLNSDPSLGPQLLGQLSAESRRLLLIMGAASEYFGVDYEEVAE
                     QVKVADTDRDNSISSKEYDAWVRRMADSTPAKRRHAKEDQASADTFDSVLPLASASAQ
                     GAAAVVQAVPPSMPSTAPQSSSRGASGTSPSAKAASATSASAYLPAAASATPSRQRMD
                     MTVGTAKAGSACIIGAMQQSLPSAAAAAPESRDVGGGAASVAMTSPTRASPKSSAANR
                     SRGCVSDAAGGGAGASPFLPVTPAATVTSAASASTKQDPGYIPWPTYLRIVAAAVPPF
                     LAFGMLDNTTLVLAGGAIDNALSGSLGLSQMGAASLGGVVSGVAGIQVHGLAERYTRA
                     APPRLTMEQQRSDAYSRATQAGNTLGMVAGLILGMTPLLFMSGSTQLAEQEERDRHHF
                     RREAARSHQRHRNTMEKEEATLRQRLWREEEAAREALLRGDDKM"
     gene            complement(<442589..>445714)
                     /locus_tag="LMJF_08_0980"
                     /db_xref="GeneID:5649382"
     mRNA            complement(<442589..>445714)
                     /locus_tag="LMJF_08_0980"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681075.1"
                     /db_xref="GeneID:5649382"
     CDS             complement(442589..445714)
                     /locus_tag="LMJF_08_0980"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681127.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649382"
                     /db_xref="UniProtKB/TrEMBL:Q4QI71"
                     /translation="MEPIRPAQRLERPPLPPLSPQRHDGIDEEDEEDESDVSTELESE
                     VLSQHFKSLPWPFPAVNVPLGISPSASMRRGVSPLASDQQTCMSGSSLTAWSGAQVIC
                     GGGAGAAWASGLGLNKFDKLRVSPRSGAGGASPRAGAGAAGKGLATPTAVARPVTTTT
                     SETTAPIATVTLSKSELTSENLDRLRETRAMSDALPVAHWKASTQTARVSPPAVIAVS
                     RARSDCAAGAGGTRMTRAAALLKQQPVLARQPRQRSANSGGARAIADVPARASPTATA
                     AKCDNGLNTSGDGPREGQGATVGGTPTTSSTSPLAVAQGGEHSHLDEPTTLRAEEKND
                     NNGCRGATSGAGAAVATDTQLPPAASPLARASSPRISHTRRKRDNVPSPLKRQRLASA
                     KNRYQGQILLLEDCTETSGDATSPWPVRQRAPRSVTPAGATNAGAHTCATSSVVPATR
                     ATLSTSSDTKKSVPGTISPCMTSGRGVQVARRISVTAPAAHSGMLSPPSISPFEKEAG
                     QESSEAVRGTNHLPSFGLSKEENDQAAADIDDSRASCSTHTMSPENARQHVVHPPRSP
                     QTCPGVPTPISEKAGRDGHGADLRSVDQREDEAEEREKRGDGALPTPVHTYQATSLLT
                     STSTTTFSRPPLLSLTAIGVTSATSGVLRSVTQTSPRRSAALQRITLPHQPQQQVRPA
                     VIISSASTTELPPSRTPLTAVTTTSPGNTGDSHISVSQASRLDSSRRSTVRTGTMRHS
                     TSCDTRMPSSADCLPSVGSTQPPLSVRTPDGDGALRWRLTTSSRTSSAGASDQRARSG
                     RAQSTESISYDSTPSLLHEACTPAAAVAHSSAPVPSSHSGSKPPATFFSLEGQTGTTR
                     LNGNHVGSSSNTAATPTNPTTIVPAVPAPATASSVRARRTYNADKQQTEASGPAAVEL
                     ATPSPATIAAGSERSGRGSSVQAATRVRRTPAPGRQLSGGDRINLAHLRASQPLHLGS
                     ATSTSLEVSSTVARAPRDRPGTLTPLDGCVGHSPLQATGAAGSGTAAAMLPMKAGASV
                     PLNTAAVAPGQ"
     gene            complement(<446890..>447870)
                     /locus_tag="LMJF_08_0990"
                     /db_xref="GeneID:5649383"
     mRNA            complement(<446890..>447870)
                     /locus_tag="LMJF_08_0990"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681076.1"
                     /db_xref="GeneID:5649383"
     CDS             complement(446890..447870)
                     /locus_tag="LMJF_08_0990"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681128.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.0990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.0990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649383"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:Q4QI70"
                     /translation="MGEAQQATEIARLLACEARKASPFEYLQLDIATCELTDVNRQYR
                     KIALLLHPDKCQLANAADAFHAAEKVHKSLSQESIFYHLKRAYRKQQDRLAEEGTSGT
                     ATGSRTIPAAGAAAGQKRAREAETALPPIAFGSLTQLVASGLSSDAQKAAEIRRVLQC
                     KPTDYFVILDVDPSSCTVADVDRRYRKMAQALHPDKCQLPHVQDAFTVFETAHKELAD
                     EKKLVRFKVAFEQQRKKEAALKAAAAQRGVSGSGGDADRFGPEESMTAEERLQKRRME
                     ALRDQQLEAARLGEEAARRRKLKEEKEKEETALAAELERQRKEWNDLQLF"
     gene            complement(<448602..>455957)
                     /locus_tag="LMJF_08_1000"
                     /db_xref="GeneID:5649384"
     mRNA            complement(<448602..>455957)
                     /locus_tag="LMJF_08_1000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681077.1"
                     /db_xref="GeneID:5649384"
     CDS             complement(448602..455957)
                     /locus_tag="LMJF_08_1000"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681129.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.1000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.1000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649384"
                     /db_xref="GOA:Q4QI69"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QI69"
                     /translation="MSQDSVEVPCSTQLTIGDVVIPVPDYAVHPERVVWASPGVDHTA
                     PYLQSMAAVDSQAGAMNPTGGLPSLNDGALAEESIFFTLQDPLTRSYLRWIAQKEQLG
                     QDMCLIGDPGPAMRWLVMLYSHLTRREIRVVYLNSDITESDLKQRREIRNGNLIYDDQ
                     SAVSAAVEGQLLVLEGLTRVERNVLPVINNLLENREMHLDNGSVLIHPARYDSLLQKL
                     YESKLQQRGHQLHSPSDGVPSAELIAEAKRELAQMGLVRVSEKFRVIGITVPVPPYEG
                     NPLDPPLRSRFQCLYVRTPMPFVKPSSSMASAAGESSNNHKRAKKVAELEERQSARFA
                     QVVQLRAAITAINDSTRDFQLSKPSKKNSASAAPACGRGRSPYTPIQYSGGMAEQLFT
                     DGADAAMSEDDADSVSGSGGAVASSPLQTLGSWALATIAQQLAIFPDIPVGEAVMRGF
                     PWPYYARQLTRSGTGGATTGYANVEEYHRRLAQYAEVLQHCRVYPPLLLAADLTTNAV
                     HAHRSSSENSKLNPPHRHQVREPPSKRSRVSERLRALVQGQDVESGDDEPCGAAAARA
                     YVRSAQLVSGAVSAASVPLTVQQTCNYILQYRNVTSTTTFSGVPVVVAEAVVATAEHS
                     AAHPGHSGTYLLKVFMGAQALFSRGPFHASGTAGWDVAEHLRTTAAPSTVFTTEHYHV
                     LQTMLQVHASRQHICLLGPTGCGKTAMVRAFGRLLGYRRASTMHLYADMTHKDLFQQR
                     MTDPKTGNTTWQDSPLLHAAIYGELVVLDGMEKLPSGMLSSLQQVLVDQSAVLTDGTI
                     LKSPMEYNLLKERITERDPSTGAVVWQPTDADMRERKIFPVHPCFRVVATARPPLPVS
                     GGAAGSRGARDFFTQDLTTLFRMVAMPDAGEDALGQVLRQVAQAEARLLQAEAWRKQE
                     APVATQQRIEAVVGQLIQLCNELEELHSTDGKMPQLSLRQLRQLVRSAVRYPSRIEES
                     VRNTLLLPLMTGVAATKVRHALESCGLAQPSARTATGRGDATSGSPTAEAEALVAADD
                     AFRTGGEASMSSSRLWNVNGEPVLLLSRAYTQAELALVPYVTAFYVNRVHESILAWLA
                     KQYAMGSNILLIGNQGVGKNKVVDAFLSRLGIPRHYIQLHRDTTVGSLTINPTVEAGK
                     VVWEDSPLVKAVQRGHCLVVDEIDKAPVEVVQVLKGLIEDREMRLGDGRQIYDPAMEP
                     HATAAAEVAGTTQRIAIHPDFRIIVLANPPGFPFHGNDFFRECGDLFAAYVMGNPDAE
                     SQLRVLTAYAPTLPRPLLERLVLVFLELQSAFTQGNLTYPFSLRELIAVVKHMSRYPQ
                     DGVYEALNNVFNFDARDESTLRVVRQVLANYLQPMIQQGGLQRLKPYKAGQPTPLLPS
                     KELVTLPMTAMTTTAPAADVAHFAALVCLPAEVTLSEHRFLSRIVEAEEEAAAARPQG
                     SRGSGTAATLWSTTYPTESFFPASPATPSAGAASSAAEAFTEWASHFTLPFVNPSTDT
                     VVAMTSVTAVGGADAEMEAATMPLLSVLLLRRTSGKDSSGDASKSSPGAAGLRLIVAT
                     VRLPPSSIETRYLVADKAGELAPLWPVGHVRFADVTSPYATELAAATAHPFSLFRFTG
                     FTLPAQALPWSTGDGEACDTVGQQQHRRRIWPPSLATWSQTAGVRRSLLHQNDSTGSA
                     AGRIPQGVVLLSSQKTGCTALIDVLAGAASDLYMTRMGVAEGARTAVIKTPGAATTAS
                     LGPVLPLHLDRCLNAASAPPAAQAGVRVLDVSPRHGVICFADASSTTRELLFVLQGRV
                     VRVSFPQPVVSLRFVGSRLATVEMEAAAVGDVREASQRRAHRRAGVVKVSVAADGSAH
                     ATMLPLSPDTQCLELVEAPTVAAGDDGPTEYLSARDRSSASHDVLVPADLKGSVWRIA
                     AAAAGSSASTPSPAGGTSEIDKDDPASRNIVYARVEGTAESGLQLRYYKSKTGSAAAS
                     AALPALTTLVDDARHQLLHIHPDGRTVSAIDTQHATQRTFASAPGAAVQAASAPPSAA
                     AAAENRWSLDSRSGTVYAWQSTSQQLSVADVDGERVRQRYSEWSSLLTGNAATVGDAA
                     TVEEGEEDVKDFKMKYSTPRKQPSGTLKHGEIDDKEHHGGNTWAGGTGGTDTAGLGGI
                     IGPYRLDKGNPVHQVSPEEKRKVPKHLMEEARRMGRKALKERLQSIGMSEEEYEQYKG
                     LQERVQPAVAQLRTLLMGLKASEGERVWITGQTDGVWDDKKLVEGIVGEKNVYKRRVD
                     SKETNPFQQQHKKRLVFVLDVSASMYRFNSMDKRLTKLLETTIMIMEAFAGFESKLDY
                     AMIGHNGDSDNIPLVNFGAPPANQKERMIICQKMLAYAQYCWSGDNTVEAMRRSIELV
                     TKERGDSYFVFVISDANLRQYGITPRELTAIIQSKPEVKMFCIFIATLGAQASHLQQQ
                     LPAGHGYECMRTDVLPQVLRQIFTSANLF"
     gene            complement(<458886..>459932)
                     /locus_tag="LMJF_08_1010"
                     /db_xref="GeneID:5649385"
     mRNA            complement(<458886..>459932)
                     /locus_tag="LMJF_08_1010"
                     /product="cathepsin L-like protease"
                     /transcript_id="XM_001681078.1"
                     /db_xref="GeneID:5649385"
     CDS             complement(458886..459932)
                     /locus_tag="LMJF_08_1010"
                     /codon_start=1
                     /product="cathepsin L-like protease"
                     /protein_id="XP_001681130.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.1010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.1010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649385"
                     /db_xref="GOA:Q4QI68"
                     /db_xref="InterPro:IPR000169"
                     /db_xref="InterPro:IPR000668"
                     /db_xref="InterPro:IPR013128"
                     /db_xref="InterPro:IPR013201"
                     /db_xref="InterPro:IPR025660"
                     /db_xref="InterPro:IPR025661"
                     /db_xref="UniProtKB/TrEMBL:Q4QI68"
                     /translation="MATSRAALCAVAVVCVVLAAACAPARAIYVGTPAAALFEEFKRT
                     YQRAYGTLTEEQQRLANFERNLELMREHQARNPHARFGITKFFDLSEAEFAARYLNGA
                     AYFAAAKQHAGQHYRKARADLSAVPDAVDWREKGAVTPVKNQGACGSCWAFSAVGNIE
                     SQWAVAGHKLVRLSEQQLVSCDHVDNGCGGGLMLQAFEWVLRNMNGTVFTEKSYPYTS
                     TFGYVPECSNSSELAPGARIDGYVSMESSERVMAAWLAKNGPISIAVDASSFMSYHSG
                     VLTSCIGEQLNHGVLLVGYNMTGEVPYWVIKNSWGKDWGEKGYVRVTMGVNACLLTGY
                     PVSVHVSQSPTPYL"
     gene            complement(<461651..>462697)
                     /locus_tag="LMJF_08_1020"
                     /db_xref="GeneID:5649386"
     mRNA            complement(<461651..>462697)
                     /locus_tag="LMJF_08_1020"
                     /product="cathepsin L-like protease"
                     /transcript_id="XM_001681079.1"
                     /db_xref="GeneID:5649386"
     CDS             complement(461651..462697)
                     /locus_tag="LMJF_08_1020"
                     /codon_start=1
                     /product="cathepsin L-like protease"
                     /protein_id="XP_001681131.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.1020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.1020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649386"
                     /db_xref="GOA:Q4QI67"
                     /db_xref="InterPro:IPR000169"
                     /db_xref="InterPro:IPR000668"
                     /db_xref="InterPro:IPR013128"
                     /db_xref="InterPro:IPR013201"
                     /db_xref="InterPro:IPR025660"
                     /db_xref="InterPro:IPR025661"
                     /db_xref="UniProtKB/TrEMBL:Q4QI67"
                     /translation="MATSRAALCAVAVVCVVLAAACAPARAIYVGTPAAALFEEFKRT
                     YQRAYGTLTEEQQRLANFERNLELMREHQARNPHARFGITKFFDLSEAEFAARYLNGA
                     AYFAAAKQHAGQHYRKARADLSAVPDAVDWREKGAVTPVKNQGACGSCWAFSAVGNIE
                     SQWAVAGHKLVRLSEQQLVSCDHVDNGCGGGLMLQAFEWVLRNMNGTVSTEKSYPYVS
                     GNGDVPECSNSSELAPGARIDGYVSMESSERVMTAWLAKNGPISIAVDASSFMSYHSG
                     VLTSCIGEQLNHGVLLVGYNMTGEVPYWVIKNSWGEDWGEKGYVRVTMGVNACLLTGY
                     PVSVHVSQSPTPYL"
     gene            complement(<464139..>465470)
                     /locus_tag="LMJF_08_1030"
                     /db_xref="GeneID:5649387"
     mRNA            complement(<464139..>465470)
                     /locus_tag="LMJF_08_1030"
                     /product="cathepsin L-like protease"
                     /transcript_id="XM_001681080.1"
                     /db_xref="GeneID:5649387"
     CDS             complement(464139..465470)
                     /locus_tag="LMJF_08_1030"
                     /codon_start=1
                     /product="cathepsin L-like protease"
                     /protein_id="XP_001681132.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.1030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.1030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649387"
                     /db_xref="GOA:Q4QI66"
                     /db_xref="InterPro:IPR000169"
                     /db_xref="InterPro:IPR000668"
                     /db_xref="InterPro:IPR013128"
                     /db_xref="InterPro:IPR013201"
                     /db_xref="InterPro:IPR021981"
                     /db_xref="InterPro:IPR025660"
                     /db_xref="InterPro:IPR025661"
                     /db_xref="UniProtKB/TrEMBL:Q4QI66"
                     /translation="MATSRAALCAVAVVCVVLAAACAPARAIYVGTPAAALFEEFKRT
                     YQRAYGTLTEEQQRLANFERNLELMREHQARNPHARFGITKFFDLSEAEFAARYLNGA
                     AYFAAVKQHAGQHYRKARADLSAVPDAVDWREKGAVTPVKNQGACGSCWAFSAVGNIE
                     SQWAVAGHKLVRLSEQQLVSCDHVDNGCGGGLMLQAFEWVLRNMNGTVFTEKSYPYVS
                     GNGDVPECSNSSELAPGARIDGYVSMESSERVMAAWLAKNGPISIAVDASSFMSYHSG
                     VLTSCIGEQLNHGVLLVGYNMTGEVPYWVIKNSWGEDWGEKGYVRVTMGVNACLLTGY
                     PVSVHVSQSPTPGPNTTTTTHAPKRVTVKQITCTDYFCRKGCKTTVIPTKECLPNGAG
                     GSFQMECGDHQVLKLTYTSMNCTGEAKYTVTREGKCGISWSGSSKSICQYV"
     gene            complement(<467201..>468247)
                     /locus_tag="LMJF_08_1040"
                     /db_xref="GeneID:5649388"
     mRNA            complement(<467201..>468247)
                     /locus_tag="LMJF_08_1040"
                     /product="cathepsin L-like protease"
                     /transcript_id="XM_001681081.1"
                     /db_xref="GeneID:5649388"
     CDS             complement(467201..468247)
                     /locus_tag="LMJF_08_1040"
                     /codon_start=1
                     /product="cathepsin L-like protease"
                     /protein_id="XP_001681133.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.1040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.1040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649388"
                     /db_xref="GOA:Q4QI65"
                     /db_xref="InterPro:IPR000169"
                     /db_xref="InterPro:IPR000668"
                     /db_xref="InterPro:IPR013128"
                     /db_xref="InterPro:IPR013201"
                     /db_xref="InterPro:IPR025660"
                     /db_xref="InterPro:IPR025661"
                     /db_xref="UniProtKB/TrEMBL:Q4QI65"
                     /translation="MATSRAALCAVAVVCVVLAAACAPARAIYVGTPAAALFEEFKRT
                     YQRAYGTLTEEQQRLANFERNLELMREHQARNPHARFGITKFFDLSEAEFAARYLNGA
                     AYFAAAKQHAGQHYRKARADLSAVPDAVDWREKGAVTPVKNQGACGSCWAFSAVGNIE
                     SQWAVAGHKLVRLSEQQLVSCDHVDNGCGGGLMLQAFEWVLRNMNGTVFTEKSYPYVS
                     GNGDVPECSNSSELAPGARIDGYVSMESSERVMAAWLAKNGPISIAVDASSFMSYHSG
                     VLTSCIGEQLNHGVLLVGYNMTGEVPYWVIKNSWGKDWGEKGYVRVTMGVNACLLTGY
                     PVSVHVSQSPTPYL"
     gene            complement(<469964..>471010)
                     /locus_tag="LMJF_08_1050"
                     /db_xref="GeneID:5649389"
     mRNA            complement(<469964..>471010)
                     /locus_tag="LMJF_08_1050"
                     /product="cathepsin L-like protease"
                     /transcript_id="XM_001681082.1"
                     /db_xref="GeneID:5649389"
     CDS             complement(469964..471010)
                     /locus_tag="LMJF_08_1050"
                     /codon_start=1
                     /product="cathepsin L-like protease"
                     /protein_id="XP_001681134.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.1050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.1050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649389"
                     /db_xref="GOA:Q4QI64"
                     /db_xref="InterPro:IPR000169"
                     /db_xref="InterPro:IPR000668"
                     /db_xref="InterPro:IPR013128"
                     /db_xref="InterPro:IPR013201"
                     /db_xref="InterPro:IPR025660"
                     /db_xref="InterPro:IPR025661"
                     /db_xref="UniProtKB/TrEMBL:Q4QI64"
                     /translation="MATSRAALCAVAVVCVVLAAACAPARAIYVGTPAAALFEEFKRT
                     YQRAYGTLTEEQQRLANFERNLELMREHQARNPHARFGITKFFDLSEAEFAARYLNGA
                     AYFAAAKQHAGQHYRKARADLSAVPDAVDWREKGAVTPVKNQGACGSCWAFSAVGNIE
                     SQWAVAGHKLVRLSEQQLVSCDHVDNGCGGGLMLQAFEWVLRNMNGTVFTEKSYPYVS
                     GNGDVPECSNSSELAPGARIDGYVSMESSERVMAAWLAKNGPISIAVDASSFMSYHSG
                     VLTSCIGEQLNHGVLLVGYNMTGEVPYWVIKNSWGEDWGEKGYVRVTMGVNACLLTGY
                     PVSVHVSQSPTPYL"
     gene            complement(<472445..>473776)
                     /locus_tag="LMJF_08_1060"
                     /db_xref="GeneID:5649390"
     mRNA            complement(<472445..>473776)
                     /locus_tag="LMJF_08_1060"
                     /product="cathepsin L-like protease"
                     /transcript_id="XM_001681083.1"
                     /db_xref="GeneID:5649390"
     CDS             complement(472445..473776)
                     /locus_tag="LMJF_08_1060"
                     /codon_start=1
                     /product="cathepsin L-like protease"
                     /protein_id="XP_001681135.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.1060"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.1080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.1060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.1080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649390"
                     /db_xref="GOA:Q4QI61"
                     /db_xref="InterPro:IPR000169"
                     /db_xref="InterPro:IPR000668"
                     /db_xref="InterPro:IPR013128"
                     /db_xref="InterPro:IPR013201"
                     /db_xref="InterPro:IPR021981"
                     /db_xref="InterPro:IPR025660"
                     /db_xref="InterPro:IPR025661"
                     /db_xref="UniProtKB/TrEMBL:Q4QI61"
                     /translation="MATSRAALCAVAVVCVVLAAACAPARAIYVGTPAAALFEEFKRT
                     YQRAYGTLTEEQQRLANFERNLELMREHQARNPHARFGITKFFDLSEAEFAARYLNGA
                     AYFAAAKQHAGQHYRKARADLSAVPDAVDWREKGAVTPVKNQGACGSCWAFSAVGNIE
                     SQWAVAGHKLVRLSEQQLVSCDHVDNGCGGGLMLQAFEWVLRNMNGTVFTEKSYPYVS
                     GNGDVPECSNSSELAPGARIDGYVSMESSERVMAAWLAKNGPISIAVDASSFMSYHSG
                     VLTSCIGEQLNHGVLLVGYNMTGEVPYWVIKNSWGEDWGEKGYVRVTMGVNACLLTGY
                     PVSVHVSQSPTPGPNTTTTTHAPKRVTVKQITCTDYFCRKGCKTTVIPTKECLPNGAG
                     GSFQMECGDHQVLKLTYTSMNCTGEAKYTVTREGKCGISWSGSSKSICQYV"
     gene            complement(<475508..>476554)
                     /locus_tag="LMJF_08_1070"
                     /db_xref="GeneID:5649391"
     mRNA            complement(<475508..>476554)
                     /locus_tag="LMJF_08_1070"
                     /product="cathepsin L-like protease"
                     /transcript_id="XM_001681084.1"
                     /db_xref="GeneID:5649391"
     CDS             complement(475508..476554)
                     /locus_tag="LMJF_08_1070"
                     /codon_start=1
                     /product="cathepsin L-like protease"
                     /protein_id="XP_001681136.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.1070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.1070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649391"
                     /db_xref="GOA:Q4QI62"
                     /db_xref="InterPro:IPR000169"
                     /db_xref="InterPro:IPR000668"
                     /db_xref="InterPro:IPR013128"
                     /db_xref="InterPro:IPR013201"
                     /db_xref="InterPro:IPR025660"
                     /db_xref="InterPro:IPR025661"
                     /db_xref="UniProtKB/TrEMBL:Q4QI62"
                     /translation="MATSRAALCAVAVVCVVLAAACAPARAIYVGTPAAALFEEFKRT
                     YQRAYGTLTEEQQRLANFERNLELMREHQARNPHARFGITKFFDLSEAEFAARYLNGA
                     AYFAAAKQHAGQHYRKARADLSAVPDAVDWREKGAVTPVKNQGACGSCWAFSAVGNIE
                     SQWAVAGHKLVRLSEQQLVSCDHVDNGCGGGLMLQAFEWVLRNMNGTVFTEKSYPYVS
                     GNGDVPECSNSSELAPGARIDGYVSMESSERVMTAWLAKNGPISIAVDASSFMSYHSG
                     VLTSCIGEQLNHGVLLVGYNMTGEVPYWVIKNSWGEDWGEKGYVRVTMGVNACLLTGY
                     PVSVHVSQSPTPYL"
     gene            complement(<477996..>479327)
                     /locus_tag="LMJF_08_1080"
                     /db_xref="GeneID:5649392"
     mRNA            complement(<477996..>479327)
                     /locus_tag="LMJF_08_1080"
                     /product="cathepsin L-like protease"
                     /transcript_id="XM_001681085.1"
                     /db_xref="GeneID:5649392"
     CDS             complement(477996..479327)
                     /locus_tag="LMJF_08_1080"
                     /codon_start=1
                     /product="cathepsin L-like protease"
                     /protein_id="XP_001681137.1"
                     /db_xref="GeneID:5649392"
                     /db_xref="GOA:Q4QI61"
                     /db_xref="InterPro:IPR000169"
                     /db_xref="InterPro:IPR000668"
                     /db_xref="InterPro:IPR013128"
                     /db_xref="InterPro:IPR013201"
                     /db_xref="InterPro:IPR021981"
                     /db_xref="InterPro:IPR025660"
                     /db_xref="InterPro:IPR025661"
                     /db_xref="UniProtKB/TrEMBL:Q4QI61"
                     /translation="MATSRAALCAVAVVCVVLAAACAPARAIYVGTPAAALFEEFKRT
                     YQRAYGTLTEEQQRLANFERNLELMREHQARNPHARFGITKFFDLSEAEFAARYLNGA
                     AYFAAAKQHAGQHYRKARADLSAVPDAVDWREKGAVTPVKNQGACGSCWAFSAVGNIE
                     SQWAVAGHKLVRLSEQQLVSCDHVDNGCGGGLMLQAFEWVLRNMNGTVFTEKSYPYVS
                     GNGDVPECSNSSELAPGARIDGYVSMESSERVMAAWLAKNGPISIAVDASSFMSYHSG
                     VLTSCIGEQLNHGVLLVGYNMTGEVPYWVIKNSWGEDWGEKGYVRVTMGVNACLLTGY
                     PVSVHVSQSPTPGPNTTTTTHAPKRVTVKQITCTDYFCRKGCKTTVIPTKECLPNGAG
                     GSFQMECGDHQVLKLTYTSMNCTGEAKYTVTREGKCGISWSGSSKSICQYV"
     gene            complement(<480203..>481804)
                     /locus_tag="LMJF_08_1090"
                     /db_xref="GeneID:5649393"
     mRNA            complement(<480203..>481804)
                     /locus_tag="LMJF_08_1090"
                     /product="putative histone deacetylase"
                     /transcript_id="XM_001681086.1"
                     /db_xref="GeneID:5649393"
     CDS             complement(480203..481804)
                     /locus_tag="LMJF_08_1090"
                     /codon_start=1
                     /product="putative histone deacetylase"
                     /protein_id="XP_001681138.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.1090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.1090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649393"
                     /db_xref="GOA:Q4QI60"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="InterPro:IPR023801"
                     /db_xref="UniProtKB/TrEMBL:Q4QI60"
                     /translation="MDKGVYYITGGVCTDGEGSDTSSQSPTAALVSGTACGAAPQPPD
                     ITVGWCFDARMLLHRSDMNRSPETPHRLQRAIETLQGCERALDVLPVELLAPFTVHKD
                     SSSGSDLGRAVPLISAANRSQWIPARLATYDEVCSFQDPQVYEHFLKSGAALADLKSD
                     VYCNEGTSSVAVRLSAGAVIDASVAALRGVAASRSGTASSAAGCVHPLVSFCLVRPPG
                     HHCTASQPSGFCLVNNVAIAAQQLRIRHASALASGPPRIAILDLDVHFGEGTASFVEG
                     ACDPASLLYLSLHRYDKRQFYPFDGRGDTAYVGGSRHAASKGSICNVAVHTNGQQPAR
                     CEQVISDHLMNSVLEEIFLPRLAKFGPDLVMVSLGFDAAYGDPLGKMAVEGGFASVLS
                     RLKGWCLHDGRTAGLVVVLEGGYNPEAVAQGVLSVALALSLPRTDPLLQRFLEEKSPK
                     VWADLRQRQERRHREWEQLREERAEEDLGAAPSGRGSELKPAASDEPEQVQEDTLLLD
                     RHKRWCAALVAKVQQIHREAMTREH"
     gene            <493596..>494687
                     /locus_tag="LMJF_08_1101"
                     /db_xref="GeneID:12982581"
     mRNA            <493596..>494687
                     /locus_tag="LMJF_08_1101"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721731.1"
                     /db_xref="GeneID:12982581"
     CDS             493596..494687
                     /locus_tag="LMJF_08_1101"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721779.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.1101"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.1101.1"
                     /db_xref="GeneID:12982581"
                     /db_xref="GOA:E9ACQ5"
                     /db_xref="InterPro:IPR000433"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:E9ACQ5"
                     /translation="MWVGECPDRIRKRISAATKSRMVIQTLNDPTRFAVCDIQGKNHN
                     CTIGNPHMCSCGATQPCAHTLSVLLLFFKVSEENPIVWQRYINEVELSDLIDQRADEG
                     KCIFCRESTGSVGSCEKCGAHFHQLCLELASKSGRGNCNTCPKCCGMVSRSESKSDTC
                     CSNCSVPCKTENYTCLFCPDYCLCRRCYTLCKAHPSHPFSCSKLVNPAPSTCSVASHS
                     MGDLQYREINPEDYDALIALDNDKRKPLGEEELSNLSVEYFSVCPRKNDSCPVCLRRF
                     VASNRCIALPCGHIMHHKCGFKWLSEFSDVCPIDNRKVCKWSNTQDARTVGEVKASLQ
                     ASTRDGTTLRIPSKITSVKLPAIKPREWK"
     gene            <496211..>497308
                     /locus_tag="LMJF_08_1100"
                     /db_xref="GeneID:5649394"
     mRNA            <496211..>497308
                     /locus_tag="LMJF_08_1100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681087.1"
                     /db_xref="GeneID:5649394"
     CDS             496211..497308
                     /locus_tag="LMJF_08_1100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681139.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.1100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.1100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649394"
                     /db_xref="UniProtKB/TrEMBL:Q4QI59"
                     /translation="MRRLTAPALSTPCVRSICGAAPVMYFPPVPFASVSKEEQIKKNT
                     KIAIEMIRRYKGEAPASYTRKHTATIEQLEKEIEALLGGAQKMRKPTTDDQPMDKLAL
                     MERCLRHALWSYHKDDGKYDFNEIARWVVYTPEDEVKLAQMKRQVEAKSKLAAYRAKR
                     AEQGLPEAPAPQINWGEEYSSVTDRELVNEKRIRYDTIAANTMERDEAQIEAVLQQYR
                     KPVQDKRLDDLVDLLERFKPVLAREAIMQRLTIKHLEGQLGVWRYMDWCPEVRDRAEL
                     EVDISGFQWWSPLEERRLLPVRLRSVNEVREIMAQTQSSKAAEASAHSPQASQSAGDG
                     DRERLLKEVLALQARIHQRDDAPVEEKRAAH"
     gene            <498347..>499987
                     /locus_tag="LMJF_08_1110"
                     /db_xref="GeneID:5649395"
     mRNA            <498347..>499987
                     /locus_tag="LMJF_08_1110"
                     /product="stress-induced protein sti1"
                     /transcript_id="XM_001681088.1"
                     /db_xref="GeneID:5649395"
     CDS             498347..499987
                     /locus_tag="LMJF_08_1110"
                     /codon_start=1
                     /product="stress-induced protein sti1"
                     /protein_id="XP_001681140.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.1110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.1110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649395"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR006636"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q4QI58"
                     /translation="MDATELKNKGNEEFSAGRYVEAVNYFSKAIQLDEQNSVLYSNRS
                     ACFAAMQKYKDALDDADKCISIKPNWAKGYVRRGAALHGMRRYDDAIAAYEKGLKVDP
                     SNSGCAQGVKDVQVAKAREARDPIARVFTPEAFRKIQENPKLSLLMLQPDYVKMVDTV
                     IRDPSQGRLYMEDQRFALTLMYLSGMKIPNDGDGEEEERPSAKAAETAKPKEEKPLTD
                     NEKEALALKEEGNKLYLSKKFEEALTKYQEAQVKDPNNTLYILNVSAVYFEQGDYDKC
                     IAECEHGIEHGRENHCDYTIIAKLMTRNALCLQRQRKYEAAIDLYKRALVEWRNPDTL
                     KKLTECEKEHQKAVEEAYIDPEIAKQKKDEGNQYFKEDKFPEAVAAYTEAIKRNPAEH
                     TSYSNRAAAYIKLGAFNDALKDAEKCIELKPDFVKGYARKGHAYFWTKQYNRALQAYD
                     EGLKVDPSNADCKDGRYRTIMKIQEMASGQSADGDEAARRAMDDPEIAAIMQDSYMQL
                     VLKEMQNDPTRIQEYMKDSGISSKINKLISAGIIRFGQ"
     gene            <501449..>504058
                     /locus_tag="LMJF_08_1120"
                     /db_xref="GeneID:5649396"
     mRNA            <501449..>504058
                     /locus_tag="LMJF_08_1120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681089.1"
                     /db_xref="GeneID:5649396"
     CDS             501449..504058
                     /locus_tag="LMJF_08_1120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681141.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.1120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.1120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649396"
                     /db_xref="GOA:Q4QI57"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR006602"
                     /db_xref="InterPro:IPR010554"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:Q4QI57"
                     /translation="MSSDPQLRLSMANQSNVPKEYVRAVDPQLLPPRVGHNWNDQAFR
                     FKQGKPQQLEAEFRGTRVFPATRNSTFPAPAPDMCRTAQQLVDALTSSSPHRNAAARK
                     ARAAADLRHVTLDDKVLRFYAFFNEPAPEAGAASFWHRKVVISFFPVDDTILIEEPRI
                     INSGLDGGVFLKRQKVVTDPRQREQFPGEEYVSLNFFNVGDSVRLNATDFFLYDCDDF
                     TRNFLTALGIEVGAPVECPDDLFMSEYGRYQERLKSGKFGLLSQDYSADEVEHSVRFI
                     RDGGKMLRFYAILDERDSVPGGMLRRLEVMLFVEDNSMAILQRQSSPESCQGLYLSRC
                     WLPKSGSVAKANELTFAHRVNGQREPDMGIPDAYYRDVDLDVGVTLNVFGRSVLLYDC
                     DDYTRDFFMERYGVSLRPPVDVSSYFQGDARRTVLGTEAPTKSLLGDSVRSVVVKPAT
                     AADAGDADGGVAVSSVNAAAAAQGMPADTLRFRAVLARPANHDDEQRRFTVTYYTNSQ
                     EFMVYESAYPKAGINGGCMWKRRKVMKIPPKPGPRNAPKPPAVPGEVLHYTLSDLGEG
                     KEVVINGLPLRLYRMDAHTATFYARCAGTLPEDTADGPAMVTDATGAMVTVDHLVSEL
                     RSYLHSRHGTGVASFLALDRDRDGIVSLPEFTMAMKAFQITEDRGAAAAIFAHIAPAR
                     DTAYFTSVDLMKWMDAVGDEHRTAGSMRIASMPSGGREAELKEIERRALHSKVLRELK
                     SRLDARCWKGADMFRLASTMPRAYRGRRADLYSFTNPDRDTVITPVQLRRCIEEILTG
                     SPTAAEMAYLLEFFFPSLPAVAYTQTRDNGTTYAVDLNEFQKRYYVMTKETMLPDDDA
                     AAATSSSRRGTRE"
     gene            <505898..>507010
                     /locus_tag="LMJF_08_1130"
                     /db_xref="GeneID:5649397"
     mRNA            <505898..>507010
                     /locus_tag="LMJF_08_1130"
                     /product="phosphoribosylpyrophosphate synthetase"
                     /transcript_id="XM_001681090.1"
                     /db_xref="GeneID:5649397"
     CDS             505898..507010
                     /locus_tag="LMJF_08_1130"
                     /EC_number="2.7.6.1"
                     /codon_start=1
                     /product="phosphoribosylpyrophosphate synthetase"
                     /protein_id="XP_001681142.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.1130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.1130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649397"
                     /db_xref="GOA:Q4QI56"
                     /db_xref="InterPro:IPR005946"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="InterPro:IPR029099"
                     /db_xref="UniProtKB/TrEMBL:Q4QI56"
                     /translation="MSVSPLCDQLKRIEKAYFYQPGKMTEVHAMSGTVSPHIEKRDYS
                     RPFCLVSGNGNRPLAEAVALLMGTHTHHTSVTQYSNGEVNVRINECVLGADVYIIQST
                     TGNEIIDINTALMELLLLIRKMRLSNAKSVTVIAPFFGYARQDRKTSLRGPISASVVA
                     RMVVKMGVNRLASLDLHSNQIQGFFDNIPVDNLLMAHEFARYLHDQPWFNVDQMVVVS
                     PDAGGVERAKQLADILQVGRIVTIVKRRIAAGKVDTMQSVGEVAGFTCIIVDDMIDTG
                     GTLVKACELLKELGAVRVMACCTHGILTNPCSDRINNCSALEQLVVSDSIPQEEHQKA
                     IPKLTVLTIAPLIAAVIHRYLNEESVSSLFPPSLAG"
     gene            <508658..>511498
                     /gene="TSIF"
                     /locus_tag="LMJF_08_1140"
                     /db_xref="GeneID:5649398"
     mRNA            <508658..>511498
                     /gene="TSIF"
                     /locus_tag="LMJF_08_1140"
                     /product="putative suppressive immunomodulating factor"
                     /transcript_id="XM_001681091.1"
                     /db_xref="GeneID:5649398"
     CDS             508658..511498
                     /gene="TSIF"
                     /locus_tag="LMJF_08_1140"
                     /codon_start=1
                     /product="putative suppressive immunomodulating factor"
                     /protein_id="XP_001681143.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.1140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.1140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649398"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:Q4QI55"
                     /translation="MTSLTLREIGVINNVAEDHDVLELFAACRESVVHVAASHLLPDH
                     VAVTTRNGFVELIDTATGEFRLFLTYLDRIPLDASLRCFSLVPSLHAASPQHHHRHRQ
                     HHLLYSLSYSNELLLGNVETGAVRVFATCESRPSVVQCDGDYIICGEGTGQVTVWRTT
                     VEEEWDARYASCSAASTSLLPPLWKTRLFDSTVVCANLHRDQLVCCSADYRCVVACAE
                     DGVVRATLPLDLDQAVAVFALTMPSMTSLLHKSLVVCFTSRISIFTSRPARGTAASAQ
                     LSLSSVPTAEHLECWTRQGDCVVGREEVACASCLGGYLAAGTISGLVLLYFCGAAESL
                     VKELVRFNVGYGVTGMQLLPNDTLLVVTSVGDVWRWPLCDLLRNADASGAEGEKDEAT
                     EAEPTAAAHQPPLPLAAPRVPAAPSPQDKTLHTEPRVPATPEEVSYTQEGDTEDRSFS
                     AHDTSTLAHTPQREREATARVEEIVTAVRVGADVPLVGARSDAEEQGTPSVHLSTASA
                     SLRALSASSENDGDEDHPDERGNDNTDMDARRAEPATVSCLPPPPPLASPTVSDKFEE
                     KRGVGGVTRCATEFQRRTLYDPEQSTEEPGVVDMGVPSSAAGNSADLSHDGLRIAVSP
                     PSTADNTAHHDAVLEDSGADVPEVAARGSAAGAAAVAAKEGTISDKHIQPFQRNHGDL
                     SDTADVAQGTAHSSPGITSRQGTGMKAAVDDLEHEFAHAMKRLLGPTVGVEGLRKDRR
                     MNPRKVAGVLANLTNQQAAAAGAKGLSYEAPSQPRALEGPNSTKLLEEKRTTLEAAVF
                     DFEAYRQAHRLEVDALQYHHPVPAPTYTLQDRVFDAVESAGRLCDKEAGRATGAAGNA
                     AATLPAAPEDELRDVTYGKVKWTLDPQIAEERRRGGPEMAQHHCDHLIFSTPYPAKAT
                     VLFAEEAPLMPSTAWEEVLLLPLPLPPAPSVF"
     gene            <512474..>515908
                     /locus_tag="LMJF_08_1150"
                     /db_xref="GeneID:5649399"
     mRNA            <512474..>515908
                     /locus_tag="LMJF_08_1150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681092.1"
                     /db_xref="GeneID:5649399"
     CDS             512474..515908
                     /locus_tag="LMJF_08_1150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681144.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.1150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.1150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649399"
                     /db_xref="InterPro:IPR019160"
                     /db_xref="UniProtKB/TrEMBL:Q4QI54"
                     /translation="MSRYKELQPAIDGVFHQRGEEVVAHETVSEISSKKKASTPRLLI
                     LSHFLGRSGSATLSIVTVDPSGQRVKIKSAFAVDRLVNISNEGSFDATFNFGASGVLS
                     VSFESHIQREMFVAAARRIRATPWSSSGVREGYTNNRLSTIRGVLTEAVGAQVEADAA
                     ARVRKLRQDKRRIFSTEEEKHLLRHIGNNGAGFDDIKQFQEILLRQQKSSELRSLNLL
                     TTSEAVWQEAQQQVQDLVQDVEEVGQRIEEYSTHLLSKKSVLQQVEHDNNTLQRRQHN
                     LEALYIMMSDLRDQLRLAPATMALLSRLRTVPEDDLVAFFSEGSNAVTLSVAMKHMQG
                     VLHNPKLDSDFPITAVAERKAFFLEQRKMITQRSKSYIMAIIGSFEATYLADKSRYSR
                     DASLVWRLHVELAHKLLNISDVIRALDRIDVEGFNNALRKYRTSMQRVYALEITHFFK
                     CLKKQVKKVNTWRGPFLLGTSESRKEAMSMRMETAQSGETPRMYSRGSQSTPALTPRM
                     MRFGDDSDYGAGAGGRAASGLGGSEDPTHLSVQFPSVADLSMAVSVPASAIELYQSAN
                     TLRRLDARAETSSVVSGMKSLNPASTSGGGYVRPDLAFAIALESFVLAVVHEEVILRR
                     CFNLFSDPAEKSGNDEDAAASANPGANLQADDSKRTGTATPRGAAGADRAQMKQESLL
                     ELFGGTDADYLVRTLQGKSRSASVQNSRSSSQDIGLPPRPPPAGYGGVPQGHGGSSFP
                     HRRMWSGASLSGHGRESNSSDGDDVDGGGPVGESSRASRIALHRNFLIRTMRDLALFF
                     VEKCDRIYCVPILCMIRAYRSTAADTAMLPSKSAFCQAMLAEVETVMVGGMMRFVAEQ
                     TDSIHRCRKRYVVRPTALLHCFSKMPALFMRFEAVHNALARNVCDRTEYASIALSLVD
                     QSFDALDQITSVKATGEDQNAEQLKLSKLIAQKVHSVLDGVEADVHSLKWVFIQQYRH
                     QSFFCAFYSTMPSDSFAVELLQDHYTSAKEKRDRYEELYLTRVLLVRSFPVFGVFALS
                     AEDLSMIYSKEELRHHKALSADAVKKVVGGLEKEMRSGVRASAARMKKHFLRDVDLNG
                     NEVSFHTTLLQRTWQHFSTLLLHKFDFLAEMLTWPVYHGISMPVARSDVVEMLAAY"
     gene            <517084..>518364
                     /locus_tag="LMJF_08_1160"
                     /db_xref="GeneID:5649400"
     mRNA            <517084..>518364
                     /locus_tag="LMJF_08_1160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681093.1"
                     /db_xref="GeneID:5649400"
     CDS             517084..518364
                     /locus_tag="LMJF_08_1160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681145.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.1160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.1160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649400"
                     /db_xref="GOA:Q4QI53"
                     /db_xref="InterPro:IPR008854"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4QI53"
                     /translation="MLRTTRLRRIGVHIPSAQELDDQLLVNRLRKSRPKSVFSLKALT
                     AGRAQSFVAAGGIVLGAAVFLGPWLWEEVQELMGSRYVPLAPSQMPHTSPEWWENEWR
                     KMNPLWRAGESMSDFFVGPYRFVKEQTGRDMSSAADFVRTSPSSALSPFGAAGEQQRS
                     FLHRLKQVFHRSTSPTICTCVSPVSSGVGAASKGGDSRRATASAVILPNPPQMLVPLC
                     GDSPIMRTAALQGFEVDAVDSSQTAIQTAVGRTEEGLPREFYPKIHLHWKNFFSPELW
                     EGPLKGKKYDVIYERQGMTSLNREQRPDYAYLLKRAMKDDGLMYVEGIFRTGRVKGNK
                     LMGPPYSLSKRELQQLFPLSEGYYVRCEEKTDAMQQLSREHRILKRVPKELYVTPFSC
                     VVFREATVNLRTRTEPLQHPEPPTLTSPQEGFVW"
     gene            <519804..>521132
                     /locus_tag="LMJF_08_1170"
                     /db_xref="GeneID:5649401"
     mRNA            <519804..>521132
                     /locus_tag="LMJF_08_1170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681094.1"
                     /db_xref="GeneID:5649401"
     CDS             519804..521132
                     /locus_tag="LMJF_08_1170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681146.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.1170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.1170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649401"
                     /db_xref="UniProtKB/TrEMBL:Q4QI52"
                     /translation="MKKLHQERGGNPMLAQQARRVLFATSITGQNIDARSIALLLNTA
                     VYFGMESDARVVRECIDFCLKNDKFISLDIMPIVVTACATLQSRDAREVIELQAIKAT
                     RNARFLDAKGVTNVISAFSKTGINHEKLFGLLSMRVQTLARVGEFEAAHLVILANAFA
                     RLRFREQHVFSAIARRAMSLRERVTVNELVPLINAFSKAGLKDPKLSKRFAGKAMEYV
                     DQMNAEQVALMFQAFAYFGIRYDQLFGVLTNRAVELIDEFNAQYISTTLASFQRIGIN
                     NPELFDNLAERALAVVQDHDAKDIALTVTALAHFGLKDEELFKRLASHAASIADQFDP
                     VGLVNTIHAFARTFFLQEDMVVALSERCVYVCRHLDANQVRRLLWSLAKFQVKDPRIL
                     TPVFNRCLTLHQDFFSDPMGGEEIEEIFDVFGPSFCPPLYQLYMSRGNSV"
     gene            <522377..>523633
                     /locus_tag="LMJF_08_1180"
                     /db_xref="GeneID:5649402"
     mRNA            <522377..>523633
                     /locus_tag="LMJF_08_1180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681095.1"
                     /db_xref="GeneID:5649402"
     CDS             522377..523633
                     /locus_tag="LMJF_08_1180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681147.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.1180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.1180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649402"
                     /db_xref="GOA:Q4QI51"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:Q4QI51"
                     /translation="MEPNADEPKKTSSVRQLLRQQRELQEMRKFGLAPLAVDTETHQE
                     ISPNIPEFISRAPWYYGATGPTLVHQRKQGDSATEVSDEVLDEKVDRIVVKGQASRFT
                     AGACKNCGSRTHKTSECFQAKKKVGSVYTNRVTGSDIETHQEAKTYSQKRDRFVGEVG
                     IDLMRGVRQDQQDDNVDVAAPATARHRPEDVFGSRTAQHGGVEVKELPKYLHNLDQQD
                     GLFFDPKTGSMRANPNSGDSTKAFRGDLERYRTGDYYNYVESQYRFLTGQSRSFVDFE
                     FDDAMRRAREQQQEPQQQEQNSTRGPVTKVLTETPQDVLLRSLYGASQPKFDSDVLPS
                     FTTESKTSAPSSSPAPPVDALATTATATVTAHSSVQAASLSWVTTRNGHAAVYGSYFD
                     PIHFRWGYACCKRMGKDTTGCSATHA"
     gene            <524483..>528229
                     /locus_tag="LMJF_08_1190"
                     /db_xref="GeneID:5649403"
     mRNA            <524483..>528229
                     /locus_tag="LMJF_08_1190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681096.1"
                     /db_xref="GeneID:5649403"
     CDS             524483..528229
                     /locus_tag="LMJF_08_1190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681148.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.1190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.1190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649403"
                     /db_xref="GOA:Q4QI50"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR001876"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017233"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4QI50"
                     /translation="MFVYLSKRIAMPNGVKVSSIAWSEGHGWLACGGEKGLLKVLKVD
                     GGPQGQRSGGLSSSQTLEGHDTTVDLVTWNQQYCKLTSSDVSGRIIVWMLHKGMWFEE
                     MVNNRNTSRVVDFAWSPSGAKICIAYEDGAVIVGGVEGNRYWGRELPYKLAKVCWSAD
                     GHSILFGTATGDVYVHDASSGAQLSQVEVQCNDGKASSALAGLSWHPAWVERPEPLAT
                     LAICYQSGKMQLMTSIGDETPRLMDSDFPVHFVSWNPSGTVLAVAALTPATEEDAPTV
                     VTQFFSNEGVHLRTLRVAGKQCGGITWEGGGLRVAIAVDSSVYFANVRPSYKYCYFKK
                     TVVFACTMPDKVEESVMFWNVNTNERRTKRVRGLQYLNACKDACVLVSRPDATQQQRM
                     IQLVNAIGSPLETRFVDMELYTYDMNSSVVVCCSDESIYIWQFRDPGTAVDALDPVSM
                     QASRAESQERIIHIGDIVRSDTAPTMKVRSALTNDLICAMCVSETHMFVALESGTLHV
                     YQLSPLQLVSKYILPTRAQSMAVNCNSTQLAVIDLSCTTSVYSMEREKFSLVPCKTEP
                     IDGVEMKDVWNLRWAIDDPHRFAVMEKTRMLVYNRGVAEEPVQSCANLCKFKSLKIRT
                     LQLDELLLDPERPRKDYIVDFEAQLLREMRAVLRDGTAKEAYEFAESHSTTKLWELLA
                     EHTLFQLDFTYAEVAFIHCKDYPAIQFVKRVRSLDDPKKQLAEVNAYYRRFDEAERLY
                     KDVDRKDLALDLRYRLGDWFGVVRLVQEGGGDEALLLQAWENIGDHYASRQKWSKAAQ
                     YYTQCRHYRKLAHVFYIIEDYEMLTQLISMAEHDKELMVTLGNMLLTVGLAEEAAKAF
                     VAASEPRMAVNGCVQVNMWDRAIALAEEHRLDDVGQLLEKYAKYLIQRERLTEAIELY
                     RKAGKHDEAATLLAQLGKRAALSDPLKAKKFYVLSALEVQKYRTTAIALNRDGVEVVS
                     EMLNKDRSTVSERTLDAAWRGAEAYHFLLMCQQQIADKNFKAALVLAMRLMEYDDLVA
                     PVDSYSLIALTAYLVKNYGLCSKAFARLEQAERNDEAGGAAAAAATTQLENFSLDLDV
                     TQRTMASACGGSTGGGTSMFTGGGGSALSGTTTSLQLTNPGKGVTRMAPMTYPTVSLR
                     DPPRPFADLARQIFMTHSPVDTSVDSVPCPTCGSFNKEWAQHCIKCQRPFNTCMVSGC
                     AIASEDGAWQCSVCHRKALEAVVDKYRNCPLCHTPKKGRARRGI"
     gene            <529419..>530006
                     /locus_tag="LMJF_08_1200"
                     /db_xref="GeneID:5649404"
     mRNA            <529419..>530006
                     /locus_tag="LMJF_08_1200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681097.1"
                     /db_xref="GeneID:5649404"
     CDS             529419..530006
                     /locus_tag="LMJF_08_1200"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681149.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.1200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.1200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649404"
                     /db_xref="GOA:Q4QI49"
                     /db_xref="PDB:3HA4"
                     /db_xref="UniProtKB/TrEMBL:Q4QI49"
                     /translation="MLRHTARRMSSLSSFTGIEVDPYTAKSMFLFGFIASVGFLSVYS
                     VKETKKAGPIELPEELEAQRQRHNDPRRPPWPLLHQRVVLLREGKGAPEDIALMWEQT
                     KHYYPADWLIPLELTQVLKYSSGKYLQTYVADPDEMRKEVLMQLLNVKYGRVSDPNGG
                     RVNKDVEEIISMAVDDLENMDLNPAADAVLIPTHT"
     gene            <532468..>533652
                     /locus_tag="LMJF_08_1210"
                     /db_xref="GeneID:5649405"
     mRNA            <532468..>533652
                     /locus_tag="LMJF_08_1210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681098.1"
                     /db_xref="GeneID:5649405"
     CDS             532468..533652
                     /locus_tag="LMJF_08_1210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681150.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.1210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.1210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649405"
                     /db_xref="UniProtKB/TrEMBL:Q4QI48"
                     /translation="MEPHMTSLVLRRDLSLEVPKLLIGAVQPYQTLAGPALTTSFLHQ
                     PDLLPFQRTAFSHAAVAPLYFHTLLHTLAEFAETPRAVQYSAVKLRHAPKADFWDSVG
                     TLNCFYYSAHAPYGAPVEASVLDQHPAMGAVELVRPGHRMESDVKLTLFNDSHQPIAS
                     MLMTGPNGAPRETDDDAVESSQGTSSTSPHARTAFPYVAPPTKETTSASDCLSAVMIG
                     GTRVYGGLYGDLMPMESGGGFGQRACYRVEDAAAYSPSLDARSRVSGTEAAAGERTAS
                     SSASTVMPPWVLYDCVQRFFLRLHRSGIFGGDAAVAPTEGWRVSAHHVVQTEDAVFGV
                     PVEVVCAVPRVYPSYRLPPWRHRLGLPAIPNGAPPCVCLRCETRQGGRLVSTGVYFFN
                     RW"
     gene            <535451..>536971
                     /locus_tag="LMJF_08_1215"
                     /db_xref="GeneID:5649406"
     mRNA            <535451..>536971
                     /locus_tag="LMJF_08_1215"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681099.1"
                     /db_xref="GeneID:5649406"
     CDS             535451..536971
                     /locus_tag="LMJF_08_1215"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681151.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.1215"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.1240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.1215"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.1240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649406"
                     /db_xref="GOA:Q4QI41"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="UniProtKB/TrEMBL:Q4QI41"
                     /translation="MLQNFQFILRAELLTITSAQGLPQGQRRLMECIQLSDSLVPWEV
                     VHSVVMRATPEEFQCPICMEMPTAPRITECGHVYCLPCILQYMSRQKVAGAQRKCPMC
                     HDLLTPYTLRPCVLQPVQPRRVGAQARFDLFKRHRNSCVLRRSDDPFLAAPPPPSSAK
                     AVAIQLPAYMEPMSCQSRYVMTTPQYEAGQRYADCASISERVRELGQLAQPLSESDAE
                     VERFLLEALNEVTKEPKGLPPSMLRNSPPMAPRPVTTPEGEGDYLELYADGEGQPYYL
                     HMLTVKMLKHDAKLRSAALPDTVTAVIEEVVTMEQTEETRRIYKVFSHVPLHGMIKLC
                     VVNVDHLVLPETRAAFAAALQRMASDRAQRRHRDDRAASEDASWKQYLMRYSNRSGDC
                     LGFSPDTAPSDFSIDTESLPYLKLPSTGSAGSDHGLPPNTLDTRQRATKRQDMQSLLV
                     DSAVEPLSRGDTATAKTSSTMAAGCWAQGSAAKLFAKAERKEATTSTWGGHVFSPK"
     gene            <538396..>539835
                     /locus_tag="LMJF_08_1218"
                     /db_xref="GeneID:5649407"
     mRNA            <538396..>539835
                     /locus_tag="LMJF_08_1218"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681100.1"
                     /db_xref="GeneID:5649407"
     CDS             538396..539835
                     /locus_tag="LMJF_08_1218"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681152.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.1218"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.1250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.1218"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.1250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649407"
                     /db_xref="UniProtKB/TrEMBL:Q4QI40"
                     /translation="MPPRWFHVPGSGARDAQRPPEGLVTSTHLSSSLLLQRSSLLDHG
                     GTADASAHELGCGGRDADGSCWGIVGPSPATQPQQPFAPRGGAGTCDTRSLGSLLRHP
                     DLRPTRDTSADDTSSTEVSRLLRHYRDENARLREQLKAKELHEAHIMARLEETSHRCA
                     HLQLAWQRASGDTPSLLLESAGEKPGAVQSVGSHGGEAEETVQSRLAQKEAEVRELQG
                     RVEAYREALQRSRAHAALSAEEWRAAPAPATCTAGNSTAVSVSPTSLHVLLLQSLNTA
                     DYLVKVFNALQHCHCTRHGDAHGSASDCCRRSLHDCKVRCLQAAVKGAPISSELLELE
                     GGPENDTAAANMETAVAVREELLYCEAVAVRLAASLLSREKSADDDAAPPATTKAAAA
                     APPEKAASLPPLSALGSLTALGVAEPVAVAKAAAAETHDDGDDEDAGEGERSTEENGH
                     ATVSYVAAAREPRRRPSRCRPDVGDCEVQ"
     gene            <541104..>541403
                     /locus_tag="LMJF_08_1222"
                     /db_xref="GeneID:5649408"
     mRNA            <541104..>541403
                     /locus_tag="LMJF_08_1222"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681101.1"
                     /db_xref="GeneID:5649408"
     CDS             541104..541403
                     /locus_tag="LMJF_08_1222"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681153.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.1222"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.1260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.1222"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.1260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649408"
                     /db_xref="UniProtKB/TrEMBL:Q4QI39"
                     /translation="MSQQLSFHDVSNDAIQHMQASEALQKHLENAQLAHRVCVAKALK
                     ANEPPVEKCALTWGEVVMRYNQWSEYRPAFHDSDAQKRYSKYWTKKRQAADDSHP"
     gene            <544525..>545385
                     /locus_tag="LMJF_08_1225"
                     /db_xref="GeneID:5649409"
     mRNA            <544525..>545385
                     /locus_tag="LMJF_08_1225"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681102.1"
                     /db_xref="GeneID:5649409"
     CDS             544525..545385
                     /locus_tag="LMJF_08_1225"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681154.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.1225"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.1225"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649409"
                     /db_xref="GOA:Q4QI44"
                     /db_xref="InterPro:IPR003198"
                     /db_xref="UniProtKB/TrEMBL:Q4QI44"
                     /translation="MTKLTVVCRAVSSALEKQTCELTCIERQTISLETMRKQHKTYVQ
                     VFKEMIEDGYDIELIELPALSELPDSMFVEDVSMIYNTCAVITRPGAPSRRPEVDPIL
                     DTVTTLRQENYRIREPGTVDGGDVLYVANSKYVFVGKSTRSNDSGYEQMKEYLGKHGL
                     ECVRCVVKQCLHLKCAVTFLSENTLLLNPEWVDPEIFTSRGFKVVEVDSDEPAGANVL
                     SFSAEKNGKPLRTIVTAAEFPRTALRIEAFAAEETAQGRPTRQVVLEADEIAKAEGSL
                     TCCSLLSYSA"
     gene            <548693..>551251
                     /locus_tag="LMJF_08_1228"
                     /db_xref="GeneID:5649410"
     mRNA            <548693..>551251
                     /locus_tag="LMJF_08_1228"
                     /product="putative protein kinase"
                     /transcript_id="XM_001681103.1"
                     /db_xref="GeneID:5649410"
     CDS             548693..551251
                     /locus_tag="LMJF_08_1228"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001681155.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.1228"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.1228"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649410"
                     /db_xref="GOA:Q4QI43"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4QI43"
                     /translation="MRDAAATERERLPSPADGDVDSLYEDGTEAETAKQRSTVSTTTL
                     LLALPWLGCTLFLVAVLLYVNVHAFSIGNRLVSMPDGVVADVSVQHRDMARYTVLFVS
                     LALLAVHLAISFCLFRRAYHVLWDVQMSLVELSFMVDVIRTHQHSTFFFVDCVERAQR
                     VRESMRYWVKEFSGFKEICAAEMAVNQVTLRLMTRPRESAQRLESPGDTQLPCTGSGT
                     SSPVQLARSGRLPPDTAAAAFRLPQDAAWSPHAQSVRTDSAHADPGPGRQLAGHHSGS
                     RHSLSFTTEIGVAQVPFEVTLKRRHVALLLLSFLTYRELVRAEAEEARQISRDFIAAV
                     NMCAQRYKACIVELYSDRAILSWNAFFESAGNYAQTCAQCGECFHDRFVRRFPPESGA
                     YFSTAGYTGHIVCGTTTEKSLLLHGQPVSMLRGLPTLLEMRYCAYVWLGTPPPACTSS
                     PLSWTRIGAVQAGADFSVDLHAMRRTSAEPLPAAMVWHMPQWTIFGDERAVRAEVLTN
                     AGAARLQQGGGDTAPVTPTSTAAATGVANALPSSPFLSSSLSLRGVGTPYETFYDRSH
                     NRYQLSNTVLGESKSCVVRLAISETGNFVAVKEIKIERGDVKPIRRRRYQRENRIIVT
                     RGEKPQWMNEVEIMERHRHTCIVAYISFVEAEEKLRIVMEYVGGGNLLKFASSSRGAE
                     GEGPPMAVLLRNVVEGLKFLHQKGIVHGDIKPQNVLVPDSGPCKIADFGISRRATTTV
                     TSAIEGTPFYMSPEATRGEVTAACDIWSFGIMMAQVLTGRLPYDASVRDYYLVSQFMC
                     NKDVKRELHTPLKKPALDVFLACTQYDPAKRKTAKDLLKMPYFIAHAATSTDDA"
     gene            <552499..>553830
                     /locus_tag="LMJF_08_1230"
                     /db_xref="GeneID:5649411"
     mRNA            <552499..>553830
                     /locus_tag="LMJF_08_1230"
                     /product="beta tubulin"
                     /transcript_id="XM_001681104.1"
                     /db_xref="GeneID:5649411"
     CDS             552499..553830
                     /locus_tag="LMJF_08_1230"
                     /codon_start=1
                     /product="beta tubulin"
                     /protein_id="XP_001681156.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.1230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.1230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649411"
                     /db_xref="GOA:Q4QI42"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002453"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR013838"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:Q4QI42"
                     /translation="MREIVSCQAGQCGNQIGSKFWEVIADEHGVDPTGTYQGDSDLQL
                     ERINVYFDESAGGRYVPRAVLMDLEPGTMDSVRAGPYGQLFRPDNFIFGQSGAGNNWA
                     KGHYTEGAELIDSVLDVCRKEAESCDCLQGFQLSHSLGGGTGSGMGTLLISKLREEYP
                     DRIMMTFSVIPSPRVSDTVVEPYNTTLSVHQLVENSDESMCIDNEALYDICFRTLKLT
                     TPTFGDLNHLVAAVMSGVTCCLRFPGQLNSDLRKLAVNLVPFPRLHFFMMGFAPLTSR
                     GSQQYRGLSVAELTQQMFDAKNMMQAADPRHGRYLTASALFRGRISTKEVDEQMLNVQ
                     NKNSSYFIEWIPNNIKSSICDIPPKGLKMSATFIGNNTCIQEMFRRVGEQFTGMFRRK
                     AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATVEEEGEYDEEQEAY"
     gene            <558256..>559776
                     /locus_tag="LMJF_08_1240"
                     /db_xref="GeneID:5649412"
     mRNA            <558256..>559776
                     /locus_tag="LMJF_08_1240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681105.1"
                     /db_xref="GeneID:5649412"
     CDS             558256..559776
                     /locus_tag="LMJF_08_1240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681157.1"
                     /db_xref="GeneID:5649412"
                     /db_xref="GOA:Q4QI41"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="UniProtKB/TrEMBL:Q4QI41"
                     /translation="MLQNFQFILRAELLTITSAQGLPQGQRRLMECIQLSDSLVPWEV
                     VHSVVMRATPEEFQCPICMEMPTAPRITECGHVYCLPCILQYMSRQKVAGAQRKCPMC
                     HDLLTPYTLRPCVLQPVQPRRVGAQARFDLFKRHRNSCVLRRSDDPFLAAPPPPSSAK
                     AVAIQLPAYMEPMSCQSRYVMTTPQYEAGQRYADCASISERVRELGQLAQPLSESDAE
                     VERFLLEALNEVTKEPKGLPPSMLRNSPPMAPRPVTTPEGEGDYLELYADGEGQPYYL
                     HMLTVKMLKHDAKLRSAALPDTVTAVIEEVVTMEQTEETRRIYKVFSHVPLHGMIKLC
                     VVNVDHLVLPETRAAFAAALQRMASDRAQRRHRDDRAASEDASWKQYLMRYSNRSGDC
                     LGFSPDTAPSDFSIDTESLPYLKLPSTGSAGSDHGLPPNTLDTRQRATKRQDMQSLLV
                     DSAVEPLSRGDTATAKTSSTMAAGCWAQGSAAKLFAKAERKEATTSTWGGHVFSPK"
     gene            <561201..>562640
                     /locus_tag="LMJF_08_1250"
                     /db_xref="GeneID:5649413"
     mRNA            <561201..>562640
                     /locus_tag="LMJF_08_1250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681106.1"
                     /db_xref="GeneID:5649413"
     CDS             561201..562640
                     /locus_tag="LMJF_08_1250"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681158.1"
                     /db_xref="GeneID:5649413"
                     /db_xref="UniProtKB/TrEMBL:Q4QI40"
                     /translation="MPPRWFHVPGSGARDAQRPPEGLVTSTHLSSSLLLQRSSLLDHG
                     GTADASAHELGCGGRDADGSCWGIVGPSPATQPQQPFAPRGGAGTCDTRSLGSLLRHP
                     DLRPTRDTSADDTSSTEVSRLLRHYRDENARLREQLKAKELHEAHIMARLEETSHRCA
                     HLQLAWQRASGDTPSLLLESAGEKPGAVQSVGSHGGEAEETVQSRLAQKEAEVRELQG
                     RVEAYREALQRSRAHAALSAEEWRAAPAPATCTAGNSTAVSVSPTSLHVLLLQSLNTA
                     DYLVKVFNALQHCHCTRHGDAHGSASDCCRRSLHDCKVRCLQAAVKGAPISSELLELE
                     GGPENDTAAANMETAVAVREELLYCEAVAVRLAASLLSREKSADDDAAPPATTKAAAA
                     APPEKAASLPPLSALGSLTALGVAEPVAVAKAAAAETHDDGDDEDAGEGERSTEENGH
                     ATVSYVAAAREPRRRPSRCRPDVGDCEVQ"
     gene            <563913..>564212
                     /locus_tag="LMJF_08_1260"
                     /db_xref="GeneID:5649414"
     mRNA            <563913..>564212
                     /locus_tag="LMJF_08_1260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681107.1"
                     /db_xref="GeneID:5649414"
     CDS             563913..564212
                     /locus_tag="LMJF_08_1260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681159.1"
                     /db_xref="GeneID:5649414"
                     /db_xref="UniProtKB/TrEMBL:Q4QI39"
                     /translation="MSQQLSFHDVSNDAIQHMQASEALQKHLENAQLAHRVCVAKALK
                     ANEPPVEKCALTWGEVVMRYNQWSEYRPAFHDSDAQKRYSKYWTKKRQAADDSHP"
     gene            <565620..>566927
                     /locus_tag="LMJF_08_1265"
                     /db_xref="GeneID:12982582"
     mRNA            <565620..>566927
                     /locus_tag="LMJF_08_1265"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721732.1"
                     /db_xref="GeneID:12982582"
     CDS             565620..566927
                     /locus_tag="LMJF_08_1265"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721780.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.1265"
                     /db_xref="EnsemblGenomes-Tr:1"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.1265"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982582"
                     /db_xref="UniProtKB/TrEMBL:E9ACQ6"
                     /translation="MPLPLTSLARASASPCAVAGSTTTGTAVAAGSSSGADCYVIVWV
                     EGRERPVYACTAPLPSSGPSASLPSAASAGAAAVPAVNVVTLRRFFAALVLLSSPPPT
                     ARARAGGHCEALSCAASFTQETAPVLRATLPLGLVGAFGASPPYYYVAVLAPSTAAVV
                     GNQLLAWLASSVLAALHPDSWATAVSPTGQARGTALLSLAADAPDLCSQLALYGAAEV
                     GRARAGAAAMEDYGVREVLADSAGQSSLAAVLQEFEPCRDSPVAVAISTLLGRCWVPF
                     AVSPATTAASLHISLAGYFTLPLPSCLRASSSAASPLVPTLYACSAGCWEALRLLASF
                     CSRRTPDLQQTSSVDAAPLAVLPLCGSSSCSSGGAVALIAASVGYVHPDTALYQAVLV
                     HGERPSRGGAVNCAAPYVHYLTTSEVAACGTPWHPDALRSVWA"
     gene            <567334..>568194
                     /locus_tag="LMJF_08_1270"
                     /db_xref="GeneID:5649415"
     mRNA            <567334..>568194
                     /locus_tag="LMJF_08_1270"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681108.1"
                     /db_xref="GeneID:5649415"
     CDS             567334..568194
                     /locus_tag="LMJF_08_1270"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681160.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.1270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.1270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649415"
                     /db_xref="GOA:Q4QI38"
                     /db_xref="InterPro:IPR003198"
                     /db_xref="UniProtKB/TrEMBL:Q4QI38"
                     /translation="MTKLTVVCRAVSSALEKQTCELTCIERQTISLETMRKQHKTYVQ
                     VFKEMIEDGYDIELIELPALSELPDSMFVEDVSMIYNTCAVITRPGAPSRRPEVDPIL
                     DTVTTLRQENYRIREPGTVDGGDVLYVANSKYVFVGKSTRSNDSGYEQMKEYLGKHGL
                     ECVRCVVKQCLHLKCAVTFLSENTLLLNPEWVDLEIFTSRGFKVVEVDSDEPAGANVL
                     SFSAEKNGKPLRTIVTAAEFPRTALRIEAFAAEETAQGRPTRQVVLEADEIAKAEGSL
                     TCCSLLSYSA"
     gene            <571500..>574058
                     /locus_tag="LMJF_08_1280"
                     /db_xref="GeneID:5649416"
     mRNA            <571500..>574058
                     /locus_tag="LMJF_08_1280"
                     /product="putative protein kinase"
                     /transcript_id="XM_001681109.1"
                     /db_xref="GeneID:5649416"
     CDS             571500..574058
                     /locus_tag="LMJF_08_1280"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001681161.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.08.1280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.08.1280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649416"
                     /db_xref="GOA:Q4QI37"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4QI37"
                     /translation="MRDAAATERERLPSPADGDVDSLYEDGTEAETAKQRSTVSTTTL
                     LLALPWLGCTLFLVAVLLYVNVHAFSIGNRLVSMPDGVVADVSVQHRDMARYTVLFVS
                     LALLAVHLAISFCLFRRAYHVLWDVQMSLVELSFMVDVIRTHQHSTFFFVDCVERAQR
                     VRESMRYWVKEFSGFKEICAAEMAVNQVTLRLMTRPRESAQRLESPGDTQLPCTGSGT
                     SSPVQLARSGRLPPDTAAAAFRLPQDAAWSPHAQSVRTDSAHADPGPGRQLAGHHSGS
                     RHSLSFTTEIGVAQVPFEVTLKRRHVALLLLSFLTYRELVRAEAEEARQISRDFIAAV
                     NMCAQRYKACIVELYSDRAILSWNAFFESAGNYAQTCAQCGECFHDRFVRRFPPESGA
                     YFSTAGYTGHIVCGTTTEKSLLLHGQPVSMLRGLPTLLEMRYCAYVWLGTPPPACTSS
                     PLSWTRIGAVQAGANFSVDLHAMRRTSAEPLPAAMVWHMPQWTIFGDERAVRAEVLTN
                     AGAARLQQGGGDTAPVTPTSTAAATGVANALPSSPFLSSSLSLRGVGTPYETFYDRSH
                     NRYQLSNTVLGESKSCVVRLAISETGNFVAVKEIKIERGDVKPIRRRRYQRENRIIVT
                     RGEKPQWMNEVEIMERHRHTCIVAYISFVEAEEKLRIVMEYVGGGNLLKFASSSRGAE
                     GEGPPMAVLLRNVVEGLKFLHQKGIVHGDIKPQNVLVPDSGPCKIADFGISRRATTTV
                     TSAIEGTPFYMSPEATRGEVTAACDIWSFGIMMAQVLTGRLPYDASVRDYYLVSQFMC
                     NKDVKRELHTPLKKPALDVFLACTQYDPAKRKTAKDLLKMPYFIAHAATSTDDA"
CONTIG      join(FR796404.1:1..574960)
//
DBGET integrated database retrieval system