GenomeNet

Database: RefSeq
Entry: NC_007250
LinkDB: NC_007250
Original site: NC_007250 
LOCUS       NC_007250             573434 bp    DNA     linear   CON 18-JUN-2017
DEFINITION  Leishmania major strain Friedlin complete genome, chromosome 9.
ACCESSION   NC_007250 CT005248
VERSION     NC_007250.2
DBLINK      BioProject: PRJNA15564
            BioSample: SAMEA3138173
            Assembly: GCF_000002725.2
KEYWORDS    RefSeq; complete genome.
SOURCE      Leishmania major strain Friedlin
  ORGANISM  Leishmania major strain Friedlin
            Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae;
            Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Rogers,M.B., Hilley,J.D., Dickens,N.J., Wilkes,J., Bates,P.A.,
            Depledge,D.P., Harris,D., Her,Y., Herzyk,P., Imamura,H., Otto,T.D.,
            Sanders,M., Seeger,K., Dujardin,J.C., Berriman,M., Smith,D.F.,
            Hertz-Fowler,C. and Mottram,J.C.
  TITLE     Chromosome and gene copy number variation allow major structural
            change between species and strains of Leishmania
  JOURNAL   Genome Res. 21 (12), 2129-2142 (2011)
   PUBMED   22038252
REFERENCE   2
  AUTHORS   Ivens,A.C., Peacock,C.S., Worthey,E.A., Murphy,L., Aggarwal,G.,
            Berriman,M., Sisk,E., Rajandream,M.A., Adlem,E., Aert,R.,
            Anupama,A., Apostolou,Z., Attipoe,P., Bason,N., Bauser,C., Beck,A.,
            Beverley,S.M., Bianchettin,G., Borzym,K., Bothe,G., Bruschi,C.V.,
            Collins,M., Cadag,E., Ciarloni,L., Clayton,C., Coulson,R.M.,
            Cronin,A., Cruz,A.K., Davies,R.M., De Gaudenzi,J., Dobson,D.E.,
            Duesterhoeft,A., Fazelina,G., Fosker,N., Frasch,A.C., Fraser,A.,
            Fuchs,M., Gabel,C., Goble,A., Goffeau,A., Harris,D.,
            Hertz-Fowler,C., Hilbert,H., Horn,D., Huang,Y., Klages,S.,
            Knights,A., Kube,M., Larke,N., Litvin,L., Lord,A., Louie,T.,
            Marra,M., Masuy,D., Matthews,K., Michaeli,S., Mottram,J.C.,
            Muller-Auer,S., Munden,H., Nelson,S., Norbertczak,H., Oliver,K.,
            O'neil,S., Pentony,M., Pohl,T.M., Price,C., Purnelle,B.,
            Quail,M.A., Rabbinowitsch,E., Reinhardt,R., Rieger,M., Rinta,J.,
            Robben,J., Robertson,L., Ruiz,J.C., Rutter,S., Saunders,D.,
            Schafer,M., Schein,J., Schwartz,D.C., Seeger,K., Seyler,A.,
            Sharp,S., Shin,H., Sivam,D., Squares,R., Squares,S., Tosato,V.,
            Vogt,C., Volckaert,G., Wambutt,R., Warren,T., Wedler,H.,
            Woodward,J., Zhou,S., Zimmermann,W., Smith,D.F., Blackwell,J.M.,
            Stuart,K.D., Barrell,B. and Myler,P.J.
  TITLE     The genome of the kinetoplastid parasite, Leishmania major
  JOURNAL   Science 309 (5733), 436-442 (2005)
   PUBMED   16020728
REFERENCE   3  (bases 1 to 573434)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 573434)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire, CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR796405.
            On Jun 1, 2012 this sequence version replaced NC_007250.1.
            Data release policy www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..573434
                     /organism="Leishmania major strain Friedlin"
                     /mol_type="genomic DNA"
                     /strain="Friedlin"
                     /db_xref="taxon:347515"
                     /chromosome="9"
     gene            <2509..>2943
                     /locus_tag="LMJF_09_0003"
                     /db_xref="GeneID:5649597"
     mRNA            <2509..>2943
                     /locus_tag="LMJF_09_0003"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681110.1"
                     /db_xref="GeneID:5649597"
     CDS             2509..2943
                     /locus_tag="LMJF_09_0003"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681162.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0003"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0003"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649597"
                     /db_xref="UniProtKB/TrEMBL:Q4QI36"
                     /translation="MGKESTVPTGCGAVNREVVLERMLVEEVAKRDDAERAAEELRKQ
                     MQLLKAEALDLRQARDLTKGSVLCTAAAHEGTAVSTVRDAECAESRESALKGENHRLR
                     QLVKRQNALIDVLRRQKVLLEASAAINISVRDFDKQLEIHKV"
     gene            <3541..>4662
                     /locus_tag="LMJF_09_0005"
                     /db_xref="GeneID:5649423"
     mRNA            <3541..>4662
                     /locus_tag="LMJF_09_0005"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681111.1"
                     /db_xref="GeneID:5649423"
     CDS             3541..4662
                     /locus_tag="LMJF_09_0005"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681163.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0005"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0005"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649423"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4QI35"
                     /translation="MTCVTGDDTGVVKIWDISKSSGATLKFSFGEQSRKRAIMGMCWQ
                     DSSTSSVAFSSSNGVLSVLDINDYVVSSSVKANTVAGLPNAMSFVKGKLVVVSKDGEA
                     SIFSSDLTSSSCFSGNGPIDAVHIHRKFGMVAMGGRENDLCVYDLASDSLEEPVFKAR
                     NVRDHILDVPFPVFVTGACIVNPYVFATCTAYHQVRFYDRRSNDRPVQEFEISREIER
                     RPTTMLQWNANKFLIGEASGDVHLYDTRRGFCSRAKLRGGVGSVRCMCKHPAGHQILG
                     VTGLDRKARLYHVPTGKLLMSVYVKQKANCVLLDKQLPMRDRVAVFSGVVNTKQPEKA
                     NTLGDALWDDMDPVLDDLDEKAMVADTVAENRRKVQRKE"
     gene            <5138..>5641
                     /locus_tag="LMJF_09_0010"
                     /db_xref="GeneID:5649424"
     mRNA            <5138..>5641
                     /locus_tag="LMJF_09_0010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681112.1"
                     /db_xref="GeneID:5649424"
     CDS             5138..5641
                     /locus_tag="LMJF_09_0010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681164.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649424"
                     /db_xref="UniProtKB/TrEMBL:Q4QI34"
                     /translation="MLYSLFSPFPSSVVCTCCWLISPIVFVTRSKLKCSIVSSIQLRC
                     LPDLFLPRHIFVLHRKMASCRTGRLPMPDDPLFNSTHMHGLRHSSRLAGLGMIAVIWI
                     MYEKLRHSHHYITYKGPENPFARIRHRRFPGGAFMFGWGNNGLNRDCGIKEFECWAGY
                     TGKEYTY"
     gene            <6874..>8733
                     /locus_tag="LMJF_09_0020"
                     /db_xref="GeneID:5649418"
     mRNA            <6874..>8733
                     /locus_tag="LMJF_09_0020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681113.1"
                     /db_xref="GeneID:5649418"
     CDS             6874..8733
                     /locus_tag="LMJF_09_0020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681165.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649418"
                     /db_xref="UniProtKB/TrEMBL:Q4QI33"
                     /translation="MDPKEFVQRFPKSALSAKLVLSLEITEQRDFVVSLIDDAVYCDS
                     WEAYFDFAERNNVAITEDVALAAVQAVGLDPLSAPLWVRAAACCESVESRKSLYEFGL
                     SVPLHGWQRLFEEYRRCTDGHEDDHVLSETECWCVSNVLTAEKWPDRYAKLDTDTEAE
                     NVRQAWLELFACMLAGLASTAIARDLQLRRMELAMRQMCTQLPGDDSCWYQLALFQLC
                     ILEDAEAARKTVACGIAAAGSSFALENIASVADGVVGVSDSSGTSSADVLSATKALMQ
                     QRRAAEELALDGVTKDRVRALRSVGKAAAQQGLGDWKIFSQWRCAEDMAAHDTKMAAK
                     VLENGMICCSHSPADALLLGSEAAQYHLLQRHEREALGYAEQQIEQQAELHHRGKILA
                     SWNSLVRIENLLGLSFSKAAKRRAELFPQNRISTFMENCRVGDYLPCDKSTFQWARFV
                     EDYQVDKASVEETPFHGIAPPRNEAVAVKRLQQVECETPDDSQWEPFVPPLSCLPSRE
                     EENPDDVTGVRELRGKLVYRVKMDARTAARCQREKATRQRSMTGEKAVERGGALGALV
                     RRVRPVNLTVGQTKRLQSVSADWVVHVLTVSELDLERTLKERAERQESHDMSV"
     gene            <9177..>10142
                     /locus_tag="LMJF_09_0030"
                     /db_xref="GeneID:5649419"
     mRNA            <9177..>10142
                     /locus_tag="LMJF_09_0030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681114.1"
                     /db_xref="GeneID:5649419"
     CDS             9177..10142
                     /locus_tag="LMJF_09_0030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681166.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649419"
                     /db_xref="GOA:Q4QI32"
                     /db_xref="InterPro:IPR008733"
                     /db_xref="UniProtKB/TrEMBL:Q4QI32"
                     /translation="MMAQEVVTGEALRVLGRNPFEGITTKTRLRQLLQTHQGRDKLFK
                     VVQYLLRIRLWWNSVDFNVNYVPGENFSRMEKNLMTIVNSRRMFRLGRFFGEFVRMRV
                     TLIKASELVYIPVNGGQWVALFIQCQMLLDMLARGLLFVKSFLEDVAFLVQKGFFHSN
                     VAGRLIYVATRCGLPVLTIDLFLNTLRLYQGILDASATKSSNEIMFSKDSFSLLSKYD
                     RVDKLRRKLASTTDEEKLKEVIKDQQRAANDTNDENVVYVESYAQLLWTDFELHWICV
                     TEAKLLLDIFVALSGLRGWKLQGAVSTAGLFSGLCSVYRVWTYGR"
     gene            <10833..>11582
                     /gene="GPI12"
                     /locus_tag="LMJF_09_0040"
                     /db_xref="GeneID:5649420"
     mRNA            <10833..>11582
                     /gene="GPI12"
                     /locus_tag="LMJF_09_0040"
                     /product="N-acetyl-D-
                     acetylglucosaminylphosphatidylinositoldeacetylase"
                     /transcript_id="XM_001681115.1"
                     /db_xref="GeneID:5649420"
     CDS             10833..11582
                     /gene="GPI12"
                     /locus_tag="LMJF_09_0040"
                     /EC_number="3.5.1.89"
                     /codon_start=1
                     /product="N-acetyl-D-
                     acetylglucosaminylphosphatidylinositoldeacetylase"
                     /protein_id="XP_001681167.1"
                     /db_xref="GeneID:5649420"
                     /db_xref="GOA:Q8I8A4"
                     /db_xref="InterPro:IPR003737"
                     /db_xref="InterPro:IPR024078"
                     /db_xref="UniProtKB/TrEMBL:Q8I8A4"
                     /translation="MHSITVVCISVVLALLLLLWMKISNLAGTSVRSDVLFVFAHPDD
                     EAMFFTPLLHSLRTQRVTVHFLCLSNGNYAGMGKEREKELYASGAFFGVQRRNIRVVD
                     HADLQDGMCNIWSPLLIRREIESYMQKAGNISTIVTFDKYGVSGHPNHIAVHNGVREL
                     KENMPPGILHLQLRTRSLLWKYVGLLAVLPYALWSSTCVSRASFVAVIPPASVWESMA
                     AMRKHAGQLVWFRYLFVIFSSYTYVNEIEEL"
     gene            <13358..>14131
                     /locus_tag="LMJF_09_0050"
                     /db_xref="GeneID:5649421"
     mRNA            <13358..>14131
                     /locus_tag="LMJF_09_0050"
                     /product="putative endonuclease III"
                     /transcript_id="XM_001681116.1"
                     /db_xref="GeneID:5649421"
     CDS             13358..14131
                     /locus_tag="LMJF_09_0050"
                     /EC_number="4.2.99.18"
                     /codon_start=1
                     /product="putative endonuclease III"
                     /protein_id="XP_001681168.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649421"
                     /db_xref="GOA:Q4QI30"
                     /db_xref="InterPro:IPR000445"
                     /db_xref="InterPro:IPR003265"
                     /db_xref="InterPro:IPR003583"
                     /db_xref="InterPro:IPR003651"
                     /db_xref="InterPro:IPR004035"
                     /db_xref="InterPro:IPR005759"
                     /db_xref="InterPro:IPR011257"
                     /db_xref="InterPro:IPR023170"
                     /db_xref="UniProtKB/TrEMBL:Q4QI30"
                     /translation="MNKRSFTPPSNWAQLFARLEDYRKHLKAPVDTMGCHRLRDETAP
                     KEVQRFHTLVALMLSAQTKDVVTAAAMDTLIKRELTVQSVHAMTETELDKHICKVGFH
                     NTKARNIKEVAAILMKNYDGKVPREYAELIALPGVGPKMANLFFQDADHRVIGIGVDT
                     HVHRISQRYRWVPSTVKTPEDTRKALESWLPREHWGTINSLMVGLGQTVCTPLRPKCD
                     ICELSDICPNAFKERRQKRLRAKAPLMEKEEPVSHRKRR"
     gene            <14792..>15187
                     /locus_tag="LMJF_09_0060"
                     /db_xref="GeneID:5649422"
     mRNA            <14792..>15187
                     /locus_tag="LMJF_09_0060"
                     /product="putative RNA-binding protein 5"
                     /transcript_id="XM_001681117.1"
                     /db_xref="GeneID:5649422"
     CDS             14792..15187
                     /locus_tag="LMJF_09_0060"
                     /codon_start=1
                     /product="putative RNA-binding protein 5"
                     /protein_id="XP_001681169.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649422"
                     /db_xref="GOA:Q4QI29"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4QI29"
                     /translation="MSYPSPFTRNVYIASLPEDYSEKDLLDLFSPFGRVISCTLKYNK
                     ETGLCKGYGFVLFESEQDALNAVIALQGHTVRNTRVQVRLARPEASAKKMYPVMMQQQ
                     LMSACMPYQPVYVMYVPSPVYSPMPLVQG"
     gene            <17249..>20953
                     /locus_tag="LMJF_09_0070"
                     /db_xref="GeneID:5649425"
     mRNA            <17249..>20953
                     /locus_tag="LMJF_09_0070"
                     /product="putative RNA helicase"
                     /transcript_id="XM_001681118.1"
                     /db_xref="GeneID:5649425"
     CDS             17249..20953
                     /locus_tag="LMJF_09_0070"
                     /codon_start=1
                     /product="putative RNA helicase"
                     /protein_id="XP_001681170.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649425"
                     /db_xref="GOA:Q4QI28"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR006575"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QI28"
                     /translation="MPSEILQRLYEGLGFPRDLVTQYLTDLAQAAEVPTFSDVTELLD
                     EAGPFQSFLVRSCFELFNCMTWFSREESDDKVSPEEGDAILENEIGTIESLFSDSFLG
                     RKHFDDDDTSDRELYFGFRTAYEKQLLVVVRFPDYYPTETPAIYVQSLRRISPESLPS
                     LVVAPSCTKDISAVDRRAIMDAAVQAINGFVGGGCLMALISAIHGAVSSMKEVRPVSS
                     TAPLDRDAAAKERSAMQQQRKAFLGALTGNRVANKKDTEEAAEDEEDRFIQVSMPEKV
                     ELATVDAASVGRETQRRDFLVSDTALDVTLKSSWDKLKTEGSLRKARDSLPAHTVRET
                     LRAALQKHNAVVIGGETGSGKTTQIPQFLYEFMCEEGHGSSANIVCTQPRRLAATSVA
                     LRVAEERDEAVGGTVGYSIRLENCVSKKTQITYCTTGIVLRRLQTDKYLGRVSHVVVD
                     EIHERGVDTDFLLILLRDLVRRRQDLKVVLMSATMDSELFARYFDGAPVISIAGRTFP
                     VKVMHLEQIIPEVNYTLEEGSPFEKISGDRETRRRNTRKNVLNLDLEDVEEDVEREKA
                     QHRLAEVVRASPKTLDTLARMNYDVINYELIEYIVEYIDTALRAPGAVLVFLPGMAEI
                     QRCLEQLKLNPRLAKSCLFYNLHSSLGSSEQQGVFRRPPAGKRKVILGTNIMETSITI
                     DDAVYVIDTGKAKENRYNARKSLSELVTVNISKANCRQRQGRAGRVQEGFCFRLFTEA
                     QFEAFDDHQLCEMHRVPLESLILQIYALHLGDEVEYLQKALTPPEERAIHSSVKVLTT
                     LGALTVEKRLTSLGQHLANLPLDVRVGKMIIHGALLQCIDPVLTMAACLATRSPFIAS
                     VDFRTEVENMRRAFAGETLSDQLSSWFAYNKWASVLQQKGSGAARKACEDYYLSPATL
                     KQIESTKRQYERYLYEAGFLDNAPRSHMSPSKFIFPPFTTLDDRVFEAGGQHFNENST
                     STRCILACLVAGLYPNVAQMRMPRGSRSVGGGNYGGRHTVKFTTFDGSECLVHPSSVA
                     SKETSFASPLLVYVDKVKTSATFLREVSVVAPLHVILFGSGNLEYLAKYEELCVDEMT
                     AFKCRQEDAALLTHLKRQLDSALTQKINDPSKTWESISSVVVRAIVKLLKEDGARAGG
                     LTIIDRRQPRELLTEPLVPEAAAAQPVIPENQPFKTNKSCFLCGETGHVSRYCPHNST
                     HHKGGPPVRCFICGQWHFPQDCTLVKALKR"
     gene            <22420..>23157
                     /locus_tag="LMJF_09_0080"
                     /db_xref="GeneID:5649426"
     mRNA            <22420..>23157
                     /locus_tag="LMJF_09_0080"
                     /product="RNA-binding protein 5-like protein"
                     /transcript_id="XM_001681119.1"
                     /db_xref="GeneID:5649426"
     CDS             22420..23157
                     /locus_tag="LMJF_09_0080"
                     /codon_start=1
                     /product="RNA-binding protein 5-like protein"
                     /protein_id="XP_001681171.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649426"
                     /db_xref="GOA:Q4QI27"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4QI27"
                     /translation="MMHPRPAAQSVNEDTLKQSRNVYVASLPLSFDDQQLQDLFSPYG
                     RIVSARIMRAKKSHASKGYGFVMFREVSSAEKAIEGLHGRVVDGSRIQVRRANADASM
                     TFSKVLHTPVCPRSTPSTQTNSTTCVLQCTIPDAPAQHVMCSTALPQAATSLYAAQPS
                     TSPYAIVAPRAYQSQNPTPVSINPSYGAIMNSHVLQEQNGGISATYFSHVQPHQVSMQ
                     AVQQQQPVYVVLLPNGQHLVQPNQFSM"
     gene            <34174..>35070
                     /locus_tag="LMJF_09_0090"
                     /db_xref="GeneID:5649427"
     mRNA            <34174..>35070
                     /locus_tag="LMJF_09_0090"
                     /product="RNA-binding protein 5-like protein"
                     /transcript_id="XM_001681120.1"
                     /db_xref="GeneID:5649427"
     CDS             34174..35070
                     /locus_tag="LMJF_09_0090"
                     /codon_start=1
                     /product="RNA-binding protein 5-like protein"
                     /protein_id="XP_001681172.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649427"
                     /db_xref="GOA:Q4QI26"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4QI26"
                     /translation="MTLNFDILAGNNADWGFDCLPTAPERSPAPALFTPFGVTAGTES
                     DLMASALQAPAPRVMSGSLQTVPQSVPLSDYSENVSPMKSDSLNMSVQASDPAARAYD
                     SNLYVASLPEWFTDADLHELFKRFGPIVSAKVMCHKGTHHCKGYGFVLFQRTDDAAVA
                     RSEMIGHVVGGNKIQVRRARSAASAPLTEAASAVSGTFTESSGSTRTSSSNVTPINYS
                     VHVVPSQQPSFNPLYPATTALTPTYVLTNPSAPVQNATHTQPAMLVAVPNGRTMVQGA
                     GDVMYMVLASSAQQMQSTSAIY"
     gene            <47627..>49375
                     /locus_tag="LMJF_09_0100"
                     /db_xref="GeneID:5649428"
     mRNA            <47627..>49375
                     /locus_tag="LMJF_09_0100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681121.1"
                     /db_xref="GeneID:5649428"
     CDS             47627..49375
                     /locus_tag="LMJF_09_0100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681173.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649428"
                     /db_xref="GOA:Q4QI25"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:Q4QI25"
                     /translation="MFIVQVAADIFGNKLNFELGFPSRPSLQEITRVSESAFSTEIAN
                     TRPDNVPQHTFHISKIKVYDEDKSKWVDLLGEGQLTDYCQLYAFQPENPWHKETQKPI
                     PPATKPPAATAALSRSATVSNTPSGSRAVASTSNALAPYTGGRSEPATLRRSYAAGAS
                     STALVPRSNAEASPEEKLRVVFSEFDNKGTRMIDVDDFKQGFHNMGLDFSSATVEDLF
                     ERADLNHDHRISYAEFERFARLYPIMTDCLYFRSKAFWEEDQMRKEIQSEVEAAHKSE
                     ATLDQAQRSLENAEADVADAQSAVKAADDDLRDRTDRMRDLAKDMEEARKGKERVMRE
                     KKEREQDLGAIREREKDARKDLQDLARDSDKLDRRAAALVSDADAADDKVRQLQKALE
                     DAKRTADRAHQAAEQAALEADQAKERERDAAMEADAIAREIPKAEDAVRMADRNVVAA
                     DQVLRELDSAGKDIGRQADEAASRRDAGEKAVAEARDKVMQKVRELDAARNAVAEKDR
                     AIKQKEAELDEHRRQRELITQHERTLIEQELRLREQRDSLEQRETKLMSEASNYLGNM
                     RINLATRSYSRDPGGY"
     gene            <51799..>52464
                     /locus_tag="LMJF_09_0105"
                     /db_xref="GeneID:5649429"
     mRNA            <51799..>52464
                     /locus_tag="LMJF_09_0105"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681122.1"
                     /db_xref="GeneID:5649429"
     CDS             51799..52464
                     /locus_tag="LMJF_09_0105"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681174.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0105"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0105"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649429"
                     /db_xref="UniProtKB/TrEMBL:Q4QI24"
                     /translation="MSALLSFPSRSSAAPLAMRGCRRTFTASAAAAISPSASSSTSAN
                     GRLLVGGAKAMERSGEVAMHNLYRRLLKAGEEGRMMQHCLTVNSLSDSVTYGLRLLRL
                     HRELTTVDATAQQTPWWRVAKRARQGLARRYYAWSLLALRLQLRSRNAIADVLVYLLF
                     VTMCFLLYEIYRACRIGVNRAEERYRTLSIPIIQTLDALEAAQARKRELRKEMEKDIV
                     QGR"
     gene            <53523..>55661
                     /locus_tag="LMJF_09_0110"
                     /db_xref="GeneID:5649430"
     mRNA            <53523..>55661
                     /locus_tag="LMJF_09_0110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681123.1"
                     /db_xref="GeneID:5649430"
     CDS             53523..55661
                     /locus_tag="LMJF_09_0110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681175.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649430"
                     /db_xref="UniProtKB/TrEMBL:Q4QI23"
                     /translation="MAEVRQQQSSRAVSDVVEYLHLAGRRYREHVELLRQEQAVRDAQ
                     HAPFKPEVSLYAERVGKNSLARQSSSIGARLHELHQKKLALLEEEAQEKAKRRAAAEA
                     QDCPFSPAITTRAAWSRRTGSDVAAALMQWGEQRRARQARAQVEATRNELSKVSAAPR
                     ITAYADEKARAERSGVSVEVSLTAEAEARRQRRHAAFEKAYPAASSSNSGATSARRFS
                     PSISAYASRIEFEEDVVSRLYERQGSRGHLVPRDRLYDEEVALYCTFHPKLSAQSAEL
                     SRRYYEEEGEAGTDPHERLFRNTHHTSKYRKPAQLSVFTGQPEISDASRRIVEERRRQ
                     LALDGQPGTLGLSPGSRLCPGTASFAAAQAPKTLKKKVLSARDTETQETPTFTPSVNP
                     ASEALWRQRVSALKASGVARNAEEARQLLWRKAAKRKEEEVLKLQDQRRRNEAAECTF
                     RPKAGRPPQRSSGYVAMPVEARAALWAQQRDRHLADLRTELSEITVEECTFRPHVDPV
                     FPLPCGDAKPAWGVEAFLERQAEARRQREEAEQWWRPKYARAPVAQTSRVSRWRSPSS
                     RVASHPSTQRTASASRRGAASSTASEAEDNEGEEEGVFEQHWARPPVSTSLTASSFSR
                     VSQQEVPSAESSPSYVAQQQPNTLFPYTVDISRRGPYPWRPTTAAGTSEAAAGEGGSR
                     ASASLSWRKPLRYRPISATATASRGRSSAS"
     gene            <56608..>59805
                     /locus_tag="LMJF_09_0120"
                     /db_xref="GeneID:5649431"
     mRNA            <56608..>59805
                     /locus_tag="LMJF_09_0120"
                     /product="putative kinesin"
                     /transcript_id="XM_001681124.1"
                     /db_xref="GeneID:5649431"
     CDS             56608..59805
                     /locus_tag="LMJF_09_0120"
                     /EC_number="3.6.4.4"
                     /codon_start=1
                     /product="putative kinesin"
                     /protein_id="XP_001681176.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649431"
                     /db_xref="GOA:Q4QI22"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q4QI22"
                     /translation="MTERIIVAVRVRPFLPHENEARCLEVSENQVAVGAGHPFVFDRV
                     FDETASSDDIYVALGQPLADSFLTGFHASTIAYGQTGSGKTFTMAALLHDTVQEVFCR
                     LTEDSEATLSTGRSSSALTSLSATLRTSPAFTMSLSVLEVYNESIGDLLAELVSQPPR
                     QHTATVLNGTVPQAVDAPRRPSAQGCGPLQNRRLLQRRAYGPTSPFPRNSLALREDPH
                     GGVYVVGLTEAQVRSEAEMLALIDSAIENRKTASTLKNSKSSRSHCVITLTLQRRGLC
                     SRCCFVDLAGFERLKSRGEAVPSGGPGDPASLVGASLPSCRTLSERMRECININSGLL
                     ALGNVIVALCERKPYVPYRSSKLTRLLQPMLSGNARTAIVACISQLASSMEETLNTLK
                     YADRAKRIHIHPHLAVAEVTTSADARQTILLLQEQLEDAQRRLAIAVPAGAGTRKPAR
                     SPSASLVQEVKHLRELLRQERQLTKRLENDVLNAECATMVEVEKRKALEVRVAQLKAA
                     SAADPKAEGAGCTEVSADGDTGKSASSLLNPRSCLAVDMTRLQQLEEEREALAALPAQ
                     KARDTVQLEAALVENGNCVADNLAATLTVNADDDSNVVTLAEDIVAQKDRVAQLQMEN
                     GDVSAQLVQREKLRRTLSNHAHPRGELRKTEVKLGKSEVALKQRKQVKEKLRTASGDR
                     LRRAREKSVDYRGRVKGSTQHVRVRQVDLESTRQLHEKLVVLQEEVFRQRLCARTTRK
                     ASWKLNDAHQQEVEQFQKQLQLMAIQTTSPNQRTNRRGAGIVKERGQLAGQQVQAQRP
                     QQEVPSPGRLCHLPPEKTLSSMPFSPSAKASPPSPALGKTSPHIIKVHKNSHASSSWP
                     GFHPHGLHSSIDGALQSSRDATQTTINCELQDLERIQKELVELLVYRRALLTAPAADA
                     SKWHRAKDGFARRLSQVQAALQSTEPGQREHTALLKEKNNVKEQLRQLQAFRHMFADP
                     AQQLAELDNRIEDLNRAHRLHTQRFCQLQRAVPKPRGNGGVVAAREKHQPSVRHMRTA
                     SARYAAAGTLALHTAVESSQGSNGNMREYVTGSKQ"
     gene            <62025..>63599
                     /locus_tag="LMJF_09_0140"
                     /db_xref="GeneID:5649432"
     mRNA            <62025..>63599
                     /locus_tag="LMJF_09_0140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681125.2"
                     /db_xref="GeneID:5649432"
     CDS             62025..63599
                     /locus_tag="LMJF_09_0140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681177.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649432"
                     /db_xref="GOA:Q4QI21"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="UniProtKB/TrEMBL:Q4QI21"
                     /translation="MSSHASPRHSREDTPVQRSFADEATAAADLFDLAAPPLQQPLVA
                     RLVPLYAGLPTLDLHQNSGNVVVGRGKDISEDYRINVSDKLSARHCELAVDPVTLRVE
                     LRDLSTNGTFLNGRRVAKGERVVLQNSDRVALTRPAESDAGGGQAPSSAVDDIAANGR
                     VDYMFQRLKQETTRARISAELTCSVCKSIFHRPCSVLPCMHVFCAGCISGWMAQGEQH
                     TCPKCRVSITDVRPTHRLQSCAENYLLASPASRRPVEELAQLDAADTIDPLGMRIGKR
                     SRSDTNDCDDDGKCGSHSDSGSDTVRAVRHAALIFGHAVPLAGPKCAECNTPSSIDGF
                     QCPAGGPHLRCSACRSCFAERPLCGRPQRCHVCHLAFCHLYRAGGCASTDGTSFQPFK
                     EHEPFSVLPPQTFSGNTIEQNILSDYLASHSILLKDVWSAALAKLEGGEWVPDMVLLN
                     GAIRADSPVCRRCAATVFAELLFAYRRHLASDKLPESVNKRPNCWYGKECRAQFHNEQ
                     HAHNYNHVCYQEKRKE"
     gene            <64489..>64893
                     /gene="ATG8C.1"
                     /locus_tag="LMJF_09_0150"
                     /db_xref="GeneID:5649433"
     mRNA            <64489..>64893
                     /gene="ATG8C.1"
                     /locus_tag="LMJF_09_0150"
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /transcript_id="XM_001681126.1"
                     /db_xref="GeneID:5649433"
     CDS             64489..64893
                     /gene="ATG8C.1"
                     /locus_tag="LMJF_09_0150"
                     /codon_start=1
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /protein_id="XP_001681178.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0150"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0154"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0158"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0162"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0166"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0154"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0158"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0162"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0166"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649433"
                     /db_xref="GOA:Q4QI18"
                     /db_xref="InterPro:IPR004241"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4QI18"
                     /translation="MSAYVLSTPLEARVAKCASLRAANAVPVVVEEAQARGGKAYFSA
                     LARETTVAQLVAAVRGFRGVDAKKPVALTVAGCSVSPSATLGELHDACRQADDGMLYV
                     AYTAERCMGAAVCTPCGSCAWDGSSADDDVII"
     gene            <65994..>66368
                     /gene="ATG8C.2"
                     /locus_tag="LMJF_09_0152"
                     /db_xref="GeneID:5649434"
     mRNA            <65994..>66368
                     /gene="ATG8C.2"
                     /locus_tag="LMJF_09_0152"
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /transcript_id="XM_001681127.1"
                     /db_xref="GeneID:5649434"
     CDS             65994..66368
                     /gene="ATG8C.2"
                     /locus_tag="LMJF_09_0152"
                     /codon_start=1
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /protein_id="XP_001681179.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0152"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0152"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649434"
                     /db_xref="GOA:Q4QI19"
                     /db_xref="InterPro:IPR004241"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4QI19"
                     /translation="MSAYVLSTPLEARVAKCASLRAANAVPVVVEEAQARGGKAYFSA
                     LVRETTVAQLVAAVRGFRGVDAKKPVALTVAGCSVSPSATLGELHDACRQADDGMLYV
                     AYTAERCMGAAVCTPCGSCSWN"
     gene            <67551..>67955
                     /gene="ATG8C.3"
                     /locus_tag="LMJF_09_0154"
                     /db_xref="GeneID:5649435"
     mRNA            <67551..>67955
                     /gene="ATG8C.3"
                     /locus_tag="LMJF_09_0154"
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /transcript_id="XM_001681128.1"
                     /db_xref="GeneID:5649435"
     CDS             67551..67955
                     /gene="ATG8C.3"
                     /locus_tag="LMJF_09_0154"
                     /codon_start=1
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /protein_id="XP_001681180.1"
                     /db_xref="GeneID:5649435"
                     /db_xref="GOA:Q4QI18"
                     /db_xref="InterPro:IPR004241"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4QI18"
                     /translation="MSAYVLSTPLEARVAKCASLRAANAVPVVVEEAQARGGKAYFSA
                     LARETTVAQLVAAVRGFRGVDAKKPVALTVAGCSVSPSATLGELHDACRQADDGMLYV
                     AYTAERCMGAAVCTPCGSCAWDGSSADDDVII"
     gene            <69011..>69385
                     /gene="ATG8C.4"
                     /locus_tag="LMJF_09_0156"
                     /db_xref="GeneID:5649436"
     mRNA            <69011..>69385
                     /gene="ATG8C.4"
                     /locus_tag="LMJF_09_0156"
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /transcript_id="XM_001681129.1"
                     /db_xref="GeneID:5649436"
     CDS             69011..69385
                     /gene="ATG8C.4"
                     /locus_tag="LMJF_09_0156"
                     /codon_start=1
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /protein_id="XP_001681181.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0156"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0160"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0172"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0156"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0172"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649436"
                     /db_xref="GOA:Q4QI15"
                     /db_xref="InterPro:IPR004241"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4QI15"
                     /translation="MSAYVLSTPLEARVAKCASLRAANAVPVVVEEAQARGGKAYFSA
                     LARETTVAQLVAAVRGFRGVDAKKPVALTVAGCSVSPSATLGELHDACRQADDGMLYV
                     AYTAERCMGAAVCMSCGSCALN"
     gene            <70568..>70972
                     /gene="ATG8C.5"
                     /locus_tag="LMJF_09_0158"
                     /db_xref="GeneID:5649437"
     mRNA            <70568..>70972
                     /gene="ATG8C.5"
                     /locus_tag="LMJF_09_0158"
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /transcript_id="XM_001681130.1"
                     /db_xref="GeneID:5649437"
     CDS             70568..70972
                     /gene="ATG8C.5"
                     /locus_tag="LMJF_09_0158"
                     /codon_start=1
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /protein_id="XP_001681182.1"
                     /db_xref="GeneID:5649437"
                     /db_xref="GOA:Q4QI18"
                     /db_xref="InterPro:IPR004241"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4QI18"
                     /translation="MSAYVLSTPLEARVAKCASLRAANAVPVVVEEAQARGGKAYFSA
                     LARETTVAQLVAAVRGFRGVDAKKPVALTVAGCSVSPSATLGELHDACRQADDGMLYV
                     AYTAERCMGAAVCTPCGSCAWDGSSADDDVII"
     gene            <72071..>72445
                     /gene="ATG8C.6"
                     /locus_tag="LMJF_09_0160"
                     /db_xref="GeneID:5649438"
     mRNA            <72071..>72445
                     /gene="ATG8C.6"
                     /locus_tag="LMJF_09_0160"
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /transcript_id="XM_001681131.1"
                     /db_xref="GeneID:5649438"
     CDS             72071..72445
                     /gene="ATG8C.6"
                     /locus_tag="LMJF_09_0160"
                     /codon_start=1
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /protein_id="XP_001681183.1"
                     /db_xref="GeneID:5649438"
                     /db_xref="GOA:Q4QI15"
                     /db_xref="InterPro:IPR004241"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4QI15"
                     /translation="MSAYVLSTPLEARVAKCASLRAANAVPVVVEEAQARGGKAYFSA
                     LARETTVAQLVAAVRGFRGVDAKKPVALTVAGCSVSPSATLGELHDACRQADDGMLYV
                     AYTAERCMGAAVCMSCGSCALN"
     gene            <73627..>74031
                     /gene="ATG8C.7"
                     /locus_tag="LMJF_09_0162"
                     /db_xref="GeneID:5649439"
     mRNA            <73627..>74031
                     /gene="ATG8C.7"
                     /locus_tag="LMJF_09_0162"
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /transcript_id="XM_001681132.1"
                     /db_xref="GeneID:5649439"
     CDS             73627..74031
                     /gene="ATG8C.7"
                     /locus_tag="LMJF_09_0162"
                     /codon_start=1
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /protein_id="XP_001681184.1"
                     /db_xref="GeneID:5649439"
                     /db_xref="GOA:Q4QI18"
                     /db_xref="InterPro:IPR004241"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4QI18"
                     /translation="MSAYVLSTPLEARVAKCASLRAANAVPVVVEEAQARGGKAYFSA
                     LARETTVAQLVAAVRGFRGVDAKKPVALTVAGCSVSPSATLGELHDACRQADDGMLYV
                     AYTAERCMGAAVCTPCGSCAWDGSSADDDVII"
     gene            <75132..>75506
                     /gene="ATG8C.8"
                     /locus_tag="LMJF_09_0164"
                     /db_xref="GeneID:5649440"
     mRNA            <75132..>75506
                     /gene="ATG8C.8"
                     /locus_tag="LMJF_09_0164"
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /transcript_id="XM_001681133.1"
                     /db_xref="GeneID:5649440"
     CDS             75132..75506
                     /gene="ATG8C.8"
                     /locus_tag="LMJF_09_0164"
                     /codon_start=1
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /protein_id="XP_001681185.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0164"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0164"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649440"
                     /db_xref="GOA:Q4QI13"
                     /db_xref="InterPro:IPR004241"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4QI13"
                     /translation="MSAYVLSTPLEARVAKCASLRAANAVPVVVEEAQARGGKAYFSA
                     LVRETTVAQLVAAVRGFRGVDAKKPVALTVAGCSVSPSATLGELHDTCRQADDGMLYV
                     AYTAERCMGTAVCTPCGSCSWN"
     gene            <76689..>77093
                     /gene="ATG8C.9"
                     /locus_tag="LMJF_09_0166"
                     /db_xref="GeneID:5649441"
     mRNA            <76689..>77093
                     /gene="ATG8C.9"
                     /locus_tag="LMJF_09_0166"
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /transcript_id="XM_001681134.1"
                     /db_xref="GeneID:5649441"
     CDS             76689..77093
                     /gene="ATG8C.9"
                     /locus_tag="LMJF_09_0166"
                     /codon_start=1
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /protein_id="XP_001681186.1"
                     /db_xref="GeneID:5649441"
                     /db_xref="GOA:Q4QI18"
                     /db_xref="InterPro:IPR004241"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4QI18"
                     /translation="MSAYVLSTPLEARVAKCASLRAANAVPVVVEEAQARGGKAYFSA
                     LARETTVAQLVAAVRGFRGVDAKKPVALTVAGCSVSPSATLGELHDACRQADDGMLYV
                     AYTAERCMGAAVCTPCGSCAWDGSSADDDVII"
     gene            <79751..>80155
                     /gene="ATG8C.10"
                     /locus_tag="LMJF_09_0170"
                     /db_xref="GeneID:5649442"
     mRNA            <79751..>80155
                     /gene="ATG8C.10"
                     /locus_tag="LMJF_09_0170"
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /transcript_id="XM_001681135.1"
                     /db_xref="GeneID:5649442"
     CDS             79751..80155
                     /gene="ATG8C.10"
                     /locus_tag="LMJF_09_0170"
                     /codon_start=1
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /protein_id="XP_001681187.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649442"
                     /db_xref="GOA:Q4QI11"
                     /db_xref="InterPro:IPR004241"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4QI11"
                     /translation="MSAYVLSTPLEARVAKCASLRAANAVPVVVEEAQARGGKAHFSA
                     LARETTVAQLVAAVRGFRGVDAKKPVALTVAGCSVSPSATLGELHDACRQADDGMLYV
                     AYTAERCMGAAVCTPCGSCAWDGSSADDDVII"
     gene            <81211..>81585
                     /gene="ATG8C.11"
                     /locus_tag="LMJF_09_0172"
                     /db_xref="GeneID:5649443"
     mRNA            <81211..>81585
                     /gene="ATG8C.11"
                     /locus_tag="LMJF_09_0172"
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /transcript_id="XM_001681136.1"
                     /db_xref="GeneID:5649443"
     CDS             81211..81585
                     /gene="ATG8C.11"
                     /locus_tag="LMJF_09_0172"
                     /codon_start=1
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /protein_id="XP_001681188.1"
                     /db_xref="GeneID:5649443"
                     /db_xref="GOA:Q4QI15"
                     /db_xref="InterPro:IPR004241"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4QI15"
                     /translation="MSAYVLSTPLEARVAKCASLRAANAVPVVVEEAQARGGKAYFSA
                     LARETTVAQLVAAVRGFRGVDAKKPVALTVAGCSVSPSATLGELHDACRQADDGMLYV
                     AYTAERCMGAAVCMSCGSCALN"
     gene            <82768..>83172
                     /gene="ATG8C.12"
                     /locus_tag="LMJF_09_0174"
                     /db_xref="GeneID:5649444"
     mRNA            <82768..>83172
                     /gene="ATG8C.12"
                     /locus_tag="LMJF_09_0174"
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /transcript_id="XM_001681137.1"
                     /db_xref="GeneID:5649444"
     CDS             82768..83172
                     /gene="ATG8C.12"
                     /locus_tag="LMJF_09_0174"
                     /codon_start=1
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /protein_id="XP_001681189.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0174"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0174"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649444"
                     /db_xref="GOA:Q4QI09"
                     /db_xref="InterPro:IPR004241"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4QI09"
                     /translation="MSAYVLSTPLEARVAKCASLRAANAVPVVVEEAQARGGKAYFSA
                     LARETTVAQLVAAVRGFRGVDAKKPVALTVAGCSVSPSATLGELHDACRQADDGMLYV
                     AYTAERCMGAAVCMPCDSCAWDGSSADDDVII"
     gene            <84273..>84641
                     /gene="ATG8C.13"
                     /locus_tag="LMJF_09_0180"
                     /db_xref="GeneID:5649445"
     mRNA            <84273..>84641
                     /gene="ATG8C.13"
                     /locus_tag="LMJF_09_0180"
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /transcript_id="XM_001681138.1"
                     /db_xref="GeneID:5649445"
     CDS             84273..84641
                     /gene="ATG8C.13"
                     /locus_tag="LMJF_09_0180"
                     /codon_start=1
                     /product="putative ATG8/AUT7/APG8/PAZ2"
                     /protein_id="XP_001681190.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649445"
                     /db_xref="GOA:Q4QI08"
                     /db_xref="InterPro:IPR004241"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4QI08"
                     /translation="MSAYVLSTPLEARVAKCASLRAANAVPVVVEEAQARGGKAYFSA
                     LARETTVAQLVAAVRGFRGVDAKKPVALTVAGCSVSPSATLGELHDACRQADDGMLYV
                     AYTAERCMGAAVCTPCGLCA"
     gene            <85673..>86035
                     /locus_tag="LMJF_09_0190"
                     /db_xref="GeneID:5649446"
     mRNA            <85673..>86035
                     /locus_tag="LMJF_09_0190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681139.1"
                     /db_xref="GeneID:5649446"
     CDS             85673..86035
                     /locus_tag="LMJF_09_0190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681191.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649446"
                     /db_xref="UniProtKB/TrEMBL:Q4QI07"
                     /translation="MSKHFAGRKDAERTTGLAYLLSPSRVRSPGELRFRRHGYLRCGF
                     VIGMVLYFVYCNPEYSYTYTALRQRCGWGTKESMFPQYLKLQPSRIPSSSTASEQQPP
                     PQSPSSLQSSAVGTEENV"
     gene            <86703..>88223
                     /locus_tag="LMJF_09_0200"
                     /db_xref="GeneID:5649447"
     mRNA            <86703..>88223
                     /locus_tag="LMJF_09_0200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681140.1"
                     /db_xref="GeneID:5649447"
     CDS             86703..88223
                     /locus_tag="LMJF_09_0200"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681192.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649447"
                     /db_xref="InterPro:IPR008551"
                     /db_xref="UniProtKB/TrEMBL:Q4QI06"
                     /translation="MCILAFITRHCERFPFILIGNRDEELARVTGGLTLDTSTGLVWA
                     LDRRAGGSWMGIEPRSGRFAILTNCRRSPAAPLTCSATARDEDQCGGSERGEPAQRTG
                     LSTAAAVWRGAAPLSHICAHTTVVPVAALPAVPATAKTAAEDNHCPQHSKQLQTVTLA
                     YDPPTSRGLVIKNFLQTGILPGDTAQTPIGCTRSEDAEAPLDKSAATRAALPAVLRVP
                     PYYAGFNLLSCDDLRRCGVDAVTSEHGRQVSGNTSAAAPEILYTTNRYAAEHRQPVAP
                     GQVHCLQNSYLDNMHGEPITARLGQLFTDALHRVIDPIAAEQPPSSTSGITPAIVTEV
                     ATALADECLCDRCNFDLPKMEKTALSAAEAAALHAQLHSNSPLLGFTEKELREYFGNS
                     AVGDGDDVSVRFCDGGAATREAYLQSSIFKVPFRGYGTRMQSMVLVERVAAVPSTLPN
                     VALSASTTTVIHFCQREVSVDVATQRVVAAPWIAYRILQDGSCLRDSAETPTSSCT"
     gene            <88721..>89638
                     /locus_tag="LMJF_09_0210"
                     /db_xref="GeneID:5649448"
     mRNA            <88721..>89638
                     /locus_tag="LMJF_09_0210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681141.1"
                     /db_xref="GeneID:5649448"
     CDS             88721..89638
                     /locus_tag="LMJF_09_0210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681193.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649448"
                     /db_xref="InterPro:IPR029358"
                     /db_xref="UniProtKB/TrEMBL:Q4QI05"
                     /translation="MFSPPVYLSVGDEYDKREGIAKATGQPPFVVSAKRNPHITDATF
                     DPFVSLSNGDPYTSVGFAGPFRANTSAGGKTEHGSSAAAPPPFRPVGASKKSSGKGDY
                     YGTFSEKAPIRHETEFPPIKTAADYKAETAAAKCNFIVNPPKKGTYGYTGLTIGQAGE
                     VQYVADPYEGNMRREALQRKYEATKRIGSPFRSAVRSGGCFDETKHGVSRVYGLTKPL
                     PPKRSPSSQQAISSAAAGRKPWVPGGALVPDLLKQPEYQEDPYDVKEQKVRAMRQKES
                     TYKPWIPAGNDPYRYIYTKPINYDPPAVV"
     gene            <91854..>94295
                     /locus_tag="LMJF_09_0220"
                     /db_xref="GeneID:5649449"
     mRNA            <91854..>94295
                     /locus_tag="LMJF_09_0220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681142.1"
                     /db_xref="GeneID:5649449"
     CDS             91854..94295
                     /locus_tag="LMJF_09_0220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681194.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649449"
                     /db_xref="InterPro:IPR018966"
                     /db_xref="UniProtKB/TrEMBL:Q4QI04"
                     /translation="MPYSKAWRSAMYPDFRDQGAYVDYKATKDILHRMKENIANPSTP
                     DELYASLLEQKMRVYEWCERKQAELLTLSLRLYECSKYLTEEEVVTNRSITLSSQPKS
                     AAKRLLPREARLIADAIMHELLRFVECRNLNTDTIEHIIGRMYRYAVLGPTGDRWKNI
                     YVEYDYDQISVEEVFCHLSRVYDRVKQTEERISAKGKLSIPTGAEGSQVFDRRSVKYW
                     VHLQDLPFVIARIVPHLPLSTFKDTYKESKEKGVSFRLFSPVSSVYYDNNKFLFYHRR
                     LERIEGSTLIRMRWYSDTYAEDWNALQEDDNVFMEIKVHHEAWSGERSNKRRFAIKEK
                     EVDAFVHAQLSLLPAVEKLKRRNASEAEQEAFKSLSTEILSKIHAYDLKPVLRTQCGR
                     AAFQRGADQRVRVSIDTDLRMSAEDFGLDHHWRYTGGDSPVSHFPYAVVEVKLQCSEN
                     ERIAPWIEELMGCRYMESVPKFSKYAHGIASLYGHTSFINMVPYWMHQLDIDIRASTK
                     PEVHLWDPTMGLAAGCLERTADRLIFGTNPAQTQTVGASEAQFLPRTDYAKIYQRVLR
                     SLQHEADGAAENSASASVAASTANSFTAADCIADGKADKRTKDAGQGAVQPSLFPVVQ
                     YSVDRRHMAYTTFHLYPYSEKGTEPLCYDPKDSKNAAAQVFYGKIPWQTGKRIKVPQK
                     YDPKTLLTSERYMVKWMQLATSFGLLGLTSIRFGKGLFLPRDVAHHSPLWQDNFHVVT
                     GVVMVSIALLTLAYAYIGFKARSRRVYARRKIRYDDVVGPTWLTFFVVVSFVVITMTH
                     IARRYGPMLTGSDSF"
     gene            <95577..>97091
                     /gene="HSLU"
                     /locus_tag="LMJF_09_0230"
                     /db_xref="GeneID:5649450"
     mRNA            <95577..>97091
                     /gene="HSLU"
                     /locus_tag="LMJF_09_0230"
                     /product="putative ATP-dependent hsl protease ATP-binding
                     subunit hslU"
                     /transcript_id="XM_001681143.1"
                     /db_xref="GeneID:5649450"
     CDS             95577..97091
                     /gene="HSLU"
                     /locus_tag="LMJF_09_0230"
                     /codon_start=1
                     /product="putative ATP-dependent hsl protease ATP-binding
                     subunit hslU"
                     /protein_id="XP_001681195.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649450"
                     /db_xref="GOA:Q4QI03"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR004491"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="InterPro:IPR019489"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QI03"
                     /translation="MFRFPTRLLFCVAAAASTPSPDVLQVTKETASKLDDLSPRAITK
                     ILDAYIVGQDAGKRAVAIALRNRWRRRQLRDADLRKEVVPKNMLLIGPTGVGKTEISR
                     RMARITNAPFIKVEATKYTEVGFKGKDVESIIEDLYTNAKLKARRALEAERHAEALNM
                     ALDTVYSAWSVSQRMRAMDRSLLSTGKAEEVTAAAADDSAAEAEESQQQQQQQHNFEY
                     FREHYLDEPITNDMVTIDINAPQAPTKPAKEGGIDLQSVGMLLGLGGEPKRLKVSVTK
                     RVADAVPLATQEALDKLIDEASVNTLARALAEEEGVVFVDEIDKVVAEPSSANADVSS
                     TGVQQDLLPLIEGSNVTMKDGSVIATDNILFICSGAFHVVKTSDMIAELQGRLPVRVE
                     LQALTEEDFRRILTEPKFNLLRQQEEMLKTEKIDVVFTEDGVNELAKVTCAVNSQGQN
                     IGARRLNTILERVMDPYSCNCEEYEGKRVEINAEMVREATEKLQKNVNLAKYLL"
     gene            <98817..>101663
                     /locus_tag="LMJF_09_0240"
                     /db_xref="GeneID:5649451"
     mRNA            <98817..>101663
                     /locus_tag="LMJF_09_0240"
                     /product="putative ubiqitin hydrolase"
                     /transcript_id="XM_001681144.1"
                     /db_xref="GeneID:5649451"
     CDS             98817..101663
                     /locus_tag="LMJF_09_0240"
                     /codon_start=1
                     /product="putative ubiqitin hydrolase"
                     /protein_id="XP_001681196.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649451"
                     /db_xref="GOA:Q4QI02"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:Q4QI02"
                     /translation="MHLRVLPRCRRTTTSYLLLIMSATAASSRRKQHYESLKEESMIP
                     FEMELDEAIELPFDVNAVAPTDVALSAPFGGKKIPMRAARAASESRVAWSNGSTASVG
                     FAVCGNGKELPSTAATADGVASPIATPANAAPTTYSAAAPSRMLTWKDTSASQRRAEA
                     QASRQDDFHPMVLCPLQNLGNTCYFNAGVQLLVNCPALVYAVRNSPFARWTRSNGPLT
                     AQAVPMPRAEAAPAATKLCLKGGAAIHTLFQEFSILLARMEMGCAAGERAISPICALD
                     SLAQAYPQFEGRSQQDAAEMMTSLLASLEEEGGQYVEVAQLLQSFEDAAALRQGVTPL
                     ASSPRASDPVTRALKGATSPLLEAETAPSASPHRRNYSEPCNIEEYSQSSLLSSTSED
                     TFLPGPRSAHFFNVLRLMERVNRENELLERRVKQRQGIAYTNSFKPPRLHFNPLLDGF
                     RGYTLSEVECHNCRAVSRVVSPFNGLLLDVPTAKQRRRYALAHPNVPRRVDFDGQLRQ
                     VKKPFRLTWWNPLSLCVAAWRQLKQFFQDPFPYPLWLDECLDIHFEPEVLRGCSRYRC
                     ESCDTTTDATKSETLLALPEYLLIYMKRFEAGRFFNSKKSDSVFFPTSWRPLTTTQAR
                     QSPINTDDAPPALPEYLDLRHYLHSSVAPFAEPIPPCLWGTDNEPHQQHHVSRDDAST
                     PTSSIATTYTLDGIVNHHGGYDGGHYTVFLYKATEERQAWVYISDDEVEQAEEVVATD
                     TEYVLLYRRQPLVQAAPESDEAEQLRRKACYYLSQSSPSCPAPNAAAATTDGPKASKP
                     HSSCPFSSSSAGGVASTPPHAATAATEPWVYISRMWLQRVAFMHEPGPIVNRLCYCRP
                     EDRGRVSMYQSIFPATVKVPAEVPHVHGPPVSWFYAPITQRDYDIFYNAFGGNLAVTA
                     SEYESLRAMQDKFCAAIDLAERQRGSAARPAPRH"
     gene            <102683..>105370
                     /locus_tag="LMJF_09_0250"
                     /db_xref="GeneID:5649452"
     mRNA            <102683..>105370
                     /locus_tag="LMJF_09_0250"
                     /product="putative minchromosome maintenance (MCM) complex
                     subunit"
                     /transcript_id="XM_001681145.1"
                     /db_xref="GeneID:5649452"
     CDS             102683..105370
                     /locus_tag="LMJF_09_0250"
                     /codon_start=1
                     /product="putative minchromosome maintenance (MCM) complex
                     subunit"
                     /protein_id="XP_001681197.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649452"
                     /db_xref="GOA:Q4QI01"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004039"
                     /db_xref="InterPro:IPR008047"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027925"
                     /db_xref="UniProtKB/TrEMBL:Q4QI01"
                     /translation="MQQRSEEYSYIWGTGIAMEVFRDEFRRYLETFALGQVVVDPSRR
                     TLPSSGGGAAAARSSVSDTAAAAAAEYALQEKYYLKELLRMHMQGRSTLEVDFTWLQR
                     VAPRLYVQTVHHPTECLQMMSAVADEVYRDVLLLRHGIEVAEDVLITVAAKKLPSMWT
                     LKQLSPQHIEQLLSIKGMVIRVSKIVPEIRVACFQCWNCQYQERSVSGDKGRIFEPTR
                     CAHCGKTYSFKLQHNLSLYEDKQLIKVQESPEHVADGETPISIGVVVYGSMVDAVVPG
                     DRVIVTGVYRSTPIRLNANTRIIKSIFATHIDAVHIELVRATRASEAGAKKGCFANGN
                     ATGTGLHVSTPTLATAKNAEGDLSSAVLMDTARLDMFHSLAHRPDIYDVLLHSFARTI
                     WGHDDVKRGILAQLFGGTAKTFVFSERIGSGAAATTSSNSAVFRSELNVLLCGDPGVA
                     KSQLLTQVHEIAPRGVYTSGKGSSSVGLTAFVVQDSDTGELVLEPGALVLSDRGLCCI
                     DEFDKMNEATRSVLHEVMEQQTLSIAKAGIIAQLNARTSILAAANPKDSQWNAQLNVV
                     ENLQIEPTLLSRFDLIFLLLDCHDSVEDRRLAAHVLSLYMDTSRSARTPRAVNSGSGA
                     AGRRVPPQGGCSDDDSGEEGEATQWRSTARAGQPTAAPDDATGTASTHVDAATGLPVE
                     VQMELHGEVFLQGPPDAPYMPASILSEYIALARETIFPKLTEASHKMLARCYVELRQA
                     RGSSCTVSATLRQLESMIRLSEARAKMRYGSEVSVEDVVEAKRIISAALKKAATDPTT
                     GLINLDMFHAADPGKNTVEGNMRRLEELLKRRYLAQGRHTVSVAELRSVFNEQQSGAA
                     RPVAPAQFVEFLALLSGGDVVQSFTATTVTLAMAGAAPM"
     gene            <105753..>106562
                     /locus_tag="LMJF_09_0260"
                     /db_xref="GeneID:5649453"
     mRNA            <105753..>106562
                     /locus_tag="LMJF_09_0260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681146.1"
                     /db_xref="GeneID:5649453"
     CDS             105753..106562
                     /locus_tag="LMJF_09_0260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681198.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649453"
                     /db_xref="GOA:Q4QI00"
                     /db_xref="InterPro:IPR001748"
                     /db_xref="UniProtKB/TrEMBL:Q4QI00"
                     /translation="MPLIRPGMPKPPQGFDVVLAKLEEYDEQMKLATQEESKGVVGVT
                     TRPRHSGGFGARKRMRDDDANAEDGTVAPPAEASSTVAAAESEAGTSTAGDDNAEAKE
                     EPPIPPLWRMAAINRARTRYVFLAYYKQHIISKEVYDYCVDTRLIDGGLARRWRLPGY
                     ERLCCTACGVPGAASLAASITSKYALRDRQERRLTTSASQQRIHDTATCLCRVPAAQR
                     RSKHFVACAACGCHGCCSADAMKGPKEGDGGEKTDKTREEPSVNAPGRGEA"
     gene            <107093..>108958
                     /locus_tag="LMJF_09_0270"
                     /db_xref="GeneID:5649454"
     mRNA            <107093..>108958
                     /locus_tag="LMJF_09_0270"
                     /product="putative drug resistence protein"
                     /transcript_id="XM_001681147.1"
                     /db_xref="GeneID:5649454"
     CDS             107093..108958
                     /locus_tag="LMJF_09_0270"
                     /codon_start=1
                     /product="putative drug resistence protein"
                     /protein_id="XP_001681199.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649454"
                     /db_xref="GOA:Q4QHZ9"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q4QHZ9"
                     /translation="MHPHEHHYGAAPLPAPEQEQPLGHYFSVTYAELLKAHVLDVHLP
                     NILIGISASIEVPLVTILGRRIGASYSSIADYISVMALCRTLLDIPFGIAVEYVGVRN
                     VMFLCLFLNIVASLVGLNVSNDVSLFAFCMLSGISLGGFFLARHIFVAGITSKKYRGL
                     LMAILSGLLRWAHVIGPVASGIFASYSGDVRYSFVLSALASSIAFGTLAVATQSTRCQ
                     QVCERTCRASLASSVARTPLHSEQEEDAPDIVWHHPGGTGRDDAYVATALLPPATASF
                     PTKSGVTSSLRDSANYRGIVGAERSDITSPPHAHHLHHAHANGGVATRPRSCSGASMA
                     SASLHPDTGACQEHNFHFTTLWYTFVDYWSVIWRLGLYIVLATVLRANRKLLISFAGM
                     RAVMTDAQVSYLMGFSFIFDALLFPLGGLMMDLLGRQFAMVPTAVGLGIVFTFLPLCT
                     TELKLYVAASAFGIVDALGCGIIMTLTADRAPPRCGAPFFGIMRTVQDMGHVVGARGV
                     SSLMRYAGFDVCCWMLTVAGFFTAVWGVYGVPSDTETLLEAPRLEQAAVVAHERLLHK
                     LSSYSQSSEETAPLTVVPATATPPTMTYGTATRPQPAPCVRRQDGGEGYRSVARS"
     gene            <111638..>113977
                     /locus_tag="LMJF_09_0280"
                     /db_xref="GeneID:5649455"
     mRNA            <111638..>113977
                     /locus_tag="LMJF_09_0280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681148.1"
                     /db_xref="GeneID:5649455"
     CDS             111638..113977
                     /locus_tag="LMJF_09_0280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681200.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649455"
                     /db_xref="UniProtKB/TrEMBL:Q4QHZ8"
                     /translation="MLNLLLELLVSIALCVALAYFAFLNVPVEAEEPGSPAAASAGDG
                     ASAMVGAAPSGALPRTGSDGAEYGHVYDPLLLLPHELPLYTSITRYVSLAEDTTLGIA
                     YRWLLINGLHYSPREVYGERRLREWGYYYSSSVGGSSGGKDIVGALSGAGMRVSDRSS
                     SAVASSLSSAGSTMAASLDSSRCSRRRLRRGAAAAAAALPTPLRRESAHWVNVLIRCA
                     AFLCLGGGTVKPEVWTDHLLYSAEKVLESVNAGYENRMRARAAQAHAVAAQLASAAHS
                     SPPPDRASSQSAAPLLTASRKPLLRIQLLELGSGLLGSALRDVHRPPLSLHHGAGDAS
                     GSTATPSRAAPPARRAATAAVAGSPGMAPSATSFAYHHHHSNSSVSSDYRQQVSSHAA
                     LCAPSFLLSSSVAGLSTAITDAVSSMTTCGADSAHLSDPVAGAPVADYAGSCSLFTGG
                     CGGASSAGAQLGVVLPRVEGDVISVEQAHSEGCHMRPPTPAASNSTPARAPSGAVSAS
                     PLPQASAAFQLRCFAVPLLYEDQRFHVRLGCCLPLGALLPVSLCVPPDVLTLNCAVAV
                     HRVTFAGHLYAAFHGARVELSFPTAPLFTAVVKVMPDTSDASSGSGSVAKVSRHGGWG
                     MRTAGGSGAHSGAAAAATAFTATYTQRNEATAVGGSIARGRDSYKAAARPPLPPRSGL
                     YSSSSNASLHHHHRSGMSGGGGASTSGSCLNEHNEKVQEVVLLAVRRLIDSLTYPKVL
                     VGELVCRRPSGAGGTAEGGAEMQLQLRWTRQTASLPLCM"
     gene            <114999..>118793
                     /locus_tag="LMJF_09_0290"
                     /db_xref="GeneID:5649456"
     mRNA            <114999..>118793
                     /locus_tag="LMJF_09_0290"
                     /product="putative kinesin"
                     /transcript_id="XM_001681149.1"
                     /db_xref="GeneID:5649456"
     CDS             114999..118793
                     /locus_tag="LMJF_09_0290"
                     /EC_number="3.6.4.4"
                     /codon_start=1
                     /product="putative kinesin"
                     /protein_id="XP_001681201.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649456"
                     /db_xref="GOA:Q4QHZ7"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q4QHZ7"
                     /translation="MRADGPSSAATRPNAASAMVAGARVYLADPATLSKATFSCDGVF
                     LPSSPTAATPAAMAAQQQHLYDVTCKSLLVPAPRPLERQRRWFSSYPVPTAARRIYLA
                     YGQTASGKTYSLFGETSTSSGVEGLSPAAGVVPRYLHDVFSTRNDAEQRRRRCGTGRG
                     SVDGAVDDVFVDLSCFEVYNEAAMDLVALSVAQSTLDFPHSTGAADVARGSVVRRLSS
                     KTPTDAAAGVTHSLRSSDLRRQLPVWMAHKLYRSEQHPDGADAHTQEDVWGTRSESSA
                     SVETGCTATAGAAAAPFASSPTLSRFLKTEYKATEKQQVLRSLERARCTTFAEAQAVL
                     QALLALRQECATSRNQSSSRGHLVLCVRVYAPAARDDLASEWIMQHETAFVDLAGSES
                     GKLADADVADVCASKVACHQPRRRGHAATGAASSSRASSLHSRVSLDTSMQSGVSLQH
                     SGISSGTTTTVSSAYHRSLLRPSPEADKKAVRVRRRRETRSINASLLALRKVFRALYE
                     ATRLSHTAVAQGSAASAATKLPRRPPLHHAPFKDSALTAILEPFLVPQPSAATPSSSI
                     SPSAPEGAAAVHVVLLVCCSSRSVDFFETIASLRLGAEAAAVKPEVVLRALPVQQRAQ
                     QHQLHLSGCATHLKPHYNTAGHRHREGGGCAACLPPRLCRSASAPSRRLVLSGDENEQ
                     GEVDELSKCTSAPGIRAASSERHDRRRPGEAVMSAADAARLCDEARQYKKTAQQLYKQ
                     CKSLCESYDECVDELQWCRAALSERDARVAELEAALEKVTRACAAGSSRQPQQPLPEP
                     LQPRTPKASRNSTAAHGSPAARTPHPLRLQRSSREAAAGESREVIAAVNDSGKREVSA
                     DPVPSATASVTAESMRATSTNSTAREGSGRWMVSVSPFSTASLAEGTAARMATVREDV
                     EGVKDVVDDAGSSGSSILRQSCDSSVERQQQHARRIMDTLLARQIFPSDEPVEPTQSL
                     SPPCASSPYPVLPTLSARGTAAPASSPVQEQQHARSHSSCQDSESDAHVAQGRESDSD
                     GRSPLTAEADAAAGEPARAKEVAEASATVAAASASMSAPRQSYNTPRSSSAGATASSL
                     LEGRGSVSVGRSSCYSVAEGPEVELMAFLSSAATAVHGVTAPVASASAVSATAPWSKE
                     MNVSVSHTVPRDSPLRATTRRVIAMSMDRDREVPHAEAAVGGDEEDAVEEVVIRLKKQ
                     DRSGALRIPAATCQPTETIRHVEVNGRAASKPPCSSPPLGAVSSAPVPPSASPLGRVY
                     QL"
     gene            <119728..>120438
                     /locus_tag="LMJF_09_0300"
                     /db_xref="GeneID:5649457"
     mRNA            <119728..>120438
                     /locus_tag="LMJF_09_0300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681150.1"
                     /db_xref="GeneID:5649457"
     CDS             119728..120438
                     /locus_tag="LMJF_09_0300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681202.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649457"
                     /db_xref="UniProtKB/TrEMBL:Q4QHZ6"
                     /translation="MTLVFEARRLPFGSISEVYAASIQPIVALHALDKLPLWDRCMLV
                     AVLPVVQQRHSASAAAAPPSTVVRPSLTRNDSDNADAAAASLSSATVRAANHEERVNA
                     SPELAGAPSLEDVALALTIVRALDELEVVYDSSISTRAELEQQQQQQPSLPAASLAEA
                     PRRAFKQPKKTSEELLMEQLLQERFTDTAPYLLESSDEGGENSADAAVDVAMCFTVKG
                     ESLGIGSATIFGGHGYHP"
     gene            <121345..>124008
                     /locus_tag="LMJF_09_0310"
                     /db_xref="GeneID:5649458"
     mRNA            <121345..>124008
                     /locus_tag="LMJF_09_0310"
                     /product="putative protein kinase"
                     /transcript_id="XM_001681151.2"
                     /db_xref="GeneID:5649458"
     CDS             121345..124008
                     /locus_tag="LMJF_09_0310"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001681203.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649458"
                     /db_xref="GOA:Q4QHZ5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4QHZ5"
                     /translation="MQQQQQQPRRCSRGSVSPSCEGHSYLKAIIVEETEEGGKEDGVG
                     MGEDRGPSVGGGDGGTSCVSNSPLTSSSGVSVHEAQPPRAAATVAAAPLGLIASGLDE
                     PLFSEQAHPLHTKSRATEAPQTPPPLLHSVVGGDTRAVDAGNRTGTARIMRLDPIAPS
                     LPSSSAPHAVAHHTLRLRPAAALLQPPPNTPPLHEPVGEEEWAPPSKRLRPHLSNPAA
                     PSATPPSATAPERLSTAGVGGSGSRVLRLPLSSSNAAPADTATTSAHTPASVAVAGGG
                     SGEVSATATTNVSARGGALKGGRGEAQEEPESTRKINEEAQRASDTPANGPLRVSPVS
                     SAGATIPNPEATGIGAAPVSASAARRPTPILTSTPSRAVSVNAPNAGLPLTVTVESAV
                     SQQQQQQTRSAAPVAMGTSGFSRLRSLTPTPYPGTQGSPCRRHRFVGVNLPGAPPPSI
                     DFSSIQRTVKEVYEVHEKLSEGTYGEVFKGVDKRTGAAVALKRIKMLSAHQGFPQTSL
                     REVIALRHIQNERERLEERLRNDAHHRGAVAITDPLAEVSQLCDVLLYDRQQRDIVLV
                     FAYATASLAGLCRRQFSFTPSEMALLMKKLLIAVRKLHEMRIIHRDIKSDNVLVTSEG
                     EVQLTDFGLCSIAASGSSRSGKHVWRTPSVITLAYRPPEMLLGSTAYDEKVDVWSLGC
                     LLAQMYLLEPPFYRHRAQAQQHQQQQRAPERSAATELEQLSRITEILGPLPPVSVYHP
                     DSCQHMRVLEQLEVQGRLAEAGRAAQPANWGRLQTIFEPSFLYQQFHGFRGWFEAELG
                     RSRHQPHRRPTQACMDVLCAALQLDPQQRPTAAELLRMPYFTTLDDTPLLGNYQRVLP
                     VTPEREDEVRRGFMIKVQRCGDSHTQRRPHQ"
     gene            <125476..>128232
                     /locus_tag="LMJF_09_0320"
                     /db_xref="GeneID:5649459"
     mRNA            <125476..>128232
                     /locus_tag="LMJF_09_0320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681152.1"
                     /db_xref="GeneID:5649459"
     CDS             125476..128232
                     /locus_tag="LMJF_09_0320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681204.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649459"
                     /db_xref="InterPro:IPR006189"
                     /db_xref="InterPro:IPR029787"
                     /db_xref="UniProtKB/TrEMBL:Q4QHZ4"
                     /translation="MVVTRHHTPTQQEPRASMLTGASAYGGGVGALSGNHEGHGASAQ
                     EMVVGSPNSQEVAELPGECASRQGQCSLVLPYRQPSPETQKLTATWQGALPKSFYLIT
                     ACVLGCALTIFIGILVPMLVIRQSANVHSAVLRAKEHDAVSAWASVLRGVMIEGFAAA
                     RALAGYSISTFPALQTPTNASDSIPSDQITAYLKRFPRFASLIASRKPAVAIQAICPS
                     GVIAMTHPHDPDSVGRDLMSPSDPTNRYKPSTTETAQSGRYAIVGPRRTTIASLKQIW
                     VIFTRAPLYRNTSNGVIPSLETFWGFVLLVVNVTGALDVMDLDRLAEARNLDYVLYDA
                     STEASDTHVIASSLPSGTMQPDYEQFIAESTVTDVLAPHSSLHIAVRSRETFVSLTPT
                     NIILIVMWTLFGSLLLLGIAIAAVLWCTATHDTAAHAPKMAPFAMLTIGPCRGEELWD
                     LASDQMVEVTERLGHVLARQMVRHHAYQIQQVHPLTTSYVTRSVAAAVKMAFSTIEEL
                     QRHPIDGPLRAVLGDEVRLLLSYAVHWCTDAAVRVESLEGTYRYEGPDVVYGGRMWAF
                     AAPSVVTASEAVVQTLPCFGLSGTVTRAYQTVDVMRTTRASHTDGSEAGIRNASSPIG
                     GGGSATLYLLLHAAKPDLVAGAEATAAAAAPGAMAPQLMVDNAPAPSLYCGPIASGNS
                     PSLEAGAAVSSLQDGSARSPEIESSASSAWSCATLTKGSSRAAKASQRRERAAVERSA
                     SACNPLSRGDSHTEPQALVQQQALAKHNAASTPEQHSLVLIEADAVTRALLQPLIPRA
                     LDVALRVAFDYQSITLDVRYAEARVLVYYFYSSYKILFRPLAAPERHNIFRRLVTAFG
                     VPQQGILEHLAARGAVQWLSQVRKITGLIHRQGSLECSSQTESSSVTPSPCDSLQGAQ
                     LLRF"
     gene            <130887..>133427
                     /locus_tag="LMJF_09_0330"
                     /db_xref="GeneID:5649460"
     mRNA            <130887..>133427
                     /locus_tag="LMJF_09_0330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681153.1"
                     /db_xref="GeneID:5649460"
     CDS             130887..133427
                     /locus_tag="LMJF_09_0330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681205.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649460"
                     /db_xref="InterPro:IPR006189"
                     /db_xref="InterPro:IPR029787"
                     /db_xref="UniProtKB/TrEMBL:Q4QHZ3"
                     /translation="MMIDEAVYQRVVRPRLPPLRVQTRLYIGIVAFIACLLLIFVGIF
                     SPLIVLRNMDKSYEAEMRYIEYTLASKAVAPYRVVMFEAFAISQALEGYVMSRMQVLP
                     NLSAPPLERIEGQNFTNFDDISVTLRRNMTMIAMTALQPGGVYAFFSPCNATKYGRDT
                     LDPKDNAQNFKPTPFETILGGRAVYVGPFRYTSGVLQGHWGLAIRRPIYNRTSYKSAD
                     IHTFWGFALTLVNISGLIERNPFAFISLTTKKRDVDYLLSVHNETSGAITILATSLKQ
                     PTATQLAEFVRLGTSVGITPNHPFLITIRGRDYGSNLSPANIIIVVSTVLSGLLAIFA
                     AVIAAVLWCTATHDTAAHAPKMAPFAMLTIGPCRGEELWDLASDQMVEVTERLGHVLA
                     RQMVRHHAYQIQQVHPLTTSYVTRSVAAAVKMAFSTIEELQRHPIDGPLRAVLGDEVR
                     LLLSYAVHWCTDAAVRVESLEGTYRYEGPDVVYGGRMWAFAAPSVVTASEAVVQTLPC
                     FGLRNIDTRPCCVVNVVRSRTLCGATGGKSATIYMPHSLPTTAQATAGVQCGKAVSPT
                     AAPLESNSGTENTQPLPPQQLFTLLDTRRPALVAAEAAAPRNVDSVSSASCPSDSAEI
                     PAMNLLAGECAVLPVLPSSAADGDSAKNAEMAIAARTSTSSDAPTESESNDILSASSL
                     SVAPPLSHASSSSDIGVSNGATTAVRLSSLAFQGDAVTRALLQPLIPRALDVALRVAF
                     DYQSITLDVRYAEVRVLVYYFYSSCKILFRPLAAPERHNIFRRLVTAFGVPQQGILEH
                     LAARCVIRYVQQRLKSRQFAPHDPHLRVTPREAPRTLNTYAKLGRATR"
     gene            <135591..>138785
                     /locus_tag="LMJF_09_0340"
                     /db_xref="GeneID:5649461"
     mRNA            <135591..>138785
                     /locus_tag="LMJF_09_0340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681154.1"
                     /db_xref="GeneID:5649461"
     CDS             135591..138785
                     /locus_tag="LMJF_09_0340"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681206.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649461"
                     /db_xref="InterPro:IPR029787"
                     /db_xref="UniProtKB/TrEMBL:Q4QHZ2"
                     /translation="MKKIFHIPTGNSAEDEQSSKRHAKRCRVYFMILAVWISLLLILV
                     NILTPMLVLQRQDNELERMHREEEKREAMSYATTFRDAILGAISAVYGVEGYIMGLMD
                     SLPNLNETPAQRVAGQYFPKFYGYAQLVSSSSPHISLFATAPGGVVLQVYPSEDEDFM
                     KNWDLLNGSSGNHTDPAAAYREDPFTTIKTGLLAVTGPYKSPGLPIRGWDKSSGDADN
                     MWWVDLRQPIYNATSTALITNSTFWGFAIVFFSVDGLVRKKDLPEKMNSLEMAYIIYT
                     ASVNSSNGCTVILASSMFKGETDCSKPFMKKFLADATTRDVLKEKLSWKIALKSMKRV
                     NRLTPRVRDAIVITSVIGVSLLFALFMYAIVRCTRVYDGAKHAPKMAPFAMLTIGPCR
                     GEELWDLASDQMVEVTERLGHVLARQMVRHHAYQIQQVHPLTTSYVTRSVAAAVQMAF
                     STIEELYSFPIDEPLRRLLGDEGSLLLSYAVHWCTDAAVRMETIGGGLRYEGPDVVYG
                     GRMWVFAGPNVVTVSQAALPSTTCMPHVKSKLFDSVFLRGVTTRQDLYIVTDTSNHSL
                     KEAEAFAADQLRRSRQAQLRYVADKEADLGSTGYTRCNRLLPSYPRTEYDSSDFDSSS
                     FAREASAYSEGATSGSGNDSNLISVVNSSGGSQLASGPAKRGARKDGVAGASGVPTAI
                     VVPASTPDDALVVAGASVSESASTLSRAVPQRRMGCRLPRDLAAANVVSGSPRSFSSA
                     ASVRSEKLETSPGEPQTPRLQPIAPEVSVTAATGTARPRRGQDNAHTAPGAITSGSNS
                     IDFRDSCSGIHATSGVRRNDLLLTNPLVVVPPAVTVAAAAHGLCGSSGGSASTTPISG
                     ESTGGRHSNFPTCSDNPLAYSTPAACRLSNSEDNAALQGSAPALNNFSDLLLRPAIST
                     QSDLLLRTVFDRQAVALDLSYDSVRVLVYYFYSSYKILFRPLAAPELHNIYRRLMTAF
                     GVPQQGILEHLAARCATRFLQRHEETQTLLWDQQHRLQMHIRSASATAATAASISDDG
                     VASTSGQAATRNTNDNKPAHTGGQEEGRKTSGGV"
     gene            <139942..>140694
                     /locus_tag="LMJF_09_0345"
                     /db_xref="GeneID:5649462"
     mRNA            <139942..>140694
                     /locus_tag="LMJF_09_0345"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681155.1"
                     /db_xref="GeneID:5649462"
     CDS             139942..140694
                     /locus_tag="LMJF_09_0345"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681207.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0345"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0345"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649462"
                     /db_xref="UniProtKB/TrEMBL:Q4QHZ1"
                     /translation="MVRVGAKRERPCILVLHVALRAAAGPAREGPQRGREEGTSLSTS
                     PRERFIWKTSATAEVYAKAVLRSIRAYWQLLGGVRYAGSDALTLVSAVWQDIDDAALG
                     ATAAARAGGSVEGASQSASPLASNIITGAKRSKQQQPRQQRMRASRRRSGVLRCAVNL
                     SRSVYGDAGAAHVLRASCACVTEATVAVPVSQLVADDGAATVAADASKDDGRKRRRGR
                     TEEDVEDVMQQTCHAAVHVTRVENVLPSRQRR"
     gene            <141585..>144143
                     /locus_tag="LMJF_09_0350"
                     /db_xref="GeneID:5649463"
     mRNA            <141585..>144143
                     /locus_tag="LMJF_09_0350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681156.1"
                     /db_xref="GeneID:5649463"
     CDS             141585..144143
                     /locus_tag="LMJF_09_0350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681208.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649463"
                     /db_xref="GOA:Q4QHZ0"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q4QHZ0"
                     /translation="MKSLAREFRELEATSQLPPSTPQQCVAPSTVLLPAAVGTVPPQL
                     SPFVANTAAALSPQASRQMCMAPLLGLSSFPRSPLHNGSTTLQTTNDGCPDTRADRVG
                     SRSCSVIDSFGRSSPPTPSVALRIGDGSRNSGPSGTAHAHAAPAARSADEDSALDPLT
                     SSSSPTATACLSQGTPENSLMMNTTSATATANRTGSGSRRSSRSGARLDRDRRCSTTP
                     PYTEVHAHHQQPRLACDTSLAWVLTPACDPSGLSTPGVGGAASQAGSVHHYAPPFPSF
                     AKSVCALHPLTDVMEPTTAAPAAAPSIPPRAASREQVSSRPPSMAAKQETPHQAPGQP
                     QGPLSTTTVTASPMSPTTAPVQLSLQEKLLISAPLTPRSGRGTPSSTLHVAPSPPRRR
                     CSSATNPSISTVGVKPDSGKSRRGGSATTAAAATAMAAAFTSSQLAPSPAAPATATLP
                     SPPPCMRLRSTGDGNSARSNPNNMSVCSIPSAVAVVPIEVQPAILSASPSFFATSPCQ
                     SPARAAVSASDSGAFIYGVAAASAVPYTPSAPKMAAIEQPGQASADPRASATPPLQRN
                     PASPTAQPVQNPAYWSVPCTPAVPMTVFLAAPEMSWHSLTGGVTTPPASSIGVAIPDP
                     CSQNFFVGCSVRGTGTSILDGCSSTASIATPLATSPASSAALDPQRTSGNRGATRTSA
                     GQTYRNVLVYGGGGTSGQGGGCATAVTASGSSHGLGLPLYSSQPQLLCTPVPLEDTES
                     VCAICLEGRASRTRTTETRETTALPSTPLQPPHAAGEGARQASDSAAAGMCDTTPADE
                     GAERGAVRGVKPGSCLLSLPCGHCYHQNCLQRWLMESQSCPTCRRDLTRDATIS"
     gene            <145424..>148228
                     /locus_tag="LMJF_09_0360"
                     /db_xref="GeneID:5649464"
     mRNA            <145424..>148228
                     /locus_tag="LMJF_09_0360"
                     /product="putative DNA photolyase"
                     /transcript_id="XM_001681157.1"
                     /db_xref="GeneID:5649464"
     CDS             145424..148228
                     /locus_tag="LMJF_09_0360"
                     /EC_number="4.1.99.3"
                     /codon_start=1
                     /product="putative DNA photolyase"
                     /protein_id="XP_001681209.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649464"
                     /db_xref="GOA:Q4QHY9"
                     /db_xref="InterPro:IPR005101"
                     /db_xref="InterPro:IPR006050"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:Q4QHY9"
                     /translation="MRQVETDSEFLAPAQGLTPPLSDSSVGEVNQAAATAEDGSHGGG
                     VLASKISWGSPAPPLALPEDAAELATDLAQEVSALYTDSGVTSARCWEQAEQEMEADS
                     GRRDDDGGVEFGDDAERDEQLLASLKGRHVQLQNTPDVVMAPLIIPDRNGRVAADTQP
                     LLHCRGGESEASASEVAPRITARLLHRHSHLAEQDRMYLGPCTAPEAQLRPPDAMRAA
                     PPSAGTQRHGCCVLVVFSSTDLRVHDNQLLAFASVCTKAAAEEVGGPVPVIGVCVLDY
                     RTFAQPSAVGGFFRQSPQRAQFLLDTVAALRRKLEDTLHVPLLVRCGRPEEHVPRLAV
                     ELGATVVLMTTQYAPHERRVQALMVRRLRAGTWVSREEVSDEAVVTGAVGQGAPVTPL
                     DKHCGSAAEEDDPLIAVVEHASCGVGGQHPYHCGSNLPSHCRSAAAPPVVHSVWQSTL
                     VHLDDLPTPLAVMKEGERWYHDDVTVSAIRPTEPYDKATALLAELPLTWQAAALLPTE
                     DERYGRAGPSVLRGALPRLEDLGYSAAAARRTDFAFQEVIATQSSHPDAGEDAALARL
                     QDWLAQGGVTSLLRYGRERRTNTKMYSQKLARVSPYIALGALSPRKYYEVLREFAQAN
                     QRDAFVQQQFREGLLRLSRRDYWHWMGLRFGDRLFFSYGPHPEHTDDVPEWRHDRKVV
                     QRWCDGLTGIPFADAAMRELVGTGFVAQEGRQALAWLLTRGYGQDWRLGAEWMERCSL
                     DYDPFVCYGNYAHSCGLMLDDFGEPVRNVYYLAHQHDQTGIYVKKWLPQLSKVPPVYI
                     HRPHVLTERMQAMHGVYLGKNYPYPLKLWQGAQRSLSAAELTAYYPQGIVKGPGYAEA
                     LRYGSAVMQPEEYNAAVSPAYLQRQEWATMLPASAFAGIEDSDDMAKHFALFEAAAPR
                     KPAPPAAVVAAESTSNRVIA"
     gene            <148972..>149604
                     /locus_tag="LMJF_09_0365"
                     /db_xref="GeneID:5649465"
     mRNA            <148972..>149604
                     /locus_tag="LMJF_09_0365"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681158.1"
                     /db_xref="GeneID:5649465"
     CDS             148972..149604
                     /locus_tag="LMJF_09_0365"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681210.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0365"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0365"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649465"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q4QHY8"
                     /translation="MSTTAHATSMGPLPYPNALQSRHTTTEQRQIAAAAVRAYQGTLE
                     QEKVLLQENDALLSEEEAGRLQRRVDNQAAADATAAQFRDRACKVVASVPGEQHQSEG
                     GVIDIFHAACDGDVAALDACLRSASDINALGQPDPARYNGFQFKQRWLFRAPPLVFAA
                     AFGREEAVRLLLEHGADPHVASTTGLRAQDYAAQRGYSAIVLMLTSGAPQ"
     gene            <150863..>151126
                     /locus_tag="LMJF_09_0367"
                     /db_xref="GeneID:12982583"
     mRNA            <150863..>151126
                     /locus_tag="LMJF_09_0367"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721733.1"
                     /db_xref="GeneID:12982583"
     CDS             150863..151126
                     /locus_tag="LMJF_09_0367"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721781.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0367"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0367"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982583"
                     /db_xref="UniProtKB/TrEMBL:E9ACQ7"
                     /translation="MEGNFYVSDVVINRELKSKYGMAYSKCPNESKRYGQCVEAGQIN
                     RSLQRDSCAEERHALRACVAKHLRNIAIGGRASCAASSGAQNQ"
     gene            <152513..>153040
                     /locus_tag="LMJF_09_0370"
                     /db_xref="GeneID:5649466"
     mRNA            <152513..>153040
                     /locus_tag="LMJF_09_0370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681159.1"
                     /db_xref="GeneID:5649466"
     CDS             152513..153040
                     /locus_tag="LMJF_09_0370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681211.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649466"
                     /db_xref="UniProtKB/TrEMBL:Q4QHY7"
                     /translation="MAFPKTLKSGRPAQQNTISQQLFYANPANAADMARQQQLDREYT
                     QQMRELHAKRGSADRRFFQRMTDYRDIQDGDPYASVFGESGGTQRLRTAAWQRQFEKE
                     NEDVELPYERTNVLARLAPNWFVRYFVNLRDKGGADHLYFLWTCALIAVSLLWVVGYL
                     FYTAPSRARPTSEIR"
     gene            <153991..>155085
                     /locus_tag="LMJF_09_0380"
                     /db_xref="GeneID:5649467"
     mRNA            <153991..>155085
                     /locus_tag="LMJF_09_0380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681160.1"
                     /db_xref="GeneID:5649467"
     CDS             153991..155085
                     /locus_tag="LMJF_09_0380"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681212.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649467"
                     /db_xref="UniProtKB/TrEMBL:Q4QHY6"
                     /translation="MVALQQQQQQQQSTNDARLANSVDRGADVSQRYRVGRVVGVVPK
                     PGPKAAEASHGKSASAACAGLAAAAADEGQRWLLAVYVGECVEPFAVSAIAEDVFTEA
                     EHRIFVQSALSTNREDGSRRASVLPSQQPALLSAETAATVQQNIKDIRVALQLTQAAD
                     KTGAVAVAEAATAQLMQRASGLKRPHAASDDDGDINSHKRRTEAASTGEDGDGIGTYF
                     GNGASSQAVRISRLTEDLVARGTQLQQLRQLLQQKDQEVKAALQQQQQQEARHRGEVD
                     AWRAKVEEQSRTRERIVKESRESLEQRDRLLEEANTKLRRLAGMATKYKQVVDAVAAL
                     LKRGGGGEASDGTVMTPEDILIALQAKKCL"
     gene            <156941..>162871
                     /locus_tag="LMJF_09_0390"
                     /db_xref="GeneID:5649468"
     mRNA            <156941..>162871
                     /locus_tag="LMJF_09_0390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681161.1"
                     /db_xref="GeneID:5649468"
     CDS             156941..162871
                     /locus_tag="LMJF_09_0390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681213.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649468"
                     /db_xref="UniProtKB/TrEMBL:Q4QHY5"
                     /translation="MAAGSGSDTVSSSSLDHSASAAAAALAGDSAHCASNASIAVFLF
                     AKEKLLFRYPDTDPFVVDVAAQGSPATSSSSAATGGAAAATGGSAAAVAAAAAAAAAA
                     ADASSKKASGESNASSAPSAAHAAPSQWDRQRGRGPYAEQTKRGGGGGGGGNSNSGGT
                     HVDPDDFSNTQTPTSSMNGGGGSRLKKSSHVHVTMAGDVKDGHQHHGAGGAQPPGGAA
                     PDSSAPVSSSSGVAPQRGMRRPASSYSLVNDHVSSSGGSLGHGHCTVSAGGGGTAAAE
                     GRRGLTARGQPGNSPGSMIQVQHTSTGSMRRQLSGAAVAAASSISGSSNTRKSTNVSA
                     GAAAGGGGGPASGGGRNGAPQQPQQQTATTGAATCVGIAPNVLMHLLRGALCGTTTIN
                     MVNCTFLVFPLFIGSAAPNTVSGRDGTAGSSSGSFGHLDRLRLPHRSGTALLVVAMKE
                     PDTDTGAIANFTQCFVNILCREEYRCQYVSTELERMEMLTNHWEVGGAAALASAAAAA
                     AEKRCPPGEAAHHEPLMAGGAGEPSGAGGSAISTSASVSPARDRHHRAASPMGGGADM
                     NTASSGNYDYLFSASRPALRHKLVPAVASGTESEKTALTSRGDRGAASGARTSLHPAY
                     NQQHHLHRSRESSPSAASQGSMAEPLLEWADPDDDADGDAGAYREDVRDADHAFSCTA
                     SPSAGKGGEHSGSRRDCLSPAATASSALTTSPSARSLYQQLAVHVRLAYEVLRVARCI
                     DVWNRTMRGGCSAGNGAGGGALEGGLWGRRTSCMTGCGRGAAGALREPRRRPSIAAGC
                     AHQQQQITFASAGTAFDTLPEALLINHMLLLPMSHLTGAERQEETASLRSASSRIHPC
                     SVLTVEADQFTEQLQHRYLDMMGRRYAKLIPLSTVYALLQALPSPRRAGSFYRSLELA
                     FLEAVQRRHARAAAAAAANNTSITSVSGGLDLGVTATSVSQADLLGIRDTIDEDPNAL
                     HTSAAAAATATTAAGIDFLAMEIIDFLRVNGAISVASEMHVCFTHGEVTPVAFLDAAV
                     ARRRRHRLKAEQRKVKAAAAAVAALKESEDGDAGKHRKCRDHRRYTTRDAEMDAKAGI
                     NGEADSAVATTGLRTSMKAMGDSASASKNWMSSHTTVMGSATAGATPEATADPLDAVL
                     DMETVPAALVLYMLECVVDTQQHRHQPHQQEQYHSLAVISGSDQRGETATPMTSMAGL
                     PKTPSTGNTATVGSVSGRTPRCWSAGTISAGKHSSQVGYRANEHDTSLRPPHGRSGTL
                     AAAGASTSLTQGWQGSPHLSAGAVGTTSSPSLHFATHTAATSTLPPAAIATAPQSALS
                     LAAPGPLSVYCAWGSACPLCELLMVHPQCWTTRSHRDYTLGFYTINAARPRYYNSGPA
                     IQLTFPSLDESVCTCARHARLLRDNADFTALMQNSYTGDGSGSSLLHSMQPWFMRPHM
                     FLTPVTAAYGVSPYEVFERMSYHCNRLSSGSGHSQRLPHHHPSHSPMSGESAATAAPL
                     IGVNSTSSLIDPDPRDLLLISRAQAHPHETSVVTACRDAAVGSAKEQGHTLLQCADIP
                     EAAVEYLRRSAEVIKQRLDYARRQQSLLERYEQAWEQQSTAPARTASVASTATPAAAP
                     DANPAAQPARSAAVAVAKPASSLAIQVSQGQTVQGAASFSSHADAARGDGSSPSFSSI
                     PVSATVAPLGRSANPQPRSLRYGRRQLPLHTASRPLANQALLFDSTTPAEMDSATDAL
                     APQRQQEQQRNYTSSTHIDPHTQSITSASAATPLTGVGGLLGTERSLPVEVLLQYVLH
                     HVIALSWGTRGLEVDTLVRLLERNLRRLPPLLANLPYIMQLRSAGYTSALAAAASASR
                     TTATSAAGEATAVVSSVFTTVHTRLAAPSLPSSVPVHDAAAQGSFQGTSPDRSVTSPY
                     SGMSHAATSAPITEAEVQLLQAYEVLDQLSLMKLLSAYATWPVRTVPTRLLLHTVVNE
                     FSDVLYVDSSERNGDAEH"
     gene            <164219..>165496
                     /locus_tag="LMJF_09_0400"
                     /db_xref="GeneID:5649469"
     mRNA            <164219..>165496
                     /locus_tag="LMJF_09_0400"
                     /product="putative protein kinase"
                     /transcript_id="XM_001681162.1"
                     /db_xref="GeneID:5649469"
     CDS             164219..165496
                     /locus_tag="LMJF_09_0400"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001681214.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649469"
                     /db_xref="GOA:Q4QHY4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4QHY4"
                     /translation="MKHMSRSKSDARRSGSKRTFDEATVTDNVQQRRHDGTAVPNTAP
                     NQVVEVVAPPPKKKKVTYALPHQNMEEGHFYVVLGEDIDVSTQRFKILSLLGEGTFGK
                     VVESWDRKRKEYCAVKIVRNVPKYTRDAKIEIQFMEKVRQADPADRFPLMKIQRYFQN
                     DSGHMCIVMPKYGPCLLDWIMKHGPFSHRHLAQIVFQTGVALDYFHSELHLMHTDLKP
                     ENILMETSDTTVDPATNRHLPPDPCRVRICDLGGCCDERHSRTAIVSTRHYRSPEVIL
                     GLGWMYSTDMWSMGCIIYELYTGKLLYDTHDNAEHLHLMEKTLGRLPSEWAARCGTEE
                     ARLLYNSAGQLRPCTDPKHLARIARARTVRDVIRDDLLCDLIYGLLHYDRQKRLNARQ
                     MTTHPYVLKYYPEARQAPSHPDNRSMLRPPPIM"
     gene            <168377..>169624
                     /locus_tag="LMJF_09_0410"
                     /db_xref="GeneID:5649470"
     mRNA            <168377..>169624
                     /locus_tag="LMJF_09_0410"
                     /product="putative protein kinase"
                     /transcript_id="XM_001681163.1"
                     /db_xref="GeneID:5649470"
     CDS             168377..169624
                     /locus_tag="LMJF_09_0410"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001681215.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649470"
                     /db_xref="GOA:Q4QHY3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4QHY3"
                     /translation="MATAAVTGSGRGEEATGRRSGSKRDHETSVTTDQNPQDAAKALP
                     PLKKKVTYTLPHQNMEEGHFYVVLGEDIDVSTQRFKILSLLGEGTFGKVVESWDRKRK
                     EYCAVKIVRNVPKYTRDAKIEIQFMEKVRQADPADRFPLMKIQRYFQNDSGHMCIVMP
                     KYGPCLLDWIMKHGPFSHRHLAQIVFQTGVALDYFHSELHLMHTDLKPENILMETSDT
                     TVDPATNRHLPPDPCRVRICDLGGCCDERHSRTAIVSTRHYRSPEVILGLGWMYSTDM
                     WSMGCIIYELYTGKLLYDTHDNAEHLHLMEKTLGRLPSEWAARCGTEEARLLYNSAGQ
                     LRPCTDPKHLARIARARTVRDVIRDDLLCDLIYGLLHYDRQKRLNARQMTTHPYVLKY
                     YPEARQAPSHPDNRSMLRPPPIM"
     gene            <171678..>174671
                     /locus_tag="LMJF_09_0420"
                     /db_xref="GeneID:5649471"
     mRNA            <171678..>174671
                     /locus_tag="LMJF_09_0420"
                     /product="putative tyrosine phosphatase"
                     /transcript_id="XM_001681164.1"
                     /db_xref="GeneID:5649471"
     CDS             171678..174671
                     /locus_tag="LMJF_09_0420"
                     /EC_number="3.1.3.48"
                     /codon_start=1
                     /product="putative tyrosine phosphatase"
                     /protein_id="XP_001681216.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649471"
                     /db_xref="GOA:Q4QHY2"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR026070"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="InterPro:IPR029260"
                     /db_xref="UniProtKB/TrEMBL:Q4QHY2"
                     /translation="MSVAMEAIHDFYFKDNFFTSGVAGACRKGNSTRTIPTARAAVGQ
                     DAVFVSLRGIPPYLYRPFFADFGPLDMSCCVHFARRLCELLRVVTGFDVHVSPASAAA
                     AGTFANGTNSGTAAPAHRKRDGRGQPVSAPSYSPSSASAVSTVSPGCPPATTLPVVVC
                     ASLDAQERVNMACLVGAFCVLCLGWSAVATWYRGFADIYPGFLAYRDASQGVSNYPLS
                     LIDVWAGLEQGVALGLVNVHTFDIPAFLEGKQHDYSWVVPRRFLAMSSPQDDKSARTA
                     EVFARRLRPLGVRLVVRLNDNLYNPSPLLRLGIRHVDLPYADGSVPCDAMLLRFLQAV
                     EEHFGESVAPVSLQEWWSVPSSTTATARAGSASKKASSGGASHRRRALQPCSFMHSGT
                     CRGMPEAWTAAPPSAPPSHARRLDSVHANGTQGHGTCTLAPGDKGAVAVHCLAGLGRT
                     GTMLAVYMMRHYGFTARAVIGWMRLCRPGSITGIQQQYLDAMERRLRPPPHMLAALQL
                     NSAAKLYSAASGERQFELSSRRTRSSSLSATSSTSALPNAAAAAQATRGRGGAAATGR
                     NQLDASPQPPLGNATTGCMRSTAAVTAFQTHGSVVADARPATATSIVGGHIRHGDSGR
                     TNAMAARPASDVTSDIGTFTDLATWTDLAGLRGAQQQRQQLLMRRFSNSSSATLSLST
                     IQAGGEALDAVARMPVLGDDSPQNRSAAMASLKRGSAAAAASDHKAYMHPSPRVDDCK
                     YASTYFVAMERAGELPHVYPWSTTSTARGGPRASHGGGPRPATANTFCETAPRGVRHL
                     SYPRSSECSIGSDASRRKETRTAPASADSCLRPRKGPTSALQRRRPYTAAAAVSVGPQ
                     LHAKRHPTHYERGGAADHSETDTHASGDTPPCSDLSEKTQQSPRPRQTATRTRVRWDD
                     KGACRANLDNARAGDTAAADLCVDVRLQTSHPPSAPMRSSLLWSNGGVTELEVGPRSP
                     LVLSRSPLAIPATSLPMWGRPVLRT"
     gene            <176842..>178251
                     /locus_tag="LMJF_09_0430"
                     /db_xref="GeneID:5649472"
     mRNA            <176842..>178251
                     /locus_tag="LMJF_09_0430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681165.1"
                     /db_xref="GeneID:5649472"
     CDS             176842..178251
                     /locus_tag="LMJF_09_0430"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681217.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649472"
                     /db_xref="GOA:Q4QHY1"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR004343"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q4QHY1"
                     /translation="MISEEDSRLFEAAKRAQVSRNTAIHVIENTNSSRILAGAFVRVL
                     LEMPTRNEGYVVARIHSTTAGETYSGFSTNPAQTTNVYLMLELPPPLAAINGVQYQLN
                     SVSNSSMGEGEFCDWLLMIRNEPTLRVPTVQGLKEVTARLHPYEVSRHRSNFHVSANG
                     SMAANGRAGVVDTGGNVPHPQLAQQQQQQRSLSARGAARQRRQSLAASSQTMLIPPML
                     QDGAPLPDSGDALLRRSSAAMYEGGSSGVIANAESSASAAGSNSNYNVNNRLGRQGTV
                     MTRDYNRNPREDGQASHEMSNPEVPGMSIYTAAPGSQQEQQQRTVLPLSHGGDDGGVA
                     GESDGGPALAATTSFMTRAATDPNMESEDDEMERRLRQEIMNHLAQECVLFPKEAQGY
                     KLSRLRLLERDMIEYLQHVRDEIQGKQENCIVCMDHVPTVILLPCKHKVMCRLCAPSC
                     PTCPVCRSKIAEMFEPEEI"
     gene            <179777..>181522
                     /locus_tag="LMJF_09_0440"
                     /db_xref="GeneID:5649473"
     mRNA            <179777..>181522
                     /locus_tag="LMJF_09_0440"
                     /product="hypothetical tetratricopeptide repeat protein"
                     /transcript_id="XM_001681166.1"
                     /db_xref="GeneID:5649473"
     CDS             179777..181522
                     /locus_tag="LMJF_09_0440"
                     /codon_start=1
                     /product="hypothetical tetratricopeptide repeat protein"
                     /protein_id="XP_001681218.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649473"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q4QHY0"
                     /translation="MDESMWFIQTKAMVLQSWYDDAEIEDDGVDDVLMEGEQAIVSTV
                     HRPNTSLRAARQGTAGGGTAAGAVSRAGRLRTSTGGGRPVSSRYGYARPGTLQNRPGS
                     VRGGPDGTAVRPVTGRFVRIGTASLRSVPGGPHINFQSLNLERYAQEKPMVAKLLCDY
                     LLYVEHKPKMALELCTAALRPVKPVTTPTIPLPSAPGVAAKLPMGGGGVGLSPVLPMG
                     AAAGAGVGPSSPPPPGKTAAASAAQEQVGIANANDWWWKARLAKANYQLGLLREAEKY
                     LKAALFDAPTNTSVGAGMLAKESKAWPGGGGSGGGFQKGRAFANYNTSVVMQLGKVYL
                     KMDQPLTALETYEAALEVNPVDHHIVLCCARLRDELREPGTAYALYNQVLRLDSSNIE
                     AIACIGAHLFYERNQPELALRYYRRLLQMGLHTSEVWTNMGLCSFYTFQMELSLRCLS
                     HALALCKEDSQRADVWYNIGHVGIGMGNMAFAERAFRLAVSADVTHAEALNNLAVLAY
                     EKRNEKTGRRLLDTAVLVAPGLTEALYNTAVISFQTGELELSYQMVMRVLEAEPDHPE
                     AVVLQGKLRERFLAI"
     gene            <182809..>185613
                     /locus_tag="LMJF_09_0450"
                     /db_xref="GeneID:5649474"
     mRNA            <182809..>185613
                     /locus_tag="LMJF_09_0450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681167.1"
                     /db_xref="GeneID:5649474"
     CDS             182809..185613
                     /locus_tag="LMJF_09_0450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681219.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649474"
                     /db_xref="UniProtKB/TrEMBL:Q4QHX9"
                     /translation="MEKSTGDGVRQNPLGAASAAAVATSDDILRGIYNEKLQASVRSI
                     ITTLTTELPQDHIFLQLLADPTTLQYCKVRLAEVVEGFLYSTQAEQYHALATELARGE
                     RDCALLHQRIEELEAALAVASAPARSPTPQRQGFSSHGGKSSTCDDHAHPAAPAGSSQ
                     TSSPTMMPAPAAAAPTASSVSPSIPANPMENEEARRELLRVLEQATHDQELLRCTQAL
                     QAVSKVVNVAQDEPHCDDKYFFERELLGELYKCVHSLLHYVDGALESQELLRCEIQQQ
                     QQHWLNGAAAESNHQDIDDDAVAGSAVSADRSASASVGTKGSGTPGVLVSGYSTPRHP
                     QVSLGNAGTALMSSAVGSRFSSVSSPAAADHTRPIQQQRKRLQRLAEQLREGQQRASQ
                     VLQTLAHMESARRREVAQLEMAVAAAREEASVATSAAESARQVKENSERLHAEHAAFV
                     ARERTELRDQLADVHAQLAAATQDVHAARRELRSVTSRAEAAEERERDLAAELAALKA
                     AMARRDAEWQEQKADRVAQQAELTALKAVHQSTVDALQDAARELLCLRVEGTMAGLSA
                     LYQEAKAAKAELLEREGYRPLSHRCSIAVATQQEVVRHAQVQSQLAESAQAEQAVAQR
                     GCMDALGVLLRSMWADEAIESALTPSSASTAALVVTGTHSTDGKDAREAPRGGRARRG
                     SRTGICGNTTSGNAEDPGAENPRSSHGYRLPTTLAGLCTSLEYAYNNVRARHSARQQT
                     IDSLRAALVSKDIELRAAQANDAQLRELLKAEQAKEEQWKAEMAQLSDQNPMRGLLAR
                     QERLLKAVSDERNELRRLWNQLSGDYITLEQRNGALHARCAEKEHENARLNGMLRRGG
                     APTTPTGPCRKDAASCGAARGPSAISKAAEAAPRLSTLATAAAPLGTSADRPASTLGS
                     GSSSPSHTNSTEALPNQVPE"
     gene            <187070..>195799
                     /locus_tag="LMJF_09_0460"
                     /db_xref="GeneID:5649475"
     mRNA            <187070..>195799
                     /locus_tag="LMJF_09_0460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681168.1"
                     /db_xref="GeneID:5649475"
     CDS             187070..195799
                     /locus_tag="LMJF_09_0460"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681220.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649475"
                     /db_xref="GOA:Q4QHX8"
                     /db_xref="UniProtKB/TrEMBL:Q4QHX8"
                     /translation="MSRSSSGATLYAMGSGNEPPHVPVTAAEAATLLTAGAHASSAAS
                     PPYPLHYRHNAASRELLLQSIGDIGKLIALALLPVTQQVGRRVADLVRALAFQPSPTP
                     SVQPSSLGVSLPARAALPPPTWTTSASVALSSTPQSHSAAPRDKDLSTGLLDAHCGGG
                     AVPSAAATATVSAARPMHLVHDDPVLVRLLQMTASAASRCPLGSSALAELYGVLLLFY
                     SGVAPQSMLEATCEATLTHHIHAVLTALHDSGAGDDGVVSASAHASDDGLVHLNSSSV
                     TLTASRFAAQLQGVAFIKDVCRLMVGARTRWLHLSPYSTSTPAPGGAAGGEGATAVSD
                     RSHSNKRGAAEHRRGSTPSSMAGITASVTAAAADASRQRAQEQQQLSLSMSLMSKSML
                     GSLAALSPGIQHELDAISAAGAAGAVSGACGLGGAAELSSLSSLAMTVPTCAAMEVVP
                     ERLRLFLMRAVTLFFKEQAKALAAPAVATAAAGGGGGTDEGASRSSAVRSAAAVSMQS
                     PLYAQCLNDCFFSVALWGLHEMGIAVSMQPPPALFVEVQEQQQRDGPFSAPPCSLEVF
                     MCTQQLVLVSISTHLHSMTNSTHVLLEAHERLLQRLCRRRKPCATSSSQWLGSSGEVS
                     GGSPMSSDDAERLSQAATVVLSLWRKTLTSATLLWELLQLRSMQGGHRGDHSAAEVAA
                     GMSVDTEAYHSSGWYSNEEWRASPAVERNGYNSDSSSIAVPSQQWSPSAHGSSACRQR
                     PSRDYLTGSQDALDVRNDSEKDRASTPPAPGLGNAAAVGEEGGTGVDATTVPLLVRLV
                     LSILALAVSHMQLHANNILQMSADDKSTDGKRGGGDSEEAEGAAFTGLLLQPSTPPRF
                     LSAGDSGDDIEGEPSLKRSPRHIGPAAANGVGAAAAVPIPLCLCVANASTVYQCFTEV
                     LNGLTAFGQLFSQLVDAQRMPSVAAADKEQVLCRCRECFLVLHPHLLHCEQLCLRHLR
                     YEEDVLPVVLKATGYWVQVSCVLQLPEQRDAHLAALVDVLQTQDPVDGHLVALAPPTA
                     LGMSDTASPTTTMLLEALLTLNGVCAAAEPIVPGSVAAAALSPSSDRDAASPGNGGGV
                     KGIRQYALSMSSWGAEWLRRRGLKTSSSACGSTVSPARAGGGGSGSWTVSPAQSQMNA
                     TPAGERGGVGARPSLAAPPRIGTPTPIATTSRSKQQQPAPASWAMPPVLTSHGWRSPA
                     VQHAVILGVCRLQHKLFIMKTLHVIANALGAQLKSGWTLLARGLAVTEPLLHMLKRLL
                     SWIEESAEEQEQQEQLLSDALHLRDALRSLCVHNACQLPYSQFEIFFAELVSAALALG
                     AATPSQQQDGAALASNHWGYGDLHAAACAAASDRLPRHHPQGCGGQWVLTSECLSVSL
                     LAMLPFIELRYTDATDGVATGKAGDGSSGGNQPGAQAVQLQHQRTGALARALYLWELE
                     TTVCRYVTDHQHVEEWGRTLLTTMKMHKRALLATTASSSVEAAATDPDTPLGTGSLSQ
                     EETRTIELVLFTVVGHVSTVAVQMCRSSRRRVAAVTSAGGEGGSPLNDTGNAAPSPSY
                     QAVQSAALVLTSGPFAAVPLTQVANALFAASAASGSSLGTSGARDTFAGVGSGGRLPL
                     LPFVQADAAQSIARLHAAVHRSSQAIALHTAADDNRSSVATAPPMTTASVHLGPLEQL
                     LASPFALLDRVYGEWQLQYAGSPSRGGGQGGRSTAANAAEQHELEGRMSPTPLNPNDS
                     RELPQRGERSTSSEALDASAAFSVVAGAVPQLLANAAAAVLMDVVKIVQSYGEAIDGA
                     AWEAILSLLQRTAVAAREHDNALAGMSVGAAGGSGSHTQGSVSIDSICGRSASSTNLL
                     GKPGIKAPTSAAGATVSSSQAVESLNTAFRALESIQHNHIPRLNADGLHRLIVCVGTF
                     TVHRVDGGAAGERKLHTNLSAVQLLWSIADYLAAFGSGAVEEIERGGADNNANGGGSG
                     IVNATAAGCAGAAAGGMPGSPTRCSDDAWVAQQQQHDRLWCSLLWQLRNGCLDDRQEV
                     RQSALQTFFALVQTYGWRFSAACWRCVLQDVLLPLMEIVAVATGLCATPPPSPPEVGE
                     DDATAVTGAAGERGAQDVTRQRLLRSFMDHPPQLEEVRVAVFNAGSRLFVTHYAHMQV
                     AATALSSPSSARSPRPRLPIAEEDKDDATQVLERFLRLCGDVCVVLRGTSGEQAAVAA
                     VHALHGLLVEMPGKGLHAHGVHLAWSALERLILRGDGGDDCADRPLAGLREGTAPDPD
                     AQRRAKQRTNAVVAATVAAVCDSFRLQRLAAAVPDAAVGSVTATSPNAVERSHNATGF
                     SSCFSGWGGGGGGIAATVAGSASCAELRHSDPSSPAPYFTRLLFLLQAVTCCPAVVNS
                     YYFPSKAQATLLEGVAAVWPTLSSREARTIWCEVLLPAFPSAARLQSFVVQDLHESVS
                     ITVVGDAATNAAATAAASTLIPLKSVMPPGSHPGYLSAVMETMRGLMLRHMGADAVGA
                     TAARRRGPDGLPPDPASANTSAAATEAPAKTTDEDRARLAFMAPSTVQVSGTLLLLHL
                     APAAVLEVPPRSGSVSFNPPALFLQECVDVLQYTLWEPVLARTRTPPPSLPFPCPEAS
                     NDSPSSAAAVQCRRDGVAALCRVFELLLTTTSTVVRHLHATPPSGAAATSGTAAVPTT
                     TITPPHVTAALQLLDLLVDTLGEVVHFVVELYEDVVCATTAITALTIASTAECTALDR
                     VARRSLSLLQRWAGAVSGTPSARLAPPSCAATPHHHQHTRSGSDGSCIMSPSAQGTVA
                     RHDVCAQSHPAAHATASTTTSRSKLQDVVRAFMESRTKAIMAQFVGNPDDASAAALLV
                     GTLRDMLHVAQSSARGDPRAGSDTAAHNLSTIMPDLLRLVACSSREPHRSAAAISREQ
                     EMREILANLLTLAMDEQHKQPAC"
     gene            <196790..>198748
                     /locus_tag="LMJF_09_0470"
                     /db_xref="GeneID:5649476"
     mRNA            <196790..>198748
                     /locus_tag="LMJF_09_0470"
                     /product="putative serine/threonine protein phosphatase"
                     /transcript_id="XM_001681169.1"
                     /db_xref="GeneID:5649476"
     CDS             196790..198748
                     /locus_tag="LMJF_09_0470"
                     /EC_number="3.1.3.16"
                     /codon_start=1
                     /product="putative serine/threonine protein phosphatase"
                     /protein_id="XP_001681221.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649476"
                     /db_xref="GOA:Q4QHX7"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q4QHX7"
                     /translation="MSSDLMELSREELISRVLDLQSENNALSRQLRSMANRRGNASSP
                     TRADPRSRTTSGGIGATHSDPSAFTATNPVSVQRNGSLSTASEVPMSAAADRLSGCAS
                     GPPSAPSFEISMSVIVIENGAALSVPLSSVLDKTYGRHDLRDADTPVVSSKYLRDTNS
                     LRTQRFSIGSVSAAGGAAADASPSMNLDEEFSDSLSPGRPSSALGRGSALVRGNVSNA
                     GGTVNDTDDEPCPKDPRAGSAGGAAAASSLAQRAGVTHLNLRRDVLFARDLSLDADAI
                     ITHQTLRLFNQQFARGANMLSPMSSYGNAVYHYIVKTFAVRNGCEHSPDDVEGFGRTL
                     MNLCEEVKHILLDEPRHGSVTSPCYVFGDLHGNFRDLFYFMDNLISFQDLRYTPHRFV
                     FLGDYVDRGEFSVEVVAYLFSMKVLAPHKVLLLRGNHEDTLVSGDISGYGNTSFRAQC
                     HSTFGAALGEELWHRASAVFAHLPLTANIDGKIYCTHGGIPRYSGGVDDRLDILNSVD
                     FPVMESFFQVPESETPQHRMYRQIGMDTCWADPAENESELDRFGFGSNPRGTGVILFG
                     SKAVDDFLDHFHFEYIFRAHQEKSDGLKLSKSARVFTIFSTSAYVGHQNGAGVVLVAE
                     GKIRLIVKTADTYEEEDYAAEVEDVHQR"
     gene            <201182..>203401
                     /locus_tag="LMJF_09_0480"
                     /db_xref="GeneID:5649477"
     mRNA            <201182..>203401
                     /locus_tag="LMJF_09_0480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681170.1"
                     /db_xref="GeneID:5649477"
     CDS             201182..203401
                     /locus_tag="LMJF_09_0480"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681222.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649477"
                     /db_xref="InterPro:IPR013518"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="UniProtKB/TrEMBL:Q4QHX6"
                     /translation="MLRGVSLAPQQRAVKDPQDFPSELKNSLLGVPPFPAPTGYGSVG
                     GSGANSAPVSSPLLSREALQVQNLFSREPSPSSLMSRVFRSAKPRYSTGLTGQVPVFD
                     YNGNLTTRQVGVHTFRFRSLSLFYFLRSQPWTVLITYSVILYLIIVLLITAAYYAWGV
                     ACGAAMNVVSAIYFTVVSLAANGGYMGEDGDTMTDATHMCYRGRTAIVMVCSYVNILF
                     VGLVAALVVSKAEYTGKLGHRVVFSDFCTLTTVPGRVDRWRLVFRVANVDNHIPLARG
                     KLRLFCVTAEPLKEYHIQQQQQQQLQALRHSRPVKKLAESTWSGIHPLLPGVEYDGGG
                     GGRQPQRTAPPPAEADAKCHTAKATKRHAKAHRRLHSTLAPPAPHDSAESSSREDRSG
                     LTRAQRNRQLHKSGSGGHTDEADRPGRHRGQRSEGSLSPQKRHSMPSAESGGHWGTSS
                     GPSRWASTASSGSDDSTLSTSVASSRFLSASSAAKATSSTRAGRKAVGREKAPSPKSK
                     SSAAVDNVDVDKANSSVSSQEGSCLYAASPLTEVGKEPSVAFAGKRSLLPTGIPEPAV
                     SVPILSHFPNVDAGKTMERVHLCVHEMRWTCAGETYLDRGERGQLSLWYPADIIHIID
                     ERSPLRPFLELPHVAASLGSGGAAANALSGFPSRADLVRQHFQIVAVFDATEMETGST
                     ITAKRTYANEDIVAHYKFSDRLVHVHPESSEVLLDFHYFNALLPMNLVEPSTTESDM"
     gene            <204430..>205665
                     /locus_tag="LMJF_09_0490"
                     /db_xref="GeneID:5649478"
     mRNA            <204430..>205665
                     /locus_tag="LMJF_09_0490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681171.1"
                     /db_xref="GeneID:5649478"
     CDS             204430..205665
                     /locus_tag="LMJF_09_0490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681223.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649478"
                     /db_xref="GOA:Q4QHX5"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="UniProtKB/TrEMBL:Q4QHX5"
                     /translation="MEKFRHFGDAATGIHPFTSVMAPTAAGRIGSVCMFPARLVLSAV
                     FALLLLVTDTLLWLFYVAHIRLLGRLLLAPLQRAWLRGLLFSIGHIFPQQPAAMVKPQ
                     QQECEASGSSRAARAGDLVVCNLQSVWDALVLEVMLAQPYHAICFPDATMAGEDGSAS
                     STEAAAAPGLRVFWPGPTQRWQVWAFTRRTGSLAFLRAQQSDSAEQQAIRKKTEATEL
                     PLYRVQKAAARAGVPVWWFGEGTCSNGRGLLLMPAVTCTSAAASNASAGCVVHLATIQ
                     YDSPALQNVLGNDNEGFFAVLFRTGLLLYGSTAPAWTSPLFPTAEVTYRSTRLARATP
                     STAADSKSAASRRHWTLSAPALLELRNAMCQRGQALVVSSSVAGVRRQPVSVGVKEKK
                     GFLEAYRAMLDSKKTSPSA"
     gene            <206919..>211430
                     /locus_tag="LMJF_09_0500"
                     /db_xref="GeneID:5649479"
     mRNA            <206919..>211430
                     /locus_tag="LMJF_09_0500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681172.1"
                     /db_xref="GeneID:5649479"
     CDS             206919..211430
                     /locus_tag="LMJF_09_0500"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681224.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649479"
                     /db_xref="UniProtKB/TrEMBL:Q4QHX4"
                     /translation="MQLSTEGYHEELRLLRDKPELLSSGAEMEVRKVWRERLWMDDEL
                     EKAELRPPKSDVVHRQEVHGAARGIAALSSSFAPYHVGTAEHAARQRQAPAPMMEEVD
                     EVVVMAQHVVFRVGHDEIASHFSAKHPHSIINASALASVQHVELGVMPPAKHMREQQQ
                     QQQERAVKQHLASLRRFSRDTPYELKERLARDIVAGRVDVPMQTAITDAVMDEQRCSL
                     PTTRHHLSPDLCVFSSPRTEKSSAAARRRGQHDGDLPASAALIMWQLTLRKPKMPTTP
                     LWQRPWLPPGTWAVEMANCDVTRAAALMRASAVRDPLAVEKRAAAIEDGVKAPRHHQG
                     TPKSAGVATAATDGEQHRHNVGVRRQEAAMACTDGTENLYGLQYVWRSPLPPGGFIRV
                     SPDPRIAMWPDSEDEDSDEDSDEGALEKTEKYDNSQARGVVHAGDGGGIREDVRRSNS
                     KISTGTSQHHDRQAQMRRLARCVNRRTHKLRWLHSIGRRHVCYKDLALSGSDNSLTGA
                     ASASSSSSSQCTSPTVSALRDIHVAAEVKQASKRVTRLPLLNDNGKARRRQRRGQEGD
                     EATSRGSRPVYDGVLNINVYAEIVESQCRNPSIVGPSPLRAKSQQHGQQASNATTTTR
                     RFLGCYRQSRLLIHFKLYCRALYEEERVRHGGAGTHVIGRAGGSAPEYTPATEGLLAG
                     VPAIPHPVLKLQEHAPSLRKSYAHRIPVASTMSGCRCWEGLYPALGTNLATSVQQAWR
                     QLRRSSLVRQALRDIYDELPHDKEGLLDKRAFVLFVLQLLELFFPTRLPAAAHIAIAE
                     EEWVYRGTTEHVGPQTFHEKFFVFPFIFYRDIAAVTEAQLVEFWTLVRVCFDAQKRTQ
                     AKAAAAASAAVRGRSSSLAGRGSDAPPPPPPPPLLPLLTPLTLFTAEQLDALLSRPPP
                     AFDVDVYDRYCLLRQAFRADPKVRAAPRDHQYVVARSVVETQQQAKRPRASNCVAQKG
                     SAAHKMTAPLTACQAQLCSADVKRRAEVAAAAQRERESRQRDLEAQEHKALLEESDYY
                     QARIGRIQSRSATVISGIESTCSTWELHRTEAYAPPQKDENADARLQVKEDVEELLLE
                     YLDDVPLDVFDGLVSLRECYLLHAGLRQERLNRTFSLLQPPVNPLARATPSRRPVKAD
                     DVAQQCMAVMTGGLGATQRRIAVSEETRLLLDGASDVSSSAVITPPTTSYVAGMYPLQ
                     AVRRTVSSVLCPSRVPSRGRRSILNRSREASLLGACKTFCSVSGVEDDGRIGAASTFS
                     SFYTAASASHAQPTRGPTTRGVQHKGVAASTSVCGVSGRYPGKDEDAVMEAVVSSASL
                     TGVRNRSCYRKPVAARLRQLSRPATPAVSATPFVPVSPLLRPRDGDVSILCGLNSAAN
                     MPASTQRDTSPLPQYQQPLTSTRASSAAALATTWTSSVMLLDLGEEVASASPGSAPWV
                     SQQGSTVVHHVSARPPHPPASSTVHAPAPSASLHYAQRLRAQKRRQEKYKRQFNNAAK
                     TAAGVACKH"
     gene            <212261..>213511
                     /locus_tag="LMJF_09_0510"
                     /db_xref="GeneID:5649480"
     mRNA            <212261..>213511
                     /locus_tag="LMJF_09_0510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681173.1"
                     /db_xref="GeneID:5649480"
     CDS             212261..213511
                     /locus_tag="LMJF_09_0510"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681225.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649480"
                     /db_xref="UniProtKB/TrEMBL:Q4QHX3"
                     /translation="MSSAIVLVGSRQVIPLASRLIVGIRLQGTIGFVDPASPYVVKPR
                     PYASYLATTLRRLQCAVALFVPTNTEHDREMMNMFYRRDFPVSFRYVNDHSKFIGAGS
                     GRGNRKRGMAPNNYTEYLRIMANEANGTGQDTSRVLFIDSEVNYRFTPVQTIVLDAYE
                     PLTRRQQRRLVQQQYSNPFGDVSSRNARRYGAAAARARKMTVRHRAVVSAQHLQDAVD
                     MQQKYTDFLIAEQEGVQLPPEMRNGVQDGHGGDLCHFSKRHPQRSAPSSSSPPHPQQG
                     GSTRGRVSGPLSTPGPSSLADTESDKTPPDGNKDIKEEQQQLSMSCALAVNLEDYSLV
                     ALAEMIAEMSASETSVADYIKTEPLIEKVEVPFHGKANYLAPENCDNIDLLNWDEIQV
                     LEKAHGTGVPEMVEETEDHKDFFR"
     gene            <214347..>216662
                     /locus_tag="LMJF_09_0520"
                     /db_xref="GeneID:5649481"
     mRNA            <214347..>216662
                     /locus_tag="LMJF_09_0520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681174.1"
                     /db_xref="GeneID:5649481"
     CDS             214347..216662
                     /locus_tag="LMJF_09_0520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681226.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649481"
                     /db_xref="UniProtKB/TrEMBL:Q4QHX2"
                     /translation="MSAAVQTLATVMATDMNYYAGDPTVLAADAASSRVEQILQSSRS
                     DQLTARVAIHAQLREAFKNVDVQQRFKPFLSDGENIQMYVQDAKARARFFSQKQQELQ
                     HDILQSEEQRQLKEAHGELAAWERENAVLLRHQMFMTYMPSQALLLESAATVALYRQY
                     ATLEEGQYTSDSSDGEVPMMLKKMGGKTYFTQSEQPFEVDTHNKMFSQQVLQNKRVEY
                     EQMREKAAQLRQALEECPTVKRLEAFVELRNDIFVAYGIDRLASLCSRKDKEMGNPNE
                     GGVDASLHGLPADDEYVSSSRVAQYSLPKIVDAAYKNYLNILSMDDWDAMMKHTGSNA
                     RAVMEKIKPMKDKETFRYWFLSCITADVPQMGPNKIVGQKATTLEDYKKFWAPQKSNY
                     VPSLTSNRSIFGSKVADRRGLPHFLILSPVTYRYRENNDPNAVKTGTMDLMVYDATNE
                     KVLLMLTNSSDERRPRAAFLKAQEERYRFAAVVRSAITYENQYHGFECEGTVAEYFFD
                     AQEGPEENYYCIMAPHRVYSKQPNKVQVPMKALRPFTSCPPRYFVLGSNWGVSAGTRR
                     NPYPASYAHVELNENAVGLSNVIPDGFISSKVLPQLLSHAEGVQKLEEEMKRQQRAEL
                     ERPQSSPRALTRASRGGAATPRPSTAPPSPENNAADILADENMRGPGEEEDPLSPLVP
                     NEVLRPVRDQLLKQRRSWQSPAYIAFRARDSDLRRLPAVKDGHLRTPLNVFNDLMREK
                     HGEDAPPASAPSSARRSNGPPSSRTASVACT"
     gene            <220624..>223617
                     /locus_tag="LMJF_09_0530"
                     /db_xref="GeneID:5649482"
     mRNA            <220624..>223617
                     /locus_tag="LMJF_09_0530"
                     /product="putative leucine-rich repeat protein"
                     /transcript_id="XM_001681175.1"
                     /db_xref="GeneID:5649482"
     CDS             220624..223617
                     /locus_tag="LMJF_09_0530"
                     /codon_start=1
                     /product="putative leucine-rich repeat protein"
                     /protein_id="XP_001681227.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649482"
                     /db_xref="UniProtKB/TrEMBL:Q4QHX1"
                     /translation="MASTSGSLYRSRCSISSLAEAPLAKATALSEQRLPRTPTPPPAR
                     ALPAIAAAATVTAATLPSIPLDRYRAKLEECAELHRQLEELAQTKEAVEQRLASCQAE
                     AVQLRQTVHRLECVVQLRNEELVLLRDYRRQRGGGGGDGALASMRMVLPAAEAAAQSL
                     DRARGGAGQQFTHAAEGAAAADQAVILEYIRTSCYVGCPTHPQLIQSFFAASSGEALV
                     ATEPPLTYAQGSVLHRLLTQTPIGWGAAAAAAAAVAELSAFRTWACEHLRTFSVRFED
                     AYAGVSILSDALLHSLPSLAQLEVWGVDSDAALTKLADALVGATQVRELSLPELVVGD
                     EGLQALWRLLRIRGSMHAPCTAAVPAETSCAADSLALALCTLDLSACHIKDPLTLAQL
                     HCPSVEVLLLPPTDRVTDSFLAEVLQRCPRLHTLDLSGCARLTDACVEFFNSAAPQLR
                     VLALEHCPHVHRLQLDHVEVLLSSLAHVHALTSRSLRVLPLPVQQRVVLTSLVAPRLS
                     QISLHGLPVDEEVLRRLNGRSGEVDGCEQGVRLTSVTFSECTFVSDDVFAGFLQSQTD
                     LQKLSLFHCKGLSNACWVAKRGLPIFAALHTLELVNLRTLTDEALRELTQACPALQQL
                     NLHGAGWSHLTDISIRQLDQLSELRVLNLLALNPDLVTAPVVTALVQRLPQLQRLYHE
                     TAITLAGHSKSVESGDRGALHPVGAVDITSASVSSSVIVERSDAEARWRAALRDYPLR
                     MLRLQHHSALVLWTDGARTAEPRASREGVAQATGESLLTATTVDGGHDGSGIRVAEAA
                     AVAPSKLFPAMATRTMAAAIAASAASTLTLPSLKAPAPPQHGPPGEVRLGDAEGAPHA
                     SGCLVTSPQHEAALLPPLRRSTPGDPAHMDADECDQASPVHEQQQLDSPSSCSSSSSS
                     TYTRQPTQEGSHKGAGHSLKRSLVQCANAAASAAFQPYQHRPVRMSTGSSRPPVTATV
                     TAAAASAQAGSVEDHAEASMGPWEE"
     gene            <226020..>229355
                     /locus_tag="LMJF_09_0540"
                     /db_xref="GeneID:5649483"
     mRNA            <226020..>229355
                     /locus_tag="LMJF_09_0540"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681176.1"
                     /db_xref="GeneID:5649483"
     CDS             226020..229355
                     /locus_tag="LMJF_09_0540"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681228.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649483"
                     /db_xref="UniProtKB/TrEMBL:Q4QHX0"
                     /translation="MTSPTHSHASTTGSRRHHTPLLQERSNSLTRRQEMLKLQNGPPS
                     TLHYPASPQQEEADADAAMPGTVVVCGVRSAFPLIPLTDEAQIASGSAVLETPSPQSS
                     PSSLRGVPCLRRPSSPTAATLFQRQHSGTGIGGDEPCIGNGTNAAGLPPALCTRNRAT
                     RNATGRPPRVRPYEGQEEQLAELDAEAGAEEDRFSRGLEDDGCEAGDARSASDNAASP
                     HESDGRSSEENAERPDVAVEVIQPLVASIDDASLSSCTKRAPPPSQVVTACASAHAIT
                     ETTMAHTPQARRLTYNGDSSLEELDDDQPASEEVRPRDSRYPTQESLENHSDDGEGRR
                     ASQPADQPPPRSCHAQLEQAALSPPCAPTTPTTHRQSVEAMDASASVVKTDATSSTLA
                     TQLLAETEGRRNSPGAGKEALVAHGEVMPGVLQTIGPRVMSASSDDRSRNQRAGKGSI
                     HAHATEVEAAHSASWQTQGPQVISASAARRASRQAAESVDPWYTDADQQPSLLQTVSS
                     CNLLGSAADLSGANSRRKVYGSMLEDHSDTPVQAEETTTVRQASSTIAAEDSADQLQS
                     RCAGAALPPRSLVDESASKRPSLLASRASSRPDTSDGEEDYDGHLSQAKRADPKRATE
                     SMAAAACDCRRGEVDQVPPMHQPHTRKGELDDEGGKDDINAMNGRKNESEEHHQQQRP
                     AEEEQAVGAAAARGSDGKHGLVPQHRRQVQVSALELHQIRSCRALAHESSSETHQAES
                     IDVCEENEDSAEYISCYDVACQTSQHLLMSVREEWQGRAQSRQEASGEDDVSKIGPLD
                     PHYVGSNRWMCAAGVCPQCHPKRRVRGSSGGFGGRSKPTWPLAPCSTLGYSAPPRPVP
                     LQRPQGPARAATAGLGARLPPLGSSSSASTRTHPQLPPASSCQQRAQRAPSARPHSST
                     YASSSSSRSAGRHYRRDRYSPTVTSYQGGYCFTREWDAQQQQRQCRLRELQMEQRARR
                     GGTGAAYTSLLLLTSHDMRSRERAAGKDPRAYRYCNLKTQQMMVHTGVGRADLALESY
                     NDTLHGAPLIEAQEDDNDGAMKAIEAWKDREVIEQKQLRYPVAAVVSAAGSSNAATTT
                     NPRSHAHPAASGSAKASRLCVLC"
     gene            <231178..>232956
                     /locus_tag="LMJF_09_0550"
                     /db_xref="GeneID:5649484"
     mRNA            <231178..>232956
                     /locus_tag="LMJF_09_0550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681177.1"
                     /db_xref="GeneID:5649484"
     CDS             231178..232956
                     /locus_tag="LMJF_09_0550"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681229.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649484"
                     /db_xref="GOA:Q4QHW9"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:Q4QHW9"
                     /translation="MKPTDAGTDNNTHAASVFDWAEREMRLVVSLEDFLHAWAEGDRE
                     GGRAKAASSSAAIEAAVAREDERQHHPGAHPNPILCASGLDAASLATARIASAPSTST
                     LANEYLAALPPRLPAPPPRSFRPNEMMPGVYLGSWSDIGTDILELARRLRSVSTGSHK
                     SSLCTAPHSWQRLVLLVRACPVKGLVAPRLELRVTRRREGVRRLCPSTEKVSPAPSTK
                     AAAARLLQPPSQRPPAMHSRKRPGAATTAVPADEDVVVAHMSLSEVYKRVCAAVSTTT
                     ADTVSDASVICAEATASSKDEGYYHSGSITGASPSTTPSGVSRVARWLCPDSPLISPS
                     RSASPASSTAADVPSGCTLADWHVFVRAMQGVLLEEAPAHTPAGAALSNEEIAETTEA
                     DHGPCSATVAELRYWRLTLPILDSPGTRLLHYTPMTSLIMRAALTLEENPQGRAWLQG
                     QQQRRELVSNNAPAGSSHAMVDVASEGGACGEVGACGTEARVFPCAAVHCQAGKSRSV
                     TFVAAFLMQEWMWWYRGCSPPNTAGAGTSTAEQQKEQRGRQGSIARRLVDTVLSYLRR
                     RRLCIDINLGFDTQLWEMMCGFVRGL"
     gene            <233990..>234778
                     /locus_tag="LMJF_09_0560"
                     /db_xref="GeneID:5649485"
     mRNA            <233990..>234778
                     /locus_tag="LMJF_09_0560"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681178.1"
                     /db_xref="GeneID:5649485"
     CDS             233990..234778
                     /locus_tag="LMJF_09_0560"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681230.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649485"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:Q4QHW8"
                     /translation="MPPAHIFIARHSERMDHINREFAKTYSRPHDSPITENGVVLAEK
                     LGEYLVRHYCVDPADVVVITSPLLRCVQTSNAVVTGALRAAAASAKVDTIPVYLEPAI
                     MEGPYWLFADMCSNPSVVEPNDGPFHCPEPVYNDAAFHRASTSPHVQLHNPFPLHPPP
                     VFTVKGNKLVDSSFPERCTQGSKRLLAVPELDGKTVVLVAHGETVLRALHALKNTEME
                     AEYHSPAYTGFVHVTCECSGAETRVSVEHEPFATPHLPAEPMKS"
     gene            <235614..>237092
                     /locus_tag="LMJF_09_0570"
                     /db_xref="GeneID:5649486"
     mRNA            <235614..>237092
                     /locus_tag="LMJF_09_0570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681179.1"
                     /db_xref="GeneID:5649486"
     CDS             235614..237092
                     /locus_tag="LMJF_09_0570"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681231.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649486"
                     /db_xref="UniProtKB/TrEMBL:Q4QHW7"
                     /translation="MSASPSSPSTAAASASPQDTVEVLLCDSCRCPIGSLWDVLPAEE
                     AVPVWRDQVYSYELDLFANGSPPIQAYSATNPSARRFDLLRLAPYVTLHRVSTPRGEA
                     PPPGADASRSCNAGASTTAASALDAQECEGSVQVEEVSTAHAPPADATGTRGAASTTL
                     HAPSFVECHTTVYSTEHSFFAGYAWCFCNCSNCGAFLGWGFAAVDRLRAARRLHRGGK
                     SGEVSETGDVGRPRKKGARQEEEVRKTETDIATAAAAGDSQPAESSSPPAAPSAPRDQ
                     HQQRPRGEGEGCRSGAHASDLAPPADSDDSSDEGTSMMTTSDSNDGDDSSAIGGGGGA
                     RGGGQEHTNTGVTPDFIGIIITHCTSDPDYPIASLMRDVEWRAARQRRRKRVEALTRR
                     ISLLLPQMRDSYRAHEIYHDYHAMEQLLYAAPLLPLQDVSDSFTTAVTALLSDVDEDG
                     VPIRMHATVEAARIAVARQMDSDNSSGVSGHSSSGHEGNSPS"
     gene            <240009..>240866
                     /locus_tag="LMJF_09_0580"
                     /db_xref="GeneID:5649487"
     mRNA            <240009..>240866
                     /locus_tag="LMJF_09_0580"
                     /product="surface antigen-like protein"
                     /transcript_id="XM_001681180.1"
                     /db_xref="GeneID:5649487"
     CDS             240009..240866
                     /locus_tag="LMJF_09_0580"
                     /codon_start=1
                     /product="surface antigen-like protein"
                     /protein_id="XP_001681232.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649487"
                     /db_xref="UniProtKB/TrEMBL:Q4QHW6"
                     /translation="MAQRARRLSMAVLMAFVVCVLLFAGGVTRAALTAAQNSITAEFL
                     RSFAVSIPGLASVWTGDDWCTWPYVSCNSDTSITVIIDNAGFTGSLPELNVAGDSANI
                     AVTEIALTNMDIGGGFKNSWGGLKKVRVLNFTNTNLFGTIPVSWNAMRSLQTVILRNS
                     SACGSLPRWTLPSLKNIDVSNNLLRGSMPNTLGYIAGLQNVSLVGNNFCGCTPPSWVS
                     RVLTSALFQAMGSAPYEPNCRPPINCDSEGAKCSRDAPQYRDAAAAPSCMVVAVLTVV
                     LTLVCNFSV"
     gene            <243370..>246360
                     /locus_tag="LMJF_09_0590"
                     /db_xref="GeneID:5649488"
     mRNA            <243370..>246360
                     /locus_tag="LMJF_09_0590"
                     /product="putative ATP-dependent DNA helicase"
                     /transcript_id="XM_001681181.1"
                     /db_xref="GeneID:5649488"
     CDS             243370..246360
                     /locus_tag="LMJF_09_0590"
                     /codon_start=1
                     /product="putative ATP-dependent DNA helicase"
                     /protein_id="XP_001681233.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649488"
                     /db_xref="GOA:Q4QHW5"
                     /db_xref="InterPro:IPR000212"
                     /db_xref="InterPro:IPR014016"
                     /db_xref="InterPro:IPR014017"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QHW5"
                     /translation="MDESQIRAATYPADAALILQAGAGSGKTQTMAARIAYLLQSGVP
                     GHSILGICFTRQAAETLRGRVRSTLPPTLTREAHALKLKTFHAFGLECLRRFGALQAD
                     THVLDARQQHQLARRVVDTYAQREKSSEAVTDLVDYVNRVKTMRMPPIPQLDPALQDA
                     YLFPYYQKALHEEHNAVDFGDLQQMFYDLIRPVPATALTASQGCGGGLDEQQPSQGEH
                     QPPQQQQQGGMVPSDVCTALRAEYTHFVVDEFQDFNEIQVELLALLAGDACHVTCVGD
                     PNQCIYTWRGAMPNVFGVWKKRFPQTAMLTLAVNYRSDGPIVEAANRVVKATQMAHHH
                     REERAVTLVQCASEDDELQAVPLVIEHVLRRRDAHLGYGDIAILCRSRRRVQLYCDVL
                     QSQRIPVRQLRGMSVDHLASMRSLLAFLRLCVSPHGPEGDANVRTVLNTAPLHRLSPG
                     AAKKFLLSLDSVCQARRATEAARIRSWRHTIHVDNSSEVGADNGGAQGSRSEGLQPGA
                     ARTSVIGGGCPTATTPGVHPESHSFFAVLQELVYHNFSHALFPKLEVSKKNQKNIRSV
                     VRIVVHAKELLAQPSCDVEQVLRYVLREGGYEGESMAAVAARTVTPSATTRGTKRARN
                     SAEGWGSDRCVDEASGRSSASAYQPRVGALLMERCASQHNQQQQRYTSSSAPASCSSA
                     GGGDSRWDRWHHGSRRSGAASGSDGAGDEDVLPPEEEAAVWQEQRMNLSELVLHTYHS
                     VQEALEREVTHELDKEGGGGEGRGEEASSRSRPSQASGNHSNSRSRLFSKATAADDSV
                     SNFSAGSTTTTMTVMQALRPPAVVLHRVLDEFVSLVSSDDYGPMREIGNADDAAGAAA
                     GADTAGNGGRLPTSTSPHWIGEVTVGTVHRAKGMEWPAVLLPGCWVGEYPVRPRDEEK
                     RVFYVGMSRAMKHLVCFTAAAREGRPGSGQAVTAASVVDLPAQHSQSGTLEPTPYLAA
                     LGDTLERVNYADLKTAYLTEQGYL"
     gene            <247294..>248301
                     /locus_tag="LMJF_09_0600"
                     /db_xref="GeneID:5649489"
     mRNA            <247294..>248301
                     /locus_tag="LMJF_09_0600"
                     /product="putative serine peptidase family S51, peptidase
                     E"
                     /transcript_id="XM_001681182.1"
                     /db_xref="GeneID:5649489"
     CDS             247294..248301
                     /locus_tag="LMJF_09_0600"
                     /codon_start=1
                     /product="putative serine peptidase family S51, peptidase
                     E"
                     /protein_id="XP_001681234.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649489"
                     /db_xref="GOA:Q4QHW4"
                     /db_xref="InterPro:IPR005320"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:Q4QHW4"
                     /translation="MSAPHLNSVRACLAGSGHDAFSEPVTIDHLLSLVATPKTGVVSV
                     AYVGTATYDLAESQTEQTSLLLQRGWTVRPIQVADPAVKAVNDSDVHFIQTAADIVLV
                     SGGNTLYAVRRWEETGLAQLLKDAAARQVVLAGGSAGAICWFTSGHSDSADPATYLQP
                     SLKRAALKMGLIPQDQISKTEAELADLSTSWSYIRVRGLNILPGMLCPHFDVTQGNGV
                     RREEDFTKMLKRHPTERGIGVDNWALLILKGDGTYESAALPGKTRVATPGNASPTATV
                     PGIFVLDVVDGAIQQRRVPTTGQLSDLLREPAGPAVLDPFERFHAMENPTSSSGSLMQ
                     R"
     gene            <249491..>252004
                     /locus_tag="LMJF_09_0610"
                     /db_xref="GeneID:5649490"
     mRNA            <249491..>252004
                     /locus_tag="LMJF_09_0610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681183.1"
                     /db_xref="GeneID:5649490"
     CDS             249491..252004
                     /locus_tag="LMJF_09_0610"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681235.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649490"
                     /db_xref="InterPro:IPR028146"
                     /db_xref="UniProtKB/TrEMBL:Q4QHW3"
                     /translation="MAGKGREWFPVWMSNFLISTVTASRAGDEDGAVVGGSFGAPPSQ
                     PRGPAPPPLTGSRSGPPPAPQGTASDARSLTAAQNPTPAAPSSSSTRLHCYTLEAYSE
                     TFLQPHRKSTAPPLFSCGTRVVDLHSEERREVLAACQAGRGAEPLRDGSADPNREGGS
                     LLPTLRVVLTPQEVQWHLVVQPANVVSQRIPLSRVNDDYCDCLDGTDELLTNACSMSG
                     PLTPAVGTRWKSYLVSNQPLRLWEADDVIAQEDAEARGYPLQPRKLGDVGDRLYISNG
                     PVLPFVCACGTVRQLLAPSLVGDGIVDCCAAEDEAVLQGTPYGGASPHRLREDPNVVG
                     ANDRALEATRAAMIMQWKQRRASAAQYKTATPSLYEDKLYPYHTSARAMLVDKGYYSL
                     YTSLEVQQEKQAAAAVLERIYADGHRIQRRRVQKGWDRLGRHLVSNRTKLQLQLSNVT
                     RELESLEEYVRYRMGEARTNDPLAAGVSVQQLQHHARLVHMSNALNSEIQHISLTTLH
                     RAYGDHYEYYPLMRRIMQLEASHLVDSRAPTTLDEATAQQRRERIITPTEVERRNAAA
                     YAAQQPAPPLHVDNISVSDYGLEVMRQTFVAQRFGNHEAPLVAQRLGLLPNNNISAYT
                     PGVFNRTTSPFQRAPVITTGSWQPYQSHRDGRVMVIADPAGDVHLARRACVRPASTLF
                     RGGGRLQWPTRHPEAPHMLSVSDAMEAKKTAKDKLKAASAGETAKVSHVYTPYHTNMP
                     SVFAVDVYTGDIRCEHDPPLTSSQHRTGGAGRDEDAPWRRAQTVQAHVTYLCDTKDSI
                     LHWANNGKCSQEVVVGTPSACTGWAWKVATERMREVEKV"
     gene            <253348..>255306
                     /locus_tag="LMJF_09_0620"
                     /db_xref="GeneID:5649491"
     mRNA            <253348..>255306
                     /locus_tag="LMJF_09_0620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681184.1"
                     /db_xref="GeneID:5649491"
     CDS             253348..255306
                     /locus_tag="LMJF_09_0620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681236.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649491"
                     /db_xref="UniProtKB/TrEMBL:Q4QHW2"
                     /translation="MRRSKHRASPGGGGGGTVSHVTPMSPDDKKRDDSDRVDKLAQQQ
                     QAQQPDGGLVAIENTPTALRRRAQYSRAKPRPIPNSLRTGSDAIAVSAAVDTFYTTPF
                     LQLAFREATEREVAARLRWSVQKMSSKLHTVRVEGLKEATAQLLQWTTQASIESAERQ
                     QEQQQQQTKSDARHTDSAAAATPRGRSNLMLPPYDAVRVEVLGGSSPAVAHGHYPHHQ
                     RPPSSELPQRHDNEAAAARCANALRSPSWDVVQHALEGVDYTSSIFNTILVPRLEVRN
                     AMSTGAPISVQLPSDVALQWTTLPTTSRSAVGATSGTASQEAPPPENKLLRAATAVTY
                     EEQELALRYIQGTCLILYHQRRCCAEGCLLYYATEVFQCMRSHIDALFTSQRREREEQ
                     EGEEQTCQRGKRGLSTNHGSVSGARTPGTSSATTAAAFTAALRESGRSQVSVDPSLVR
                     VVVALVDAVEAACHYNPSSLRRFVQTGGVTAMLNLAYCPFMPTPIRAAVLNTISVLLQ
                     QVTPLRRYVAAASKAQGTSNPGGRGGAVEPNPDPLLQRMLENAVHDNPLGRDGQQIPY
                     STDFGSASKFDSAVRDWFFANGLGNVIASVAQLQDLRNTFQPTSFIVPQGAAAATAVA
                     HANMLREGELHRKRIGWLLECMDGRELR"
     gene            <256926..>260411
                     /locus_tag="LMJF_09_0630"
                     /db_xref="GeneID:5649492"
     mRNA            <256926..>260411
                     /locus_tag="LMJF_09_0630"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681185.1"
                     /db_xref="GeneID:5649492"
     CDS             256926..260411
                     /locus_tag="LMJF_09_0630"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681237.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649492"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:Q4QHW1"
                     /translation="MNSLQTPVAEAAVACLRVLHCLLQDEEVTLAQLSYLIENVHDPL
                     AHVCLPPSQRPTAVPALQLSSPSASALNRYSSPGKHAHSSARSTMAAAAANEVKARRL
                     PPQPAVVETAAPAQKEATPPKTAKSTERMHQTSKKASRTGEVNATASPSSTSRAEARV
                     PLTLSRYWAIFANLPTLYTVHLTLVQQLDKVLLRLTQIVDELHPATQDTENGGVLHSS
                     AAMPVPDAALNTCKDVSALRNPSASPAAGARSVYNEIGAMVCEFFGSDLMKHFMAEHM
                     MYTVKYTQQGAPQLLRLSRLWRWCAEPSGSSGVSAASLTHLSEMDRKMILENDLFLDF
                     LWRSFGPSGIPADDRVCIPASMELKQCTAAGGQDQALSRARALAGGSGVTRRSRSTAA
                     ASSPAARLPPIPAMWEGFHTLLVLLATPLSILRRYSHVARCLVESGALLPNDRKRLQS
                     CFVNVAALRISEETNLVMEELCLHDVRGIMALMDIPGASTNSGGAGVEPINTGAVPAL
                     SSTGAPANRSNRVLIHYGRLLKRFERGRHERLIFLFSDWMCYAQESSNGRFRVRGTIP
                     LAGLRVVEACDNPSMDMVNCFELVAPSLSKRITLYAASPEQRDQWVDAIRYTVRRFEG
                     QRQRQAATNGSAHNSNTNMAAGDGGMPSAMRPTAPILIPKSRLSRQRHNDIKWQAYGN
                     LQRRTAEIAPQPLHMISGAARVPLPATAGGPVGGSSSFPVCHSPPPANVPSGDPSPNN
                     SAVRQRSRSTHWHLDYSVKSWSARTSVHRRIRSQELIAVHQQKLAASSSHIATPTKTD
                     GAPPGGGGATVESNSNLGPIVVHSLDTGNMDSTSPVREADRNAPLQRQHSRQALSPVT
                     STAAVAASAERRSSSSLHAFTIDIIVSSNRGGGGSGVSTPLRRPVSERFEAANISSRG
                     GNTPHQPPQETFAPPEKVARHPGGRRVASPPSSLESSSSSSSGVLDNVIGRAGPPALV
                     TDGVPASGAPPSASAGAQAWSRADSGPPSKSIVSAAEIPPTSPMVVEENNSGDSRPIT
                     AGDQSASGTGSVMSAAAPLEESVDGGAEEDDSVTATAVVTAFRTPGVIYHRLMTPTSP
                     LVMKSRPAAVPRENSDVPSPFRPIRNSSTGFDANVRKTTVAAVPLQKTVVPRHVDPMK
                     KVPHGGNSDDGPVQP"
     gene            <261506..>263008
                     /locus_tag="LMJF_09_0640"
                     /db_xref="GeneID:5649493"
     mRNA            <261506..>263008
                     /locus_tag="LMJF_09_0640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681186.1"
                     /db_xref="GeneID:5649493"
     CDS             261506..263008
                     /locus_tag="LMJF_09_0640"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681238.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649493"
                     /db_xref="GOA:Q4QHW0"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="UniProtKB/TrEMBL:Q4QHW0"
                     /translation="MLMLIFGTFIGAIALVGTFMYIIIMGPSRCHRDGVVGKLHRLLT
                     SVPLSVCGFCVSCCFGCDQRKGRLCCSRCAEHTIHERNWFMVVFYVVLVWTVEGLYLL
                     VSLPRLKASITSKAVSWVLVVLSEFLWTCATFSDPGTVTAEADRAAQRQQFATKAAAG
                     AKKRPLSREMAKRGAGIAGQGTAPGNSNARRAFLFSPAQEFVLNHRYIVDGMVYAIAS
                     DEATAQLTRAEKEYTSPTVGKPVQLGQSCTSCHVFRPSRSKHCRLCHRCVRRYDHHCP
                     WINNDVAERTTRYFLGFLLCHAMSCTWACIDLFRNIRQFLMTHHAWGWVLRYPNGRTV
                     PLNLSQYLTILVNFHLLEACLFFFAFFIGLVLYGFWGYQMTFAVANLTVNDLNKIDDT
                     VEFVVTLPTLDLVYRESRKVRERLEQVAERKPKALLALTAPPPPKTEPGYEEGGKENL
                     AYRKRAKKMLTEDLKGLYDRGVWRNLMEIFLPSAPLRDSAVLAKATACVL"
     gene            <264071..>265933
                     /locus_tag="LMJF_09_0650"
                     /db_xref="GeneID:5649494"
     mRNA            <264071..>265933
                     /locus_tag="LMJF_09_0650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681187.1"
                     /db_xref="GeneID:5649494"
     CDS             264071..265933
                     /locus_tag="LMJF_09_0650"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681239.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649494"
                     /db_xref="GOA:Q4QHV9"
                     /db_xref="InterPro:IPR010488"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QHV9"
                     /translation="MTTTASPQTGSSPTVPTPVAPPSIDEALSYWIGLSRLIHRVCVT
                     SDSTPSADEGEPSTFTRYALHCVLLCCGIKQHRVRQTADHMLAQLLSAAYTTAAALTG
                     PVVLLDSESPASTPFRSPVRQLPVPLPVLVADWLKQSSADDQKASQHNRYCLRVPAVT
                     WTRSIIKWLGSELRGQMISLRPLSRWNMVCAQQSGRMPVVIFVGGASGAGKSTLASLV
                     ASQLRVPNVLSTDTVRQVLRARLCGHEAQFPALFVSTYEAHKVTADDSHASADDGSAV
                     PHAQSADENAIVQGYEAQCELVLRVLDGMLARLLARRESIVVEGVHLLPRYLAAKRAE
                     LLVSRVACVPVLVRIPKADSHLERLCIRARGMSMRAQNNKYIASFKAIRAIQAHLVDS
                     VEAASLPVLVLSNTNMDKSFTALHHTLLETMEYAAVHGWPADAAAAADVPLTGLVFRA
                     VKDRLVAVVRQRRWRRSATNDNISTSSGTGASAPGDEEKGGVATGPFSALVLAPHARP
                     PVHSPAGSSNGAAPRARSAELLGVVQRCLLEQGLRYHSRTSNAQVDAATVYGSSGVLG
                     ARDASSRFHAHVVIRRSFTIAAKSHISMTASSHLPLDNHNEEFDELEIPSLIGS"
     gene            <266608..>267666
                     /locus_tag="LMJF_09_0660"
                     /db_xref="GeneID:5649495"
     mRNA            <266608..>267666
                     /locus_tag="LMJF_09_0660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681188.1"
                     /db_xref="GeneID:5649495"
     CDS             266608..267666
                     /locus_tag="LMJF_09_0660"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681240.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649495"
                     /db_xref="InterPro:IPR003827"
                     /db_xref="UniProtKB/TrEMBL:Q4QHV8"
                     /translation="MSDAAPGPAPAPVTAAVDAPPLPAPTKVKPPRKKPPRAEEANPR
                     LLAPANGVAAQQQKQRDKEFATHKAHILTNLQTNACDLSPKGSLDAKCLPVMGVLNTH
                     KDYVTTSSCSGRIALFHSIKHSEACGADDGTATPKPRMKRGENAALGWVFVKHGMLRP
                     MEMAQVVGFLCGAPTTPEDVALDSAQMEKHAAHMASVSCSAHCHSAAPGSLLAEMYDG
                     EVEGALVGARVSGDEVAALPVPTRGTVSLKMEPFVMHVQCRTMEAAKLLLSAVVSDSG
                     FRNSGVVPPGKKIMCGIRSAAGLGLEVPVVVDGVNHVASQRAYVWALLGLANEKMEAN
                     EKKIKLLERSVAARVLPA"
     gene            <268339..>268755
                     /locus_tag="LMJF_09_0670"
                     /db_xref="GeneID:5649496"
     mRNA            <268339..>268755
                     /locus_tag="LMJF_09_0670"
                     /product="putative prefoldin subunit 2"
                     /transcript_id="XM_001681189.1"
                     /db_xref="GeneID:5649496"
     CDS             268339..268755
                     /locus_tag="LMJF_09_0670"
                     /codon_start=1
                     /product="putative prefoldin subunit 2"
                     /protein_id="XP_001681241.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649496"
                     /db_xref="GOA:Q4QHV7"
                     /db_xref="InterPro:IPR002777"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="InterPro:IPR027235"
                     /db_xref="UniProtKB/TrEMBL:Q4QHV7"
                     /translation="MSANTSVSESSLTEEQIVQQYNRMRQEQSAIMSRIAELENESHE
                     HDLVATELRPLNKDRCCHRLVGGALVELTVGEVLPDIEENLAAIREALVQLNKGLMEK
                     EKQMDEFMTKHKLNRPGANQAVTANQSNEGNRGVLA"
     gene            <269301..>270410
                     /locus_tag="LMJF_09_0680"
                     /db_xref="GeneID:5649497"
     mRNA            <269301..>270410
                     /locus_tag="LMJF_09_0680"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681190.1"
                     /db_xref="GeneID:5649497"
     CDS             269301..270410
                     /locus_tag="LMJF_09_0680"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681242.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649497"
                     /db_xref="UniProtKB/TrEMBL:Q4QHV6"
                     /translation="MFPQGLIDQWLSKSREGRRSVREDRKATPAILDNIARLEEYCRS
                     HPYDVFCASTLQHPPFALHALESEAAEQQRLAQPPPVFAATVPSPSAHTTASNEVRGG
                     VCGRYADGDESRASVTAARQHLHNVAARLAAYLQSSGAVRSSASRHEEESQCTVVADF
                     FVHLLSEAAVAAVYRQGIAAQVEAEERAAFQHRQSQRRLQLRVDSKHDGTLQRLELSD
                     SKGADTEAVHEVEGLTVVRPIADYRRLSQGLASLWSLLAQTQRRGGLAVGGPSKERSR
                     DSTADTDSVNDNDNLWTRVRVDCLRHWLGDRALPPPPPLPGTAALGETQRKTEASSPA
                     MPGGAWWSRPLYISERDVEFALRKVLADVTASAAS"
     gene            <270703..>271623
                     /locus_tag="LMJF_09_0690"
                     /db_xref="GeneID:5649498"
     mRNA            <270703..>271623
                     /locus_tag="LMJF_09_0690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681191.1"
                     /db_xref="GeneID:5649498"
     CDS             270703..271623
                     /locus_tag="LMJF_09_0690"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681243.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649498"
                     /db_xref="UniProtKB/TrEMBL:Q4QHV5"
                     /translation="MSSKLINAVCTMATRECVAELALFHRALRMLHPTLPLYLGCSSE
                     IRDAAEAATDATSQLRSLHDDAHVRWVLCLDQYGPVISRAEMERRRGVWYPARHTDFM
                     MEKANLMELALMTAEASTPTVAFLDCDITLLRELPCVPAAAAVALSPHWIRESDEAVF
                     GAFNGGYVVASTPEVLWEWRRATQTSRYFDQASLEQVAAVFERRAQLHRLPPQHNYGF
                     WRLLQSRCGSVAEEARRFSIAPAPSPGSEQQPAAMAVHYDGAPLCSVHTHFLMPDPPR
                     DVRLFNAVLERWLGRCAATNPVCAAALAHF"
     gene            complement(276887..277006)
                     /locus_tag="LMJF_09_5SrRNA_03"
                     /db_xref="GeneID:12982584"
     rRNA            complement(276887..277006)
                     /locus_tag="LMJF_09_5SrRNA_03"
                     /product="5S(M5) ribosomal RNA"
                     /transcript_id="XR_002460093.1"
                     /db_xref="GeneID:12982584"
     gene            277080..277151
                     /locus_tag="LMJF_09_TRNAMET_01"
                     /db_xref="GeneID:12982591"
     tRNA            277080..277151
                     /locus_tag="LMJF_09_TRNAMET_01"
                     /product="tRNA-Met"
                     /db_xref="GeneID:12982591"
     gene            277210..277292
                     /locus_tag="LMJF_09_TRNALEU_01"
                     /db_xref="GeneID:12982595"
     tRNA            277210..277292
                     /locus_tag="LMJF_09_TRNALEU_01"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:12982595"
     gene            complement(<278098..>279468)
                     /locus_tag="LMJF_09_0700"
                     /db_xref="GeneID:5649502"
     mRNA            complement(<278098..>279468)
                     /locus_tag="LMJF_09_0700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681192.1"
                     /db_xref="GeneID:5649502"
     CDS             complement(278098..279468)
                     /locus_tag="LMJF_09_0700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681244.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649502"
                     /db_xref="UniProtKB/TrEMBL:Q4QHV4"
                     /translation="MYSFSPVTPGKTAASPANDLVSSSSNSNGELVDDIKESLDRIEK
                     LLNRGQQLLYGDGAADGKKAYSEGAAVTPDGEPADADTVSIPTARHVDANCGSYQLPS
                     DTHVGLPLRGTGTSAAANASLYPQSTSQHSASHFQRNSEKLYQRLSGESNHRYPSQNG
                     SNRSSLHARPHANRASVGSNRLPPGFKDKVLVSVRGRRIVQIQKEGGIVPNFEEGLDA
                     HDTPQNFTIEELKARIHRELEEYRRLGPLMNRYKSFRRRQCVTVAKRAPMMKIASRTF
                     TAATTAALGSKLVKHIPAPASASTPQGAANRFGVHAAAATTKTGPHAAPASRQAAKST
                     NGTPARSTLRNSHERGRVETRRADRGSHPPMMAPPGNSTYSAYYNPLQMSGGSRNASC
                     ELSLKQTAGCSDVVPQHARNVSKSKPRTTEPQDDMEEASLPDSMEDCDASQPYVAPLD
                     LSVIKK"
     gene            complement(<280911..>282461)
                     /locus_tag="LMJF_09_0710"
                     /db_xref="GeneID:5649503"
     mRNA            complement(<280911..>282461)
                     /locus_tag="LMJF_09_0710"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681193.1"
                     /db_xref="GeneID:5649503"
     CDS             complement(280911..282461)
                     /locus_tag="LMJF_09_0710"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681245.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649503"
                     /db_xref="UniProtKB/TrEMBL:Q4QHV3"
                     /translation="MRVAATGGATPSAASPAGDNASTSSEVRAARRITEAVLSARAKH
                     KLQHRQPSPPTPVPPSVRAKAKAPRSPASDIEEGVVKDTVTVEVQTAARLALSYGKSA
                     FMTHLVHQHDDAHQRPGTVSASEWDQPMVSDAGEPEASVMTASSETCAVLPLRARTPT
                     IPRAAAGTPGLQMAIDKWWRDLTDEARVRWITSTPQGRRALQHATKLAKFRNVSCGQG
                     RSSNSGAHVVPSMESMLTKYKNTLAQPRLPRAAALAPSPKESILRMKLQDEKGASVSP
                     SSKPTTVSSALAGMMHAASENNANRRLLRDRADAVRREEQRKLWHQALVQFLGGASAF
                     TFVHDVKDLQQPRTEAEQAVKREPGAQSGGGAGRATTVAPNTPAATATGNATPEEMAD
                     DGAPVAFSDGLLDMCEGLGIRSPRRAYVLSRVLPEVDAANASEGPPLSLAEVQDLAKK
                     CSTEYDELRDDAMRTARETGSASAEDAVRAFEREQLALAVARVQKKLVMFQENLPLLK
                     RCVNVLSK"
     gene            complement(<283716..>284735)
                     /locus_tag="LMJF_09_0720"
                     /db_xref="GeneID:5649504"
     mRNA            complement(<283716..>284735)
                     /locus_tag="LMJF_09_0720"
                     /product="putative cleavage and polyadenylation
                     specificity factor 30 kDa subunit"
                     /transcript_id="XM_001681194.1"
                     /db_xref="GeneID:5649504"
     CDS             complement(283716..284735)
                     /locus_tag="LMJF_09_0720"
                     /codon_start=1
                     /product="putative cleavage and polyadenylation
                     specificity factor 30 kDa subunit"
                     /protein_id="XP_001681246.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649504"
                     /db_xref="GOA:Q4QHV2"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:Q4QHV2"
                     /translation="MFVDDAAGTHFDFEDTLPKEQPRAEKKLEICQDFQRGRCRLGDA
                     CPQRHIISAYRTVQTKVCKHWLRGACVNGDNCLYLHAYDNRYVPQCAFFERVGECTNP
                     ECPFLHTKPNESQPECAAYRRGFCPLGPKCRLRHVKRESACPYYLAGFCPLGPRCPLG
                     HPIQERYDRDAVSKRILAKMIVERADDPTFNRSATCYRAGCFDPGHLAPDCPGPQHSV
                     LHKALGEIQEPGQPTGGLENSGHGGGGGGSHRRCFLCDQEGHTVKDCPMNTHRTQHRA
                     GGGGGPGAPHGSGGGAGVGNRRRLRREGVAGGGGGGGSAGAGAGAGGGFGGGGGRRRP
                     GRDHY"
     gene            complement(<285445..>287346)
                     /locus_tag="LMJF_09_0730"
                     /db_xref="GeneID:5649505"
     mRNA            complement(<285445..>287346)
                     /locus_tag="LMJF_09_0730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681195.1"
                     /db_xref="GeneID:5649505"
     CDS             complement(285445..287346)
                     /locus_tag="LMJF_09_0730"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681247.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649505"
                     /db_xref="UniProtKB/TrEMBL:Q4QHV1"
                     /translation="MDASSTLPSASVAASSLVSSPFVPCIEDSAHTRRVGRHPVLFQR
                     TLDAVSYRYLTASSRLARTVASSSSDKNVGSVALQATATANAAHAAYVTTLTENYQQL
                     WQQRGLVPKAARREWFETVVVHLKALNALGATLAWLTDAPATVASAALSDHDDGDRKQ
                     QKSRKLAHDPLPLWCLWQDAQRHLHHMSLRLRPRPPAAGVAYGTREAMRMSDLARMDS
                     AAFAWRVRQWCCVAALFRRPGGADTGAASSLVGVAEAVHPGMLADVVCRVGPGGSSSM
                     SAASPFPDSFSAEEPEVARMLRLCLGPTSETAAENCLARQYVAGALVYRMLLEVTLGR
                     LRALPRCIFTWRLLRDVVRDHLVTSAAGFHDTGNEQMAVLLEMAAYVEVVVIPYLQHR
                     DCHLASLRHTAAQVHAQFTRLASAKLEQLRAAVARAGAGDGDEMRTVAESEAGTPDAV
                     VDDVNAATAPAAEANAEVNKEEQGRLPEAQRHRMTASMEPLLRRACAGGAPAFAETIA
                     LPLPTSHTASESAVQGAKDVIASIILGNTVTSDRAKRDEAGGGHQGDVPPAPSGSWED
                     ALLSMRHDFHGKRVDDSVLHSSAARISQLRFFLYHYFTQSPTLAFDRVSDTAAAPAHA
                     DAGKEGEAY"
     gene            complement(<288104..>294799)
                     /locus_tag="LMJF_09_0740"
                     /db_xref="GeneID:5649506"
     mRNA            complement(<288104..>294799)
                     /locus_tag="LMJF_09_0740"
                     /product="putative ubiquitin ligase"
                     /transcript_id="XM_001681196.1"
                     /db_xref="GeneID:5649506"
     CDS             complement(288104..294799)
                     /locus_tag="LMJF_09_0740"
                     /EC_number="6.3.2.19"
                     /codon_start=1
                     /product="putative ubiquitin ligase"
                     /protein_id="XP_001681248.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649506"
                     /db_xref="GOA:Q4QHV0"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR003126"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q4QHV0"
                     /translation="MGYNPDIPSTWSIKQLLEYARQRGIDVPSGCEKSELVTIVDEYL
                     TDELLAEHIRKENALDTDVIEDIAGASTASILRHAAHPSYTSVLRRHPAKLQAIIEAG
                     IEQLQSLPFVARLCSARVHSPLQAWLGTLASDCGDGKCLLTVLTASNSDVAASPVCGR
                     FCGEQEMVVRCLDCGADSTCVMCMDCFRHSPCVNHRYRITQSSGGGMCDCGDPTAWKL
                     ESFCSRHRAAAAAAAAGDGNSVSDPLDTMAEEDRVWAVPVLRGIIQFTAVTLLQHTRL
                     QVLQKRAQSRARKQRRAASGAGNSTASGSGTSTAGTAATPSFSDAEAALLNDVARISD
                     KFDWLEEWMSEVTRQLWELMQASDIAKHLVAQLWAEPVRMAVCGGPGAVVTAAHDNEE
                     EKIGGETGTAASMADPVLDALPPNFTCVHMVFLHEASRPVTAHEQPLNATSRSAPWLN
                     NLLRCVGHCLSNAKFRFPVGGLMAAYAEYINAQERSEDKNECLSQYQVQVLTNPDVIR
                     HLMTPSHLPYKAATNTVLHRQLSALLYALWLARDTVSGASANPVTETAALSRDGLLFV
                     AHQATPVSLASVTALQSCLSGSPAACYTLVLNRLAWRAFAQVAGSLAISGYICKDPNA
                     PTDSQHYPTPDFIGRCISRHMWLWVHAMRVVLSCLLRLPATAATDSSASMPALPHDSI
                     AEVLGITTELWETWRGATAFDTPPDRLRQKGPLLEMLSACRVANGKDEALLLLEHGPM
                     AAAQSRVLGKQPLAEQVGTAVTAKTSILAAPALATAMGYTIQALYEISRTMDVVFEKQ
                     RDGFCRRCRSIVLERKTFMGLPRSQQAASHGGTSENEEARDADGKAGARLPAPSTCSV
                     DIVEYTLLEPHAHATTLSNHLPRLFGAVLTAWVIESQRATSRLQSAAPSSSAAPAEVL
                     AMTRISGLPRASTNSTAAAGETSDLPATPAHARRPLRSLLDAFFQLRAEVTHNEQDRL
                     TFSQQLLDSLVMPHVLTGQVFDGLWRRGDYDVSSAVTMYLTFSRGVSAEFDILMMQVL
                     TMELAPADMSLQILQRFSYAKRRLRNVDTEHAHQAPRRRASALHGQRPADKLPEKPLD
                     ALPTMLAARRPFFRRCLNGYRHFLRLILTIVTDVSKAAFQAPMSSPVIDRIVGGLLAH
                     GKVSHSSIVANVNGTARGGDYGDADEDEKDASGNVIKFSRLIDAAIRKLAVAENSAQG
                     KQFQLKDVDVWRTHVGLYHIGVVDSHLEEFYKTYRGLASAADAAKQKEAESHALADGD
                     KSDNATGGGGQQQKRISLPPTQLSDTSMYAELVPTTRALLHTDAVLLPALYVLHLYAN
                     CHVPAAVAAASDAKAAVADKEGTASTAALAQESPLSRHDNAMHESADDGREDTESGSE
                     DDRHSDDREDPNVITREALLHATTTLYLCVQDCVSITRAMRAIEGYSGEMASATEKGV
                     ISWDLLELYLRRFAINAPSFTHASCVQWLPLPELVPCQTLLEKLQTPVRLHTHTSNGT
                     PTAIATSSSADMLHRLRGYLLSNKDTDPYGCLEMVEAVLVQTGLATFSTADLLDEQKT
                     KDEAAQSRKKVIQERQALLMQRMRSRALKASEKMKVAATAAQQQEGQRGGDEASGPAA
                     SASEKSPTGGVIGSLLAKLLLELTTLDCCVCRSTTEEPLFLLCHTGTSGMLPQLGALS
                     LPDGRHVHSHLSMCGHAAHKSCVEKVFVRLAVLWQRWNFRSQFYLGPTEFNCPVCTTI
                     ITALCPMPVLSCGGNGDWTTATSRTTRMLSSAATPFASLFEELQNGTVSASNQRAVDV
                     AAEFHTTLANAAVGFSPSEDVPAIVSAEDELQQKNEAAWQLSEAIRAFCYACHLQLEA
                     IKAGQELSHRDLIGLLSVLVSIMPAELERQQADLRSNYARNMQDNESLLVMDALLQPR
                     DASRLISAHVLTRVLPSMPVNVIARLVAVACASNTDDNGEGSHAAAAAAASLEEEFTG
                     VTAALWQTVGVLTLLKALVVEDAHHGVVLRSSTFTVAGAVTFAVPSVASVRTPVSRCT
                     SIVRMLQYLLPVPHKSTEAELQVVGQDILACMQAATTPATLSCSGHGMEIVKSAVPYT
                     TPEEWVARIAEELLHLPSVYTTVLTRFAEHKLCAICHQEPTKPVVCCRCGKLMCMQPP
                     NSPPELYTHTRTCGGAVGIFLVVRTANFYVLELTSGRVYHYPSNYTDEYGEHDRNLRR
                     GIPLFRNTEETQKLVLTWMLNKWGAVSSIFGVSNRMDLSTL"
     gene            complement(<296504..>299503)
                     /locus_tag="LMJF_09_0750"
                     /db_xref="GeneID:5649507"
     mRNA            complement(<296504..>299503)
                     /locus_tag="LMJF_09_0750"
                     /product="putative acyl-CoA binding protein"
                     /transcript_id="XM_001681197.1"
                     /db_xref="GeneID:5649507"
     CDS             complement(296504..299503)
                     /locus_tag="LMJF_09_0750"
                     /codon_start=1
                     /product="putative acyl-CoA binding protein"
                     /protein_id="XP_001681249.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649507"
                     /db_xref="GOA:Q4QHU9"
                     /db_xref="InterPro:IPR000582"
                     /db_xref="InterPro:IPR014352"
                     /db_xref="UniProtKB/TrEMBL:Q4QHU9"
                     /translation="MMRGEAADGATVLSEFTVLRKPSNDNKYWHTAVHQGEPVTFRVL
                     DDSGIDPVDGAGYVMARVQAMQKHMQEARVDVAAEHAYRAVLVEVSLLDDPIAVPEET
                     QRDMNCAVDLWCPLHVALMTSNKAAAQALLQFHVEHAVTAMTYIASTPSAIGNAGAVD
                     ALDSPPVAPALDDDAPDAPGDDHTASVPPVAASPILECHVHRELGGAVVLLGHFDGRV
                     RLSSAAVRKSRLPTPVRGGSPHAAPVSSSPGGIESALAGGCHCSTGIAVGEDALVQNQ
                     CKHNDALLREEDALFEDKGEEYCLRNILVAMRPLLQSVVLEIKRRAQCTTTTAPLSLQ
                     HHHHTHKASLACATPVVPESAIDFVHDYCSSLSMLPQHPPLLIDGDTVFDVCNHGDLA
                     LLANVIDVFEGCFAPILRGQTLLTDRCAGGRGVGFAAPTGAAFPHNFSLSSPPSLSGT
                     GQSSSPSFLSLGGDASAHSMAGTSHKGSVGRHVHALPPAPFWWSCPPQNVHRLAFVAV
                     WIGCREAIDENSGSGRRRAVSMSNKNRVTMVAIRQLQESRVAAQKLDSTIWSGHLITI
                     MKLLSRECSLEDYVDFVEEGGYFAFTSPRGFSGLFLSVLVSGVMAAALVPEPAMLRVL
                     RCKVETLLADVPGRPSPLRTYVMGRPSTHAERFRELWLDAGCHGIANPDGGNGQNDAG
                     DTETGGFNPVGGIQSAERRPMKFRSRIELLYYAVIEQVVAAAEEAWRMHEADDGDSSE
                     AAGDSAAPSSSSSPWPSGATKAEALTALQGWLLMWANFLTSLRDWTPHRGSFSCSTAS
                     SQMPQQERPQHSLNSGAEGQLTVGGMSPPLTATTAPHHEHTASSEDLFSDDANETADM
                     VQRVSHALVERLETGREPLPALRRALFPNGANDVETGAPAAGASAHVDKDLPVSSIDQ
                     EFASAQHAFAATAGRESDEVKLKFYGLFKQATVGDVNTDRPGIFDYAGKAKWDAWSKL
                     KGISLLDAKRMYVSQYKMMMELRKSRK"
     gene            complement(<300595..>317040)
                     /locus_tag="LMJF_09_0760"
                     /db_xref="GeneID:5649508"
     mRNA            complement(<300595..>317040)
                     /locus_tag="LMJF_09_0760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681198.1"
                     /db_xref="GeneID:5649508"
     CDS             complement(300595..317040)
                     /locus_tag="LMJF_09_0760"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681250.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649508"
                     /db_xref="UniProtKB/TrEMBL:Q4QHU8"
                     /translation="MALLEEARRQLDAEVYAYIRSMQPAPPLALSLNNDVGAAAATVA
                     SKVLASAADPAARAVPIKPPKSHEVGGGASDEPHASRTAKPPNVKQARARLWELIKKL
                     QCATFVTTQVSSTDKDAAPALRRRASKSACKTQATIYPEASATAARHGGNPTGARGRA
                     ADADTVEDAAATRAGSRPSSPPHGLVRIASTATSATTAGTGRGNAAEHNTRASLRRLN
                     ASLAFTQDCLHYAATLAQAGLGSDAQSFFLQPIAHDITSPYESVLARCIEQQSLADGD
                     PLQNSGNVSAVSAASAAATAAMRTPRRQHLSLGGGRGREDRKRTSTAGCSDNAGSSGA
                     RATAEDASVEEGVRVTDALDVFAPDVPLPLALRLHKCVLRYQALSLYIQFGEIMKSDV
                     YGDAAGFATALEACACVEQLVALEQRVLRTPAFNAASILKREEEKLKEDVGQATDALP
                     KTVDAIVVAGCRLVDLMAEPPMESPSSVPLVRNARTGGGEAAPRIYAVEDTAAPVLFA
                     MRQYVANMCQRLLAYLSSTSAVATAAADMTSSPPSVAHATNVASAVVHRLIEALRTSL
                     SMSELHYTDTRGPAAAAQNTTDERLRGGGGDKTCIPLATVEYLPWRLHEYSLLQTCYM
                     HLQQDPSSVPAAVAVAQRALHQVLQLMELEYLDPVPPPASSVYLLESAVQQCAGQLLV
                     GIWRAAFIQDGSPSAMQLASPAEMVPKPAANGSSCESPRNLTATAPTASFIMASIIAL
                     IQQTVAHLLSVQCSSPPAASAPSLVSLPPRATQQRGQGSGNSTDSMNGTRLLVVLWTF
                     IAQVQQQCMLLAGKSEAADALRAAATSGVQYDDGDTSGDGASEAASGKGPVSQSARAS
                     SLPGGGLPAAKSAKKSKASTSSGGAAASAKHKLGKEAVEAAQLSQEQAAAATAAAGES
                     SLALPTSIAHPHPSVVALAARFPRMALELTLQLITTIEAAGATPCYTGDTDRGNSSGG
                     SEAVARSSMGTQWRLSKTDVGFGAKDGADRKSLKSTRSRAASMTSFSEAAAAAPISTG
                     AGASALFAGVHIRTPHTMYRHCVETLEVLLHGAAMAATELAPVGAETSAPPSPWGSYG
                     SGTRLGALTHAAVLRDAMDTLRFADGVDVVAAGAAGAVHGAANGPWASTNTTVVGTPH
                     VEQQTAHEASLMPRCFLYNTVDARCLSRSLTWEALFLPPSLMAPGTAAALAARGARED
                     VEDGVQRSVAAFRTLAMASSQLAIVVRIGVALESWWRSQRQQAATSAKLAAASTASST
                     AKGAISKKKKLNSATAPLLLPRSSTPETRSVAMEACIRCIELLRALALSVMIQRHQYR
                     VAKDESALTATLLAFAAVERALSGADAPTTSTNPLLPLVQSPTEELADYARLYSLAQV
                     GQRLSQLQRRCIGGDDRHVPEVGLREFTESTGLSSVDTAAGSCSNSSGGAGGDSLSCT
                     SAPPQSLQLYRASAALLDKVTAALCALPPPPTSSSVDGASESVASSGVTTMVAGGLRT
                     PMMTALSVLKPVVADVASFLLRCGGELRSQWHRHRALRQLRQATTVHGDATRPNASAI
                     TADAPPSVDERELDAEATYATVVLCVLTSMWRSGTSGGSGGMQLPDDRGVASLVRSVE
                     SGFLQLVPALPSSSATAGEAKAAAAVAETRVPPAQLVRLIAHGVTARRLVDRVRGQLQ
                     RRVESLLAHAVPRSGIKGVGAPAAATAAPCEKSSNAGQLSTARDALTELTSLWVAVRW
                     QLARLQAHRSGYIAQHMDLETLTVRQEQQQVYGRTTAKELRILRALEQATPVLPVTAK
                     DEEARLRRWVAEQRQQQSQSRMAMATSASFLLLDALVCTALVPLNTADPSAQQRLLDE
                     AIRAMLQAEEECAAKKPRKRSSNWRSALSSTRAATAVAAEALVLYTPVLLWCYLAEAC
                     YVYGTREQAERVRAVLDAQMLKEMPVITNYTNDGGAVTAVTTSFVQRLILQPKWSTLQ
                     ASSTTTQLAYCRTLSSMAAVDTSKAASGSDALGSLQIVYRLVLALQIQRMLGPSEAHG
                     GGPEGTGRGTSGSSTGRRDSLPSSFAAPAFASSPLAVDTAQQLVAAILNYLTRSSGNT
                     ESRPTLKTAAAPLLLPPLVALCEVLLGLPPSSPEWADAAVQLLAVRVLTLFKEQLTYV
                     MSSTMTVAGAVACLPAVADAMLRLLWATLVHVWNNVLRNPNARQRRSLLAVARETHWA
                     RRVYDGHQRLMQQQEAAEGTLDAESDEKGAGGSGKNVRHARNGSSEAAAGAHGDSRAS
                     TAPVPSLDFPGVVYLAFEGAPDGGSRTQEVLEAKAEKGDGVTRTASAAPAHLSPASAA
                     TGAADSSKRSSACEPSTVPMHASAPADLVELLEEVLLHVPTLWPLIFSAAMDGGAVTD
                     ADAGAEGSAHEAVGVMASPKPLRRGKDSAEEAEQQQQQPQQPWMDSLADFVRFAGQNA
                     TRVLRSQPAAPIADVALSSSASGVQSSLLRLQGVPSIYADVVVALRQYSAMITHGAAT
                     AVTGAAATRGGGGSRVHTGGGGGTASAVLLDVLGKYKDDPAYAKMAVHTVREMLTMCS
                     DAHDSLDNGSGVGGGAMSASAGTGTAARKRNTGTNTPGAEVGVTSIAARSTSVAAAAA
                     IISDARLVMHAVREQVEQNRRSMEAYLETVDSETRAWLARDWHGLCSSPQHQVAANAG
                     ARESLPIAASARKRDGGKAAASKRKLANRGAAAKKSAGKSGAPRGNEGGHEDEEKSRH
                     PADDEPSYTTVTRVWNFAEQHSLKRLTCAVAWWRRRRAARTLRHRYTQYNMPFMAQMH
                     LYEAALLHMGATAQYTAVTHERRVQELLRLVSGDGSGDGDPRTAAAVDRKLAVFNPTA
                     SAAAAATTQGGGAGSGSPEKLSNSINGTLADTPQDLAQTTVELLQHCARAALLFQYLW
                     LPTRASTAAQLAVRHLQQLRVTLPQKGLSVSSAAAITALVNQLLEVPLFSIAAVQHGY
                     YDARRDVHAGVLQPTVVKVGADVSWRYRFRFHRSVPSLLSLVSLLGQHEEMQSVQEAR
                     LHVLRQRQHEELQLRLCVESEATTRAEAERDELQAKVDILQQMQELLPQLRQSAAVKE
                     TLLAAAELLTSVETGLDHLRSRRRSPQGLPDAPQTVSVPSRESVHAAAAEAASTIQYF
                     TFESVPRGGCPAATSDARGTMTMTGSHKEASRCTGGQLSTCSGSGGGDAAGLGSVGAT
                     HYGRDMREAVLVEQLTCLAHVVVSVQPARCEAAYRVAQRLTAGRYAEELLPRILQIES
                     ESLGQPRPETRAAYDQAIRDVPEVLVLLRAARTARAQLSASEAQATNTHHQQQLLQPN
                     LVSAESLSAEAMPTRDPSASDTSSSWKAAVKQYQRAAQGLRAAGLIQPLGECLYEEGG
                     LYYAASHVSEAAKRWSDAVDCFLSTPHALEDWHRHRTVPPAPHGGRRSLEELLWITAA
                     LTTLANHAFPTDSPRATDATLLCALLIHQSWRLPGLVSTAASSDGAGRTAVARTHQPH
                     LPPAQYCLLDVHHVSASFSDAFRPTVVGVSQQHSPTGMPGALAEVTRRLISAAQSLLT
                     KPSSACYSSESAVLAAFSDFVATIVLQDVELTVEARLVRAAAAAHLGSFSVAMRHVYG
                     VCIGVGLPQPVLASLGAEETLPGFYSLGCAAASSAGATAAAAATSLSSPLPSGSATAP
                     SFFYNDEESPSSSHNTAAVRAFLAACLPGLPLDAVAKHNTTVGNSEAAVSALLPLTVG
                     VLASAALEERYGVCLTRRVQLAIAELFVRLGTCDSAFLLMAPPTVVAAAASSSLATAT
                     FSSAPSNSAGGGGGQNRTSLGETMATPRVGSGGSRGSQPPPPLSPAAGRGDRPVNACT
                     EACRYASALLQSLASADVCFILTGQSSPSGVMEGGGAAGVGATRPSGSSAAATASSSQ
                     ASRARPGSSSHGAAAGASEAVAAEPRTDVSRQVDSTDRGGGGSVTPGSPCAAWLGTLG
                     AIRQYALLLTAELLAAQGHYGACLRSLAACIAEHNEVQQYKLCHPQRQSSSSAPFPSH
                     AISTTTHPPSRSQAPHALLKGLGVQGGDQALAPFWFPYDHWVRVWLLMCRCYGHLRQY
                     PQLEEAAGTQGLSLCTAFGVAGVQKSDNSSIYKDASCWTMFRLYRLYALMQMGRLREA
                     DDVVEALELGHCAAAATSSAAAVTADSPAMGIAEDRWVAAAALQWWRTHRGKTIKSAA
                     SRDALEQLVRWAITEHGVLSWQPSACSSSSSASTVASPPHQLQHYVLVSPSARTILPS
                     LALSRCATTARLWRLHDTMNHHALEQQQLSMAAVATPAALGGGEASSDEARGSGRAPQ
                     QRLATPNCGRMSNSTSTDMASTSLTAGVPATAPSGAAASLVQALEVVSPQYITSVHAS
                     FWFESQLWAAQLKVQEVCAHLLAGAREVEVEAVVRGGGDGGAATRGKSESACVASQTG
                     VPPLLLSKEDVLRALPAPVRNVCDELLRVLHCCVELPVQRHSYVRAILLDLTRVVSTY
                     VRLLRARQHHAPLPQGTQSLSPATTAESSFVSQLESIAAACALLAGLVSDMERRVRTG
                     ADSLRGYATDPRVTAAASAISEANTEEQGQAPWPESLWAALQRTQDTVGRLAPAAHSD
                     NAGGSGATGLADVLSNPFYNSPSIHPKQPPLGNGAVSSAGSTGAESDRGASAGRGHRG
                     SSKRLSGLSAPGTLPTMSATVAAQLSVPTMALTYTMLCNEAAAARALTPVTDALEHDI
                     AQQLVTRHLQRLTTPANCTYLCYRDKERQALLESVGAVLRQQQQQPQQSSRRGGSSGH
                     SRRVGAASSSTNAATGAGGGGGSLPSVRFTEADVWKALAPPVLLAAVPTSLFSALGAD
                     ALGAPLYNSVAAAAVCVVAGAGAAGGAAAIVGRDTSDGGNASQVRNSSRGGAHEARWQ
                     LYLSVSPLQDAEVDAAPPPLLPGSVVASLENCALLPPSYILNAVAASAETSGAGAAAA
                     MTTTSASVSGTAASRARIASRQSTAGGSAGATSSHARCTGGSVVSGADRGTGGAWWPP
                     LIASAATSTRELLVPSTNWALLDSIQQCQLQQQQQRESSRQDTDGGVKLPPLPSLAAP
                     AAPATRGVRKLGGRSSFSSVAALAAAAGGGGGGASNAALQHKNDGAAPPCEPAPLRWT
                     CVSLEVSGSTVRTLRRHLRAVRACMWRVKAEEGTAGGAGEDASVRKNGYGCRRCTEDA
                     VSGATGTGAAAPTAVEAHGAKRREDHSSGVASLAVGGNSVDSDSTNDHAAAARCALAA
                     AVAQAQSALRSRVLAGGSGGGGVGGTAPGGNGAPPSVAQGAAGDGGARAGFNSSYPGG
                     SSSAGSAAATSPSTSAGRKTANKTNGSGRNVSRASSFGGHGNGVPAAGGTDGLQSGIH
                     VAHDLADAARARQVAERRRRLQQLEEELDEAKSSLLMELLETIVSAACASSLCPTAAE
                     AMLDEARIEADVQRLLPRCALSSDVIGFLEEWIGSHAVLNVQGKDVDHDTCGDGGNDA
                     DGEDGCSGRSRTTSLRFYSPGLHEWMQRISRYVVEQQQQQQQR"
     gene            complement(<318935..>321130)
                     /gene="OPB"
                     /locus_tag="LMJF_09_0770"
                     /db_xref="GeneID:5649509"
     mRNA            complement(<318935..>321130)
                     /gene="OPB"
                     /locus_tag="LMJF_09_0770"
                     /product="oligopeptidase b"
                     /transcript_id="XM_001681199.1"
                     /db_xref="GeneID:5649509"
     CDS             complement(318935..321130)
                     /gene="OPB"
                     /locus_tag="LMJF_09_0770"
                     /EC_number="3.4.21.83"
                     /codon_start=1
                     /product="oligopeptidase b"
                     /protein_id="XP_001681251.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649509"
                     /db_xref="GOA:Q4QHU7"
                     /db_xref="InterPro:IPR001375"
                     /db_xref="InterPro:IPR002470"
                     /db_xref="InterPro:IPR002471"
                     /db_xref="InterPro:IPR023302"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="PDB:2XE4"
                     /db_xref="UniProtKB/TrEMBL:Q4QHU7"
                     /translation="MSSDSSVAASAQPPIAAKKPHRVTFGYVEGEDRGPNPMNPPRYR
                     EDPYFWMRDDDRKDPAVIEHLNKEKVYFQARSADIAQLRDDIYAEHISHINEDDMSAP
                     YVYGKYRYYTREVKGKPYKIYCRVFTDKEPGDVAAEEVIIDVNQVAEGKAFCDVMEVK
                     PAPPEHDLVAFSVDMSGNEVYTIEFKRISDPSQTIADKVSGTNGEIVWGPDHTSLFYV
                     TKDETLRENKVWRHVMGKLQSEDVCLYEEHNPLFSAFMYKAADTNTLCIGSQSPETAE
                     VHLLDLRKGNAHNTLEIVRPREKGVRYDVQMHGTSHLVILTNEGGAVNHKLLIAPRGQ
                     PSDWSHVLVDHSEDVFMESIAVRSNYLVVAGRRAGLTRIWTMMADSQDGVFKAGTGLR
                     EVVMEEPIFTVHLVESQMLEYEEPTFRMEYSSLATPNTWFDVSPQDHSRTAVKVREVG
                     GGFDAANYKVERRFATAPDQTKIPLSVVYHKDLDMSQPQPCMLYGYGSYGLSMDPQFS
                     IQHLPYCDRGMIFAIAHIRGGSELGRAWYEIGAKYLTKRNTFSDFIAAAEFLVNAKLT
                     TPSQLACEGRSAGGLLMGAVLNMRPDLFKVALAGVPFVDVMTTMCDPSIPLTTGEWEE
                     WGNPNEYKYYDYMLSYSPMDNVRAQEYPNIMVQCGLHDPRVAYWEPAKWVSKLRECKT
                     DNNEILLNIDMESGHFSAKDRYKFWKESAIQQAFVCKHLKSTVRLLVRR"
     gene            complement(<322508..>323299)
                     /locus_tag="LMJF_09_0780"
                     /db_xref="GeneID:5649510"
     mRNA            complement(<322508..>323299)
                     /locus_tag="LMJF_09_0780"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681200.1"
                     /db_xref="GeneID:5649510"
     CDS             complement(322508..323299)
                     /locus_tag="LMJF_09_0780"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681252.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649510"
                     /db_xref="InterPro:IPR027887"
                     /db_xref="UniProtKB/TrEMBL:Q4QHU6"
                     /translation="MPLTCRSFCEWALAYMGTQEYTPSIIQQRNSMAAAERDPDDRNV
                     LDFSTYEDYLDQQVTGEDLFYLEDQDAARKIVELGYKGKDVLSREEFEAAQYLARTGP
                     LKRRESAEVITSAGKDVSDSPLLTALAKREELVRTGKLATVLFLRDYVSGQEVSAYID
                     YGYRLRSENFEAYFKKDKKLLPKRSDLSYYNWKTHTLFYNNSPTFQVLADSTLGLVMK
                     HKRDRKAIHVDPNSPSPGENCSRTVVPCKDYLQAVIYDHVTRRKN"
     gene            complement(<323741..>327481)
                     /locus_tag="LMJF_09_0790"
                     /db_xref="GeneID:5649511"
     mRNA            complement(<323741..>327481)
                     /locus_tag="LMJF_09_0790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681201.1"
                     /db_xref="GeneID:5649511"
     CDS             complement(323741..327481)
                     /locus_tag="LMJF_09_0790"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681253.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649511"
                     /db_xref="UniProtKB/TrEMBL:Q4QHU5"
                     /translation="MPSRRKPHKRDGPQMPQADAEEQQPSLGVTEDAPASEPSSTTAV
                     VLQPSPVSGGDTDDDSYMSVLTDEEDSYRLVIEHDEHLERTRAYADFHGQLACMKKAA
                     AGAVGRDSDVTSRRVFDVSAMRTAPTSPEVPPTTPAPLTTSQQQQSAALSSHPSPIPL
                     VRTPTNRGDVFPGSENHLATPLMCMERGASPSRPPKASDAKEVTRLQAENTRMAVELQ
                     ASQEAVQRLHDSLLEARGALLHRVRVEEKDGAVGQAASERQQHSFPAATDACEAAAQH
                     VTSRRPPLATPTTAFSPSNSKSPAPATSVPTAASSSAGHDHPPPKALLRSPANRLSDG
                     GVGALCPHSSTKRLDVAEFFWALQVAPPPSTLQCGCTCSDRCQASATSLCRAPEMAAE
                     GTPFGGAYGATSRPVEGVSTASAEKPPPHHVSRYHLDHWHDPRQRQGAETEAVALACE
                     SAWSNSDYYCYHIKEMSSLRVVSSPDEAVDGSGSTVPAMSDSEVGRRLLHHIPAAASP
                     PLAEGNTPLSSPTPHSTPVATTTWSVLEGTVTSVWSPAKTRSAAMLTSIVSSPSERCY
                     WLPYLQRLWVTSVLRHLLLFFLVTAICVLLFIPGVVLATVNVFEAAEGEDFYALHNRF
                     GRSAMLVAARLDACTFVFFAFFGALCMISHPQQQQSLSSVDAQQADAEKAAAVSVPEA
                     GSAASATTAAKQPRSSIFSVKSVGTLVHLMLCAGTGLMFLGALLLREGCRDTNLSLAI
                     LGESCYGAGEALLLAGLGTVVSAEVGVAAGVIVSLQILLFSWLIVNALGFFVLPSLSY
                     YLYITAAMLNALVYVNGFIGALVFSVVMLCPRDLIERAVRASGKDITPRKLWSAARHD
                     VSLCFLLRALTVGLLTAAVVLLMSCGFAVFIPTQAAAAAVAESTKSHAQMSTSTDKGS
                     RATEATESLTTYQDSWTTHQRHAPVLLFTYALVTMPMCFIPRLAALINRWCSVPLLTT
                     LLCVMWIISTGASWAPVLGLGALASNSGGKDGVAIATVSAVLSRCSGVWLWLAERHFL
                     NPCIDACAIATGVIYTVVVSSLLRSMVNAGVRLPVMHPNRWRMAFHERDRHSAAAAAR
                     FPSESTPLLETSAQKGCCKNAEAAAAGTVCPDTATAPHAASANAPTATRTHTPEESKT
                     YAEELQRCVQMQLRGGPTVMTVLTCMLIMVVLLLCVAVMTTAAVLLIDRAESPVYVRR
                     LLPGVTLDEHLIAKTTLALVLIAAMLVQWVEVAHRFRRCRSS"
     gene            complement(<328640..>332500)
                     /locus_tag="LMJF_09_0800"
                     /db_xref="GeneID:5649512"
     mRNA            complement(<328640..>332500)
                     /locus_tag="LMJF_09_0800"
                     /product="kinetoplast-associated protein-like protein"
                     /transcript_id="XM_001681202.1"
                     /db_xref="GeneID:5649512"
     CDS             complement(328640..332500)
                     /locus_tag="LMJF_09_0800"
                     /codon_start=1
                     /product="kinetoplast-associated protein-like protein"
                     /protein_id="XP_001681254.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649512"
                     /db_xref="GOA:Q4QHU4"
                     /db_xref="InterPro:IPR024743"
                     /db_xref="InterPro:IPR026983"
                     /db_xref="UniProtKB/TrEMBL:Q4QHU4"
                     /translation="MPASACQTVLIQPWISLASTAGSHGDAGHASPSGGTSRRSPSPK
                     QHGVTPAVRLAEINAMQRELEAVEHFARSEGDGGDDDGNDKRLAGELSQAYTRVLALR
                     SQSRGYSSLRADDPHRSSEEGTTVVVDDDDPNPELTRQIEHKLAEFRKRIANMLSGMK
                     TVRRNQRELQAAQKRVQVSLEDAKRQLREAQEKVQRIDKQHLREIQGYRLPPVVVKYV
                     MDAVLCVLGEKAKNWTEVVTAMRSPSFISNVVSFHHAQLTPADVQELKKNFISNPRFS
                     YADVLKGSHALGQFHEWVIRQLQLIEAESAHAKFMGEKGESSQELALARKKMEAEAAE
                     VRHLEEELEALMREQAPQLQERRSGTLSLCPTGGKALSQRPSSTLTNALLPASESQGA
                     AMPGQQRSRRPSMHAVSGAEAMAINNGAAAVGDGARRRSSTSVTAIAVPAGCASAPHT
                     AADAAAAMTDSSMEMTTDGVAAVNRPPTAVMLPQQQQVPAMVSPGTRWICPHPGALHC
                     STYVLRSSILCVLGYQQERTSEKPGETSPDNGTATPAPDMFELTTAQQQFVAEALHGP
                     ARALQPPPPTSATAGSARSSHATIVTQHTKIFTGKEWETVVKDSPDELHRAFVEDVAM
                     ICQVPNRAVTGVAWVLRGLHVQCAVCHPSSDSSEAVQAAIEKGAYPTVMALYAQRQCT
                     PDSLAEESTCQQHQAVRLASMKEQIRAAQQPGAEARCETQSLRDAFEQEQQALMEQVA
                     VAQTSSQAGAHDAVRADLTLQEALEARTAQLGHAQAALAESQAKANCAEDELATAQVH
                     LASAEERAAKVEADADAARTAADLAAIHAEKALEDLGSQLRAAHAAFEGERTRRQTEL
                     DEAQAAAAARETRLLQQLDALKQRLADAQPREKVVEEEKTRQDFTAAADAKRAAEHAA
                     QVAELERKLREALSAQAALQEEHKHLRDELARAQAQAAENETTRLQRQENMERVRKQR
                     GYQQQHGAEAAAIPLVHCRKNCFERAQVRAAEADAALVEALRVQLTAIEVAINFCRAE
                     LEVQKSAEAASREQQAVRRAAVTAIREKIENLAENFTTVAAERQRQPPQQLASEKEAL
                     IGELIAQLEEVEHEKAEIKTATARAQRLLATMQRQVADAQGRAAQLEEARRTACQELQ
                     AMMATVSAEDASNSVTDAELVHSGNIQAHQEALVDISERVIAASAALTSASDALATHQ
                     QQRAAEPKQEEAFIANIFREGDGRRRRPNREGSELAAQIMGEVYDAATGSFLSRHQWT
                     WMNVCLGVLLLLSFTTLQYRKYEV"
     gene            complement(<333885..>334529)
                     /locus_tag="LMJF_09_0810"
                     /db_xref="GeneID:5649513"
     mRNA            complement(<333885..>334529)
                     /locus_tag="LMJF_09_0810"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681203.1"
                     /db_xref="GeneID:5649513"
     CDS             complement(333885..334529)
                     /locus_tag="LMJF_09_0810"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681255.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649513"
                     /db_xref="GOA:Q4QHU3"
                     /db_xref="InterPro:IPR004127"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="UniProtKB/TrEMBL:Q4QHU3"
                     /translation="MASLAHLSTPLPSEPSAAAPPPAASAPAGALHLERFLESVLKQN
                     LDTVLSQRDELYATVAQCAQLRWLMDDMQALSRYHSFIEASTAAETAAAVPLSALSPV
                     ASGSPNASLPLMSKRAQADAYKPPQKNKVLVDLGNHFYTQGVVKDAGVLFMNMGCGVV
                     LPMSLDEAREFLRKKEAVVRRMIMNKSKEALRIKYRIRLVTEAIARLHERHLGL"
     gene            complement(<335117..>336709)
                     /locus_tag="LMJF_09_0820"
                     /db_xref="GeneID:5649514"
     mRNA            complement(<335117..>336709)
                     /locus_tag="LMJF_09_0820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681204.1"
                     /db_xref="GeneID:5649514"
     CDS             complement(335117..336709)
                     /locus_tag="LMJF_09_0820"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681256.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649514"
                     /db_xref="GOA:Q4QHU2"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QHU2"
                     /translation="MTVILVVCTVVFVLVLGSATVADGRPKQPISKGNVAEASSHASS
                     SLCPRCPLCSRPGTPIKERLKYCHATSGYIFSLFSWGTSALAGKQRTGVSNREQRQLY
                     PLELPFATDDAVRRQCMRDMQDLLLARVRGQPQVVMPLLDVLRRKLAYPREPVVVHLA
                     GDNGVGKTHTARLVSQALSLRCAPDRDVCDAGDNLLTIAGTGFDGLSVAEARQRIIGQ
                     IIAHTDCYPHGVVLIDDLTAMDPSLVSALAPLFGRAAHFPEQLTRSSSATAAGARHAA
                     AKSLQTIHASTKGLGPDGGTGSAAKKGESEKWEAAADTGGAQPAASEMASSSLSSGQP
                     PPPLSQLIIFITTDFGRQGRTVGKSRTEIEAMIQHDFADLYGTLLPAYTRTFVYYPFT
                     SAMAEDVVRSAVTDLPCALGERLIASSTISDEAVSFLVQQHRQLWSGKENGHALRRLV
                     EDEIVSQLIVYWETHAQQRHFERLRVHFDLDEASMHVLLRTPHTSSTIASQPPAALSS
                     AEARAYDHGGADDRDGEERGDL"
     gene            complement(<337796..>340126)
                     /locus_tag="LMJF_09_0830"
                     /db_xref="GeneID:5649515"
     mRNA            complement(<337796..>340126)
                     /locus_tag="LMJF_09_0830"
                     /product="DEAD/DEAH box helicase-like protein"
                     /transcript_id="XM_001681205.1"
                     /db_xref="GeneID:5649515"
     CDS             complement(337796..340126)
                     /locus_tag="LMJF_09_0830"
                     /codon_start=1
                     /product="DEAD/DEAH box helicase-like protein"
                     /protein_id="XP_001681257.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649515"
                     /db_xref="GOA:Q4QHU1"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QHU1"
                     /translation="MAVASTRLPTVGCSCSVATLAYSRTYVRSSNTRSTGSSSGSIIS
                     SSLPWSQHRCQVRTLIVPRQLKAYGGTFSQSIGERVDHAASHQVLQSLSPARTAQSPL
                     LAKPVKTKVVDNFADMLVTPALQEALADMGVSTPSPIQQTAIEAVLQRKNTVIAAPHG
                     EGKTLAYLLPLYQNMEKDRDVYKIPLRERRPRMILLAPTKELVEQLQTVCARLDAATG
                     LTSVCFTSRKRSKYHLSRMLKNTMADVLVMDPKLILRLLRTRRLFIEDLRYFAVDEAD
                     AMMSSLHDHDAVQLLMKVQKRNQFKYLWPVQTQYVFVTAYMTRKLEYIVGRKISDPVT
                     CMFRQLMHRPQARLRHRFYAIRREPEKFTVLMHLLRKNGHVPLPIDTDVAEVDVHTNP
                     RKLSGSLAEWHEAVQRCAWKEQHEQEKSSGSGEAVTDDVVDVDEVAVRAPEEASAAVP
                     SVGLSATENAAADDDYDHDSYARYTLERVRPLHWEHLTTVAAPFTCPIRRTVFAEGRR
                     TIIFFRNIDATTAVFHQLRSAGFAVSLLHASLPYKVRKEMYADFASGRTNILCATDVA
                     ARGLDLHVDMVINFDVPTNALAYLSRSGRTARMGREGQVLNLYNKHQGVIVSAIKAFL
                     KDNLPMEGLTNRKADMMQPRYAEWRTHKINALARSYVSLITRKTIPAHLERTYVHHNA
                     TWRPVFHPQKTGIHGGVAPRQQQKLMDRVREQAVWFRRGQLARRKGGRAKFGSRTMKH
                     GVWNDIGGVASREVVNEAQNPSPAGPNFGPPSGPPQ"
     gene            complement(<340807..>341973)
                     /locus_tag="LMJF_09_0840"
                     /db_xref="GeneID:5649516"
     mRNA            complement(<340807..>341973)
                     /locus_tag="LMJF_09_0840"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681206.1"
                     /db_xref="GeneID:5649516"
     CDS             complement(340807..341973)
                     /locus_tag="LMJF_09_0840"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681258.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649516"
                     /db_xref="InterPro:IPR003226"
                     /db_xref="UniProtKB/TrEMBL:Q4QHU0"
                     /translation="MSARKFAGEYVSRHLDGLTVLASLADRPAAAKPVICTHNGSFHC
                     DEAMACGLLRHVPEYREAVILRTRDPKQIDACDIVVDVGAIYDADTNRYDHHQASFHG
                     TMTTPKKAYKTRLSSAGLVYKHFGRQIICEYVEAVLQPSSPARAAVLSMTSWSESRTG
                     LSEAELDVLEDALYAHFVEQVDGIDNGVECWGLADPAVGTLVPNYTQSTSLSQRIGQL
                     QAYWNEPENGDVVAENANFAVAVEMAVTEFFKALTYLSFSWLPARSIVEAAFQRRHEF
                     DESGKIMVFKGVKACPWKDHLLELEAESNCLGAVLYVVFSDGKGWRVQAVPKTSTSFE
                     NRKPLPYRGLRDDALSAACGIEGGVFVHVSGFIGGMKTFDGAMALAKQALVVVN"
     gene            complement(<342864..>343871)
                     /locus_tag="LMJF_09_0850"
                     /db_xref="GeneID:5649517"
     mRNA            complement(<342864..>343871)
                     /locus_tag="LMJF_09_0850"
                     /product="ras family protein-like protein"
                     /transcript_id="XM_001681207.1"
                     /db_xref="GeneID:5649517"
     CDS             complement(342864..343871)
                     /locus_tag="LMJF_09_0850"
                     /codon_start=1
                     /product="ras family protein-like protein"
                     /protein_id="XP_001681259.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649517"
                     /db_xref="GOA:Q4QHT9"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QHT9"
                     /translation="MPLMMSCWSARARTLSLYTPALPPFSPSSQQIVPRHSRTARASL
                     LDTRPRLPLVLAMPAAPALPTSLDYPRIKLLVIGDVGVGKSCLIKRYCEGRFVAKYIP
                     TIGIDFGVKKVEVSKAAVLQQRSSEPSPPAATAQSGGGASSAIPPAVRVNFWDGSGDG
                     DYREILNEFYEAAQGVLLMYDARNAQSFAALQSWWEELTVYCQGMPAASGGGGGGSGS
                     GGGGGSNPALAGNAAAAGAGGKRASASNIVTSGTAAGKAVGRTDGRAPIVVLCANKVD
                     DTAVPGAAAPRPRAVSEEQGRAWAREHGCAAYYETSASTGQNVKEVIEDLVVWMVAKF
                     M"
     gene            complement(<344580..>344900)
                     /locus_tag="LMJF_09_0860"
                     /db_xref="GeneID:5649518"
     mRNA            complement(<344580..>344900)
                     /locus_tag="LMJF_09_0860"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681208.1"
                     /db_xref="GeneID:5649518"
     CDS             complement(344580..344900)
                     /locus_tag="LMJF_09_0860"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681260.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649518"
                     /db_xref="UniProtKB/TrEMBL:Q4QHT8"
                     /translation="MNSYVKRYVGTDQRVTQLVGFKRASERRLVVVCALSALGIYCAV
                     YLYEEKERNRRHASIKKDIERERWRARELGLAAPIDDGFAERYEALDGNTRAWRQQAL
                     KGKE"
     gene            complement(<345764..>347344)
                     /locus_tag="LMJF_09_0870"
                     /db_xref="GeneID:5649519"
     mRNA            complement(<345764..>347344)
                     /locus_tag="LMJF_09_0870"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681209.1"
                     /db_xref="GeneID:5649519"
     CDS             complement(345764..347344)
                     /locus_tag="LMJF_09_0870"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681261.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649519"
                     /db_xref="UniProtKB/TrEMBL:Q4QHT7"
                     /translation="MYSFSLASNRKRAIPNASGLAPPAAAHVIRAPSELKPHQRLPQP
                     LNEAADDAADDDVMQVSNARFGWHPAHAHAPTSSLYSVRPPAEQLVHVHNLNAYAGLR
                     DAADWSVEVQREREQKKRRALAQHEAVKLEEQRHRDAHEEQTKKEMQQRRLERQQERA
                     ELREADAMADFQERNTQFLQNQLWLMQLGSYVKQTDAQHKAHVREELHKSSSSRNHLD
                     VDHASTTCWTGTKARGHHASAPSTEIDLRQAAEATEEAYVRLSLAYRNEAQRSRAAAA
                     ILHPGELTGKGRSRLQAIRPAGAFASPTSPSAPSQAATAVSTPSHSPAASPAPAAVTE
                     AAAKVSAPFHTAPPMFTHTSTENMGQHANAIPYTYIPEYFDAPSAAATTGKVPAPHRA
                     GESPEQQETGAVMPLPLSPVPVSRDVTGALQARYYPWALYSAATVRKSMLPPLPPPRE
                     ASLPVRRWGAAELRDSMFGHCILEDGTIQDQCERKKVCAAYLSYTTLPRDNATATSNA
                     AVEPQEPLHFGKRMDIWL"
     gene            complement(<348377..>349831)
                     /locus_tag="LMJF_09_0880"
                     /db_xref="GeneID:5649520"
     mRNA            complement(<348377..>349831)
                     /locus_tag="LMJF_09_0880"
                     /product="histone h1-like protein"
                     /transcript_id="XM_001681210.1"
                     /db_xref="GeneID:5649520"
     CDS             complement(348377..349831)
                     /locus_tag="LMJF_09_0880"
                     /codon_start=1
                     /product="histone h1-like protein"
                     /protein_id="XP_001681262.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649520"
                     /db_xref="UniProtKB/TrEMBL:Q4QHT6"
                     /translation="MLRAALRPSCVLHAALLSSSSSAAVHNAAASEASMASNAISSAA
                     ALLWMQNSQSHDGAAATMHTQQTDATGAAEVQDHGNALVVLEEDNTSGSNGYVDYFMG
                     GFGPRHLAEVTVVPESAGARAHRSLDHANKADAAAAAVEASFSSETATAAAAASPARR
                     AEGDNGAVARRPVITKARRIRLASAASQAAEVLQSVGSPATALLLSQRVQQLQAEEAL
                     LNASLQRLKAERDLATVQHTCGEELDNYRRGVQQREQQVVRAAITAGTRSQDPLVSYS
                     QESGGSAGGDTLQTVVEADLLGMPATADAEAATAAAKKAVQKSGRASHVAATVISAKK
                     QLRYSAAAAGGHKANASPKALSRQPATPAASKSKRPSLAKQTAVKARAGKQLAAVCKR
                     AAKDKPKAPLRMKAKTPAPAAATAKAAAQRQKAKVKAAATKPPRKLTKKPTKPRATTK
                     AKSVRAQPAAKAAPSTRKTAAKKRPRYEKRPTRR"
     gene            complement(<351796..>359373)
                     /locus_tag="LMJF_09_0890"
                     /db_xref="GeneID:5649521"
     mRNA            complement(<351796..>359373)
                     /locus_tag="LMJF_09_0890"
                     /product="putative phospholipid transporting ATPase-like
                     protein"
                     /transcript_id="XM_001681211.1"
                     /db_xref="GeneID:5649521"
     CDS             complement(351796..359373)
                     /locus_tag="LMJF_09_0890"
                     /codon_start=1
                     /product="putative phospholipid transporting ATPase-like
                     protein"
                     /protein_id="XP_001681263.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649521"
                     /db_xref="GOA:Q4QHT5"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006539"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:Q4QHT5"
                     /translation="MGKVKAFLGSLAAAIRSTVSCTIPGDNVIDDEDEDNFMADNAKD
                     GGASESGQGAFVEIDLLRSDRNRQRNFPDNSFRTAKYTLLTALPLSLLYQFYKISNIY
                     FLLVMIIALVPGASPINPFSSIVPLSFVIGAGIFKDLWEDCKRRRADRQANEMTVYVL
                     RACAEVSSNGSAAASAAATSSGSGTPTGKQNSTSGSDGAAAAPLCVHGGHDHQQSLRR
                     WRQRVVRVVSRPSSPRDGTAVSRNKSYDGERVHAMEEAEMTTYGRSCGASTACPMALS
                     LRRTSAPPQESATPDAATEPVVTFQPVRSCEVHPGDIMLFRLGEEVKADCLILNTSLP
                     DGLAYIETANLDGETNAKTRRAKIQTVEALGTVEDVVEKALGVSPSNAAAVHARMNGI
                     DTGPQDVWGMSCEAAAPAKVRVDCCDAFGGAHAVSTPERWMNASVRGTAATDAKRLDA
                     SLTTTSPAALGKGLGRSALSAKTAAAKGGDMVVHTAISESSVPQGGLHDYSPQRQHNS
                     QRPVGWECSELKAAEHDSAAATAERGAAPLRHQNESSFSDQQKHFASISATGIPLAHS
                     SADLSAAMSGNFHTVASNVTSDMSPERILHQRLMTLQERLAEEGQLAMPLQLRQLSEH
                     YERTVHSRTNSAGTRVSSLHVYPHNSTNRAGESKYLLDDAAEHHHRSRESPQWRVPEP
                     RRCDGAGDAETAATQPGFGASLCGRSRGFSAPDKFGVFHNEPLHDNRIADGSNRASDA
                     ASGVVLISCPPTPDLSMWFGQLRLPSGEMVPLGIDQFIPRGCIIRNTEWVIGVVVYTG
                     RHTKMLLNLRPKPHKVTNMTRRLNQMNMLFFAFSQVLILLLCGLAIWSKRELLRKVPG
                     AKTDHSAWYIQWNLERYSDVSLFWWRYLTNFVLVSYLIPLSLYVTLEFNKAMQMLLIG
                     ADKRMAVFDEFTGVIKRARPKTSELNGQLGHVRYIFTDKTGTLTENLMTYVGGVVDGL
                     THNETEQPGGLGRALLRRSTAYTAGNVLTSVCPNSMGSSHESSLRCDHHKHLRLNSSL
                     GREASTLGDAAVADSVAGMQDEVALVSPHAAANNTGSCSAAGGGDQHSPTHTFQRLVA
                     VMATHIASDAHAGGDGDKVSQSPRTVMAASPATLVATGDIGATSPQPPHLPLSNSYQC
                     GSGTFGGNTFPGLGSAAPGAVGNEPGVLGSAVGLRNISEAVLEREPLFCYLRAIALCH
                     SVVCFPVDAVNGVADSQHVAEKGNGAPQETKGHKDRRRDKDRNATAAAGEGSASLKRK
                     SNHRHYRHHNRADDRAGKGAPRRRRGSTSTADPDPSRGHHQQSHETARHTPDLVPLSN
                     ILSLNDISVGNFVEIPYAVPAGPAVCENFEPYTASGTNGGRSLSMSTHDHLTRANTTP
                     FLTAAASTDGRGQHQYHHRQTNTNSIVPASTTMDLGLLTKGIFNLSRNNTALLHGRTS
                     STSWYQNRYFNRAMHNRNLSAHVSHDGGERNPTHAASPSTTMYSPGSAGEFAEEAATR
                     AEAGESAAPVAASDLEPFIDRSKIYEGQSLDEIALVNAARENGFSLFERTAKQIYIKA
                     LGRVMCYDIIAELDFTPQRKLMSILLQRRPDLDSEAAATSVASGVSAHYHRRAPESSA
                     AAAAARDASELLAATASGVLPECGVASRPPQSQSHDGLCAFPAQGKKTNGDSAASSLP
                     GGDARLCQTKTTSVFATLTAAELLLPLSRPFTVVLTSEARKSTAEQGEEEDGNRSADG
                     PAAKMLPPHSILLPPPTKQQRVPHLGSSSVFTATPTLNSTQQVAYQPSGGDMSSYHDG
                     FGSSAGFGLAAAAGAPASAPGKYLLLVKGADSSMMEIVNMQKRANVRVKNKMLKELDA
                     MSQMGLRTLILGQRYLREEEVRGWLPVFNDAQCAMQDRSEKLHKAYALVEKDIDIVGV
                     TAVEDKLQEEVPQTLEFCIQASIVVWMLTGDKRETAVTIAHTSGLVKAGYTDYVCHLD
                     VSDIIEEEALLRQKQRYKETCRRKVKDGSGDGASSLESVSSSSSDADNAFHSPVASTT
                     TRAHLSGSSRTHSLQLPKALAQAGSVDCATVASTASPLQETANRIAGGDSIKAETSIP
                     VDAAQSFLMHKCARIEEQLKAAEERCSEGQEVLDGRVVVIVVDGKTLDFIFEDCNRAH
                     RFFLLGSRCRSAVCCRMTPLQKAKVVRMFKRNANAVVLAIGDGANDVSMIQESSIGVG
                     IMGLEGSQAELASDYALPKFRFLKRLLFVHGRFSVFREGHCVVYSLYKNVIVTVGMVG
                     YQFYAGYSGQTLIDSWLLGMFSVFLCSLQPLMIGILDKDVEDELAESLPRLYPPLSRE
                     SMYFSCTYIIKWLIDGLMEGLIFFFFLMYTVGVQDNLYTYMTAAIEDYGATFFTMLVL
                     VADLRAGTLVTYYMLPFALVIGLAIILVPTLEFAYAALHDLAGSNWFVYVANELYGTS
                     GKFWLMLFFACGVFVIFTMASNMYIQLFAPWHNAGFAMRAAHRSNHRVPYQHTKEELK
                     AEYARLLARYEELTKLQQQQKESAAKKSGAKGKTQTTTTAAAAAR"
     gene            complement(<361730..>362290)
                     /locus_tag="LMJF_09_0900"
                     /db_xref="GeneID:5649522"
     mRNA            complement(<361730..>362290)
                     /locus_tag="LMJF_09_0900"
                     /product="putative ef-hand protein 5"
                     /transcript_id="XM_001681212.1"
                     /db_xref="GeneID:5649522"
     CDS             complement(361730..362290)
                     /locus_tag="LMJF_09_0900"
                     /codon_start=1
                     /product="putative ef-hand protein 5"
                     /protein_id="XP_001681264.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649522"
                     /db_xref="GOA:Q4QHT4"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:Q4QHT4"
                     /translation="MSCAKEASPSLSQQKRSDVCRAGLSGFSSAIYRGALNHSASAEL
                     QEGYRILTSGQKANIISDKDLFKAVHGCGLHTTEEEVNDLLRVVHQDERTLGLEFSEF
                     MMLMTKEIDEKSIEEMRSAFSVLDTNKTGTITKKQFTELFVSSGEHSSAEELEELMLL
                     AETSEELEVVDYDKLINELAILLNKM"
     gene            complement(<363918..>364367)
                     /locus_tag="LMJF_09_0910"
                     /db_xref="GeneID:5649523"
     mRNA            complement(<363918..>364367)
                     /locus_tag="LMJF_09_0910"
                     /product="putative calmodulin"
                     /transcript_id="XM_001681213.1"
                     /db_xref="GeneID:5649523"
     CDS             complement(363918..364367)
                     /locus_tag="LMJF_09_0910"
                     /codon_start=1
                     /product="putative calmodulin"
                     /protein_id="XP_001681265.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0910"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0920"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649523"
                     /db_xref="GOA:Q4QHT2"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:Q4QHT2"
                     /translation="MADQLSNEQISEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNP
                     TEAELQDMINEVDQDGSGTIDFPEFLTLMARKMQDSDSEEEIKEAFRVFDKDGNGFIS
                     AAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKMMMSK"
     gene            complement(<365681..>366130)
                     /locus_tag="LMJF_09_0920"
                     /db_xref="GeneID:5649524"
     mRNA            complement(<365681..>366130)
                     /locus_tag="LMJF_09_0920"
                     /product="putative calmodulin"
                     /transcript_id="XM_001681214.1"
                     /db_xref="GeneID:5649524"
     CDS             complement(365681..366130)
                     /locus_tag="LMJF_09_0920"
                     /codon_start=1
                     /product="putative calmodulin"
                     /protein_id="XP_001681266.1"
                     /db_xref="GeneID:5649524"
                     /db_xref="GOA:Q4QHT2"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:Q4QHT2"
                     /translation="MADQLSNEQISEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNP
                     TEAELQDMINEVDQDGSGTIDFPEFLTLMARKMQDSDSEEEIKEAFRVFDKDGNGFIS
                     AAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKMMMSK"
     gene            complement(<367466..>367915)
                     /locus_tag="LMJF_09_0930"
                     /db_xref="GeneID:5649525"
     mRNA            complement(<367466..>367915)
                     /locus_tag="LMJF_09_0930"
                     /product="putative calmodulin"
                     /transcript_id="XM_001681215.1"
                     /db_xref="GeneID:5649525"
     CDS             complement(367466..367915)
                     /locus_tag="LMJF_09_0930"
                     /codon_start=1
                     /product="putative calmodulin"
                     /protein_id="XP_001681267.1"
                     /db_xref="GeneID:5649525"
                     /db_xref="GOA:Q4QHT2"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:Q4QHT2"
                     /translation="MADQLSNEQISEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNP
                     TEAELQDMINEVDQDGSGTIDFPEFLTLMARKMQDSDSEEEIKEAFRVFDKDGNGFIS
                     AAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKMMMSK"
     gene            complement(<368909..>372583)
                     /locus_tag="LMJF_09_0940"
                     /db_xref="GeneID:5649526"
     mRNA            complement(<368909..>372583)
                     /locus_tag="LMJF_09_0940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681216.1"
                     /db_xref="GeneID:5649526"
     CDS             complement(368909..372583)
                     /locus_tag="LMJF_09_0940"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681268.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649526"
                     /db_xref="InterPro:IPR021846"
                     /db_xref="UniProtKB/TrEMBL:Q4QHT0"
                     /translation="MVKQRMTALDVRATVEEMRATLIGLRLLNIYNIGSKVFLFKFGH
                     GEKKQQVLLESGTRFHLTELAREKPKVPSQFTLKLRKHIRAWRLDSIAQLQHDRTIDL
                     CFGVPSTEGCFHIIVELFSKGNVILTDYAYTIMMLLRTHRDDEGLELKVNRVYPVTAP
                     FVVAVAAESAEAQEVDTATVASAAASAMRTAASAAEEPHMSLYPPHVDVSGHLHVQRT
                     ADADLTLAQRQLKEERTRLMKVDWEVGLSRSNDRTVVQTLVAGIQHFGPDLAQHVLTV
                     TGVPNAPRKSWTQSTESIFATLCPGLLEAFDLAKVDLTSAGGYLIKPKARPGSAAHAS
                     APPAPGASAGAADLVAVAERYESFTPILLAQYANDGVEALYRTSFGRVCDEFFLLTET
                     ERIDASNAKRKNTAKSKEDKFAADHARRINALETDIAANQMKGEQLILNADRVDEAIQ
                     LINGALATGISWDALRMLLKRRHAEGHPVAYMIHDLFLERNSISVLLETALDEENGEE
                     DCDVPPLVVEVALSKTAHANAADYFSKQKQYRSKLERTVAATEKAAAGAARKGARKAA
                     GQKEKKVIVKERQRNWWEKFFWFRTTAGDLVLRGKDVQSTELLVRRVMHLGDLFIHCE
                     VDGALPCLLRPMNDVWQELGGNNAGGDLTASPATQPVALRSVCEAGAWCVAFSGAWER
                     KQTTGSWWVYASQVTGGTATGAYLYAGERHHLPPQSMSLGCALLFYVARTVCEPAAVA
                     RAASAACAGDDDEGAEHVEDNAVDSFTVLRCELPSLLPSPADSGQPSGPGEAVVPADA
                     AAALVELPSVEALRAEQRKQRSLFVAGGCNPSGGGRAGGRQKKGKAAKKGGARNSRVD
                     RAGLQGTPAATVAFLPSSAMEDGVATAVAVTATPKDNAQGRNLTKHQKRKLRKIQDKY
                     GDQDDEDRMLGAQVNGNQLSRAQLLALQRRAEQRQEAEQAKRAHEKESLSAQRAVCTP
                     QYRSIGHDNGQEDAEEEEEDDEVVSEFTDDGEETETNVAAIDASAAEAGGSDEEDEQA
                     AAVEEAGGGCETEGEEEATEAGAAASTAAGSRNDRDAAIVQQSAELNCAFPHYTMRPG
                     PMDTVQHVVAVCAPAIAVSEYVYHSTLCMGSAKKGALAAKLLQLFTARAEQGEAGADG
                     TATGLGAVSLGAQGRKATKTAAKKGGGAPTGRPRSPSWASSPAAATVNPSVVKALQMM
                     STNDVVEQLRANVKPIEFHL"
     gene            complement(<373103..>374890)
                     /locus_tag="LMJF_09_0950"
                     /db_xref="GeneID:5649527"
     mRNA            complement(<373103..>374890)
                     /locus_tag="LMJF_09_0950"
                     /product="SLA/LP autoantigen-like protein"
                     /transcript_id="XM_001681217.1"
                     /db_xref="GeneID:5649527"
     CDS             complement(373103..374890)
                     /locus_tag="LMJF_09_0950"
                     /codon_start=1
                     /product="SLA/LP autoantigen-like protein"
                     /protein_id="XP_001681269.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649527"
                     /db_xref="GOA:Q4QHS9"
                     /db_xref="InterPro:IPR008829"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR019872"
                     /db_xref="UniProtKB/TrEMBL:Q4QHS9"
                     /translation="MDDRSLKLAEDFVSARYIDAGRESLRSTARILRSILAQRCCPDE
                     GLTDAAIELILRQLSLMDTNNFARHVGGGEREGRVVSALVRMRHFHLTHGVGRSGDLF
                     SEQPKAAGSSLLYKITNVLMLDLIRQAGAPSTAAAVVVPMATGMTLALVLRCVAKTHM
                     KELMKEAEAVQLQRTATKDSTSAASAAPAQEPPMSEADRGRHGRTSLPVPATPRYVIW
                     PRIDQKTALKCIDAAGLVPVPVQLRPAVPLARSAALCASTNRDSLDRGQDSIGSPSTP
                     TSSSSLFLECHVDDVAAAVSAVGGPSQVVCVLSTTSCFAPRLPDNTVAIAQYCKKAGI
                     PYVVNNAYGVQSRRIMTRLDAAQRLGRVDFVVQSGDKNFLVPVGGSIICSSDKERCKA
                     VTALYAGRASMSPIVDLFITALSLGRRGMQALWSDRYKCRARLIRQLRVFARERREVL
                     LVDDTDDDKADEDTVGGSQKTSNAAAPRNDISVAVTMRAYGLPAAEASSSGAQRGSEQ
                     VGKVTNWAAARALGAQLFRSAVTGPRVITPAPSTPTTIAGCTFRNYGMHQDREPPCPL
                     LVIACGIGMSESEGDALMARLRDLWPVPT"
     gene            complement(<375711..>377582)
                     /locus_tag="LMJF_09_0960"
                     /db_xref="GeneID:5649528"
     mRNA            complement(<375711..>377582)
                     /locus_tag="LMJF_09_0960"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681218.1"
                     /db_xref="GeneID:5649528"
     CDS             complement(375711..377582)
                     /locus_tag="LMJF_09_0960"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681270.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649528"
                     /db_xref="UniProtKB/TrEMBL:Q4QHS8"
                     /translation="MANYVTGDPLGVAGQEAGKGAGALLAAVQQCSAELSHEFGDGVA
                     LMTGEPAAATTSSHASPLSPEQRVALSAGAVTCLSVASLPGTTDTAVAVVGTTVGTVA
                     LLLIEGSRAVYKVAECSLMEWSSGAITAQDAIVDVAFSMDPAGRPEFVGAASAGCVVV
                     VDVQLLYRPSGNSSRSTDEEVGDTATDAPAAVVHRAEWHQATELWSNSALRAKAVEAL
                     ERSSAQLVRHCCSDVFACSFVEADVVRILAPQRLQAAVAIDVALVVVLSSGALHYVER
                     VVEGGSVRLLAEHHWQRLAKGAAFTSHASAATQGADSAAENDFSADGTSVHLVTDSRA
                     VPHVIYRYRLSPYHVQACQDGGQTASGGGGNYSMAALALPCATESVTHVCDAHLHFSE
                     KDAACHVVLAGTQRVPVGKVGYMSVASRVGSLGHAQQQQHAGVAGCRTLAWWAVVQNA
                     VLPRQTFDRSALERQALQHQHQQQQQQLHDGHAFPPFRTNAGSPPFTVHVQSNTMALP
                     CGLGTCPASALTSPATSSPATAGAGVASGVSAVGPGQGSGFAAAFMLTDILVLASGHE
                     LYVGDLRDVPRSAKTLPVPRPLRSFGSVVEGITAGPYMDARAVLVATGSRVAPVSLV"
     gene            complement(<379532..>380746)
                     /gene="EF1G"
                     /locus_tag="LMJF_09_0970"
                     /db_xref="GeneID:5649529"
     mRNA            complement(<379532..>380746)
                     /gene="EF1G"
                     /locus_tag="LMJF_09_0970"
                     /product="elongation factor-1 gamma"
                     /transcript_id="XM_001681219.1"
                     /db_xref="GeneID:5649529"
     CDS             complement(379532..380746)
                     /gene="EF1G"
                     /locus_tag="LMJF_09_0970"
                     /codon_start=1
                     /product="elongation factor-1 gamma"
                     /protein_id="XP_001681271.1"
                     /db_xref="GeneID:5649529"
                     /db_xref="GOA:Q66NE0"
                     /db_xref="InterPro:IPR001662"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR004046"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q66NE0"
                     /translation="MTYKLLAPLHPESARAQKIMVAAAYANVDVELKVCQYGQENETP
                     EFARNCSPCMRFPSMQTEEGYLFESNAIMRHIARVEKSGAKLYGATPFESSQVDMWLD
                     FASSELDAHNTPYLMETFAGIPAPESAMATLEESLAGLELWLETRTFLVGERMTVADI
                     SVAFALQWVYRMNVKHGEELTKKYRNAYRLYNTVMQQPKTVEVLKQWGATFGPAKAPK
                     KAAEAKPKEGKKPKEAVEDEEEQPAKEEKKSNPLDALPPSSFVLDAYKREYSNTDTRT
                     VAAPYFFEHYDAEGYTCFWARYKYNEDNKKQFMTANLVRGWFQRMEHVRKYAFGVALI
                     IGEDAAHELVSFWVFRGKGMPEIVSEVVDTELFEWEEIKDVQAAKEKITDYLCWEGPT
                     IPRPVLEGRCFK"
     gene            complement(<382237..>385251)
                     /locus_tag="LMJF_09_0980"
                     /db_xref="GeneID:5649530"
     mRNA            complement(<382237..>385251)
                     /locus_tag="LMJF_09_0980"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681220.2"
                     /db_xref="GeneID:5649530"
     CDS             complement(382237..385251)
                     /locus_tag="LMJF_09_0980"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681272.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649530"
                     /db_xref="UniProtKB/TrEMBL:Q4QHS6"
                     /translation="MNIWLRRALERQAESAIAEAMRDGKPIPEAAVATVASIALGAAA
                     ATPTQAAAVEPKNNDASTSAKTLAAPPVAPKTSFAELMRQHREGLVPPSAQPPVKVTT
                     VVKRPKGTKSPTPVGTPAAEEALPAPAPNKKCAARSAGQARTAPEAAPATLSPSEVEK
                     TAREEGEPTQTTPTTEADSSATASAAVAVHQAAVRKRSKATNSVPAKRAHDTSAATSA
                     AATPTHVTTVKGKASLEELRARRNRTTAGGSANHHNTPHPGEGGAGVASSSGAGKAGG
                     GHSQQDEYNDSALDAVSRLLLRYCVGDRTTVTVPSTVAATNGVDVSSSSTEPVAAPSA
                     ESPPASTQTTTELEFLNELMEFCENDSVTPASLELLRELFQHVRVLPRPASASNAGKN
                     CANADAGAPAVQDGMATMVELDAEAYREAARRREYVQQVIMVLLNRLKHMKTQEQRQR
                     QKCCGDSAVETSTSAVAASPQPATAYGAPFIKVGGVSLAPPPMSSLSQQQQQSGIMYP
                     QGQRTASAAPWPSMAEMASAYPDEAAAAAFTSDMMAYGYPNPYAHLTVFSQHQPVAPP
                     VGWPSPFHSPTAGARRGRYGHHGSKSLNSNSDVAARLVASPFPGAFPIIPPPATTDTS
                     ADAEDHEMQELFRMIRTQLTQPVNTQSSSVTAISSQVESSVSLSGTAPVEVSQEERAV
                     LRHVQMDFKKHMEEHQQQQLAAAEGSPVPQPPPPTAPTPPTASLTAPPGTDATPPRRM
                     HATPGATADTSDSAAGTATVAAAATQVESSKSQRDQTLMANQANCLEEKGEAAGESPS
                     ARSTTAPAQQQEEEGGILTGKTAPAKPRGTTLSLNAKPFVPGGARGGSSSTASAIIKL
                     TATTGSTPTKTTFNYHAKPFLPSGNASSLMPAPPQKPAKMNVAAPAFVSKQQQQQQQQ
                     AIAFPSVTFSPPTSAPPLNAPTTSTPAMPSPLPKCVADPWASYEMFARWRDMMEAYYQ
                     NVFAMQNAAATTTGPSSSSATAGGAEDHSHQL"
     gene            complement(<387471..>403616)
                     /locus_tag="LMJF_09_0990"
                     /db_xref="GeneID:5649531"
     mRNA            complement(<387471..>403616)
                     /locus_tag="LMJF_09_0990"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681221.1"
                     /db_xref="GeneID:5649531"
     CDS             complement(387471..403616)
                     /locus_tag="LMJF_09_0990"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681273.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.0990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.0990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649531"
                     /db_xref="InterPro:IPR026854"
                     /db_xref="UniProtKB/TrEMBL:Q4QHS5"
                     /translation="MVFAGYVAFILSTYLGKFIKRLNKDSVNVSLLRGSIELKKLELL
                     PDLLYSCEHLQLESGTIGSLSFKIPWHSLYRKRCEVVVRDVSITVAPKHQRSDTATAF
                     FRSKEEFLTAVRGALADATKHEKTQKDSKSGFLCRLQQTILKNLAFRLENLSFQLEDK
                     TGCWKGQTARVQARFGRLTCEATDSNYKPTFVQPEDSIANESLYRLVSYEGVSVRLLY
                     SSKGEELLQRRSSQSQNSESVDSFIDAEEVLVSSEGAMTIYLQKQSATVQTERRVFAA
                     LMTRKTTLQWSASCTTAIGILLESVKQAPRRAFFWSNRPASRIRVGDPAGTSRWWFYA
                     IGKVVTYQKARRDRRRFDWAVYQRRKLFLASLFTFCLQLLKAPWIPSGEEQSLSEDQL
                     VRTSAQDVMACWNAARECFAQFQRTKRPPQGSAYEQYLQYFYLNEQKSREEPLLESSP
                     LTALPAEIGLTIECAELAVSLDQNLRGVTNQTYIGITASRDKLCVQLSAATATVVAEV
                     DEDKPVLAITGGDTAGVWLMASKVGHSPASVELVIEEMVVCLDLSFQELLVTKVASYT
                     VAARPFLNQDFSDVSTAAVLVGNKVDHLEVRTQQEPFSSFSIIVKFVTGKADGVWLHA
                     QCAQLALALSRPPAVEIQEISAVVNDATLVQLSSVAVTPAVGSDGIHIEVVTDSANIS
                     TNVEGFEYVKLLLGFMRQQWSSRTNSFVSDLQARSSGDAKQDALSKEKSQVNLALRFE
                     FIEYGALALEAFSIRTTFGDGWHIHLSAAGGTTEGWCHSISPRPQEPFIDIHVWAGAF
                     LVYSPFADSIEDNGITFTCNFNHVTVCLGNDLISSLESLYDTVMMILYDDEDRHVYLS
                     ERDKYTTPQIIGLFTGSHMMLLLDSKGGDLTLLPGHADTAVAAAAATAAARSADYCRP
                     GATPLPTPPPLTVELLGEECLHVSLQRYGDKRMDVHVVLQSGVNAYLIGAPAHIPLFV
                     PRDSMRAEVDLHLCSPSAMDLPIFPYGRLNVVVKLSNVATVMHIPTLTAVWTYFDTPS
                     LPLCRLRNIGLRLHFSSRPSHPGATLAPRSPASASVEAVGAAAFAHISRPSEGGARSA
                     SAPVSTLAQCDVYSMPVFPSDMRLSVEIAESELYYPWGEGSVAPLYLHAELPNCEVVM
                     LSRDGCVEVTVRGFMTMPRVRPALHTIPRAMSETTAQSAEASTTRTVAESSGEHGSYK
                     KAPPSRTSEEHAAITTDAAVDGGSTARPCSSRGTSSTAQQTNRRARTAHSPAAAQAAF
                     PSEEYLAAPQHCASPPLASSLIQVHVVYTIDSRPPFSPGNPDESLRVSLTATAVPGMG
                     ALPGPLHASLRSPAEVATWLTFFTFFDLTNTVSLSTSSCAATVSPTFVSAGNKNSGGS
                     GGSMPTSAAQSPRRLIMNVHTSPIVFHLPFAAAAAVLWEGLDFVASPGYSALRIPKLD
                     VLVHEQLWCTAATGVAASVQRLATLRDNGYAVLSLRSSSSGSIGEVDMAPAILFESHA
                     TGPTAAEVHRRLVLPAIVGHLAHATTLVQLQQCSTLAAVSAVFAARNAQTALLNAVIV
                     QESQRRKLRYACCCATSAGGRGSSGTDADAEAQLLPLLSPPLAIHIHSGCLTFEWMSG
                     LQQGLRAGVTVAFANARCNDYDAHNHLSAAQPTDDSCDTTAHCPQRFPLAVTMPLIME
                     VEAVEAYAWWTNTESTSTAEAAVGEEVASLEDPQSTSKQHPSVPLVTACMPLLLYPVQ
                     VHTRIDTAAQAADTDTGKAARERGTTAAAASGTCLSVQQEDARVATSEEELKLGSAVS
                     SGDDTIGTVARRSQSLSSATLHTMPSTPSDRSSVTAAAVPTAIMYPMRPAEALRTSVF
                     LVTPIHVVLNNSAYVVLSEMLLHKVQGTSAATAAGAQGAAAEATPPVSQGVAIVSQYY
                     LKHCVVELPTAARGSAAISSDSASSPFPTLACSRSGPSSYTRSVRNSFGGSSGGHASS
                     LLVRAQAARAKTIYVFRYDSAPKQRVWVESQSQPSWQPDQQQPNGDNSVEKGGERGLE
                     PSLNGAAEIAEVEKRGVPMSHIPLSSPYAMDGMRMLEAPAAHDGPANLRGGRVHAGHS
                     RLSSPSMVQEEKRREPHRRPRPSTQVTRVVSTLGPQDATQPRLPMRMTVAEVCLRLVY
                     YRDVETVAAAVSEERRFWQRYAAVHASARRAAAASPAPATTTEAPCLMTFLAASVAPL
                     RSLHPASTNSSTARSRISRNASPLKRSRTPLRWGQAPASPASAHQLLLAPTAMLEEAC
                     VDALCVRLSGIIVSRFTDARSVQLESCVCTSVKSPSRPLLSTTQVELYVPSSAVAYPS
                     AGEAATTVTRDLQGATWVTEVLRDMETAPEAESVGASPTMSPKDTNAIAAPSAPVLPQ
                     PKPSDPTRQAIRSHSADSPSSAAAPTAASTSVNGWNCNGDGAHRQAIVMQTDVGCRLE
                     TLTIDLSAAALRAWLSCLVEQPVAALRAATEEEKRAEPVADRSQRAVVVATTTTPILS
                     PVQWKPGQGLRVHEIREAFWNLEHDITLSRDGLVLVFSSQETNLLTVYLNGHDITLDP
                     SLLHRPAGLQRVVMIVQGGLTVRFVGSGRVRLPLALWSSSLVETTANVGLETALLPFM
                     AIGEGSYLECAQVRLGFTEPSAESSAGGGNGREPTASSQRPVPDSLAFISKALAGVKA
                     EEGSKDASVDASPLPPPSSHAGPHQSQLVHRNIHLYVPHISVIIEPRRESRQLHIRTA
                     VESWMSLCNGRLLRDDVRCTGFMVLSESVYDAATTTARTTVLAPVNVSVCSRNGRHHA
                     VSLGPVQVDLGRADLLIISTYAGELQALRLYAKHLTHSKVERAFLEVVEATLAWKASA
                     ATTNNTGVHGEEDEHDSELYDDADSSDTSEEKKGNEERRSSGPRGGAAREQSVAAVPP
                     SRTDFAHANHASDASGEAASTAAVREGAMSIDRPLSSSTGPRRESHRQPSRPATMQGS
                     ATRRTGTTKTLLRQAVAGSEVQEEVRSHVCAEDDQTCCVPTVDVRRQQQQQQQRRRQR
                     LLRRRQSRGFSWVVFTFSVEVIFSDHRYPLMQVCVQDVMVRRTSSSALASTSLVRCQR
                     ASVRVHGRGRWDVLLKPSAALTWSLTQTVSRHSSNRHVSLVVEGVHWRCSHLIVAKLL
                     YMNRQFSTLVASLRRRLTMAAAAGGEASSAAAPASVADVAMTPAVTKFRGEDDSGRDT
                     SSNTTADSASVSTDGDDSSDSGDSKRSSSSSRQSNASTETFSDASSQRRRRQLRQDAA
                     AMGAGGQSADSSLTMEATPSSSSFAASSSVAVNEVPITAVTTAADRLAATMRSSQRGG
                     HSRPSMTAGAGAPASTVAVSPGMATHRLLNSFSHTLFAGICECVAATTVSATATPDVL
                     SAAARSADSSSLQPTAEPAVPMLWRCNELYWLPPASTTDIFISYRRAHSLMLTFFTAE
                     CVEWDGVNCVWTLNAKGETALAARAIVSTAKPSPTVPPLRQQQQLDTSRGTVSAATTN
                     WFAFTSLQYGMARALTICTTASRGAVAAPASTPATATGISEYGGGNGSGGGCKVLAYS
                     LALTCVDPEEEADTSRYPIVVASGESDDDGLTPVPHQQQQRQRHARRRSFTASSADAS
                     APLSRSASSMCVGSLKKGGALLCGSTSKGAALRMARGSSSSRADASDLTSNNFVPAQR
                     VEPLLHRSHGCYDRLQMAQCGAASTHSLPDQRRSSATISTTTDNQKPAAQRRGRPHSR
                     SPGRVPPAVHRRYLQPPYHVKTASTPVPSWQDTEGGGGDLLVVRLQARSSLFNETGCT
                     LQLLSSLQLLTALNSVDDAPSLPTTLTTVPPGWQLPLNEEDVHNEVVLRVCCPSTRWM
                     PSPAALSATTASPTRVTVSGHTAGVAETMDDATAHLGWYETRTVLGQLQSGRFLSFRR
                     VDVAGDAVGPPVDVAGAATANDSASSLHRCATSSRPRGDHDERLLILFVIHTYSADGL
                     MQHISLYPRLTLINHLGLTARVVVFQQDPLAGPQTPDEATLIAKWTAPRVGRGLHDQE
                     RFYRSLVALGIHDALPHQHALPLHLCTYGSNLILGLSFTQSTGDAFFTADLRPVVTHL
                     RDAVDRHPRLLQLRDSHGRAFYVQVSVMSRTVVLSVALWVYNLTEYPLLMSDGFLQRR
                     LCPGQNSTSGIIPSQGEPFLIGCQLADFTQGFFAIGMDGGWSSAVPIDVGSSGVFVSV
                     LSQLGIARSCNYSILFPNAQEGRPMVIQITPRWVFYNNTPKQLRLQFQFPGLETAMQQ
                     AEKRRRRLRMREMDATAAENDIEAAAVPAGDAGAALQGARHRLLLKADDTVGALNSIA
                     AVQLNPGDYHVSCIGPIEGNQFRVQEVLQGILPTIASIDAAGRVGHRDVSSYYESQYT
                     PYMDVDRPGEATFNLWAAPRALGKQLAVNYGSDLIVQWPSAPHPTELEPHDMYSADAV
                     ITERIAVAVQSADNVLAVLLQPIQGTKILLQNRTQSHTVMARQLGSSRRNCIPPRQNR
                     FFLWEDARQEHTIRVHLLGYKGRWFDVDFSAGECQVTRHVDTEAAAAAEALDHARRLH
                     PHPTQVKLEAELHGRTAAAADFSFHVRGYTNTEKTRVTILVTEAPVPVYAAIDSWRTS
                     QAVSLRMTMVQLSWTQEMSTYVATAAKFATPFAIDDGDDGVVDNGASGVAITPAEDTD
                     RGGDTAAAALPSSVENAALFSIILEGVQLERLATEDNENFYLAVHQMQWVDEKQKAVF
                     VYRARPRLPPAMATLQAADAAQSSAGAAAAMLRTPRLSSASPSSLSSPSRAKPNPSDR
                     TGSLTRRRQLHRAGSPAVGTAAAGAKSRDASSGGYGALLEPITATANRLLSTALGRSD
                     AFLLCMEKQNDLELSYSLIKYADGVTRYTELRNVLTPLVVVLTDFWVVDMIQEVRRLR
                     LLLGLHKQSVASQTTTTSPLVLTVSSLRQQQRSTWRSFGDEDTGSGVMVVVPGKQAFS
                     DPCARPPSWRLGQRSGSVIVVDGDTEAEVLPSEQPTLAAQMVPRHRSPSKRTSSEDAV
                     RQRRPGQQTNPLSRRGSQGRNRDGDKSSVTATSSVHTRRTGSSHTHNSKAGKMRSATR
                     RLVTTTPASPRRYGPSCAAIAATAVTVPPQQQYQQGGGNTAGFLSQAFFLQQLVQEVR
                     TRLEQRGTDVMAGSVAALATRGEKQLQSGSGKLLLLPGGIAGAGPEVQHRQLLRGTAS
                     AAVRHYQSAMHRGVPGDGLVGATTVDADGNRAVADVGGSGARAAGDGGVGRVSTASFM
                     FIERLEVQRVTLYVTFVRHSPDPLRPLLGAYAWMLPSQLCQREFYLPAWTLTRQVETP
                     ASLRARLVRWGMHSLREQWTKVTKLGTLLDALKFWQHRTLLLHGAPRPLTLSRVQKQQ
                     QQQQKRGGGGGQPLATFAPCVSSGEEEHDENTDDDGGNADPQRGGAQVKSTVAPMEQR
                     L"
     gene            complement(<404091..>405029)
                     /locus_tag="LMJF_09_1000"
                     /db_xref="GeneID:5649532"
     mRNA            complement(<404091..>405029)
                     /locus_tag="LMJF_09_1000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681222.1"
                     /db_xref="GeneID:5649532"
     CDS             complement(404091..405029)
                     /locus_tag="LMJF_09_1000"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681274.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649532"
                     /db_xref="InterPro:IPR018997"
                     /db_xref="UniProtKB/TrEMBL:Q4QHS4"
                     /translation="MNAVKLPEEWETLCSTNDAEVIHECINGVFRRLLANLLLDFNNP
                     KLRQVKKDNKALHRLTDSLPAGFIEFLFSSIGFVEHDDVFIFEGSPESLKHGDAVLSY
                     IEDSFGKERLQAAECELHRLRNLAIKKAENGLAPREMMTATAPLPRTQPLPQEEDAKR
                     QAQHSGTEKDVAEEHAVKETVRKTLLNTGRVRNGFFEARDFSVRIMQHGRVYACTEKC
                     PDHCVEVHWHLLTGRNILYSHLAHLSADGTRLLHLGPEHGYQYNSLPGSANFGKMIHF
                     SEKLMDENGRLVHIKNDDKPVTACIYCGRAFAQLLL"
     gene            405536..405608
                     /locus_tag="LMJF_09_TRNAVAL_01"
                     /db_xref="GeneID:12982585"
     tRNA            405536..405608
                     /locus_tag="LMJF_09_TRNAVAL_01"
                     /product="tRNA-Val"
                     /db_xref="GeneID:12982585"
     gene            405670..405788
                     /locus_tag="LMJF_09_5SrRNA_02"
                     /db_xref="GeneID:12982596"
     rRNA            405670..405788
                     /locus_tag="LMJF_09_5SrRNA_02"
                     /product="5S(M5) ribosomal RNA"
                     /transcript_id="XR_002460092.1"
                     /db_xref="GeneID:12982596"
     gene            405863..405933
                     /locus_tag="LMJF_09_TRNAHIS_01"
                     /db_xref="GeneID:12982590"
     tRNA            405863..405933
                     /locus_tag="LMJF_09_TRNAHIS_01"
                     /product="tRNA-His"
                     /db_xref="GeneID:12982590"
     gene            complement(406114..406186)
                     /locus_tag="LMJF_09_TRNAPHE_01"
                     /db_xref="GeneID:12982594"
     tRNA            complement(406114..406186)
                     /locus_tag="LMJF_09_TRNAPHE_01"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:12982594"
     gene            <408693..>410540
                     /locus_tag="LMJF_09_1010"
                     /db_xref="GeneID:5649537"
     mRNA            <408693..>410540
                     /locus_tag="LMJF_09_1010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681223.1"
                     /db_xref="GeneID:5649537"
     CDS             408693..410540
                     /locus_tag="LMJF_09_1010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681275.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649537"
                     /db_xref="GOA:Q4QHS3"
                     /db_xref="UniProtKB/TrEMBL:Q4QHS3"
                     /translation="MPSNKVLVVTGAVLATAALIGTAAITRSYKKSTEDNDDDAFCAP
                     LSSLSQSTKQTFSVAKNTARSSEAAASEATTSQEKTKAAPTTQPAAAKKDASAHADVK
                     VPAAADAAASLLEEALDELEPTRPAASAEETKVASKRTATKVAAADTADRKTFEHLGI
                     SMKVPEGWEVREELSPIPNVAMVTVWNPEFEHFPNAEMPGAVPVIILSVEDIRGENLN
                     LVEFKDRSKDLSMQQMLMMTGGVVQPIVRKDSSVQEGSFRHILEYSQSMPPFFDLSVI
                     NLLEVRNGVAYVFQIMCNPKIMNQYRPIFTQLARDIVVTPMDSSSLGFFRVHTGKVSM
                     DIDTTWSWSYPDAGDDAALHLAQFQLASTVKKEEITLYEVSKAPATEHKQRKEKTVDG
                     VTICSAFDGTQEKKTFTYNDYCLVVHPQQKAISYLSEAALVRAVKSVTPSAEPPKPKC
                     GAAFITTEYGYTFDVIGASRVVSTKLGNGTVVYAPQGIPSDPSKAASPEETGPTVTIR
                     IGKPETDPDCMGSIEEWTTRIREEAANGTITKIQVVQLKEQECLTFLSKEMQEVSPKE
                     RVEVVGKVFIFVRNGTTTLVRWESATGTWRKYERDMEAFLESFQFLESA"
     gene            complement(418490..418561)
                     /locus_tag="LMJF_09_TRNAGLU_01"
                     /db_xref="GeneID:12982586"
     tRNA            complement(418490..418561)
                     /locus_tag="LMJF_09_TRNAGLU_01"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:12982586"
     gene            complement(418620..418740)
                     /locus_tag="LMJF_09_5SrRNA_01"
                     /db_xref="GeneID:12982593"
     rRNA            complement(418620..418740)
                     /locus_tag="LMJF_09_5SrRNA_01"
                     /product="5S(M5) ribosomal RNA"
                     /transcript_id="XR_002460091.1"
                     /db_xref="GeneID:12982593"
     gene            complement(418801..418873)
                     /locus_tag="LMJF_09_TRNAVAL_02"
                     /db_xref="GeneID:12982589"
     tRNA            complement(418801..418873)
                     /locus_tag="LMJF_09_TRNAVAL_02"
                     /product="tRNA-Val"
                     /db_xref="GeneID:12982589"
     gene            418948..419019
                     /locus_tag="LMJF_09_TRNAARG_01"
                     /db_xref="GeneID:12982597"
     tRNA            418948..419019
                     /locus_tag="LMJF_09_TRNAARG_01"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:12982597"
     gene            419086..419156
                     /locus_tag="LMJF_09_TRNAHIS_02"
                     /db_xref="GeneID:12982592"
     tRNA            419086..419156
                     /locus_tag="LMJF_09_TRNAHIS_02"
                     /product="tRNA-His"
                     /db_xref="GeneID:12982592"
     gene            complement(<420124..>421917)
                     /locus_tag="LMJF_09_1020"
                     /db_xref="GeneID:5649543"
     mRNA            complement(<420124..>421917)
                     /locus_tag="LMJF_09_1020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681224.1"
                     /db_xref="GeneID:5649543"
     CDS             complement(420124..421917)
                     /locus_tag="LMJF_09_1020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681276.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649543"
                     /db_xref="GOA:Q4QHS2"
                     /db_xref="InterPro:IPR005045"
                     /db_xref="UniProtKB/TrEMBL:Q4QHS2"
                     /translation="MSMLPRSNSATVAPQPASGGGAPAFSVSMSSSRWPQRGASPPLT
                     TSSQVPPSAESSSANSSSSRTSSSYADSDDERCRVQGSGGGVRGAGNAAAVSAEAPKS
                     RSTRAKLWLQKKLVPDFVHEYGRTVYGGNPLSQQTLPGVFNYPPPFILVPIFYVLMVP
                     FLILGTLVLVKGREYHIVEQEYSHIHQYQYVPSNSSVNINHRILQFTADGVTHAQGTR
                     TWLEINISHHMKAPVYMYYKIANMHQNHRDFHNGRSNSQLRGKSTIKKPYLCQPYTYP
                     GFRSDEGDTPITITDATGAQVTRPASYFTYNPCGIAPWSKFNDTFILYRKLTPAEVLQ
                     ANTSGIPVLHGGVDSTTPMTLICNGTDFGLRGEPLHGSVTKNHCSKMGITWKADREVR
                     FHNITLREDWWSLYYPYPTTNEYLRNGWYLHEPGHALPDPSDYDLHVWLRASLTSNFR
                     KLYRIINMPLYPGTYLVEISEFYDVVSFRGRKSVVLQNANWVGGRNIVLGVVFIVMGC
                     ASFVLGVTFTVECMLQLNGVNRYKRLREPKRSWYVFWPNEPEFANYYQLRLRRHIPMA
                     QLQLLRKAVAELESLTRDGDVNRNDVNGQRA"
     gene            complement(<423074..>424015)
                     /locus_tag="LMJF_09_1030"
                     /db_xref="GeneID:5649544"
     mRNA            complement(<423074..>424015)
                     /locus_tag="LMJF_09_1030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681225.1"
                     /db_xref="GeneID:5649544"
     CDS             complement(423074..424015)
                     /locus_tag="LMJF_09_1030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681277.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649544"
                     /db_xref="UniProtKB/TrEMBL:Q4QHS1"
                     /translation="MGTADTVARPIASPSRAVHTSSSAPAQRPLTSARGRRAHKTAPF
                     ASPQPVLLRNPYGMERSRLVDALHGGRRAGFRAHQHGPTSSSHADAEALLSRQDAALY
                     DACATRLRVVQQERRALAEKMEASKQQLEHVHALLDVWREKPQQPPATAPTKQAERDG
                     AVPEPQPSSSPRKQETERIIRQLRELDRANDELRRRYEALMQEKRHCLTVHNARLRRP
                     APAAAPSSTISRRSSAVAACNESSAFARNVKTLETLLATAMAQQQTLQQGLALAVAKE
                     RGRITALTDLQARGFACMYAPELNGSAITSASREAGA"
     gene            complement(<425966..>428023)
                     /locus_tag="LMJF_09_1040"
                     /db_xref="GeneID:5649545"
     mRNA            complement(<425966..>428023)
                     /locus_tag="LMJF_09_1040"
                     /product="putative phospholipid:diacylglycerol
                     acyltransferase"
                     /transcript_id="XM_001681226.1"
                     /db_xref="GeneID:5649545"
     CDS             complement(425966..428023)
                     /locus_tag="LMJF_09_1040"
                     /EC_number="2.3.1.158"
                     /codon_start=1
                     /product="putative phospholipid:diacylglycerol
                     acyltransferase"
                     /protein_id="XP_001681278.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649545"
                     /db_xref="GOA:Q4QHS0"
                     /db_xref="InterPro:IPR003386"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q4QHS0"
                     /translation="MHIETSINAMHRPPPVEVSPSNPKVSAARRHAPSVAGGQHHHRG
                     QRKGLSVSGQPQSRWMRLRSFMFGREEFVDFDSAFASPTDPAKVTDSQRRTARMIERL
                     PLPSWVKHNLFDVVDFLTRRRVHLVLILAVFMFVIAPEGVMEDVAGSFTVDEDARPGL
                     TFFKKYNRGDTYLPRRHPVVIMPGFITGALEVWETSLPCARQKSFFSGFRQRMFGPQM
                     IYLILSDPQCWLDMFSMNKKTGMDRNDTKVRADSGFASVDYFVPGYWVWAKVLINLAD
                     IGYDPQSMAVVTYDWRLSPDKAHERDGFFYQVRNSLHFLCRRNRKRAVVISHSYGATV
                     ALAFFRWAEQREGGFMDRHVAYYVNVGGVAMGVGKAASALLLGDARDTLNIQWAARKM
                     LDTFISQEARYGLSRSWSCLVSMLPRGCEEAWPGLTVLPNGTALGTRGTAELIRGGCQ
                     RSGHEDCVRQIDSFLETIDELPSLPQAPHTTVVCLYGVGLPAEAGYYLMWNPDEANTE
                     TPYVGNSSVFNNNTSHGVRMSDGDDTVPLMSLAYMCRAVNGWGRNVGRVVTREFNHSV
                     SGASSLKLRGGKLSAKHVDILGNYEMLEIILKIASGIDEEGVEKPETDEFSYTNADTG
                     ETSTLQRRVHDRIYSDVDFIIRSNLRSCLRKKNKPIKPIEGYEDDDESVWSGTSKSSW
                     QRR"
     gene            complement(<431092..>431835)
                     /locus_tag="LMJF_09_1050"
                     /db_xref="GeneID:5649546"
     mRNA            complement(<431092..>431835)
                     /locus_tag="LMJF_09_1050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681227.1"
                     /db_xref="GeneID:5649546"
     CDS             complement(431092..431835)
                     /locus_tag="LMJF_09_1050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681279.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649546"
                     /db_xref="GOA:Q4QHR9"
                     /db_xref="InterPro:IPR000535"
                     /db_xref="InterPro:IPR008962"
                     /db_xref="UniProtKB/TrEMBL:Q4QHR9"
                     /translation="MDVRAPNIIVNPEKFELVLHANEDCTFELTNVGYEAIIYRVRTT
                     APLRYYLKHSKGVVKGNSSAKITIFLNQKTFAEGLPVGARYTKDTFRVECAVLEEQDV
                     IEAHGANLASLIQKKKDANASSVVQKYILCRVLLDAGDSKDGAAGKAAGKAAGGGGVA
                     AGGDAVFRGRDAAGEKSSSGRKSMTAEQMEQNTLNEKRRRNVSGGQLAVRGNRMQVLR
                     IVIAAVVVVVFAMWVMRGGDGDDVEEIAE"
     gene            complement(<433090..>433881)
                     /locus_tag="LMJF_09_1060"
                     /db_xref="GeneID:5649547"
     mRNA            complement(<433090..>433881)
                     /locus_tag="LMJF_09_1060"
                     /product="putative DNA-directed RNA polymerase III
                     subunit"
                     /transcript_id="XM_001681228.1"
                     /db_xref="GeneID:5649547"
     CDS             complement(433090..433881)
                     /locus_tag="LMJF_09_1060"
                     /codon_start=1
                     /product="putative DNA-directed RNA polymerase III
                     subunit"
                     /protein_id="XP_001681280.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649547"
                     /db_xref="GOA:Q4QHR8"
                     /db_xref="InterPro:IPR005576"
                     /db_xref="InterPro:IPR013238"
                     /db_xref="UniProtKB/TrEMBL:Q4QHR8"
                     /translation="MTTTCGPSSAATATAAVSSDGDNECYSLTLRDILLHRLTERYVG
                     RVIPSRGLCVAITEVMEYSASSVRGAAASAWLTVTFGVCVFAPNPGTRLKARIAYQTA
                     VGVYLTMDLFVAIPFLVPAEMLVPGSRFSAAQGFWYLPLDTEDQEGGEHSAELDAGPA
                     VAAMGQGNGKDGDGYGSDALASSALSSTTAAAAAPYNAYMVGAEVIVKVASCTVQSEE
                     TVSAAEDADGASGGDGGAIPIMELRGSFVGDALGPMSWFEKDDDA"
     gene            complement(<435603..>437042)
                     /locus_tag="LMJF_09_1070"
                     /db_xref="GeneID:5649548"
     mRNA            complement(<435603..>437042)
                     /locus_tag="LMJF_09_1070"
                     /product="putative eukaryotic translation initiation
                     factor 2 subunit"
                     /transcript_id="XM_001681229.1"
                     /db_xref="GeneID:5649548"
     CDS             complement(435603..437042)
                     /locus_tag="LMJF_09_1070"
                     /codon_start=1
                     /product="putative eukaryotic translation initiation
                     factor 2 subunit"
                     /protein_id="XP_001681281.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649548"
                     /db_xref="GOA:Q4QHR7"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009001"
                     /db_xref="InterPro:IPR015256"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QHR7"
                     /translation="MAEEDIADFTLDDEKVIDTDQGLAKQDFSKIDLDELNVDTFEVM
                     SRQATINVGTIGHVAHGKSTVVKALSGVKTQKFHREAVMNITIHLGYANAKVYQCETC
                     PRPTCYQTYPSSQPDSTPCPNCGETMTLKRHFSFVDCPGHDVLMATMLNGAAIMDAAL
                     LLIAANESFPQPQTLEHLKAVEIMKLRHLVVLQNKIDLVGEVKAHDQYRHVRAYLDNI
                     ALNVPIVPISAQLKRNVDYLLEYLLHIPMPVRQLKAPVRMTVVRSFDINKPGEGDIES
                     LKGGVAGGTVTQGVIKVGQVVEIRPGLVRSRSSNEQGSRFTYSPLKTRTVTLKAENNV
                     LQYAIPGGLIAVGTTLDPTLTRQDKMVGNMLGEEGTLPEVYCEIEVQYYLFSEMVGAK
                     SKDGKSTAKRVQKLNVLESLQINVGTLTAGATVLNITQDPEIAKLELVTPVCCSTGEQ
                     VAISRMVDKTFRLIGWGTIRRGVPMKQSS"
     gene            complement(<438046..>439851)
                     /locus_tag="LMJF_09_1090"
                     /db_xref="GeneID:5649549"
     mRNA            complement(<438046..>439851)
                     /locus_tag="LMJF_09_1090"
                     /product="putative translation initiation factor EIF-2B
                     gamma subunit"
                     /transcript_id="XM_001681230.1"
                     /db_xref="GeneID:5649549"
     CDS             complement(438046..439851)
                     /locus_tag="LMJF_09_1090"
                     /codon_start=1
                     /product="putative translation initiation factor EIF-2B
                     gamma subunit"
                     /protein_id="XP_001681282.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649549"
                     /db_xref="GOA:Q4QHR6"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009001"
                     /db_xref="InterPro:IPR015256"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QHR6"
                     /translation="MAEEDIADFTLDDEKVIDTDQGLAKQDFSKIDLDELNVDTFEVM
                     SRQATINVGTIGHVAHGKSTVVKALSGVKTQKFHREAVMNITIHLGYANAKVYQCETC
                     PRPTCYQTYPSSQPDSTPCPNCGETMTLKRHFSFVDCPGHDVLMATMLNGAAIMDAAL
                     LLIAANESFPQPQTLEHLAAAEMIGVLSLIVLQNKVDLVSKERAAAQYSIIHHYLATK
                     TAYAKAPVIPICAQQHANISFLLDYLVHIPLPRRQLHHAQYMNVLRSFDVSLPGPAGD
                     GAKALKGGVIGGTVAAGVLCVGDEIEIIPGLLVLRRRDGVLPRRADVLSGRELAYVAS
                     PPPGELYAVPLRTTVVRLQAEKNELQFAVPGGLIAIGTTLDPSLTRQNKLRGHVVRVV
                     SRGPVWRSRRMGCRPRRCDSPPAVAEAASASTTPVTTTTSDATWTPSGAVLPCPSPAP
                     AAAAVECHTGMQVYQEVVIQFFLLREIIGLAAPRPGRTTSHRDKDRGFNGGANSYRVH
                     PDRVVSSLHRRVAPLREEESIILSVGTLTTAATVLRTSQHAGRAICRLESPLSADPPH
                     QRIVLARYVDRKVRVIGWGTILKGVPVKFLPEDRQ"
     gene            complement(<441162..>441929)
                     /locus_tag="LMJF_09_1100"
                     /db_xref="GeneID:5649550"
     mRNA            complement(<441162..>441929)
                     /locus_tag="LMJF_09_1100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681231.1"
                     /db_xref="GeneID:5649550"
     CDS             complement(441162..441929)
                     /locus_tag="LMJF_09_1100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681283.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649550"
                     /db_xref="UniProtKB/TrEMBL:Q4QHR5"
                     /translation="MATMPTNTAMATAPGKGGRAAVHTRSPSGSPLPNIELDEATIAL
                     IKENEQMLQTITTLQHELDKQQVRLSNAEAARASLADEVSELRSQLGLATSEATTSTG
                     KVLNYKTAFTDLQHAFDQLKRDSDATKEKLEEATKRERVLMQSASNTARQQTQMKESL
                     DLVTLALRMPNSFLVSIQRIMEKLNDPALRPADRKRKLKDDIDRLQAQVAAYEPERSS
                     SVVVSADGTPSVDIPIRQCVYTFLSVIMTLLKNEVDK"
     gene            complement(<444972..>446348)
                     /locus_tag="LMJF_09_1110"
                     /db_xref="GeneID:5649551"
     mRNA            complement(<444972..>446348)
                     /locus_tag="LMJF_09_1110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681232.1"
                     /db_xref="GeneID:5649551"
     CDS             complement(444972..446348)
                     /locus_tag="LMJF_09_1110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681284.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649551"
                     /db_xref="UniProtKB/TrEMBL:Q4QHR4"
                     /translation="MFLFRHSAEPMEAEEERHERVDSTTEPHNAATAAARKRRTSADV
                     ANGEVSREASGVAESFDETGGAPHTPREGTAPPPDVHDMLEHQRPRDEDDAEADMAAA
                     ALAASAPAPFHGVPTLPMPRTCDENPQAEADGNSTQRHRSYSHTSRFAAPSPRSTSGI
                     SRGRSYSLSGLSAAELADVHEQQYRRCTSIVKSARCISARRASSVNGVVGVIDDLYTL
                     ASRRSSAMTEAERVAVERMIENEYRRQEAAERSAQFALARESIIVNEELAREKATYVR
                     RMHLNEELHARLAKSSRTRQERMTAAAQRRQEIEQERLRVLYGSMMEKDTRYHFRNPY
                     EMMAAQRRYSIEMRSPAAIAPQRRASSPSTRASGNAQMSPRSAEGVANCTTEDRCTSS
                     PATRRRSSTPSIAKSKPRQCLPLDAWKKPVPPRKDSCRSDISAEHRCRSPTDWRATAV
                     LEHPRQWH"
     gene            complement(<447387..>448115)
                     /locus_tag="LMJF_09_1120"
                     /db_xref="GeneID:5649552"
     mRNA            complement(<447387..>448115)
                     /locus_tag="LMJF_09_1120"
                     /product="mitochondrial RNA binding protein 2"
                     /transcript_id="XM_001681233.1"
                     /db_xref="GeneID:5649552"
     CDS             complement(447387..448115)
                     /locus_tag="LMJF_09_1120"
                     /codon_start=1
                     /product="mitochondrial RNA binding protein 2"
                     /protein_id="XP_001681285.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649552"
                     /db_xref="GOA:Q4QHR3"
                     /db_xref="InterPro:IPR009044"
                     /db_xref="InterPro:IPR018539"
                     /db_xref="UniProtKB/TrEMBL:Q4QHR3"
                     /translation="MLRRVPTLCALRQRAGVTAMAVVGGLSASTGSFACQASPLQQVR
                     WASSDAVAPTSNNAQRNNSRNSSMQSQRGRRDAMPPAFDIVHWNDEDIAAGHLLRVVH
                     RDGFIVLDYHRQRCATAELREDGSRAANPNRAERVVTVTLPPVYVARFLGVLEGRMSK
                     LEVQSRFTNASFSPNAAKGKHHYTLRCTSMKPTTGQIQTVDGADVHEETVEWTVEFDA
                     AESLMLHRFLTQALHYNTGFSRKV"
     gene            complement(<449115..>449573)
                     /locus_tag="LMJF_09_1130"
                     /db_xref="GeneID:5649553"
     mRNA            complement(<449115..>449573)
                     /locus_tag="LMJF_09_1130"
                     /product="putative inner membrane preprotein translocase
                     Tim17"
                     /transcript_id="XM_001681234.1"
                     /db_xref="GeneID:5649553"
     CDS             complement(449115..449573)
                     /locus_tag="LMJF_09_1130"
                     /codon_start=1
                     /product="putative inner membrane preprotein translocase
                     Tim17"
                     /protein_id="XP_001681286.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649553"
                     /db_xref="GOA:Q4QHR2"
                     /db_xref="InterPro:IPR003397"
                     /db_xref="UniProtKB/TrEMBL:Q4QHR2"
                     /translation="MTSILDPRQPIEPLQRAMMVAKDSTLATAMLNVFGGYVMGFGFS
                     LFGSMISAETSTQAMGTADFFRHSLRSAHRLGGSFAFFGFVFGGIEVALEKRRGRKDQ
                     WNPTIAGAIIGGGYGWRSYKHPGLAAGIVGGAAFSLVFEKMLDAMGMAQH"
     gene            complement(<450652..>451356)
                     /locus_tag="LMJF_09_1140"
                     /db_xref="GeneID:5649554"
     mRNA            complement(<450652..>451356)
                     /locus_tag="LMJF_09_1140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681235.1"
                     /db_xref="GeneID:5649554"
     CDS             complement(450652..451356)
                     /locus_tag="LMJF_09_1140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681287.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649554"
                     /db_xref="InterPro:IPR008979"
                     /db_xref="UniProtKB/TrEMBL:Q4QHR1"
                     /translation="MLTTCSGSPIHASPSSSPSPSPSSLARNAGNPHTVTTQCTQARR
                     DLPEVQHTQAERKAKMAATNSRVYFDVHFISFHDDNLPGSAITDPKAPTSFVLTTGGF
                     PQEVIVQTRAASAKISKLSVALNDAKEILVEKCCGETPTAFEVMAERTLARGSVGGSN
                     SSPSAAAAADGGVGGPQTERFDLDPEGAGRDIRFIRLTILSGYSEFVAVYSIDAWGEE
                     SQQRVAILQTKPEVVM"
     gene            complement(<451879..>452742)
                     /locus_tag="LMJF_09_1150"
                     /db_xref="GeneID:5649555"
     mRNA            complement(<451879..>452742)
                     /locus_tag="LMJF_09_1150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681236.1"
                     /db_xref="GeneID:5649555"
     CDS             complement(451879..452742)
                     /locus_tag="LMJF_09_1150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681288.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649555"
                     /db_xref="UniProtKB/TrEMBL:Q4QHR0"
                     /translation="MPPLHSRATRQLVKERSKIEGPRSLHRGIHYQENEAHASSYMQN
                     AKKKRADHRDLLVHHQRINEDLQDIYTRTAALHSDNMTMEERIEESWKKYERIGGKRP
                     ANVRTHGQDAVLCANQTAVPYAERLAQVSQQKKELRERGAWERLTHGEAVDYSKGSAL
                     HAAKDKRVQMFQRRQLRRAHLLRRVGDPTPLKQSGTYDMNSGTLRVFNKTIRNVQREV
                     AHDARIAEVRKRRKNSRSQWDLNESGNVNRPDQEILRYSRDWELGPQRKARGGGGGGG
                     RGGRKRGRDEL"
     gene            complement(<453715..>455937)
                     /locus_tag="LMJF_09_1160"
                     /db_xref="GeneID:5649556"
     mRNA            complement(<453715..>455937)
                     /locus_tag="LMJF_09_1160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681237.1"
                     /db_xref="GeneID:5649556"
     CDS             complement(453715..455937)
                     /locus_tag="LMJF_09_1160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681289.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649556"
                     /db_xref="UniProtKB/TrEMBL:Q4QHQ9"
                     /translation="MQHTSSSASSAETLAAVSVRHRATQRAEPTSAPAKVVAGGGGQT
                     RRVQQGSGRKLVASKELFFAGFPCIEPYRRQAPGATKPSTTPALAATYSKQFVRGFFQ
                     QYGAVEALFYDEKRGMGSVVFADGADAESCYLAVHLSFIAAPDENGGMGQPTWERDRQ
                     TEALDERKARALDLLLCLEFAQCCPFVHPCLLTRDAFLVGGEKEWEVPGGELSRALLL
                     HKFPVLLLSSDSRPSATEPMVPVAPHVVVRWEAETVEAPAPRVEVVEDGDRSPAAAAH
                     SPETVPSPQSRRVKRVGPTFPGRGIEPAVIEEALWQILQPAHVAPQDGNVVTVMDMWW
                     EYYNLYALRKTQPSADRIADDAFLYAAQPSLAQEVREVQRQSREYAHGDEAAAQQVMM
                     RLVHDNVYHSALSYLCVKQKLKCDPMWASLMRDLYNDKVVLHVQAWRALAETAEAAKQ
                     GSAVEGGVHNAKLATTSLSSSTATGPLTTRRGRAVKAALKVLYEPQPTKQEDIEALRA
                     TEQLWRTMPRTEAAANLIENVKLLEKIKRGLVDRNGHDKVDTRPPLPALSPDGGGGQP
                     PDMNMEAAYPTMSAAQRDEQLYLAVMQNVDGYVETGTADELVSLCEHPKLFRYVKGHI
                     GYEEAHRLPSYWRAYLNALWVPLIAFLLLGFGTYYMVDWLGINEAHEKAVAERQRREF
                     HAHLLHLLNQQQAFLDQNVTDGAHLKATLQALNETMRRTSEAAARAGKKFHIELKQDL
                     "
     gene            complement(<457031..>457621)
                     /locus_tag="LMJF_09_1170"
                     /db_xref="GeneID:5649557"
     mRNA            complement(<457031..>457621)
                     /locus_tag="LMJF_09_1170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681238.1"
                     /db_xref="GeneID:5649557"
     CDS             complement(457031..457621)
                     /locus_tag="LMJF_09_1170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681290.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649557"
                     /db_xref="GOA:Q4QHQ8"
                     /db_xref="InterPro:IPR011333"
                     /db_xref="InterPro:IPR016072"
                     /db_xref="UniProtKB/TrEMBL:Q4QHQ8"
                     /translation="MSNEEVFRISNVSGYSVEIPLATAKELLGMLNMDQVFRAARAGT
                     DDTDESGVDDGDTEPVKAEGMDYGKEVLDVVRAYALLPPDKRTSSIPRPLTQDLRSVV
                     YAGEMELVEKAEREDYLVDLLNCALFLRFSQLSALCAAYMAVRIDEIAKAAPDIMEGA
                     ERIRKFLHMQNEWTEEEMGHLRREMEYAKSVDPNVY"
     gene            complement(<458894..>461908)
                     /locus_tag="LMJF_09_1180"
                     /db_xref="GeneID:5649558"
     mRNA            complement(<458894..>461908)
                     /locus_tag="LMJF_09_1180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681239.1"
                     /db_xref="GeneID:5649558"
     CDS             complement(458894..461908)
                     /locus_tag="LMJF_09_1180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681291.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649558"
                     /db_xref="UniProtKB/TrEMBL:Q4QHQ7"
                     /translation="MQRTKPAVTVPTTSPKAAQAPKEPTITIISSDGEAFSLIPSTIA
                     HSHLLEGAVRRWAEIYQAKVKERWGAPCTPTEANDDEDDATADDLEETPDENYIAHFY
                     EETASDVTTTSGALEDVGSGGGAGAAARPSGRGAATAAATDDDDDAESKRRQRRPHAA
                     RTKSARARNEEDAHHPKKVALPFEFADTDEGTSVARRASGDGESNLRGADNGDTDSDR
                     TASVLPSSVESSMSSTSSPLKSQSNGGTPTRASDAAGVLTELAGVPRFTHTPRLDTHA
                     QPSPMSTASLQHSAAAVGVEESRSGNVCNTPTGAAAHALTTTAATIKSRNARSPAATG
                     TSSSSRSSRVSPSTLMDADQSTPSVLSGEEGEEREEERGRDEGAGGANGGKRPSRDSR
                     NLGDEGLDSVEVSSSSSESMSPFGCPANTTTTVPNGRGARRHRDPVVSASSSFTSSTT
                     SSSSHLTSSGGGRSKGHRHSSTVVKVGAAEADDDFDEEDKGDAARTDVGVALDTAAAA
                     AMTSTGSARSGSGRPSTSPPPPDWCSPSSCHQRTPCMTDEDDVGAMMAEDRLGAPAGI
                     SPALTSSRTESIGCFSLSTQPPLAPGAGGTVTASVPSPMDHISLTAATHAATSASAAA
                     ETALATKRNSGGAGVKPLTSSLAYADGIRITSSAIVFDLVRSASPCASPSSGKAAAAV
                     PVVESAASAAGAPPTAAAPTVNIHSSTLLVCIKYMKHFAEAEAQAAADAAAAGKCRKH
                     LRHKYRHCKHRRGRHSSDSSGNDDDQDSSATGTSSASSLSITSGSSSDNSDEDDDDTE
                     VSTVSDSSFSPMSIGAPPGGPCVSGGAVRRGNPDGAPPGTAAGTPASPLGGPAAIPAP
                     LTTPLVSLLSPWEQNFLYVDLLGAPETVLAASLAILDVCPDFDYSSPSVHLGDAKARA
                     ALMAPPPPPEGVHTLIEVMAAAKQLQIEPLHALCAGWLADFMIRASYGATDNFEAAHL
                     IRQCLRVTSDWSRRETDCLKIENEWPANEESE"
     gene            complement(<464997..>466769)
                     /locus_tag="LMJF_09_1190"
                     /db_xref="GeneID:5649559"
     mRNA            complement(<464997..>466769)
                     /locus_tag="LMJF_09_1190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681240.1"
                     /db_xref="GeneID:5649559"
     CDS             complement(464997..466769)
                     /locus_tag="LMJF_09_1190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681292.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649559"
                     /db_xref="UniProtKB/TrEMBL:Q4QHQ6"
                     /translation="MRSREASRAAAEPAPTPSSEPLWQRPADAVAVPASVQRFYTHFM
                     TLLTQQGRCGPATIAAAVSAPLQHHSTSTADGQDGTEDDALRRLTCAQEDALGPLLWQ
                     WLVLFSLAVQPAGEAPQERGPVPSATAVASAVCSAAPSHTLGPHDVERLFRSGFSSLL
                     PVAGSGGGAGGLRGSRLPPADPPAPWHSVPLAEHNGPERALVAALSTLSCNGPLFSAW
                     CALCYTCVGASLLVSTSQRRREGENAAADLSTNDFSASEEAIRSALQRLRHAWNSAVE
                     LADAATGGLSRPGKLAARRGVDACATLRLWATVYTTCTAFGSVAEAAPITHEKGGENR
                     ELQAPPLSLSLWAVQWYCECTRVAAHGADEGFHSEEAGVPVELVTRVMCYMCHRLEAE
                     VVRRARRRECTGSAASLLIAPPSESSAPAPTVPPLRVGTLTALALQSAMHLVGDDADR
                     RGGAAKRSGGRRGRAPLRRRRHAWQRSSDDDDDSDADSSLEDPDYGGGTEGRWCGRTD
                     AQSGASRFIFGQQERYEVAIASGVFTTYSVCPADDDVAQPADRHYMHRLTGEQYLRNG
                     TVHWWTLRDSQRHRQLMAEARNTS"
     gene            complement(<467346..>471743)
                     /locus_tag="LMJF_09_1200"
                     /db_xref="GeneID:5649560"
     mRNA            complement(<467346..>471743)
                     /locus_tag="LMJF_09_1200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681241.1"
                     /db_xref="GeneID:5649560"
     CDS             complement(467346..471743)
                     /locus_tag="LMJF_09_1200"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681293.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649560"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q4QHQ5"
                     /translation="MRCAEQQPAPHGTESPSASPKVTEDSAEASSNTDALRRGRQQRT
                     SSPCPTPTSKAQMTRMAVRQRFQQLLKRSNASVQALYRATRKTDVILSSTTSKATRTA
                     PAAPTSFACVADIDAADVFWALVLYMSAALCWRQRRFLAAPRRADACVEDVVSSSRDT
                     SERHSLQPHISSQPSRQESAHSSLSSTADYFTGHTPRDTAARHGAGGGAEADFSAALR
                     SHYALGKAAADNTPLSRCRRVLERLLPLLESRLSEAQLWRQPSLLAALDVLARGFAMA
                     EDLVHALSSPSDMGTAARCPLCYAAALDNELAVEAFLHLRCYAAAYQGAEDVAEDAGA
                     QHGRQRRETRNGFDRAELIPGDVGWVAACRIALWNNCRASLMRLCCPPLFCTAMWWPH
                     HQEACERAGCRRYAVLEALWISWWRAEAWLASGPSSPEITSTRVVISRDAAARWRSAL
                     LFMQVVLPAAEAAAREPGAEDSGVEDGAAEKHPNSQRANHRALLAHLVQLPIVTERIH
                     TAGTRNCGASGTVFHWLSQQGDVPLLTLLCRTLDGCTAAITAGKAPVGRPVAAAEAAA
                     GHAGRAYIIHLGAAHARGEGVGDDRRHRATLPAPEAAESGAVASIGGPVSQPAPTYPG
                     RGLCSSVSSVWGLHLMDTLGQNALDVACRHQHLPCVRLLLQAGLSPNSLTTLVSDKCV
                     DSLPLPLLRLLYDPSLLEGADGSRGAPHMGLAERLRQPTCPAAAASRTLAQLAFRLWT
                     EKVQQLSMVPQAADGEAFALDQWLSAYTRCQAAQDRVLRPAMAALEFDAYEPVARLVV
                     LSVLTRKLNDWLATAPSSVRFGASDLPVGTSGSVRGDAASSRSSPTVSQLQPAPPSLR
                     QLRLQHTVALRLYTQLTCPLGRALLRRAVDARCAVCDALAAREDRAASVLLAASAVMS
                     APSTAEAVSVGDEVAKRDVAVVTPEASVPVPPGASSLALSEPVKSRQELQGLYERELA
                     DAHKLDARLVAEHQQRMCAMEARGGSEGDYRHRGTHPRHLRASLVAAHGVATVLRGRH
                     HEHHTCARRHSHRSGSGHDGEACALYALAVIPSAEALQSARWETSANRCTVEQPRPQR
                     TTAGVRHVVEPTLWTFTSAPQQVWLRLPDGVDLDRLLRENDGGGFGVIADDMPLTAPV
                     QRGDLVTFRCSSGRDGAGGSGGISARVAQQQQQQQGARAEERRHSPQFVVQQIFSERR
                     TLPYLVWKSATAEDKDLQHQPPPASLVLPYAVAAGTPAWTLPHRAAPRSTSGATDPRQ
                     DSITLHACCLAVSYVARMTSAQLHDRHPLDWLLQTRRAANFSPSASESGSTDVLTTLQ
                     WSAEWTARWAQTVWAGHQPCWLEERMRTTNDSSGASQGHGDSSRECGTHSSSRSPGCC
                     TANGGRDVVHFTDPFCTFDDADAADGRDSFAVDGGRRSLHVLRTLMSGGTAPHEAQKL
                     SAEVDWPSRAEGCSAVVTADVVLGSATVV"
     gene            complement(<473005..>474279)
                     /locus_tag="LMJF_09_1210"
                     /db_xref="GeneID:5649561"
     mRNA            complement(<473005..>474279)
                     /locus_tag="LMJF_09_1210"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681242.1"
                     /db_xref="GeneID:5649561"
     CDS             complement(473005..474279)
                     /locus_tag="LMJF_09_1210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681294.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649561"
                     /db_xref="GOA:Q4QHQ4"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q4QHQ4"
                     /translation="MSSAPQHNGAASVIVAERVTHFLMTLLVILGCSGALQYADARLE
                     RQAYVAYRTPHLCSYQIMQSVACPDTKPMCCVASSAIRCCAGTTSCGNCTESIVGYEM
                     PKSSVIIGCFSLSVFVLLGSIIMSGVGRHLAWMLEHRRVIESYRKRLLLLRAEAREFK
                     KELAETEEKDIDDTVGCVICCARHIDVALTPCGHVCCCHFCAKRLRECPVCRSALQRC
                     FDLPLYYVKQLLSAAEAAEDDNGGGVSESALSPSEMSTITCDSATVTRARAAREEDPR
                     GADEAAFAPATAEDHAVESAMASLPSNCNCSSSISTRGGIVAGMHGSTEQSPRSTLRA
                     SGTSEMGMVNPFRSRYSRVPYSDEDNDGDGRDKRMGSSTASASPLVRRVPATGAVASP
                     PSEARAAAVEEADTATSGVNAHHSHVYISVER"
     gene            complement(<475547..>479413)
                     /locus_tag="LMJF_09_1220"
                     /db_xref="GeneID:5649562"
     mRNA            complement(<475547..>479413)
                     /locus_tag="LMJF_09_1220"
                     /product="putative AAA family ATPase"
                     /transcript_id="XM_001681243.1"
                     /db_xref="GeneID:5649562"
     CDS             complement(475547..479413)
                     /locus_tag="LMJF_09_1220"
                     /codon_start=1
                     /product="putative AAA family ATPase"
                     /protein_id="XP_001681295.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649562"
                     /db_xref="GOA:Q4QHQ3"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QHQ3"
                     /translation="MDLLRLYVEFFLLCVQPTVPCRTRAAAAVADVGCNGSYPAAAAA
                     KPAAVDVATQLTTLSFISVPHCVRSFLEGVALLRKDGEAAPAAAGKAGGRKRHRDSIE
                     RNGTKSVAADDLVVEGGEDSDLPYQPSVMLQRLRAYGEVQVPGFESDSAYLAAKDVLV
                     YLKHYAYLVSGMALSAAVLRNIELVGLDFRQQCVPCMAAVTELVGHLIDAQLHKMQRL
                     PRVVRLSERLRLSAKAAHTLEYLLVCHCGRYAAGNIAEPLRPANIAYHNDLTPQELLS
                     ILSESGVLWKQGLIFSDIKLRTTFMECKYALPIEAIAALSGDQLSEEQLIKLERTALL
                     EVLNEERNAKTTSTAAATPALRAEEHVGGSRSVSPSPKRGDEEGDLEDEEDDDATADS
                     AIALTEEALDSVLEDVDPAVLASKDQDAIYEAVSHRLRNALAGRTATQFGGRAVAAAP
                     VAKNSAATETEEAVKGGKSSREESAMVAPSTAPSTAPPSRTTDTAPRPEDGREATTAT
                     SAPLKARLVLADINPLAQRYRCTGASAGAAAAVSSPSATPHTDSSMRGVPYESDIEYM
                     DAAFRILANMIRIRYAEGDMKDEEDSYTPKSKVEASIRELKGKVRVAAAVHESRLQAT
                     LATRAFTPRIEQLAQRLQLTEMEKQIMLFMVGNVISHDMLVAVNGRYVMRDGQRLITV
                     GYMLFVLCESLEERVVARRAFYQSSPLVSNGVLSLTLDAVGRSCFNTDLMDYLVDIDR
                     KIVDDVMGIPAETAEMVPGSQLYFPEVELANVVLPTSTMDRVLSTIEHYSLFEQCKKS
                     SGFGDGLGTSKGGLVMLFHGPSGTGKTMLANAVAHHLKKKILLVSVSQFRTSTKAEAD
                     ALRFLFREAKLSDAIVFFDECEALFEDRTSNGTVTALLSEFERYDGLVILATNRAQNF
                     DEAMNRRISLMMEFRPPDHQLRLRIWRSHIPKQLPVNEDVCLEKLALNYELSGGLIRN
                     AVLAALSRAVAREKSSTPKLTMSDLDEGARLQLRGFFLAAELPEGMSEFYLTPKRTLA
                     ELVVEPDLAEKLEGIASSAKSRSTLYTEWGFSEDANDNCGALYLFQGVSGTGKSLAAE
                     AIAYECGATIRLCNVAELLLREEMRVHVVFEEGRRLGAIIVFDEAQVLFNESPKSLQL
                     SQLIQYHARRYPRPVIVIATTVNRDGGGGRHLFSTANINSRSSCMLFQAELTFALPRR
                     PLREQLWRKAFPERVPTSSDVNYGRLSATSISPKLIRMIAFNVCCTAALLPVSDRVVT
                     MAMIEAEMERTVTRERTAVSASAMFA"
     gene            complement(<480582..>481907)
                     /locus_tag="LMJF_09_1230"
                     /db_xref="GeneID:5649563"
     mRNA            complement(<480582..>481907)
                     /locus_tag="LMJF_09_1230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681244.1"
                     /db_xref="GeneID:5649563"
     CDS             complement(480582..481907)
                     /locus_tag="LMJF_09_1230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681296.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649563"
                     /db_xref="UniProtKB/TrEMBL:Q4QHQ2"
                     /translation="MSDAPHRQSSTPASSFLPPEPLCVADILSELLPFLLAAPQPRDG
                     CPPSSSAQEPAESPVLLIPPTVASEHRVQVSIRGRRYETALEVALTYSLFFFVFFHWP
                     FSEEDESSDAAGCASDVAHVKRAPRSVGDAVMAAASARDLPKEAHLLRHYTRVVEPVL
                     RVFLDHWAAPLDAAAAAQGEGESAARAETAEAGDAARLPLLPPLPHPVRIAYDASTRV
                     WKFEFAARLTAGAAAEARSGRQCDDSSAAVSLAAADGCAAVATDKLNNSPFLLLQSEY
                     MGLLLVFLRRCAKVRAERRAAGEGAAACALAPYPSLPIRWEEMNYDEQLSVVQLIRRF
                     GVVSLARTYTRPTAPETTSLYIGEEAAAATARVKVEGDACSLRARASESMGKQQQKIQ
                     QAASVAVDTAEVVKKERCINEDDFDGLVLSAKGCARCGMAEHSTEECHF"
     gene            complement(<482692..>489552)
                     /locus_tag="LMJF_09_1240"
                     /db_xref="GeneID:5649564"
     mRNA            complement(<482692..>489552)
                     /locus_tag="LMJF_09_1240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681245.1"
                     /db_xref="GeneID:5649564"
     CDS             complement(482692..489552)
                     /locus_tag="LMJF_09_1240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681297.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649564"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QHQ1"
                     /translation="MQFRRAYKVGTATDSTTTAKADAVDLTAPLPWTLPPAVLAESST
                     SGHVMQPIEGYRGTLVLLLFHPLRVVRIWARDVLLRVMTCTAPQHEAPVPSKSSSDGG
                     ERALATLLSFSLRLLCTLKHVSVLPAQVSFISLHAHPSWAVSAAPERHVDAVKYVMQD
                     RVHTVVDGIFHLLTVLTAWDTHFGKAVEALAMTSTATADRASATSMPILLGKCRATVL
                     LLGGSLVLYGLQGLHQGIHRALLEAWHDQQHRHPRSSSARVDLSRASQAAMTQLLGPL
                     NTLLSSNPRMPRANAVAATAIRKALAKVLVHCLLDNASGLASSKEEEAWRRARLEWLW
                     MFAAALEPPTPRTAAPLPADGPNASAPSPADHTGPAAPEHQGSGTTKATGQDNVGTGA
                     LVWVPGRCAGWLLQPLFKNAAQQFQWAKAMEAAKAKPSAGGAATASDGTDSAIAVLDK
                     AVYGVSMLLDSLATALPRLLRSTYLHDTLVAHESQLLTLAIGGIVHTRSAYALRLHRL
                     LFHADVHAFAAGAAAQERGDTAPAGTFGTPSVCLQRLWLTLPALIVQVCKSGTVSPAD
                     CGGHAGNAIRGSPLPLSDVVASLCGALTVLAGEDAMPCPQWLFMSPAKVLSRAPPPFQ
                     WVVQRCVRTLADTLQEQQELLKRVWLRLPSAPTEAAYASAAAAAASRALTRERPLLRL
                     LFALRVAATEDAEAGKLAERLTAVFCVGVTSSVSRTLSAEAAMWVWRRVVVTQPELRL
                     HPPPPSTASIAAAAAAAGDGACATWDMNDAVVTNTARAQGPRWLVLLCACCFDQMSEW
                     EVQCGWWMAALLADVVTLDVEQRRALAEEVILALPTAPMLALSEAATHAVGSTHPPVE
                     EAVEGQCGAIETKGEHQLRDKGAESAQHRHSVVQRLLIHVLRKAEQYPQASLASMLLR
                     ISEALPPAVAARDVRFQQQVQPLLVQLCARSPDVQKCLTRNGAMWLRRCTEQATQTMN
                     ECLAEQERRFRQFELEEATLRREEVEAAQAAVAAGRLRHANEAKRAAELGQQRAVKRS
                     TAASEVSQSGSDGGVVSVPMHKLTTTVSHHSDHGSSAVAATRRNLRQQQLFPDRPLAH
                     LAVKRERTPPVDGADMRSPKNAPPQPADNGSSAIIVLDVDSDEEDVMVAASIVPLHHR
                     SARPASPCAVTPPSPASAPAPLAKVPKTSPSTTASTTARAAPTRLQHKLQEINARNTH
                     RVHHAEQLRQLQERLRRVAISTNLLHLQPPLIHDIVGPASQCMAPEVPVLPEVFVSES
                     DGFRRVSPDGSAASTGGASLNTSATMPFGDAASEYAVRFAPHIALELRYDIIRNYEDF
                     LDGVCKGHSGRDTNSSHHCRHSAATAPVTAGEGASPSPVNCQLNSLLPLHPGIPSACV
                     AVQSSCAASHGHNGEAMPGPQNLHFDVRACANPAVDMYLQRQQQQAQGTHLSAQRSST
                     TPTIMHPKSVHVVVVAAAQQGLSAALSEGDVVAVLLPLQTILAKWAERELRRPLSDCP
                     VAELEHRVLAMLDTLPRSWRTLGCAVQVCEVQSLSPGGRTAHLCATPSVVEQSSGGHG
                     PPSLRFSHVFRMAYDTTSSPTFYVTKLTSVNASLMELEALHKIDRTRFAATLYDPRST
                     APVGVAFCGWANSLLSTAGPSRAVPLLDHLRARLLLQQQLNDWQARAIVAVLYAACPG
                     WDDGVAEQSTRAPVPRAPEMLVIEGPPGTGKTQTIGSLTLNLLHHLSRTWGTAQRILV
                     CAPSNCGVDEALLRVVRLREQLRGAAPGGALPPAHAVLAGGLLRIGVRDRVDREVLRL
                     QEPVFFDDVVERHLSGTPATGESLRRGERAGDSRDSAIPRGRNASGNGAASGRAALRS
                     AVRTHTLESAAIVFSTLGSLHHIGRQVQGLAFDVVIVDEASQGTEPAVLQAVALAKSK
                     SVLVGDSRQLQPTVLSREASRCGLRRSLLVRLLACGHPSFLLRTQYRMHPDIAAFPNE
                     YFYGSKLLTDRSVLARSRAPDNPTAAPATIAQTLGRCPRFVFVDVRNSPMERRRGRSL
                     LNRREATAVVDCMRQLRAFFKMTVREMAAHVGILTFYTAQRETILSILTQEERHNGVQ
                     VATVDSFQGKEKQIILLSCVRTLSAAQLQQLQGRAAQGEKESNSDDSDSVAREERCAN
                     RRLGRYGLGFLADWHRLNVALTRAQDLCVCFASRDTVRAVGMAAMASAAPANAVTTVD
                     SSAGEVVHQLDADDEDPLALYRMLVHAETRDPTLQPPASEPVLLDASTDSVEIVDAPG
                     ASRSRAACLTYHCKAHFVRELTARVRAAQARDDLRNAP"
     gene            complement(<492233..>492787)
                     /locus_tag="LMJF_09_1250"
                     /db_xref="GeneID:5649565"
     mRNA            complement(<492233..>492787)
                     /locus_tag="LMJF_09_1250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681246.1"
                     /db_xref="GeneID:5649565"
     CDS             complement(492233..492787)
                     /locus_tag="LMJF_09_1250"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681298.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649565"
                     /db_xref="InterPro:IPR024950"
                     /db_xref="UniProtKB/TrEMBL:Q4QHQ0"
                     /translation="MEPESGARAVESAAAGNVDDVPMLPDASKTGPDVRAHYYACRHC
                     RARLFDAVEVLPHDPQEGANKTFKFRRGGPLQSDGALGNVSSGPLSAAEVCTSLFLDP
                     DQTPWVAEDMREANSSGAVVQPDTIYCRNPRCRAKLGMQSWTGSQCSCGAWITPAFRI
                     HARAVDKMLDTTPTSATHAASSLH"
     gene            complement(<493665..>495614)
                     /locus_tag="LMJF_09_1260"
                     /db_xref="GeneID:5649566"
     mRNA            complement(<493665..>495614)
                     /locus_tag="LMJF_09_1260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681247.1"
                     /db_xref="GeneID:5649566"
     CDS             complement(493665..495614)
                     /locus_tag="LMJF_09_1260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681299.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649566"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="UniProtKB/TrEMBL:Q4QHP9"
                     /translation="MSATPKLYNEADVAALVRSLDRAEDHHIFAVDVLETYPYLAESY
                     TKVCPRRCDLATAAQKALEGAYSYDLRLEGLKADIALMASNCVAYNGPTSAYAETAAK
                     FERYALEQIDAFVLQHNGGCRVSRLRLPRASASQEHASADGTAPKKGSTGTSAAYKTA
                     AAALPSTREMVQLVDSLNRREDGGAFSVDVAEAYPDLRDSYRKICPRPMNLILMHQRA
                     KEGYYTSGSATVYGDTVAASLTRLREDIELLVRNCITFNVKVQSWVTLARSFQAFAHR
                     RVDDFVLRRATFLRGTAMGADVYESKGNASASAPSATASGTAGGDDADRSGQASPTAA
                     ADTVTATSGGIGGSAVAAGSRKRERADERVTASGGRLRAPVPVSRVQVVAEATPQVCP
                     TPLQPSLTIPPLLRRRLTLDHVRHTRLPLRRVGVSVSRDELYPPAVSPADVKASSDSS
                     AAAGGAEAATASTAMVNIDASCSASHVLKLLRESVVKFFAAQRSGTDFVDTFAYSARE
                     EQLYLSVLAVVAEKYQCTAAHLLLYETESAELQEWAALRALDSCRDAGRMAPASADAG
                     DTIAGDLHYLYFVRFLVQWPQLASLCCTTATPSSVPASAAAARGAAQGSLRISREQLK
                     VVAQVTHITQEFLQFVEAIEERQRQ"
     gene            complement(<497179..>498216)
                     /locus_tag="LMJF_09_1270"
                     /db_xref="GeneID:5649567"
     mRNA            complement(<497179..>498216)
                     /locus_tag="LMJF_09_1270"
                     /product="putative mitochondrial carrier protein"
                     /transcript_id="XM_001681248.1"
                     /db_xref="GeneID:5649567"
     CDS             complement(497179..498216)
                     /locus_tag="LMJF_09_1270"
                     /codon_start=1
                     /product="putative mitochondrial carrier protein"
                     /protein_id="XP_001681300.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649567"
                     /db_xref="GOA:Q4QHP8"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q4QHP8"
                     /translation="MVVADPSWPTPIVPQVDEGKWALLHPMKPSLVALVPGAAQGATT
                     VVLGHPLDTAKVRMQSGGPHTCRSTIGTMWSMARTEGPSSLYRGVAPPLLMEGAKRSL
                     QFALWDWMRAFARDASASGNGADGAARGGAGGAWEAARDCAHCGLVGIGSNSFVCGAV
                     AGGVGTLIGCPMHVIKIQTQFQTAMDTRNAWTCTRSIYDREGIFGFYRGFRYNVAKDV
                     CFASMYLGLYAVLREHAFFEPPSASTAAETTTTTTTTTRPSRKTSMCAFLSGAVASMA
                     TWGLLFPLDTIKTLVQAQQAHAILPVLRQPALLYRGLAASLIKAGPVSGVAMAVYEQT
                     RAFMNKRPTLR"
     gene            complement(<499788..>500891)
                     /locus_tag="LMJF_09_1280"
                     /db_xref="GeneID:5649568"
     mRNA            complement(<499788..>500891)
                     /locus_tag="LMJF_09_1280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681249.1"
                     /db_xref="GeneID:5649568"
     CDS             complement(499788..500891)
                     /locus_tag="LMJF_09_1280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681301.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649568"
                     /db_xref="UniProtKB/TrEMBL:Q4QHP7"
                     /translation="MTTATSVSVRPTTASGVLCNSFPIAAATSVASTKTHTHPLPEVS
                     RGKRSAESLSWVTELYGLEASPPAVFASVAADGTRKSIKKALPLATTANPLSFASSGQ
                     LGTLPSLAALHNQNQRVPHMRSLTPAELSGAVGGGASFSAQVLSDVSAASFSATLTAA
                     ATNVTSFYRQRKNVSWRCMLCGYHVLAMDQDGAPLPFSASAFGNVLPMTCPRCKMSHT
                     SWQPSTPFSEEGNHMNLPTTLSNRYLVSLPGQQPLRAKDAEATGAAGQPGAAVETASS
                     VVAGSRSAQRVGFVSALATQQRSVPVISAVSSVQRRAYYCGRCGRRLLRVDVNGEIVD
                     MDRDKDGQVLPITCPGCMESHSDWVLKPYAVNR"
     gene            complement(<501917..>503680)
                     /locus_tag="LMJF_09_1290"
                     /db_xref="GeneID:5649569"
     mRNA            complement(<501917..>503680)
                     /locus_tag="LMJF_09_1290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681250.1"
                     /db_xref="GeneID:5649569"
     CDS             complement(501917..503680)
                     /locus_tag="LMJF_09_1290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681302.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649569"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="UniProtKB/TrEMBL:Q4QHP6"
                     /translation="MPKLSSSKAKAAAAAASGPPALYGEDLSGPPLVVEVNAPSAWTA
                     TTGADASSNEECLTGGARWGHAAMLSPSESVLCIVGGTPCQRPHAAEQAPVPVWEYTA
                     VTPSRVPTAMSASAIKVPVAAAAAPAAAAAAACAWRAGAARRAVQQDAIHGAHAGAAE
                     DHDWPLFACWWASWPSGNGADGPSVMYADGGWSGARRIAGVRAFATGANGDPSFTSPP
                     SSAAGISSTRSHHSVTCVLGRLLRFGGETQQGTAAALEEIDGASGSLDEKQQVDGEHR
                     NAEGREAAVPEPTSTTPRLPPALGPPPPRAAHGACSLSQRYMVVVGGRQVHTQADDTG
                     AVASGASAGKGARAKKITAMRALSPGKRGGASGKDGKGSPDALEASALASATLTTLKD
                     VAVYDAKLGAWLPVRVVGGGAVPCARYAAAVAAVPMPGAAPPTSRHRSLVADAVQREV
                     LVVGGLDADGAICADAWLLQVMSGADAELAEVPAGTPADSASTAVPVVKIRWVRLELP
                     KAAASVFQRHHAAVAVSSQRMVYLVGGCGPHGAAEPCVCTLQLPPLTSASVRLADEAG
                     GDAEGAAMPKRSSASAKGLTA"
     gene            complement(<504512..>505168)
                     /locus_tag="LMJF_09_1300"
                     /db_xref="GeneID:5649570"
     mRNA            complement(<504512..>505168)
                     /locus_tag="LMJF_09_1300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681251.1"
                     /db_xref="GeneID:5649570"
     CDS             complement(504512..505168)
                     /locus_tag="LMJF_09_1300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681303.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649570"
                     /db_xref="InterPro:IPR008580"
                     /db_xref="UniProtKB/TrEMBL:Q4QHP5"
                     /translation="MHATKSGVTTLSASAGNSDVPVMSAAYEDAARQPNAVFVNVYDI
                     MKSNSWLWSVGLGVHHAGIQVYDKEYQYGRCEEGSGVRAVEPRHSPPHIFREQFFVGQ
                     TQLSALEVRKLVARLEQCDTWQGSKYHLVKHNCIHFAQAFCEALLPPHVRVAQMRTAL
                     PSTYQSAYMEEVEVDGQQYSLPVLIPPHVSRLSNYATSYLPESALQMLDSMDNPFSTP
                     "
     gene            complement(<507076..>507840)
                     /locus_tag="LMJF_09_1310"
                     /db_xref="GeneID:5649571"
     mRNA            complement(<507076..>507840)
                     /locus_tag="LMJF_09_1310"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681252.1"
                     /db_xref="GeneID:5649571"
     CDS             complement(507076..507840)
                     /locus_tag="LMJF_09_1310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681304.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649571"
                     /db_xref="InterPro:IPR008580"
                     /db_xref="UniProtKB/TrEMBL:Q4QHP4"
                     /translation="MDSASGDGGDGAPASAERHSLKPLRWIEEVRDASQPNAVFLNVY
                     DVRGSSTLLYSVGWGVHHVGVQVYGKEYQYGHRPIGKGIGSVKPHQSPPHTYREQFFL
                     GQTQLSASEVEKLVVAFSDKVEWLGSNYHLVKHNCIDFARAFCEALLPPAVRVEQARR
                     AEEAGLSQKMHMVEVEVDGMRHSVPVLIPHHVDRLARYAAHYLPKSSMQRFDRLESSF
                     FSMSEVPQERGQPTAADPDTNRSTTPTPQPHTRTSH"
     STS             508695..508935
                     /standard_name="fb82h10.x1"
                     /db_xref="UniSTS:191700"
     gene            complement(<509179..>510231)
                     /locus_tag="LMJF_09_1315"
                     /db_xref="GeneID:12982587"
     mRNA            complement(<509179..>510231)
                     /locus_tag="LMJF_09_1315"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721734.1"
                     /db_xref="GeneID:12982587"
     CDS             complement(509179..510231)
                     /locus_tag="LMJF_09_1315"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721782.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1315"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1315"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982587"
                     /db_xref="UniProtKB/TrEMBL:E9ACQ8"
                     /translation="MLSTSPPQFDAAAAASDVVILPSSLDEDSPMSTQGLTPERVAQW
                     TLKDVENHIFFMVWVCGIPVHVRYIVHVLEHSAVIARRGGEQILHGGSTRESLTAVAQ
                     ADVLAPVCSRAAVLCQVVSRWPIMATLPGLQNHESFSELVPLGVLSEEPEHEGNAIRP
                     AEGGERWVHCGSVKVTASSSTSSLSCSTIRAGAVTPAEGFVNVAALALRSPAERGGTS
                     MSSEPSATWCAQAYWTAVAQAQQWIAGWPTFCSNAVRNTSSLGGIDAAAASAWPHLRP
                     ACTQTAPGRRRLRGGDAPITSGVVVVDADEGDARGSTRGAGPTSSAANDAVRNSKAQR
                     REAAEVVVIDSDDDDL"
     gene            complement(<512099..>513916)
                     /locus_tag="LMJF_09_1320"
                     /db_xref="GeneID:5649572"
     mRNA            complement(<512099..>513916)
                     /locus_tag="LMJF_09_1320"
                     /product="putative paraflagellar rod component"
                     /transcript_id="XM_001681253.1"
                     /db_xref="GeneID:5649572"
     CDS             complement(512099..513916)
                     /locus_tag="LMJF_09_1320"
                     /codon_start=1
                     /product="putative paraflagellar rod component"
                     /protein_id="XP_001681305.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649572"
                     /db_xref="GOA:Q4QHP3"
                     /db_xref="InterPro:IPR007824"
                     /db_xref="UniProtKB/TrEMBL:Q4QHP3"
                     /translation="MNGSAIIPPTYPSRDVQNVENHRAVAAVAELAENGLTIADNFVT
                     YAEGRLPPLAVNGEHILEAVAKLHERYRHERPAGWDEARFMGECEQRVTSEEIEDLCT
                     RPALDASAFANTLYQLTDKDLPRGRYLVLKDSLNAIKPHAPQSTVINLPETLAALHEI
                     QHVDPTEEIKDELSEMNTQQHKYATQVDEAQAVYDAALSHSDVVEVERAHRHLIAARY
                     EYLVSYVKRLHFLSSTEEDSEVVHFGERLQKLREDAEDAVKAFSDDKHAIKSALRADL
                     ERCEESRAREAAMHEAAKAAYQHQKQKMEASLSSVVEHKVQLVNEILEKVVELRKVME
                     QQRAMTQDVVKAVQEEAKRVTAHEEFVTIGDQHLQRLRRCLEYCHGCEPVIREMEKYV
                     KNMVEKLPQEDAEKALNSIIDHESDEFLKAYRAFVFVCGELTVKKTHRLDTLERQARL
                     AQHNRDSSMDSLDPNYKHYREELAEVLAQAQAVEGVINALHATQDAGEQVFESVEELV
                     LTSCERTEKPFVHPLQEFGYESVAARTRFVNRSMKYVEGEEQEVFQKKARIAEAKALV
                     EQEQEALERGVSAAAIAAPAAASLNAADGADPAPAQIEA"
     gene            complement(<515610..>517433)
                     /locus_tag="LMJF_09_1330"
                     /db_xref="GeneID:5649573"
     mRNA            complement(<515610..>517433)
                     /locus_tag="LMJF_09_1330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681254.1"
                     /db_xref="GeneID:5649573"
     CDS             complement(515610..517433)
                     /locus_tag="LMJF_09_1330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681306.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649573"
                     /db_xref="UniProtKB/TrEMBL:Q4QHP2"
                     /translation="MTRKVAAAAVLATAALLLLHTTFFASVAAVAVAPTHVSSPPMAA
                     QRQRLRSFAAYAERVGVALELFVGRHYESDTTGIDVSASHFTEDRQLHPSASSAPMPS
                     VDRMPLLAVVTQCLQHPHVVVQSSVQSVMRLASAGRTLASVLVGASFAKETDALLAKV
                     EADADLGAEVGSATAPPFMSPTNMHTTLAPIQQAARAVSTPRTDFAPLRQVFSSAIHQ
                     QAETLVTQPAEATPLSCISGVNAYSSNAIVACRNSNDTYTAAEYVSLSSHEKEQCNGY
                     ISEEEPFTQTCVCAQDYYMTRVNESSYLCRSRPLDVQVLLEDKHLCFSHADVALGLPG
                     TMEGEYCIKTNRNSTLQLPVTWKYNFLSDDAMLAASVFRHHVPPQVPQESEGLQWVVM
                     SGTRSVMGHYSELSMSTDVFSYLVAGYAGSGQLPPSTNDVGFYLSANTELLAAAAFSA
                     VFCFTSPRKTKDQLKEVPLKTESVLKQYLGNPNGVSSHSLTLDLSTVPNEFVEGNQMY
                     VEVGLKGGPSIYYYRVARIHVSFTDLTEPPTNAHEYKKPLDPLYTLLIAAASTLVIGT
                     GLAVLWYHCMQPDDYDDRLVSAAQRKKAQRHHPGVNSRSDN"
     gene            complement(<519149..>519484)
                     /locus_tag="LMJF_09_1340"
                     /db_xref="GeneID:5649574"
     mRNA            complement(<519149..>519484)
                     /locus_tag="LMJF_09_1340"
                     /product="histone H2B"
                     /transcript_id="XM_001681255.1"
                     /db_xref="GeneID:5649574"
     CDS             complement(519149..519484)
                     /locus_tag="LMJF_09_1340"
                     /codon_start=1
                     /product="histone H2B"
                     /protein_id="XP_001681307.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649574"
                     /db_xref="GOA:Q4QHP1"
                     /db_xref="InterPro:IPR000558"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:Q4QHP1"
                     /translation="MASSHSASRKASNPHKSHRKPKRSWNVYVGRSLKAINAQMSMSH
                     RTMKIVNSYVNDVMERICTEAASIVRANKKRTLGAREVQTAVRIVLPAELAKHAMAEG
                     TKAVSSASR"
     gene            complement(<520578..>521156)
                     /locus_tag="LMJF_09_1350"
                     /db_xref="GeneID:5649575"
     mRNA            complement(<520578..>521156)
                     /locus_tag="LMJF_09_1350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681256.1"
                     /db_xref="GeneID:5649575"
     CDS             complement(520578..521156)
                     /locus_tag="LMJF_09_1350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681308.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649575"
                     /db_xref="UniProtKB/TrEMBL:Q4QHP0"
                     /translation="MQAPKTSTSSEKGEVIPASRQSLSETPFVTDPAEVAAFDIPVEY
                     VRRIEDAQRVYGNHYMEHRMYTDAWNHAAMTLGFQCCWLGVGAWIVSRGLNYSDPMNS
                     VVARWVQHSRVRRLTTPISCFGLFIFTATCMQLPYDFRLLREASAGIDRQTALLKKSM
                     DERYLAYREGKIAKEQLEAKEAEAFAKSMKVQ"
     gene            complement(<522209..>522727)
                     /locus_tag="LMJF_09_1360"
                     /db_xref="GeneID:5649576"
     mRNA            complement(<522209..>522727)
                     /locus_tag="LMJF_09_1360"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681257.1"
                     /db_xref="GeneID:5649576"
     CDS             complement(522209..522727)
                     /locus_tag="LMJF_09_1360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681309.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649576"
                     /db_xref="UniProtKB/TrEMBL:Q4QHN9"
                     /translation="MPSWGAALAEPVSEPESGEGKRVRRKAGTASFSQQLKSLFRPPS
                     SHSLEWEPRAPLLAVEASPGCSPALLLQSLAEVNGPTMLTGAAMPAHASLEATATTVQ
                     EQLPPSASHVPLPGVFTASHSPVMEPWKKSAESCPLYAIGSDSEAILRLHATAEGTTA
                     SASSTTRRSQWH"
     gene            complement(<524730..>525536)
                     /locus_tag="LMJF_09_1370"
                     /db_xref="GeneID:5649577"
     mRNA            complement(<524730..>525536)
                     /locus_tag="LMJF_09_1370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681258.1"
                     /db_xref="GeneID:5649577"
     CDS             complement(524730..525536)
                     /locus_tag="LMJF_09_1370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681310.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649577"
                     /db_xref="UniProtKB/TrEMBL:Q4QHN8"
                     /translation="MMMPMTGPHNSPVCPSDAVGHTHEMDKPVIENCAQSNPLLAAPL
                     NHLQKAGKQSVVSCAPSGTSSAARVSDVAALLRHAVVRDLIRENEGMLMEIAGLQETK
                     RRWCATQLRLVTLEESAARAALKAAESIARGVWATRAHASLAAHVQRLEQQLSDEAEE
                     AAELRGFAELAQAQLATSPRSQTEGAAPEKEQYASPPAKARRGSGTGDVDGGSQRASL
                     EEITNVRGSVKRLRSVESSDSSGTPRGQARRTSSSQKSPGALTKVRKTMY"
     gene            complement(<527792..>529603)
                     /locus_tag="LMJF_09_1380"
                     /db_xref="GeneID:5649578"
     mRNA            complement(<527792..>529603)
                     /locus_tag="LMJF_09_1380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681259.1"
                     /db_xref="GeneID:5649578"
     CDS             complement(527792..529603)
                     /locus_tag="LMJF_09_1380"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681311.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649578"
                     /db_xref="UniProtKB/TrEMBL:Q4QHN7"
                     /translation="MLSLCKSLSSDAPTRTKTRVVLSMFNASHVDELLASTTRTLQRS
                     QVLLDERRSVIQSQQGLPPMFCVASSSAASTSVGSSAAAPYASASSSFADTVRSLQSL
                     SELRSYVEATAEMMKRVREEGMEPSPAMQQRRARGQDFALLQSMTRGLRGAMTAAWQM
                     SETTAALWAFSTEACGGAEEAAAAEDAASAAAGSTLCAVPGARSGGTRSSGAQLTSTL
                     IFSAFCVDLAIAAPRAASAVAAELESVFEPSSDNGRPSSLVSEWMRDGNVKLSALLRD
                     VAALLPPPVKTRLVARLADVLFRPSPALPRSPKESSGHPLGCELLSGGQLLLPSLDYY
                     LLEQYPSSLASRWFLQPLQATAEHLRADYYASADQFHVQCRWLLRLVLTLLYACQSAA
                     LPTSTASRPPLERRLRTAQRLYDAWLIPLEKTFGNGTARHGMSVSFNRALVQPHGHMV
                     ERLLFTSSPASGVSGVSKVVQQSREWSGILYSAQYRLLLILEKLAHSEVAQVNGTSST
                     SAKQRTYETMLRQNGGKVSVSLLQTLAEDKQLLLDETPSRSPDGHRLYKLHDGLLDDS
                     GKAVFVYLDDGALFTKVGRARAFQRVKSVEDIFKPLQ"
     gene            complement(<531113..>533104)
                     /locus_tag="LMJF_09_1390"
                     /db_xref="GeneID:5649579"
     mRNA            complement(<531113..>533104)
                     /locus_tag="LMJF_09_1390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681260.1"
                     /db_xref="GeneID:5649579"
     CDS             complement(531113..533104)
                     /locus_tag="LMJF_09_1390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681312.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649579"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="UniProtKB/TrEMBL:Q4QHN6"
                     /translation="MSFFKRTISLDSIGVVYDELHPRSRDGAAAHGAEREQSERRVFS
                     PVLTPSLNVARIDDVFSETSTTADTRTYSSSYPVTTSSVRMHHLREASGDFTFTGQPR
                     AVVHFRSCITANDARSRLHARAGRGGDGDGDGDDAVEAELPVQTGPFSADIVCIILLY
                     VDTSTHAGIVQLGSVCRFWHFYANLAPHWTYFRCREWRKQANLPHYVRRIVAKTKVVT
                     RDEYIRERVKVEDYKKKEYIIGTAKHIRWCIATGIMVGVMLTANFVIAYFLGFLRTAL
                     RSDLSLGITTFVLLIVATLLEITLVIFPLAGNFTSSTNKHSTMRILAWCVFMLVCSMV
                     LGTISALAFTRVQASRHVLDGPTIDLTMSAPCEAYSSKNLPSFVLVPAELSDLRWRPI
                     TLDESETQLIPYCVPKSNEGYDTAPTCFVLMYFDANYSSAVFQNESALVAGRDVGTRY
                     ATSFDPFSVGVQISGLWCNKSGHPQVVALTQAVYSSVKVRRDRLYPTTADWLDPSKRP
                     ATFSIISLRCSSAINRETTENPPKSTELWYGNAAAWKWYYVPLVTTHAEVRSTFQQMH
                     DHFIHYVSLCHILAAVVWVMMLLAQIIFKTAANMILGVATTAALVCLNPLTMILSGAL
                     CVKVSDSYFMCDAGSGGALIGGGIGLTFLVLTIYVTARE"
     gene            complement(<533891..>535507)
                     /locus_tag="LMJF_09_1400"
                     /db_xref="GeneID:5649580"
     mRNA            complement(<533891..>535507)
                     /locus_tag="LMJF_09_1400"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681261.1"
                     /db_xref="GeneID:5649580"
     CDS             complement(533891..535507)
                     /locus_tag="LMJF_09_1400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681313.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649580"
                     /db_xref="GOA:Q4QHN5"
                     /db_xref="InterPro:IPR001382"
                     /db_xref="UniProtKB/TrEMBL:Q4QHN5"
                     /translation="MMNFCTQMQRRRIRHHLRFIDRYIVFAVLGVAAYILVLSLIAQS
                     LAVGVRDRAKAKVSAAEVQHATSSIPEDVFWPHRWPAAPIAEVRIVKEAMEYVTASLT
                     KAMPFTKHLPEAQLAAWDLLLLTGVGTEWTPTAKELKAAAEAALNTAESAASSEALAA
                     VREALESAAVVWSLKGAAGEADEVREFLKDMSEPPAPAVTAAASSWSAFSREVWSRVT
                     AGGASSTTDSITAAHDTLRKASESFWHPSEQAAAVPPLHDSHLLPLRSGTYDAVVPFA
                     RLLLQLWVRGGRRDSDKQLVEAYDAAVMSIVQDLFYTRTVTAGAQSMNFTFVGSRAEA
                     LVPVATPRMCALAGVLAQGIRYGAHRYPARPSTARYTEDDVLQAAEALATSCFQLYAD
                     PAGRKLRSAVYVTGSGPVPGYTRAANGDGSASLRSSYCDVPGVLLESFYELYQTTHDA
                     MYGLWSVLVMRQDTSDHCGLRKTDITSATPWRRHIRELRTLWLLFHRMDCLVYRGSRG
                     SRGMCDLATATIVSPVTGHLVPVPNTPAAL"
     gene            complement(<537171..>538892)
                     /locus_tag="LMJF_09_1410"
                     /db_xref="GeneID:5649581"
     mRNA            complement(<537171..>538892)
                     /locus_tag="LMJF_09_1410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681262.1"
                     /db_xref="GeneID:5649581"
     CDS             complement(537171..538892)
                     /locus_tag="LMJF_09_1410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681314.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649581"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:Q4QHN4"
                     /translation="MPPPNTLQRGSEWVAQCMRDIKAAKLQQTVRPYSNGTPAGEALP
                     VRTIVATSRIHRGEHLGTVKRDSIMTGERASQLLRRACRGGPSQTDVTAATGLQPLAA
                     QRFDDLVSRISSLPSALSVPPHLLLSRDALLVTVALYLTRSPLNAGVLPAESPLRAWA
                     DALPRRPPPMGALLRRSFLSHDDVEPLPRRLRLGQRTKEVAPGEDVAAASTELMVQAV
                     EQGELELADLRRPEMETALTPTVLTNYFKGRMSALTQRQRQSQRARGGVAEAEEGALH
                     LFMTWERQLQTHFVDALLPVLLLPSCGSCASNLEAVQDSAAWLGEESALRWAHFMTRS
                     RAVNLNWRHPGPPQLSIVPLVDMLNHTSRANANVVYQREDSGDVCVTASRTIEAGEEL
                     VLRYNHIGQRGCLFGDLPRPSKPTAEHERGRLSGKAAAVADEVHRIEKRQYWELYACD
                     EDEEAVQHTGHTPSTSFTASTRCGTFDPAPPAAVGQQEMEQEVQWLWRFGFLRSNEEK
                     NREAALLWSRGLRSRIAHLTDVRRKGRPGEFVLGVPEGLQHLREQREQLERNRYNNKK
                     VFPPQQL"
     gene            complement(<540102..>540521)
                     /locus_tag="LMJF_09_1420"
                     /db_xref="GeneID:5649582"
     mRNA            complement(<540102..>540521)
                     /locus_tag="LMJF_09_1420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681263.1"
                     /db_xref="GeneID:5649582"
     CDS             complement(540102..540521)
                     /locus_tag="LMJF_09_1420"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681315.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649582"
                     /db_xref="GOA:Q4QHN3"
                     /db_xref="InterPro:IPR008880"
                     /db_xref="UniProtKB/TrEMBL:Q4QHN3"
                     /translation="MPVDYSKKLDALRELYERVQQKDTDIPEDVYAAAGVKNKARLKD
                     IEKEISTTKKKVSQEVKKVTNEEIEKEYEALAKEHNMTVEEFKETVMGKGRQPALGSE
                     FSERHAAQRKERAEQRDLKETRRQVERGDFDMTVDYV"
     gene            complement(<541296..>541859)
                     /locus_tag="LMJF_09_1430"
                     /db_xref="GeneID:5649583"
     mRNA            complement(<541296..>541859)
                     /locus_tag="LMJF_09_1430"
                     /product="putative ubiquinone biosynthesis protein-like
                     protein"
                     /transcript_id="XM_001681264.1"
                     /db_xref="GeneID:5649583"
     CDS             complement(541296..541859)
                     /locus_tag="LMJF_09_1430"
                     /codon_start=1
                     /product="putative ubiquinone biosynthesis protein-like
                     protein"
                     /protein_id="XP_001681316.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649583"
                     /db_xref="GOA:Q4QHN2"
                     /db_xref="InterPro:IPR007715"
                     /db_xref="InterPro:IPR027540"
                     /translation="MKNCMMADQRGRSILQYQPIVGDEALEFSRGLAPSTFGFRYAAY
                     MDRNHFLPSGRTAVKHIADPTLAYVMTRYRQCHDFVHIITGCGRSIEEELAVKIFEWK
                     HTGLPLGLLSLLGGAPRLSAAQWAHIRLYWEWASRNAPSSRHGEPAVPMYLNVPWEDM
                     LAKEYDEVVAYTGITPLPDFLEKRQKH"
     gene            complement(<546384..>547625)
                     /locus_tag="LMJF_09_1440"
                     /db_xref="GeneID:5649584"
     mRNA            complement(<546384..>547625)
                     /locus_tag="LMJF_09_1440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681265.1"
                     /db_xref="GeneID:5649584"
     CDS             complement(546384..547625)
                     /locus_tag="LMJF_09_1440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681317.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649584"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:Q4QHN1"
                     /translation="MHGIRRWRVRLVNRACQSLSGSLVFSACRHCATVPTEDDVRKAY
                     KILGVHTSATLTDVKKRYGDLAKEHHPDVSNSSAVSSTNRMTDINNAYNTVKQFHQAG
                     RRLFEATRAPNASGASDSSSSSYYSKQDSAYQPWYEDMDPLMYELMWEEMRRQNEEDS
                     FARNMHAEAFYRPNDRWRPPRGNASARPRQSSGSSDGRQSHAGKKSPSSTTWPEEQVK
                     AMVNMYQDGKSFEFIANALGKESAAAVLEEFNRWSSDNQPQRRKGAKPHHARRHRYHG
                     GHGPFYHTESPDEVPFELYEMMEEEPYYDGSSEESGDPFGYYSGDGEAYDVPYTHATP
                     FYGVHQMNGGPAPYGHFEGGVGREYNSSRKMSHRPMRNHRGGPPNKNRRYGGTSSNHK
                     GSGGGFQSGNGKSHGSGGGKT"
     gene            complement(<548558..>548953)
                     /locus_tag="LMJF_09_1450"
                     /db_xref="GeneID:5649585"
     mRNA            complement(<548558..>548953)
                     /locus_tag="LMJF_09_1450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681266.1"
                     /db_xref="GeneID:5649585"
     CDS             complement(548558..548953)
                     /locus_tag="LMJF_09_1450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681318.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649585"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:Q4QHN0"
                     /translation="MSLPEFTHAFNVYEAQAVVRALQAGSANGVYLLDVREEFEVQAV
                     RPLPHALVIYFRDFYDAMQMRESAFQRKYGVRKPHKKDRILVYALNQVRASSAATYLA
                     ARGYKSVVFLDAKMSEYLDSTQNKLDEDL"
     gene            complement(<549603..>550055)
                     /locus_tag="LMJF_09_1460"
                     /db_xref="GeneID:5649586"
     mRNA            complement(<549603..>550055)
                     /locus_tag="LMJF_09_1460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681267.1"
                     /db_xref="GeneID:5649586"
     CDS             complement(549603..550055)
                     /locus_tag="LMJF_09_1460"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681319.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649586"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:Q4QHM9"
                     /translation="MLRRTWCLCWCLSIDQVAKIVKAKQSCSDAVRNIQLIDVRSTAE
                     VAATGMIPSAINIPLPVLRDVLSQDSILEDDEFDFFFGGARPVQGVTQIVLYCAHGVR
                     SAIACEIAEELGFENVSNFSGSWAQWYHAYGTPSTSAAVPESLHTPLK"
     gene            complement(<551010..>551369)
                     /locus_tag="LMJF_09_1470"
                     /db_xref="GeneID:5649587"
     mRNA            complement(<551010..>551369)
                     /locus_tag="LMJF_09_1470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681268.1"
                     /db_xref="GeneID:5649587"
     CDS             complement(551010..551369)
                     /locus_tag="LMJF_09_1470"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681320.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649587"
                     /db_xref="GOA:Q4QHM8"
                     /db_xref="InterPro:IPR001307"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:Q4QHM8"
                     /translation="MQHLTYAAMKALVTKKLSGDLHMCILDVRSTDEVAGGAIPASVN
                     VPLDQLETALQLTADEFRKKYSAPKPEVSDHVVTYCLRGMRAERAAAALHSSGYRNVD
                     VYPGSWAEWSEQEKCAA"
     gene            complement(<552956..>555400)
                     /gene="JBP1"
                     /locus_tag="LMJF_09_1480"
                     /db_xref="GeneID:5649588"
     mRNA            complement(<552956..>555400)
                     /gene="JBP1"
                     /locus_tag="LMJF_09_1480"
                     /product="putative DNA J-binding protein"
                     /transcript_id="XM_001681269.1"
                     /db_xref="GeneID:5649588"
     CDS             complement(552956..555400)
                     /gene="JBP1"
                     /locus_tag="LMJF_09_1480"
                     /codon_start=1
                     /product="putative DNA J-binding protein"
                     /protein_id="XP_001681321.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649588"
                     /db_xref="GOA:Q4QHM7"
                     /db_xref="InterPro:IPR024779"
                     /translation="MEPDPKKIKLDIFNFPTARETRTPEEVAESYAEAVKSHPFYDNV
                     HSVIDFYDSGTIKDGRGQIIGVVLREALPKYAVSMASELLASAAVRTSLRSMMFGGES
                     PLSGIAGYFDYRGSPVELKSRKTSFTYEHEAAWPAVFPVVDYVSELYRHVAPERWKAQ
                     NDAIPDVVRIHGTPFSTLTINSRFRTASHTDVGDFDGGYSCIACLDGHFKGLALAFDD
                     FGINVLMQPRDVMIFDSHHFHSNTEVELSFSGEDWKRLTCVFYYRAALGEPASYAEYQ
                     RRLEKSKQDNSFTPVVSNVRVKENGTNLNRPSPVYPICPSPFWVPMVAHCLQHCASEA
                     QCVHDAMTADGSRLAEVMFGEPLSTSDGIPLRGEDKKLKANSDSASRPLSRLGGFSET
                     NLMVSTAVEKKKYLNSEFLSHFISAQLLDMWKQARGKWLELVGREWTHMLALNPERKD
                     FLWKNQSEMNSAFFDLCEVGKQVMLGLLGKEVALPKEEQAFWTMYAVHLNAACAEELH
                     MPHVAMSLRKLNVKLKDFNFGGTRYFKDMPPEEQKRRMERKQRIEEARRHGMSSGAHE
                     KRANWLTNDSFDYQTEDCVVDYAQHKWPPPALHAKEITKNVRTGELPTREGVVRVLVV
                     LPDPQSKLECVDCKLEVPETVRCSCEWERLMSSLAVRRVLAAAQRNLQLPGSVTHGNI
                     EIRFAFHSRLPTDMCDFVVLQHVLSCIPDDVLASAYIRRAAALCTGCVYVVETDVQCR
                     QYYTLKCAARCDYDAVASLFFQQLHRVSYGTKAARVRTKGELESLIPTVCCARYKLQG
                     SPLNTTVHVVSPAPSR"
     gene            complement(<556542..>556895)
                     /locus_tag="LMJF_09_1490"
                     /db_xref="GeneID:5649589"
     mRNA            complement(<556542..>556895)
                     /locus_tag="LMJF_09_1490"
                     /product="putative cytochrome b5-like protein"
                     /transcript_id="XM_001681270.1"
                     /db_xref="GeneID:5649589"
     CDS             complement(556542..556895)
                     /locus_tag="LMJF_09_1490"
                     /codon_start=1
                     /product="putative cytochrome b5-like protein"
                     /protein_id="XP_001681322.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649589"
                     /db_xref="GOA:Q4QHM6"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="UniProtKB/TrEMBL:Q4QHM6"
                     /translation="MTPNYIPLSEVEKHITENDLWFIKDLKVYDITKFVDQHPGGVDT
                     LLSVAGKDGTSDFNAVGHSESAVEELARYYIGDVHPDDAEKVQQASIKAANNYFGIAV
                     VLALVAICSFFIFRP"
     gene            complement(558185..558541)
                     /locus_tag="LMJF_09_1500"
                     /pseudo
                     /db_xref="GeneID:12982588"
     misc_feature    complement(558185..558541)
                     /locus_tag="LMJF_09_1500"
                     /pseudo
                     /db_xref="GeneID:12982588"
     gene            complement(<559017..>559382)
                     /locus_tag="LMJF_09_1505"
                     /db_xref="GeneID:5649591"
     mRNA            complement(<559017..>559382)
                     /locus_tag="LMJF_09_1505"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681271.1"
                     /db_xref="GeneID:5649591"
     CDS             complement(559017..559382)
                     /locus_tag="LMJF_09_1505"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681323.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1505"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1505"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649591"
                     /db_xref="UniProtKB/TrEMBL:Q4QHM5"
                     /translation="MKLVRRARKSIRERRMKACINDLNSNLSKVEMRVFRKQKKERDA
                     KRQALGTSELVPKDVLNGRMNPDLYAVECRLHEEAGLPKPLPYQGYKEDLLRSRATTH
                     CVGFVGLRTILQAIRARNR"
     gene            complement(<560275..>564909)
                     /locus_tag="LMJF_09_1510"
                     /db_xref="GeneID:5649592"
     mRNA            complement(<560275..>564909)
                     /locus_tag="LMJF_09_1510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681272.1"
                     /db_xref="GeneID:5649592"
     CDS             complement(560275..564909)
                     /locus_tag="LMJF_09_1510"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681324.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649592"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:Q4QHM4"
                     /translation="MQCVQRRENITLIHRGVHVEEHLEPVLIAFLQAIRSSAEYGMQV
                     AADEIAKEKQMQRLLQMNVNAGEVDATEARGTKVHERDNARQGGGSVQLSKELRKKIA
                     KLRQEYHYVHPADRQAAAANRYGLITAAHNDLLKPPRIDSSLLMSQAFAASSPVNRTT
                     RASMAASLMAAKSARSHTAIFNQLQRRNTAGLLSELRDQEPDGDCESIRGNGWGDKIT
                     LYTFDGVSSVMALPGIPNFDEVVRELALDFWVRTDLKPVDGKRVLIQIMEGQREDVGQ
                     LFQLSLNWYEDMPDSLRVIIRDSANRVLEAVASVAKAGLTDGTKFHHLMVRVHSLEEG
                     QLSCEVDGRSIDVQLIQQEHPIAFNPWSHRLFVGGYLDEVNAPALVFRGVIAELRFWS
                     GVFPSHPIVRWPLFAVENGTLQEVTRTIPADHHETLLNLRAVEEPSPRSAPWFDGNLV
                     MNVGTLPLFGPLMHNWRIELCFRTDVSSRMMTLLGVTDRNFQMQELGIVLNSEPVITK
                     ERLRYHELHTTFYVADAFGACCSALLRGTERQNLMDGEWHKLVWRCIDSEANKFSVKV
                     DDVLQDLLFVSREGPTRFVSYDNWIAVGGHNVRNWKIQRPFTGQIDHFYLSLRGYPYV
                     TLEMNEGPGAYVLQDRSHHHNHGLLINSATNVVRRNDVVWIPGPANDSQDLDHGAVPD
                     MRTFKSNDVSVAAVVFTCTFDEENIVRETLYDVLSGKFRELERTPHILPKHTEAQWKS
                     WYGLPAECYHAFDSVTRLEESINTVLRATAPRGHLLITVRIGDCLASIFHIREPERPA
                     DAVYDCNMLRWHYPYMVEGMRGRRELMLNRMIEGAESVLLSDTLKPYVTAKLGPLNSG
                     PRSVLTDDIIRSLQNSGRPWFLPAVLHAHLLNAEFGSTLHLIQRVRPHMSANEAAAVS
                     VFNKKLFDGVRGNAALLIQRNWRGCLGKREAARRSEQRSLNDRKVEEIRTLRMNAAVK
                     TKGSLCALLITLHHPRCPGVPAIDSDTRPLEEALRQQGYEVTTLEDPDMATMLRAVSQ
                     TDTTKSNFIYVSGYGGALGLRQPPAFGFESLAVYIEEQAQRATVECDESGAFRQLMAL
                     MAEEKARVPVKKPKKKAKKASATARPKKKTAVEVELEQRQCESALCSHCQQMEQGESS
                     ARTNLVGEWETMNQLLSRELRRTVAVTREYEERYKAKGPEGDGQNYVYPCESHMIEPF
                     ATTVVDVEDVIGAALHRQAPPLGLQCVVAVDLQPVTPYSCGMACIASSTGNTFRVPYR
                     PQQRELLSLILVKAFNGQLPKVSATFKYAILSGGIETAANERDWKSFASYVVGKLQRY
                     CSPERCRALRGELDRHVPFVAELVPVRDIVMDAEARDRRRRERETQKVKAQVTFGVGS
                     AKVQSDMFSLFRDFLEGVTVSDLIFVNTICILLTHQNKGIDGIQVEDVTDALEKCRPS
                     ACTLAFEVRVTAGGVEVQFKVSDAGDRLLLSQWLNALSLRSLTWQFRQRPLFGTSRLE
                     VDYIEHLYDAKIACSARRYRQLCKQFDAFPVPKPYVRFVRARVSKSPKQN"
     gene            complement(<565826..>566842)
                     /locus_tag="LMJF_09_1520"
                     /db_xref="GeneID:5649593"
     mRNA            complement(<565826..>566842)
                     /locus_tag="LMJF_09_1520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681273.2"
                     /db_xref="GeneID:5649593"
     CDS             complement(565826..566842)
                     /locus_tag="LMJF_09_1520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681325.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649593"
                     /db_xref="UniProtKB/TrEMBL:Q4QHM3"
                     /translation="MPPKQGKKDAKASAPVITVAQELHVDTDLRRLQEACGVLGEPFA
                     PFARRLKAELMRVKDGDQEGVPQVPLFVHGAVALGDLKTLCSVALRPYPFLRVIQLHH
                     AVLGDDGILILCEFLSEYQPLPDRNPFGIQRLELPGCAIGPRGCRYLGSYLRSNATVT
                     KLVLDFNPLEDAGVRELCTGLQWNSSLTSLSLQYCGVSSVGAGDIASRIVKESNVSVL
                     SLRGNAIGDKGLEEVAKAICVSSKLEDVDLADTAFTGDVNAVLALCEAMECVTALRVV
                     DLSMCTITPSATECLLKSLQASGHVTTLRVSERTDPVVYKQIVGISATRSQAGKKKKG
                     KKKM"
     gene            complement(<567346..>567831)
                     /locus_tag="LMJF_09_1530"
                     /db_xref="GeneID:5649594"
     mRNA            complement(<567346..>567831)
                     /locus_tag="LMJF_09_1530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681274.1"
                     /db_xref="GeneID:5649594"
     CDS             complement(567346..567831)
                     /locus_tag="LMJF_09_1530"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681326.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649594"
                     /db_xref="InterPro:IPR003117"
                     /db_xref="UniProtKB/TrEMBL:Q4QHM2"
                     /translation="MNAMYSADQIHVPPELGTIMKQYTKAVMRDKPTDLYKYSANFFA
                     ILSGYAAPFDSEGQLMENGVQEASSRSTVPISFGSEKEENAGSQDPTDILLRRYDRTG
                     TGYMDPAELPQLLAELRMNLSLDEKDVVSAEDILAALPSACDQIDLLELRNLLLESMG
                     D"
     gene            complement(<568323..>570146)
                     /locus_tag="LMJF_09_1540"
                     /db_xref="GeneID:5649595"
     mRNA            complement(<568323..>570146)
                     /locus_tag="LMJF_09_1540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681275.1"
                     /db_xref="GeneID:5649595"
     CDS             complement(568323..570146)
                     /locus_tag="LMJF_09_1540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681327.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649595"
                     /db_xref="UniProtKB/TrEMBL:Q4QHM1"
                     /translation="MRTKSYADVRALTSQYEQTIKQKNAELENLRHTSMPRGDVGDAS
                     KRCKLLEKQLAAANSEKSVACMERADLQAKLRKVQALLKCRKDEVVKVKGSLEESNVE
                     RSSTVAALKMTVETLSQERDRLNSELAERAKRQCVERTSTGTVCECHRSEGESQTTPI
                     ERMSQSCQVCTLQGALSTSGEEAEAPHSLASLLEEKTRECDQLRGALEDLSAMQRDAL
                     AMLEVTKNQLSTEADRRRIAVEDVENLSLQLRALQQRCSDQTAAERAMGDKIRLLGEE
                     RQKMLVEKSQIERDRDHWEEQLRQYEADVAQLSATKNHANRQLSTLANENENLRAEMQ
                     QLCEREAQALYAVKAKDMEVQEILSAYQKAAQENESLLESQRFLERELDNVRAGLASK
                     EETVAYLQEQLRSMHLREQQLTLDIQSLEYDNENHHQRLARRDHEAAELEAKSSELAQ
                     LVQTKEHCIEELHQSLSELSKQVIVKDNESLLLRQRCDTLLADMALVRVSFSNEKAKV
                     QELEAANARLVAREVLSLSDAADRREQAQALEDERATLKAAIDENERLAVSCEQLAES
                     NKVLESRVAELEKSLQESIEAKERLHRIVLEQNKALSRLSE"
     gene            complement(<570800..>571345)
                     /locus_tag="LMJF_09_1550"
                     /db_xref="GeneID:5649596"
     mRNA            complement(<570800..>571345)
                     /locus_tag="LMJF_09_1550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681276.1"
                     /db_xref="GeneID:5649596"
     CDS             complement(570800..571345)
                     /locus_tag="LMJF_09_1550"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681328.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.09.1550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.09.1550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649596"
                     /db_xref="UniProtKB/TrEMBL:Q4QHM0"
                     /translation="MGSSSSKAKATPAVSVPRYEDSPPESTNIGDLVVSGRYKVASPE
                     TVELMKQIQAPRDANKMYPDSDVKDLKQYIIEQEGLEIGQARRRALAQQWRFFLSCEP
                     MQRALDAGIILGSVSAFVAFRKPRNRVPAKISLIFLGGFCVGMVSVPLMVVATESYNS
                     KRIKKLEQELFEKQRSEFYKR"
CONTIG      join(FR796405.1:1..573434)
//
DBGET integrated database retrieval system