GenomeNet

Database: RefSeq
Entry: NC_007251
LinkDB: NC_007251
Original site: NC_007251 
LOCUS       NC_007251             570865 bp    DNA     linear   CON 18-JUN-2017
DEFINITION  Leishmania major strain Friedlin complete genome, chromosome 10.
ACCESSION   NC_007251 CT005249
VERSION     NC_007251.2
DBLINK      BioProject: PRJNA15564
            BioSample: SAMEA3138173
            Assembly: GCF_000002725.2
KEYWORDS    RefSeq; complete genome.
SOURCE      Leishmania major strain Friedlin
  ORGANISM  Leishmania major strain Friedlin
            Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae;
            Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Rogers,M.B., Hilley,J.D., Dickens,N.J., Wilkes,J., Bates,P.A.,
            Depledge,D.P., Harris,D., Her,Y., Herzyk,P., Imamura,H., Otto,T.D.,
            Sanders,M., Seeger,K., Dujardin,J.C., Berriman,M., Smith,D.F.,
            Hertz-Fowler,C. and Mottram,J.C.
  TITLE     Chromosome and gene copy number variation allow major structural
            change between species and strains of Leishmania
  JOURNAL   Genome Res. 21 (12), 2129-2142 (2011)
   PUBMED   22038252
REFERENCE   2
  AUTHORS   Ivens,A.C., Peacock,C.S., Worthey,E.A., Murphy,L., Aggarwal,G.,
            Berriman,M., Sisk,E., Rajandream,M.A., Adlem,E., Aert,R.,
            Anupama,A., Apostolou,Z., Attipoe,P., Bason,N., Bauser,C., Beck,A.,
            Beverley,S.M., Bianchettin,G., Borzym,K., Bothe,G., Bruschi,C.V.,
            Collins,M., Cadag,E., Ciarloni,L., Clayton,C., Coulson,R.M.,
            Cronin,A., Cruz,A.K., Davies,R.M., De Gaudenzi,J., Dobson,D.E.,
            Duesterhoeft,A., Fazelina,G., Fosker,N., Frasch,A.C., Fraser,A.,
            Fuchs,M., Gabel,C., Goble,A., Goffeau,A., Harris,D.,
            Hertz-Fowler,C., Hilbert,H., Horn,D., Huang,Y., Klages,S.,
            Knights,A., Kube,M., Larke,N., Litvin,L., Lord,A., Louie,T.,
            Marra,M., Masuy,D., Matthews,K., Michaeli,S., Mottram,J.C.,
            Muller-Auer,S., Munden,H., Nelson,S., Norbertczak,H., Oliver,K.,
            O'neil,S., Pentony,M., Pohl,T.M., Price,C., Purnelle,B.,
            Quail,M.A., Rabbinowitsch,E., Reinhardt,R., Rieger,M., Rinta,J.,
            Robben,J., Robertson,L., Ruiz,J.C., Rutter,S., Saunders,D.,
            Schafer,M., Schein,J., Schwartz,D.C., Seeger,K., Seyler,A.,
            Sharp,S., Shin,H., Sivam,D., Squares,R., Squares,S., Tosato,V.,
            Vogt,C., Volckaert,G., Wambutt,R., Warren,T., Wedler,H.,
            Woodward,J., Zhou,S., Zimmermann,W., Smith,D.F., Blackwell,J.M.,
            Stuart,K.D., Barrell,B. and Myler,P.J.
  TITLE     The genome of the kinetoplastid parasite, Leishmania major
  JOURNAL   Science 309 (5733), 436-442 (2005)
   PUBMED   16020728
REFERENCE   3  (bases 1 to 570865)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 570865)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire, CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR796406.
            On Jun 1, 2012 this sequence version replaced NC_007251.1.
            Data release policy www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..570865
                     /organism="Leishmania major strain Friedlin"
                     /mol_type="genomic DNA"
                     /strain="Friedlin"
                     /db_xref="taxon:347515"
                     /chromosome="10"
     gene            complement(<3684..>4868)
                     /locus_tag="LMJF_10_0010"
                     /db_xref="GeneID:5649743"
     mRNA            complement(<3684..>4868)
                     /locus_tag="LMJF_10_0010"
                     /product="putative fatty acid desaturase"
                     /transcript_id="XM_001681277.1"
                     /db_xref="GeneID:5649743"
     CDS             complement(3684..4868)
                     /locus_tag="LMJF_10_0010"
                     /EC_number="1.14.19.1"
                     /codon_start=1
                     /product="putative fatty acid desaturase"
                     /protein_id="XP_001681329.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0010"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.1320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.1320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649743"
                     /db_xref="GOA:Q4QH80"
                     /db_xref="InterPro:IPR005804"
                     /db_xref="UniProtKB/TrEMBL:Q4QH80"
                     /translation="MKSVLKAGREKDVDVVVPPKELTIKQIQDQIPAKYFERSAVWGM
                     YYVFRDIFQVLALYFIMYRAVMPVLSALGGVVYGVAGANIVSWTVVGAVKFAAWTVFG
                     IAQGLNGFAIFVLAHECGHQAFSSYRLLNNAVGLLLDSVILVPYHSWRISHGNHHKHT
                     NHLTKDTVFVPRKEQRVIGLVEETPLVMLWNMFVIFTFGWPAYLVANIASQDYGRRTN
                     HFEPSSPLFHKDDGPDIVLSNIGIVAALFILGLCTYQYGAYNVFCWYVVPYLWTNFWL
                     LYVTYLQHSDLRIPHYTHAHWTFVRGAIATVDRDYGFIINEWLHYINNSHVVHHLFSQ
                     MPFYHAIEVTRHHIKDIIGDAYVTDSRSLVEMLCETWRECRYVIPSEGISVFYSFTGK
                     GA"
     gene            complement(<7849..>9828)
                     /locus_tag="LMJF_10_0020"
                     /db_xref="GeneID:5649598"
     mRNA            complement(<7849..>9828)
                     /locus_tag="LMJF_10_0020"
                     /product="putative pteridin transporter"
                     /transcript_id="XM_001681278.1"
                     /db_xref="GeneID:5649598"
     CDS             complement(7849..9828)
                     /locus_tag="LMJF_10_0020"
                     /codon_start=1
                     /product="putative pteridin transporter"
                     /protein_id="XP_001681330.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0020"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.1310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.1310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649598"
                     /db_xref="InterPro:IPR004324"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q4QH81"
                     /translation="MTVGQQTGNVVGGADVLCATPPAEQLGEEDKGYVHPDTAALFDA
                     SPFMRYIPIFGTAVVPFGPKCVMSLGIVYILSKGLAKTLLNSSRYAMFMKKYGVTTAV
                     YQRISGIGSLGFSIKPLTAILSDTFAFFGYTKRWYMALSCIAGAVCAIVYGVLPFKQS
                     SAGIAGAMIFISVFCIANIDVLSEGHYSRLIKRHPIPGADLISWIWALIMVGAIIAST
                     IQGPLSDSGRPTIGIFLSAGLQAFCVFFFIFNWYGEKKNLVERKEDYIFLLKQEAQMQ
                     ETDSEPIKEGVGMHDITTGKSKTKSTVLYHESSPQNSDGELVNFGELDDDVTEYDFVA
                     TSCMCGIFGVNKEIISRNISVAVYGVIMTAGVVALTVLNIMGTTYQLLYGCVSISVIL
                     CATGFLCIPMTIMKANFFGWCQQVCYILISGGTDNFYMSDASCLPDGPHFSQTFYNTV
                     GAVIGNAAGVFGVYLFARVFSKQSYRVTLICTTLVQILASIFDIIIVERWNLYIGIPD
                     HAMYIMGDAIVYEVCNMLNFMPLNMLISRLCPKGCESTMFAILASFSNMGASTSSTIG
                     AILMETVWPLSSSPPCDFSNLRWLLISGHFITPLIAIPLVIVLIPGTRICDPIDPKDV
                     EALSIFQKWLNKFYATSSAHAKPQPKSLPDSERQQ"
     gene            complement(<11909..>13390)
                     /locus_tag="LMJF_10_0030"
                     /db_xref="GeneID:5649599"
     mRNA            complement(<11909..>13390)
                     /locus_tag="LMJF_10_0030"
                     /product="phosphate-Repressible Phosphate Permease-like
                     protein"
                     /transcript_id="XM_001681279.1"
                     /db_xref="GeneID:5649599"
     CDS             complement(11909..13390)
                     /locus_tag="LMJF_10_0030"
                     /codon_start=1
                     /product="phosphate-Repressible Phosphate Permease-like
                     protein"
                     /protein_id="XP_001681331.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649599"
                     /db_xref="GOA:Q4QHL7"
                     /db_xref="InterPro:IPR001204"
                     /db_xref="UniProtKB/TrEMBL:Q4QHL7"
                     /translation="MANVNPYLWIVIVGGFVSFLTGAGVGMNDLANAFGTTYGARILT
                     LTQIVIVASVCEFGGAVTLGGEVTSTISSGVADPKDFAKQPYVFMYGMLCACGAAFCW
                     LAVATWLRLPVSSTHSICGGVIGFALVYGGGGAVSWAKRKDDFPFFSGVAPIVASWFI
                     SPVLTGAVSAIIYSLVRFLVLRPKNCVKRAMYTLPVVVAIAFFLESFFVLFKGASKRL
                     KWSVGKAAWVATCIGAGAGVLSCVFIPLLKRLVARDEAHAFAASEERPSTTEGSTQRK
                     PLNDEDVHKAREVTGDVVSQSEASDSEQSEERQVTGASGLQVQQYEWRAERVFRYLQV
                     FTAICASFAHGASDVSNAVGPLAAIYQVYQTGGVEKSSSVPIWVLCLGGAGLVLGLST
                     FGIRLMRLMGEDLTVITPSRGFSAELSAALVVSFASGYGIPVSSTHCITGGVIAVSIV
                     DVGFLNIRWLMVLKMYGGWVFTLVVTAIISAMFFAQGASAPAM"
     gene            <22697..>25525
                     /locus_tag="LMJF_10_0040"
                     /db_xref="GeneID:5649600"
     mRNA            <22697..>25525
                     /locus_tag="LMJF_10_0040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681280.1"
                     /db_xref="GeneID:5649600"
     CDS             22697..25525
                     /locus_tag="LMJF_10_0040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681332.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649600"
                     /db_xref="InterPro:IPR012880"
                     /db_xref="UniProtKB/TrEMBL:Q4QHL6"
                     /translation="MRCDVVFAPVVESTAESKEELRDSIEKSLRSLLGSRLAGSALQT
                     IENGVWRGIAALQSLVFDSTVAYHKGEVRRLRDRKEMLNDDSNQRLALPGLHFKIGWH
                     YLVLHEFSSTRQQMLSGLRKIKTLFPLFPSFEARLCGSVFLWHFLFCVSVSEGHLSSS
                     SEVYQEIRCFVDWIGTAYGGGVKDECQTVVLVLTKVMEAEWLEYLARKTENLEARQCC
                     DYLVAAAQALQDCDAFLPSRKEGIAIEAPPHIGEEELLGNHASALWKSFDKSALRGRI
                     TRLLAEAKAACSSRETEVEYLAFLAGNELIDGVPDTEAIDRMLVKASSTIISRLAAMA
                     WGSASSWSALSPRLTAALLLHGCVDALGHADQERYHLRMHELEGCLHNDVVLEYPKGR
                     LQAPFTAVAYFDEESAKVVGDSARVVVTLYSTSAASISVDVRMLTLSSGTVAGATETQ
                     VPFSPARCVKLSASCPQELAVDVPLSHSGEYVCTSLTADVHVGGICATTRWRFAVGPS
                     SVAGKSATATRAAFSAKISRQVLQVSNPSTIFRVECPSLLEAVEGECAECDIVISCAL
                     LGVRNGYMTLPHEPNLFRAVCWTSANEPLPVTETGGQVRYAVPDLAADESVHLVVSIA
                     CIRSAEFRLPIAFEYSTDRYGGVSCCRTLHISVDPPFNAEHSMIGGSLWGDAAAAMSV
                     PSMSLSYAQYDKSVLVKAADIFSSPLVTNWKDDCALYFFTKGTTAKEFVFQRDDTVTL
                     SSTFRCTAKRGITVLHADVVTGDDVDVLSFCCGEEGSFLEEGECVTMVTRFQAKRLGR
                     FNPGFIRVFFAPQRTAARLYSDVCIPAVYIEDFGVQVSAKYPLVAPYGSPLELDVSVY
                     NAAGVPFIGELLLDPQADDFVCAATTRRSLQIGPAEGSVTRYVLTPLRAGELKLPRFH
                     VRCDATSRLVASADESYVVHILPCDPEG"
     gene            <26371..>29133
                     /locus_tag="LMJF_10_0050"
                     /db_xref="GeneID:5649601"
     mRNA            <26371..>29133
                     /locus_tag="LMJF_10_0050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681281.1"
                     /db_xref="GeneID:5649601"
     CDS             26371..29133
                     /locus_tag="LMJF_10_0050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681333.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649601"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4QHL5"
                     /translation="MREHLCTPEKVQPAMQLLASVAVGRAGLSRTDIRLLFVFFAEKL
                     AQQELQTTALSLLALLISDIREQHECDEEWFKVVGTPFTEYVRVQQLPLHSRKQCFCI
                     MSFLFTEKTVDLCDSSTLAALLELIDGESDPELVMLAFDLHVVAATRSSREAFATVVD
                     DYFESVSSYFPVVFSQPPGCKVTKTDLRAGLKRCLCLTVYKELCIPFMQSKLASPSTA
                     VKEDVLDVLLTCFDTYHSQDLVPHCQSLVLHMKSEVIKLSSFADRASNATLTKCLLMS
                     CEVLGRVSKQCSVKTQSEALEIFGPVVEGLLASLSADPPTCSAYGTMVVHVLTGSWNC
                     CLFVASYLFSMLAMSIEGAERPANAFILLAALASGMLDGLDAFPGEAHKEQLRSSIER
                     TTPMVVEAVTGCSQRWRAAGDEACKDDFTLMCGCEFLVCVLKLSAVIEPWMPAAAASE
                     GVDALVWVALHHTVEVSAKVCRLLRDYAAVDALQVQEALARLLCNPSAPPERALTIAC
                     ELASTSLAALLLVFADGFFSTTCEWMRGISAGHRAAALRTALQHFGRALQDGAADRMT
                     ALLDRVDVPPEFFECACLVASNMSGDICGQLLFTEGSLSLLGIAAVVSRRTHLHCVQY
                     NWANTAAQFVGLTTSDHQAWRRVGMEGITGMVMRKVFPEDTQALLTRVSTRGHLNVEV
                     AILWGKLLVDRADSGETTAPPPGELVSSFLYQHLGAATPASCFDRAAVQEAFSYVPFL
                     TTQAAVRPSVLQLLLGSEMSQSELPNQVLCSALQCLVDGETEERVQACLVDLLTMVRK
                     LTSSGAENERALARALLFSVDAKCGGSAALARSVLFNESSVQALLEGTKDAALTVRCR
                     SLHLIRSLARGALSLMGSCSQEEKAELARARDHILLLTKRSLGDHKRRVRQASAACLH
                     EWFKVK"
     gene            <29978..>31069
                     /locus_tag="LMJF_10_0060"
                     /db_xref="GeneID:5649602"
     mRNA            <29978..>31069
                     /locus_tag="LMJF_10_0060"
                     /product="thymidylate kinase-like protein"
                     /transcript_id="XM_001681282.1"
                     /db_xref="GeneID:5649602"
     CDS             29978..31069
                     /locus_tag="LMJF_10_0060"
                     /EC_number="2.7.4.9"
                     /codon_start=1
                     /product="thymidylate kinase-like protein"
                     /protein_id="XP_001681334.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649602"
                     /db_xref="GOA:Q4QHL4"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QHL4"
                     /translation="MRAVVFSDVASAELREHIRAIASTSYAEVVYVDVSESAEADLAT
                     AWHTRYGGASHSPPAARDELDDLKNTFVCYLTEQKTIEDSDVVYAVFVAEVHTLVLTP
                     SVTLTPLMHATADGSVSARKAAIESFFSVAPSSSSAEVIVVEGGDGAGKETQTGLLVR
                     RVHAAGDEVHALDFPNEKGLYGGLVRAVLSGKKGPISELNPQLFSFLYSLNRFGCARQ
                     LHFWLRRGSSVVLDRYYTANFGHQASKLPPEEREAFISDLEFMEVEWLGLPRATYVLY
                     LDLPPAVALEAMRQDATRKQLDIHETAGSDYKERVRQTYRWCCEHLPGWHHIECFSDD
                     GRRLTREEVHASITSHLRDAGSRAIGAPS"
     gene            <32794..>33228
                     /locus_tag="LMJF_10_0070"
                     /db_xref="GeneID:5649603"
     mRNA            <32794..>33228
                     /locus_tag="LMJF_10_0070"
                     /product="putative ribosomal protein l35a"
                     /transcript_id="XM_001681283.1"
                     /db_xref="GeneID:5649603"
     CDS             32794..33228
                     /locus_tag="LMJF_10_0070"
                     /codon_start=1
                     /product="putative ribosomal protein l35a"
                     /protein_id="XP_001681335.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649603"
                     /db_xref="GOA:Q4QHL3"
                     /db_xref="InterPro:IPR001780"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="UniProtKB/TrEMBL:Q4QHL3"
                     /translation="MTTSKVHSQRSKKLHQLSAKTSRVNRNRKAPRLYMKGTLAGYTR
                     GLHGQTKQTALVRVENVNTREDATWYVGKRVCYVYHGKKVKRCVRWSKAPARRSTTRA
                     LWGRVTRPHGNAGMMRVKFNGASVPASAIGRRIRVYLYPSQI"
     gene            <33836..>34867
                     /locus_tag="LMJF_10_0080"
                     /db_xref="GeneID:5649604"
     mRNA            <33836..>34867
                     /locus_tag="LMJF_10_0080"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681284.1"
                     /db_xref="GeneID:5649604"
     CDS             33836..34867
                     /locus_tag="LMJF_10_0080"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681336.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649604"
                     /db_xref="UniProtKB/TrEMBL:Q4QHL2"
                     /translation="MLKECDFFSDSYGCIITKSIGYQAPFPLVRLSNGRSTKIPDGAC
                     VQGACFVSFGADHTGSRGRLLTMDVSARASSVSFLQLLSSSCPPVTLEPEVEYVSKIE
                     TTETASAVVTRGGGNRWSTSVYVQGEDVPDTAYSRRVHFHRASVASLFGFSLWLMEVA
                     KDDYGAQAVHRYSLSTALTGGVSESTLVSANLGRPLDIIALSEDTALVLGTNGVAMAD
                     RRQRASDILFFSNLLNGGATGDRQLLTFGEDYTLRAYDLRDVSAPLFQATSATYLRIK
                     SEIDTRASLLVTSDITGVFDVLHVTTVASLQHSGDTVLDAAVLPSRHNGVRVCTSTGS
                     GMIYDWTVT"
     gene            <38964..>40202
                     /locus_tag="LMJF_10_0090"
                     /db_xref="GeneID:5649605"
     mRNA            <38964..>40202
                     /locus_tag="LMJF_10_0090"
                     /product="dehydrogenase-like protein"
                     /transcript_id="XM_001681285.1"
                     /db_xref="GeneID:5649605"
     CDS             38964..40202
                     /locus_tag="LMJF_10_0090"
                     /codon_start=1
                     /product="dehydrogenase-like protein"
                     /protein_id="XP_001681337.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649605"
                     /db_xref="GOA:Q4QHL1"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q4QHL1"
                     /translation="MIHVGNCYIPWAVFTLAELRTISCQIVLLAIWGAVLGPLCRRGV
                     TGVALLACYTVAMFFYQRRLASGLPVRFLSLRAWRSSPENFRKTSAFLKALKAKTPAA
                     GVSAEGFGARPVVVITGGERGIGKEVVHQLLREGVDVILCCPFEAEALRTIARLKARV
                     SNSRVHFVKLDLNDEESVRECAAEVLGMTPRIDVLINNSGLVSPLSHKLNKRGYEVVL
                     SINFLGHVLFTELLLERVKASGPSRIVNVASLMHLDACVEGPCKTALDVMAANCDPTS
                     PHHTRNYSLSKLLLVCYTRDLARHLRGTDTAVATLHPGVVITDIYAFAVIFMRVFFRT
                     VFKFPGEGAEVVLYCALADNIRSGSFYADCAEYNSLLSPLAVDDAHNERLRRVLLRYF
                     ALDGSKPTGKSLADVVQSTP"
     gene            <41493..>42266
                     /locus_tag="LMJF_10_0100"
                     /db_xref="GeneID:5649606"
     mRNA            <41493..>42266
                     /locus_tag="LMJF_10_0100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681286.1"
                     /db_xref="GeneID:5649606"
     CDS             41493..42266
                     /locus_tag="LMJF_10_0100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681338.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649606"
                     /db_xref="InterPro:IPR007718"
                     /db_xref="UniProtKB/TrEMBL:Q4QHL0"
                     /translation="MSRAVDHLVAEYLAEEHPRVARALRKEAPSTTPPLLSPFGKKSL
                     QEVVMAYRVQKTTPAVVDNGTSSDGDEAQRASHKTAKTSSPSPIPKPARRKAPIADSD
                     SDDESATRPAAKTTSPKFALKKAAVDSDSSDEDEPVPKNSSAGKRPAPRAEEAPAQRA
                     ARTESEGAARRTPHHLNEDGTFRRFQRIDPAKVTFDADALRDNRPGREHLVLRQNQEM
                     MRTKGKGFNKLKQKNKGKFYGAGVDLSVRAYQFPDSDDE"
     gene            <43351..>44538
                     /locus_tag="LMJF_10_0110"
                     /db_xref="GeneID:5649607"
     mRNA            <43351..>44538
                     /locus_tag="LMJF_10_0110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681287.1"
                     /db_xref="GeneID:5649607"
     CDS             43351..44538
                     /locus_tag="LMJF_10_0110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681339.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649607"
                     /db_xref="GOA:Q4QHK9"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR028608"
                     /db_xref="UniProtKB/TrEMBL:Q4QHK9"
                     /translation="MDGARTGDGTALATAPPLLLPSSAPQDVQVRKIAALRGHKDRVW
                     CVRWCPTALVLASCSGDTTVKFWGRSRSAENGCEAWTCLGTLEGEHSRTIRHISWSPS
                     GEYISCASFDHTATVWRRNGSDDAYDFEIEGVLDGHESEVKCVEWATDSMLVTSARDH
                     TAWIWERVDEGEYECGGVLTGHVQDVKHCQFVLPHNDGDVPLVVTCGYDDTIKVWSEG
                     HHHDDWQCVQTIAAHEATVWATALQKLEVPMELVRASHASHAPLPQPLLCSCSDDLSI
                     IFWKRNAEGRFVEAARISGFAERSLFDVDWAPHNAPVVACASGDNSFSLLGVYKDEMD
                     VHACTLARVADAHLADVNSVSFASQGTLTACNEEGERTGVLLATAGDDSVIHLWTVSA
                     EME"
     gene            <45939..>47027
                     /locus_tag="LMJF_10_0120"
                     /db_xref="GeneID:5649608"
     mRNA            <45939..>47027
                     /locus_tag="LMJF_10_0120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681288.1"
                     /db_xref="GeneID:5649608"
     CDS             45939..47027
                     /locus_tag="LMJF_10_0120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681340.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649608"
                     /db_xref="InterPro:IPR007557"
                     /db_xref="UniProtKB/TrEMBL:Q4QHK8"
                     /translation="MNQMHELSHGVSAMPFSKTKRHNPYASKVLAPEDSVEFNSMLNS
                     PLSTHQSPLNWEARAFDPTFMYSNVSTPYLTQSLASLSMDLQVRRSLFGDSPTALTGK
                     SPSDASTDLGAGRAPVAVAPVMRSSVTAPLKKTLGKMYVGGRPVVVPRHDNEVTVQLR
                     HSEATFVIPDIYSLMALEQETRDVVGLPVIVEGDRGEDFGVISGMAKMEAATVTAAPS
                     PKTEEEAASRGSPSCAAKPLLKVLRVASALEVQNSEALPQREAEALEYCQACLQEVQL
                     SVPITIEGVVFQFDRKKLTVRYTSDAYVDFNDLTRMLHKKYNCRIWMDQLNRDTVNGA
                     EKRGRRGEHGGKKSNPHNRGAAKRREQQ"
     gene            <53016..>55223
                     /locus_tag="LMJF_10_0130"
                     /db_xref="GeneID:5649609"
     mRNA            <53016..>55223
                     /locus_tag="LMJF_10_0130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681289.1"
                     /db_xref="GeneID:5649609"
     CDS             53016..55223
                     /locus_tag="LMJF_10_0130"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681341.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649609"
                     /db_xref="UniProtKB/TrEMBL:Q4QHK7"
                     /translation="MPRDTHVLRFKVLTVECAALPDGQQYTVMYHRGNSNRSTPCYTA
                     QGGVINFASMPEGAAVVHFKAGHGGGRFAPKYIRFMIEEYTRGMPRRLVGETEADCTQ
                     VLKDYGASGSGILTVVFRLYGTTAKMRIAVLVYPEHAPPLSFDGLIDPSEVAAPLPTQ
                     AVKVMSRGEAMMILMGLETLLERRRAMKAEGQSLPQSREEKKLAELEKRRKALVGSEG
                     LATEVIKTRCEEVVAVQYTALARKHRNNFIGQTAAYLREMAMLAGEDFIGDDGDSSGD
                     TVLEQLNRVNRSIEEVEMQVKKLEEEQAALRRIQHKVDVMAELTVSLDKVAALQQKMQ
                     VLKESRTALTEAMKKQAAKKNTPLAREVTAINTRIAALNAEQQQMAPRIQHMVAVAAS
                     HVVKWARSKNPPELDTKSCIDSLHETGGNARNPVDDLFSDAGKPKTSKEQSMLDDVQR
                     KQVVEALKGLETTTAPLSTRSPTSASSSSGHRTPRDLFADAGLPSMGDFSDTKPKEEE
                     TATKRKGDTSTTPLHEDPLKPSGLGVDMFSAKPAPAAASNVPAGLPSMNDFMRSSTAS
                     RQQSAQPTFDFGSILQTSSVSPQMGGGFVLEPQPSEAAASSFAAAAPSAVSGAYQTKD
                     YPYYDEMDDFTVPPDAADSKNYGAVEITGGIFSFQDDTSSPAYVAPRPTFDFGPSSGG
                     DDRPSGVGVTVSPAETFSFGGGAADELSTNNPRNSSDNPYTGITNLPTYNFSS"
     gene            <57228..>59444
                     /locus_tag="LMJF_10_0140"
                     /db_xref="GeneID:5649610"
     mRNA            <57228..>59444
                     /locus_tag="LMJF_10_0140"
                     /product="putative DEAD/DEAH box helicase"
                     /transcript_id="XM_001681290.1"
                     /db_xref="GeneID:5649610"
     CDS             57228..59444
                     /locus_tag="LMJF_10_0140"
                     /codon_start=1
                     /product="putative DEAD/DEAH box helicase"
                     /protein_id="XP_001681342.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649610"
                     /db_xref="GOA:Q4QHK6"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QHK6"
                     /translation="MSGMAASNVLPRGSSATDDLAPSEVDSSYTHPLEVSGTSFKLYG
                     ESTTYTKEDAGHIFSSAKMHSYDPAILFNDLRQEGHQGLLNPTGGLGAGRSGDSPLAA
                     DDPETAARATEEEESDAVMRSGRNKQGAAGAAAMAAAMLDSRRAAEGIAMVPGHPLPV
                     VFPRSDGLSPAPRVVKKLASGGLNEAHAGPQARQTRQSSEEDVDAIMCGEVMESERHV
                     ESHSLQRSITWRVQVLDEHCKPTPIKHFQHFREAMDVLPARVMQGLSESGLTRPTLFQ
                     SAAIPQLMCGRDVVGIAPDGSGTTVAYALLSMAVLVKVKAAQEQKRLAKVVEEGTSSA
                     PLPPEPSEAPPSSSGAVVAHPIVVVLCTNRQTVLLTAAMYSSLGGEDVRLVAAYQSVD
                     ADDEDSQRSVIRRKKGCDVIVATPARLTALVREGHVALSRVHVLVVDRANHLLAVDPS
                     PNGRSALQHVEDIMHAVKENGVAHQFSLWCTELGLPIESLVRKYMSPLTVTVMATREE
                     HTNVNVREILYPLPSRDDRIKAIQQLYDQGTILKRDQVLVYCAYRETAEEVRRELIKA
                     LSAPSSMVQCVHSGLRCRKRNELLKAFQHGDIRILVATDVATKRLDVEELKHVIHYDL
                     PAFTEVYKQRVSQVDRSGRQGTSHTFLTPGDTRVPPIARFVEKQTDHALNDEIRKMIA
                     DIEAAAGEDSWATPVLRMHGHAVSNTKWRVRGRREIRQQVETLSGLVSESDETPVG"
     gene            <63097..>64212
                     /locus_tag="LMJF_10_0150"
                     /db_xref="GeneID:5649611"
     mRNA            <63097..>64212
                     /locus_tag="LMJF_10_0150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681291.1"
                     /db_xref="GeneID:5649611"
     CDS             63097..64212
                     /locus_tag="LMJF_10_0150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681343.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649611"
                     /db_xref="UniProtKB/TrEMBL:Q4QHK5"
                     /translation="MSDMDMNMRIHNVKYTSGLESGPFTSEGVLSTNADPAHGYEAST
                     TALGAHSTLFHALAVVEEDDDGENSNDVLLRLLNEVRAVESDGEDDEVQVIDKGSDEN
                     AAGVLALRHGEELAKPYMPPYTAVPRGGAAVIAGGFTVEGNASYSSAASLPPPPPPPP
                     PPPPPPAYSTPSMAPRSPYANCYSGIPHLSTTPGSKPPPPSFAEAMATAHGTPASLLG
                     RSVPSQECSPMLANYVPPMPAAPQETVLLRNSNGVFLLQPISKPTPPYTPPAGSTSPP
                     VSPLPRYSLPPAAASTLNTAAANGLLGSSMVQAGARASSITEPLHYAPFGPTGGSPYL
                     STTVPYSHDVGSVRGTPSLGTAPPPYACGAPRGPATR"
     gene            <68706..>70223
                     /locus_tag="LMJF_10_0160"
                     /db_xref="GeneID:5649612"
     mRNA            <68706..>70223
                     /locus_tag="LMJF_10_0160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681292.1"
                     /db_xref="GeneID:5649612"
     CDS             68706..70223
                     /locus_tag="LMJF_10_0160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681344.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649612"
                     /db_xref="UniProtKB/TrEMBL:Q4QHK4"
                     /translation="MTTEGNSASMSGPPPLYDFEAEAHQLTREQLEERVLQMRAANVV
                     LQTSVLRLREFLATLQEGMRVNYADLERRQESIANMLLRRLEATKRRRSKLVAHLRSV
                     EAEKTSQETKLRNTTQNINELSKHLKQEEQEIANRLQRRLERLHAQRKQLDHALEEQT
                     NSLQQLEQLVQEVEEMDQSDAAEASAGGVAAQSAALTSALSAALASSASSPSSGIFVP
                     VHERSSSRMSAASSTTATTTADVAYDPTSMIRYLEEEIAAAESLRTEALSKAEKYVAT
                     CERLERRLAREKQKRAEQHSRTQELRQQLQDASTAVNEKEAEQALTMEMEVDRHLNSS
                     RFGGDLISSASSTCATPQLRAVSAVASRGNSASPGISQPCPEPAVQDLEGRPQDPFML
                     PVSSACSAQASSTSHPDHFRGASGVSASMSGCTSLGNALAAAPAMEVLNRLSSSTPLN
                     APASRDETTISSEGSQHARLLLQDTSCVAAPRPVTPAEKTLPSASSMPAAQGPML"
     gene            <74079..>76103
                     /locus_tag="LMJF_10_0170"
                     /db_xref="GeneID:5649613"
     mRNA            <74079..>76103
                     /locus_tag="LMJF_10_0170"
                     /product="putative nucleoside phosphatase"
                     /transcript_id="XM_001681293.1"
                     /db_xref="GeneID:5649613"
     CDS             74079..76103
                     /locus_tag="LMJF_10_0170"
                     /EC_number="3.6.1.42"
                     /codon_start=1
                     /product="putative nucleoside phosphatase"
                     /protein_id="XP_001681345.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649613"
                     /db_xref="GOA:Q4QHK3"
                     /db_xref="InterPro:IPR000407"
                     /db_xref="UniProtKB/TrEMBL:Q4QHK3"
                     /translation="MSRVVLAFFAAVLFVVFLTAYEVGVGTANPLQSRHMQLTQNAVK
                     KSEENLVNCREVNTDLRSGGDVNVARAMAEMRRQREELMNIVALERERVVSARSLLQV
                     CEDELASDLSVLFGVADHNFTARLRSLEKKRKHLEGLHSMLNTDPFGAVQLRSSSEIR
                     ALQAALFHEMRASKKKAENGVASGAACAKSSVKYSVVFDIGSTGNRVHVYKYRVAPAT
                     RTAAAAGSELSDIDLVEELFELNHKALSELENSVQDAPEALWELFVKAKDFVPAELHA
                     CTAAEFKATAGLRMLGMEKANEILAGIRARYRNETFWLRGNASVRILDACEEGPMAWL
                     TVNYLLGAFSRGATATDSTVAVIDLGGGSTQIVFEPGESTFHGMRTDFRYAATLGSRS
                     VRAYQHSYEGYGLHAATKKLLYHIQGKSQEKPGGGTATNTAMTTTTTAPANGGDEVLP
                     VWKALRNLGADGRSERGDIVTKRAPPMPPPDAEAMEAFPCFAVGYEDPLGVKNVKRNN
                     AEEPVMPPNFQACANLFRDRLLKPVGLTCEAVNCGIAGVMQPPLTNFTGEIYAFSFIF
                     DLLVLANSSLVPAGAAVSKEKFEVKLPDLAKIAEGHCAAFSLTRIAEATAKGGLGSLK
                     PEYECMYYSYVYALLRYGYEVPEDRVLHVAKKIRGYETAWSLGASLLSLT"
     gene            <77974..>78690
                     /locus_tag="LMJF_10_0180"
                     /db_xref="GeneID:5649614"
     mRNA            <77974..>78690
                     /locus_tag="LMJF_10_0180"
                     /product="putative leucine-rich repeat protein"
                     /transcript_id="XM_001681294.1"
                     /db_xref="GeneID:5649614"
     CDS             77974..78690
                     /locus_tag="LMJF_10_0180"
                     /codon_start=1
                     /product="putative leucine-rich repeat protein"
                     /protein_id="XP_001681346.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649614"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="UniProtKB/TrEMBL:Q4QHK2"
                     /translation="MALVHTTYPQCLSLVEADTAEAEVQQALEDGANTLYFSHHFNYT
                     DVPPSIAALREQLEVLHIDNNYPFTTISPRVTALTNLRWLNASYCSLRSVDSSISRLS
                     KLERLTLNNNMLTWLPLDVWQLKALEELHIDNNQLNVLPGCLLFLPRLRVLTLENNPL
                     YTHEEVNGAAAATYIPVQCSVDCSACCIRSRNYKVFVTFHTIVGHSDVPFVHVVCSDE
                     CAVHVRSRLEAYDRAHANQP"
     gene            <79906..>80481
                     /locus_tag="LMJF_10_0185"
                     /db_xref="GeneID:5649615"
     mRNA            <79906..>80481
                     /locus_tag="LMJF_10_0185"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681295.1"
                     /db_xref="GeneID:5649615"
     CDS             79906..80481
                     /locus_tag="LMJF_10_0185"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681347.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0185"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0185"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649615"
                     /db_xref="UniProtKB/TrEMBL:Q4QHK1"
                     /translation="MRGTAARTQRESRNDEEGVGEEEGGACMMPGVEQAHVQHRPKRI
                     HERVLWTGWWFAALLPFLKMLDLCPSPGSFFVWLFVVTHHFRWRDRLFCVQWCLHEGV
                     AALSTRPPLLPPHTRTHTHTHRGERTYARTVVGSDAPKKRNAQTKRDLRDHTKAIRPV
                     VVVPARLCDAISRVLLSSEGIRRGSAGLLCA"
     gene            <80849..>82852
                     /locus_tag="LMJF_10_0190"
                     /db_xref="GeneID:5649616"
     mRNA            <80849..>82852
                     /locus_tag="LMJF_10_0190"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681296.1"
                     /db_xref="GeneID:5649616"
     CDS             80849..82852
                     /locus_tag="LMJF_10_0190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681348.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649616"
                     /db_xref="InterPro:IPR001478"
                     /db_xref="UniProtKB/TrEMBL:Q4QHK0"
                     /translation="MSAPLTEHNLFSALREYASRLEVQYMIEEEVKKFQEKVLPRVLS
                     EAFATASYAAAAESTASGDAAGAASRTVSSSPPSNTAAPSHATATPNSDWVRTFLKAH
                     VDDVLSRQLSPMIVREVQRQLRSVNGSALAPSSSSGSQPCGESSVPAAAARARAGLPP
                     LPPSPRPSRSPPCETTPVLAGRSTPEYRMDGNSDLTMLASAADDEGLRQRKQILNAIA
                     DIEHQLQDAQRELDEVVHQQRLSRRRFEYLCETLQGMGLSPAAENTPSSLCVALEQAL
                     DDRKADVVRARLAAILQGLLPPPTEPHSGKGAEIRNEAALTCGSSPSLAPQDGRLLSA
                     SLASTKSYAVQSSGHDTPPQLLDRSSSCLRGDAQSPPLVTTGAVEAPPAQPPYSSGMP
                     SVNSTPASARTLTYARHGDASAAAAGAVRPAAAALSRAHRSITTRGTASSAAAAKAAS
                     LPPPPSALVTTNETAPPPLPVLRQPSRARPDADAVVSRPAPLPQACVDQSMRERAVRD
                     THAPTSMRMADSSATAATTTAPPASCTGPSNACFRSSLYHSVPSPSITSVASSREAAA
                     AGEAPRAVVLGIDAVDIPPGVLPGSLGRQGAVRVESVTPQQLAERAGVCCGDVLLSVA
                     NRPIGSCEQMQAALAAVRATQPSVALEVYRHTIQEIICVTLQL"
     gene            <83711..>84376
                     /locus_tag="LMJF_10_0195"
                     /db_xref="GeneID:5649617"
     mRNA            <83711..>84376
                     /locus_tag="LMJF_10_0195"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681297.1"
                     /db_xref="GeneID:5649617"
     CDS             83711..84376
                     /locus_tag="LMJF_10_0195"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681349.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0195"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0195"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649617"
                     /db_xref="InterPro:IPR003409"
                     /db_xref="UniProtKB/TrEMBL:Q4QHJ9"
                     /translation="MPAKKKEVKVDEPLFVDEEGSYVHEAEGARYKGGVRRYAPPGGT
                     DAGGTAAPPAKNSRSRSTSSPGKGGATPPPSAAAGAAASMAVVSDAPVFRHGRGVYTC
                     PSFTYAGDWVEDEMHGSGQLTFVESGNIYEGEFSHGCFSGQGTYQWRDGALYCGQWRS
                     NRMHGEGIYTDVQGHVWKGRYYNGTGPGLIRLYPTLERVDDAGPSSPGPDATNAAATV
                     ANS"
     gene            <85776..>86999
                     /locus_tag="LMJF_10_0200"
                     /db_xref="GeneID:5649618"
     mRNA            <85776..>86999
                     /locus_tag="LMJF_10_0200"
                     /product="putative mitogen-activated protein kinase"
                     /transcript_id="XM_001681298.1"
                     /db_xref="GeneID:5649618"
     CDS             85776..86999
                     /locus_tag="LMJF_10_0200"
                     /codon_start=1
                     /product="putative mitogen-activated protein kinase"
                     /protein_id="XP_001681350.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649618"
                     /db_xref="GOA:Q4QHJ8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="PDB:3PG1"
                     /db_xref="PDB:3UIB"
                     /db_xref="UniProtKB/TrEMBL:Q4QHJ8"
                     /translation="MQAKGEAAMRDLIAELHAMQSPYTVQRFISSGSYGAVCAGVDSE
                     GIPVAIKRVFNTVSDGRTVNILSDSFLCKRVLREIRLLNHFHHPNILGLRDIFVHFEE
                     PAMHKLYLVTELMRTDLAQVIHDQRIVISPQHIQYFMYHILLGLHVLHEAGVVHRDLH
                     PGNILLADNNDITICDFNLAREDTADANKTHYVTHRWYRAPELVMQFKGFTKLVDMWS
                     AGCVMAEMFNRKALFRGSTFYNQLNKIVEVVGTPKIEDVVMFSSPSARDYLRNSLSNV
                     PARAWTAVVPTADPVALDLIAKMLEFNPQRRISTEQALRHPYFESLFDPLDLTEGLSE
                     RFHFDESVTDVYDMHKIFTAEVERFNDLRERREEVARERAVAAQQQGEQVLGTDHMPR
                     THSLMELAGSAPAPS"
     gene            <92707..>94128
                     /locus_tag="LMJF_10_0210"
                     /db_xref="GeneID:5649619"
     mRNA            <92707..>94128
                     /locus_tag="LMJF_10_0210"
                     /product="putative nucleolar protein"
                     /transcript_id="XM_001681299.1"
                     /db_xref="GeneID:5649619"
     CDS             92707..94128
                     /locus_tag="LMJF_10_0210"
                     /codon_start=1
                     /product="putative nucleolar protein"
                     /protein_id="XP_001681351.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649619"
                     /db_xref="InterPro:IPR002687"
                     /db_xref="InterPro:IPR012974"
                     /db_xref="InterPro:IPR012976"
                     /db_xref="UniProtKB/TrEMBL:Q4QHJ7"
                     /translation="MSRTLYTLYEAPTGYAIFKVRTTEEIGAEDVALQKELQRFSTFS
                     PWVKLVSFAPFESPENALEDAVCISENLMSTFLNNFLTAAFAKKVAKNEANWELGVQD
                     PKLGSAIHDELNIPVLCNETVAEISRCIRLHAEKLLPEHNEGDVPRAQCGLGHAFSRN
                     KVKFNVHRSDNMIIQASALMEHMDKGVNLLGMRVKEWYGWHFPELAKEVPEPLKYANV
                     ALLIGNRNSLEEAPEEDVKAQLGDILEGDEALAARVYEKAVTSMGGDMAEVDWDCIRT
                     FAKRVASLGQYRVALAQYLVDKMMLVAPNLTQLMGQTIGAKLISKAGSLTNLAKSPAS
                     TIQILGAEKALFRALKKKKGNTPKYGLIFHSSFIQRASKENRGKISRYLANKAALACR
                     IDCFMDAPPTVFGEKLREQVEARLNFFDTGNKPPSNKAAMAEALEQYQRILRKRNRKQ
                     ANEDTEETPKKKSRKVVAASESG"
     gene            <95385..>97523
                     /locus_tag="LMJF_10_0218"
                     /db_xref="GeneID:5649620"
     mRNA            <95385..>97523
                     /locus_tag="LMJF_10_0218"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681300.1"
                     /db_xref="GeneID:5649620"
     CDS             95385..97523
                     /locus_tag="LMJF_10_0218"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681352.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0218"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0218"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649620"
                     /db_xref="UniProtKB/TrEMBL:Q4QHJ6"
                     /translation="MLRTSYLLRPTGHDGAAAAAPTEQLSDVYLCASSPPVIEEWVGW
                     PDAPCVMAGSIRYFIDPRGALSPCAPAESSTPRAGGTKVPRTAEAKSSPNSPPELSSA
                     VPLDGLCRAYEAADGRSGSAFLQVYSVGAHGLLSPEAKAVITGCTMAALRSRLSHLLG
                     LLPHERLNGADSALGMSAVAVLNRYCRATAALPPPSPSAMQPRCGTDTDGGGMRGRGW
                     VVTWALELVLCVAASRIVAGPPLATACPPLCVSDCGDVIMASLHFGLGVRLQRDAVAH
                     HDERTIASSTPLTSAAERCPRYAALSVQLTECTPASSHPLDVRCAVDVTRVIYVNHIR
                     SAQAHAEDGTDAFQRLARCEGGVSDPLSVATARDAWAEALQSYQASAIASQGGVLFVL
                     THDLSVQSGPAALLPLTVREERSRSHAAEMSHDVAFPPALRDHVLASVRVRSAPVYFN
                     HILLCQAWSSDDVVAEAHARHWAEKLANDGALAPARVAVEWRASLLVSRAKGGAAVTS
                     DAGGSQTLAPTPLQWVLYTARRQLVVAVANRSQVVLTGRRRGLDRTAAEATTKAAQFS
                     PSALRALAEQCVKALPVARGLLGWHCPWPVPSCLQNTDTCTAIPSAAAVEEVLWTLRM
                     LGKLRWRAAQLYEAAGDSAEQHRQLRALRADVQRWSSRRRARTLAADGTTLACEATAW
                     TPTVEDVVCHVDDGDWGALTKELSSMLPPA"
     gene            <98306..>99136
                     /locus_tag="LMJF_10_0219"
                     /db_xref="GeneID:5649621"
     mRNA            <98306..>99136
                     /locus_tag="LMJF_10_0219"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681301.1"
                     /db_xref="GeneID:5649621"
     CDS             98306..99136
                     /locus_tag="LMJF_10_0219"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681353.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0219"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0219"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649621"
                     /db_xref="UniProtKB/TrEMBL:Q4QHJ5"
                     /translation="MTTICKLTVVAAVVAATVLLAATNATALAGQMCSDPTNPLASID
                     YSDAAVQACVVARCTTTLNVTPTITADGFCDGVATSESSVPCNTLEVGYNAYYACLVR
                     ALQGTNTTGLAEFGAAAKEFFSTPGFPYRLSLLGCYACNHYRLTVFPSLGSKCSNWTC
                     ATVSSQSPSAPAYGQPDEGYNHRLCSTGCITGIIMIPFTVVTCAIFFACGCCWPSPSL
                     KTTYEAMLQEERRKHRRHPKAEDDDSHGVGNGCYSLAHEPAPVSNQRNHPEVEGQHFV
                     "
     gene            <102781..>104253
                     /locus_tag="LMJF_10_0220"
                     /db_xref="GeneID:5649622"
     mRNA            <102781..>104253
                     /locus_tag="LMJF_10_0220"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681302.1"
                     /db_xref="GeneID:5649622"
     CDS             102781..104253
                     /locus_tag="LMJF_10_0220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681354.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649622"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4QHJ4"
                     /translation="MSYRARQSEFPNWSPQEEGVATNRTSASVTDDDLRRDFDSEVLE
                     LGHDKSLSRKERAARKKELLKRQAVVEEERRRRAIVALEAMLPRPDWYSSDDEDEFTQ
                     DGVEAQKISELTTQPEGGAGLVFCVVYTVLSAAAFVCHLTSSCPIPWMRGESGRKYGV
                     WRATGGGQPDLEVSDIHDCSYEMQSWKAAAAMSVLATVTSFGAMISGVLLCVNKGHMG
                     ASFILSFYSFFFSLVSWALVVALYHSFRCGKGTFAGGVAHLDAGVALMLIGWVMHIVA
                     FTVLGVHFVKYWTRSIDSGKTRAVRFIYVAVGVATIFLYSVGQAYTMWGKAFPQVEAS
                     VSLWHVRIYDRKTRLSTFLSRSTYKCPAITHRMKAAAAFMIMSIIWLFFAVVLGTGAC
                     YKSQYIKISIVFGYASCIFALTAWITLLVTWNSRLCTGATPSGQSSWTDMGYNGIPSG
                     IQNAQINFSGYSLREGFGLIVGGWAISTVALIFNTVLWDI"
     gene            <107894..>109150
                     /locus_tag="LMJF_10_0230"
                     /db_xref="GeneID:5649623"
     mRNA            <107894..>109150
                     /locus_tag="LMJF_10_0230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681303.1"
                     /db_xref="GeneID:5649623"
     CDS             107894..109150
                     /locus_tag="LMJF_10_0230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681355.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649623"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4QHJ3"
                     /translation="MAASYHREVRAETELVDQQPIERFSPDPNNVSLTSSQADAKALD
                     EAAGVDLRAVPEEHSGKCVMISWILFSSVSFIFMLAASLPVPWLKDGHGRKWTVWRDV
                     NGTPWSKIECDHKRQLFQAMEAFTIVGCLLSLGSLVAGALQMMGRGHLGVMMLFGFLT
                     VMVSLTDWALIVNQYHKHNCAGDQVYAAGINRLDAGFGLVFISFTLMLFGIITLARWM
                     NESLSLSELHRTKYHSSALMSSFISGCVLTIATVGTAQNMWEHYDRTTSLKITYWGVE
                     IYHRNESLSENWPLSSYHCPQLTLHMRAAAVLSIISDAFLFPTFLFSVAAVYSRPCKW
                     VTVGFGAVSWTLLLACSAITIAARYKTFCPSGVVPPSTAIYGAPLDTVEQRVNFKGFV
                     ITDGLGMIISAWCITTANLIYLVVKG"
     gene            <111100..>113280
                     /locus_tag="LMJF_10_0240"
                     /db_xref="GeneID:5649624"
     mRNA            <111100..>113280
                     /locus_tag="LMJF_10_0240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681304.1"
                     /db_xref="GeneID:5649624"
     CDS             111100..113280
                     /locus_tag="LMJF_10_0240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681356.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649624"
                     /db_xref="UniProtKB/TrEMBL:Q4QHJ2"
                     /translation="MTSLTGATGPAAAVAPFSEENAIVLDKWLYDVCGVDDLQFPSHR
                     RAQFARYVERLPRVAKTKHFVANTFDYPSRSGTREVLVLQTMLEALALHTQAAVRETE
                     QVQNNALQVRRVLEERTMGASAIVEEEKPHAVSGAAAAVERRKGKGAPAAPSATLAPS
                     YASSPQGQGYVPFDSAAAASDNGAATPARSAETTPKPQQAGDEAVSEDGDASAAQEPF
                     SAAARAARPAGYEKKKALSLRYISAIQTKTQDMSRQRAEMEQRHARLLADKEQLDKEY
                     EALQTTEELVVARHQEAESRKNEETLLLSEEAAMYAAEEAAFDMAWAECAAMLDGQPA
                     AACSTGEPGGRAEGPPSTSPRPHVPSLSPPSYLSSASAHPLPAPSSSSRSLSGEDPVD
                     VAAVAPPDTEPATVAAANQEDSAGDHPGTLSGGNPSGDSSSTAQPPPHQQTLEMLRHR
                     LSEIGARATNYRRQLLNEGHMHLQRFLQSQQRLKDWQGMTAQLRRTHHQLRGQVDVIH
                     TVLSDTASRLEKSGTTAQRTSYGEQLARLNALLKERSYETLQYYVGSREDAEMDMLLD
                     ASADEELRKLQRPSPTSTLAGGDLTPARAGSASASNMTTPTCQSAAASSSHSSDKVLP
                     PSGSWRTPVRQAASNGTAAAATLSSGTGIQSSVDSSHRHRSRYELVRHLQRWEAVLLA
                     ERLAILKAAHMVPGPNSGTGANTKQANGFSARHAYEELRALLLQ"
     gene            <114346..>115125
                     /locus_tag="LMJF_10_0250"
                     /db_xref="GeneID:5649625"
     mRNA            <114346..>115125
                     /locus_tag="LMJF_10_0250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681305.1"
                     /db_xref="GeneID:5649625"
     CDS             114346..115125
                     /locus_tag="LMJF_10_0250"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681357.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649625"
                     /db_xref="GOA:Q4QHJ1"
                     /db_xref="InterPro:IPR001533"
                     /db_xref="UniProtKB/TrEMBL:Q4QHJ1"
                     /translation="MRQRSSFSAVSSAAMFKNTLTTQRAQKGDYGFNVFHNSNPQHGG
                     SYARHERRMREDEVEDFLKSVKHWRPLHEDVADGDLVDDAQSSSSTSAPAAGPPMPRL
                     ARMGEEAIMRTFQFETFREAYLFMGRVWAFCYGSDKYPHVTWEGTALTVYLYSSSFRG
                     LSKREARVAAFLNDQYNMLRKSKWQQRRIVDGIVRQSAVEELLGEEVAAHLAHRETLR
                     TAPLQEVQDGPRSWRSAIGSPLRSPNSGSDGAGSSMGVRES"
     gene            <115883..>116272
                     /locus_tag="LMJF_10_0260"
                     /db_xref="GeneID:5649626"
     mRNA            <115883..>116272
                     /locus_tag="LMJF_10_0260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681306.1"
                     /db_xref="GeneID:5649626"
     CDS             115883..116272
                     /locus_tag="LMJF_10_0260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681358.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649626"
                     /db_xref="InterPro:IPR013714"
                     /db_xref="UniProtKB/TrEMBL:Q4QHJ0"
                     /translation="MSRPNFDELLHSPPIPFTLKILGILGAFGCGTYVLFLFMIHHYH
                     SIRSFAALLYLLTFSIIIPSAESGLLNSTMLAVFARFLISPMGRAFLYVFMGGVILGI
                     GIGGWVVGVYLFVVAILNVIAGCFQYA"
     gene            <118346..>121141
                     /locus_tag="LMJF_10_0270"
                     /db_xref="GeneID:5649627"
     mRNA            <118346..>121141
                     /locus_tag="LMJF_10_0270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681307.1"
                     /db_xref="GeneID:5649627"
     CDS             118346..121141
                     /locus_tag="LMJF_10_0270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681359.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649627"
                     /db_xref="GOA:Q4QHI9"
                     /db_xref="InterPro:IPR006055"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013520"
                     /db_xref="UniProtKB/TrEMBL:Q4QHI9"
                     /translation="MRRASSPPATPAIAGATASVLTKDVKKKRRHKKARQDEDAAREA
                     TRPPPQLPQLRQPHLLHGAPAAPSLLQQRFSEVELQFQLEQDRAQRSALAPRDIANLI
                     LWSVPAPVPIIESPRIFFIKNKSRVRNTVVIYVNGWSYDEMLCTGVGLPRAHGEAQCG
                     GAPRERAAPSPSPDAMGNATGHTAESAAPAASATSGDDDSAAHWNERLCSALLSPVRE
                     GRCWARPGRGTGCAGGVQYCPLFIPSTCNELEKDLWWRNDAPRRPGPSSAASSSALNR
                     WGPNRSRGGEGGDRDVADLHLTSPAVKDARGVGSMFQQAMQVHAKDSGVGDCAASAER
                     SPKAASAPAADSPTIASDAFQQHQHLWQDRTLLQQYALHLPEHTAEMQELGFTVAPPQ
                     ESAAAVHADGSSAEADVKETALPKGNEEGGAQDVWVSFAAPSTTATTDSTASTTPLVT
                     VVALDCEMVEVEGGESALARATLIDVLTGKVVLDLLVKPHQRITDYRTRFSGIDAATL
                     QPVSTTLADCQHALQRIIDTHTFVVGHSLENDFKACKCVPNCYVLDTTWLFPHPAGLP
                     YKNALRFLAQRYLQRRIQHGSHDSVIDALVSAELTQLKLINGPSFGMRPRVSVLGLIT
                     EAAGSAPDGVSAGEGPEKTTEAGFDAQLHLFDDAVTLTSLLPAPQKYDAASAAQAEAS
                     GGTVSGAPRSSSASSGRIDAVPVRHDEDGMRKAVRALQRRASQQAREVAVAANDMDGE
                     TATTQRPSFSLFWVQLTQAKVDVVLPPAQPPTPSAEVEAEEESETAERAAHAGHGGSR
                     DTASAHTAAQFRRVHDTNRRVLRIIEACPDETLIVVLAGRCDGEAGGNHFSRAQGTCF
                     AFVKDSSAPGPRPEELTKLTDENNVSALPRASAGGAAVDNIPLQDASALSTAAVPHSV
                     DRETAMVEHTPLACQQQ"
     gene            <122082..>129119
                     /locus_tag="LMJF_10_0280"
                     /db_xref="GeneID:5649628"
     mRNA            <122082..>129119
                     /locus_tag="LMJF_10_0280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681308.1"
                     /db_xref="GeneID:5649628"
     CDS             122082..129119
                     /locus_tag="LMJF_10_0280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681360.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649628"
                     /db_xref="UniProtKB/TrEMBL:Q4QHI8"
                     /translation="MLGNRPPRGWAASPTAIIASSSDGATVNVGKAYALSLHVEKTAA
                     GSPLPLPAITSLGSGAASRGGGKDSAVHGSDGAVARGPASPFPTSPSVSVGLRTAKAA
                     ASGGGFSSSAATSTLPLPRSDEEVTQYVLYDGLPQIGPAARRAQKRQSEAYYQFQHRI
                     HERTESAHALVLSANPLSLSVMASQLRMYRWRVTQAQTLTEATSILQDYVIDTARHGY
                     RVRRRAPPPFGQSRYAHGRGRAALKRRAQAELERLSGVQPAAENSAGVSIDGARVGRG
                     ISAAPRHPKDRGASDSRAAEVAEGEEEEELDEAAFEDDAESALPPPPPDTLPRLVLVD
                     TFTHEDLGDIARHVRFVDQEHGLEMLLVLLLPGEAGTMTASMQGAGCVITPTHQMTME
                     DAYAVGYDLVLAHNMDHLLVDFFTSEFVSSVGRWRNDVRSKAAVGNYMSLRSVLLGGL
                     DTAALQRLIWDDRIDDTGVLELLGAQSLSTQGGTQRYGAATRHLLQQQGTAAEAEAPA
                     KRYGSGASRSSRGDSGESDADLAQSVNESILLTGVPRLRNRPTSVAHFGVRLPAQQCA
                     VHEPLSSFSTKRDVFSSVMAQPAGARQSQRRRHGQASGAKDLECDADNNDDALKHQQR
                     LLQGALETELGRLLAENEGKQASIDAMQEEVERLQRTVTVLRRHQRGAPSASGDGSNA
                     NQISEPSESGSMIHLSKQQQIFILKERLEAANDRIAALLRGGRLSGVPPSPRRRGGGR
                     GGSLSRRPRGSSASGGPRTPTKTPSPTAYSAFLTKVTVQEAEQMAALDSDANASLDQL
                     ELHRQELIAAANNTAGQTAAGQKQRREREAVNQVIHSLQLELQQLQGRLDDTRPGSSR
                     AEAEGCEGLQARMASRLQSALEVMEAQKVRIRHLEELRQMDQLLHTTFSREGSKGRKK
                     GAGRSTESISGVSGGSDEADHEHGSSSFSADEEGDAFASARGTARGRRVRQARAKGKK
                     AAKSRFGVELVSAGKKGAAGGGGGVAPSRGVTKGGLDAAEDAESDSAQKMDMEEVAAR
                     RTEAAVHDAVTSLQRTHRRQLAALVQTCKMQLARVALKLQKPSTSAYTALLREELSRA
                     LCEQRAAWMRLRCTLRDLTPDQYDATLAERASSSAAETPLLISLRVTPTPEPEATDSG
                     AALRARDDANMVPLGAVTDPHVQSTAANIAREYAAYGLRIAYVSSELQRVEQHMMDSS
                     RHLPEFAPAAMPAVADTPPEQQLLSVYQAAKARVQETVDTCGPIQEYLEAVQAELAIE
                     QQFRPWCDVNSEQLFSAASTALVPSTLSIGASMSGSAAAYDHTLHNTHSSTVSTTADQ
                     LVLLADVDASMRDVADVYATMLRALTPKGSEAAMSISTTSSGSISRHHASPPARVSKK
                     RDSKKRRQSAVSPTQPKPAALQRRFVAKAADKRSSFSPDESDSLLPLRGPAGFTVEEA
                     LDALPIQPDDVACYQGQLGAIDISEGVHSAAQQRLYKFILRAYQQHCIHPVHMAAVES
                     ALSLPLLGDRGSGISNDVSRESSASASEALVDLMSAQATAVHAQHREIMALLELIAPT
                     MTQAVRTLTKGLQRVQHLLDHEDDSAAFAEAFNGTGPPCTSPVFLTAVDAAVLGCVVD
                     ELRWREWRYSLLQSKKDGTDSSDPAPFPTAGATPSELLRALILARRGRSGGGRRATPT
                     ADGGADLEDARTIGHYAAFCAARERAACNAYSNQGSSVPGPSESLSSEAEDLFHLTDA
                     PPMLVVPSKSRGIISALAATGGDNADVGLTVAHELAALFSTRRQQDAHGDDDKAAALL
                     EEIYLGDGEYGGAGVLGGDSNTEAMHSIRRELEYLQAAKQQRMWELMMRFELQKERCA
                     GKTDGSGRLVSKFGTASARGAEDRASLPSIDPDRLDFEVKSGSAAWYGMEAAKRVHNI
                     LRRRARPDQIIVGGGPHGGSVGIELSRRTAQPGSSTAGSSKTGNFGGAGAAPGCGVLG
                     QEDEGYVDSSADEAALFTLGPYASHQRSGCSTGRATPSTVRLPPLRQHLLSRAQQGRD
                     GLAGHGGNTTLMAGVGYLSPRDVISLNAYGSMTPGGAYDYAGATEPLHAAGSLTEQVL
                     AYREALMRSAGRVVPMPFTAYANGDPYCLPLSTWPASSGKVGAAGSGRYDPLDRQLPS
                     PVPLPDLTAWVYGVPEGYASSLLQQQHTGSHQRQNMALFMPRYGCSPLAEVEGRQRAC
                     MASAVPPSLSRGRSFPAGAPTYSTPAALAAQRLQAMLSVSMRDPSVAAVPAATEAATT
                     GSRGALPTTRGRAYPVHSRRSDGAATAQPRSPAPPLTKRALASASAGVDGAAPSSETD
                     GRTAGEGEVSEPNYESFVFDEKDLNPLAETLGPAKGSSS"
     gene            <130290..>131597
                     /locus_tag="LMJF_10_0290"
                     /db_xref="GeneID:5649629"
     mRNA            <130290..>131597
                     /locus_tag="LMJF_10_0290"
                     /product="putative isocitrate dehydrogenase [NADP]
                     mitochondrial precursor"
                     /transcript_id="XM_001681309.1"
                     /db_xref="GeneID:5649629"
     CDS             130290..131597
                     /locus_tag="LMJF_10_0290"
                     /EC_number="1.1.1.42"
                     /codon_start=1
                     /product="putative isocitrate dehydrogenase [NADP]
                     mitochondrial precursor"
                     /protein_id="XP_001681361.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649629"
                     /db_xref="GOA:Q4QHI7"
                     /db_xref="InterPro:IPR004790"
                     /db_xref="InterPro:IPR019818"
                     /db_xref="InterPro:IPR024084"
                     /db_xref="UniProtKB/TrEMBL:Q4QHI7"
                     /translation="MFRHVSAASASSLVAARSFSSTNVYLDKRIKVKNEVVDMDGDEM
                     TRIIWSFIKEKLILPYVDVPINYFDLSVTNRDATNDKVTVEAAEAVKKCNVGIKCATI
                     TPDEARVKEFNLKKMWKSPNGTIRNILGGTVFREPIIVSNIPRIVPQWHNPIVVGRHA
                     FGDQYKATDAVLKPGKLQLVHTPADGSAPTTLDVYDFKGEGVGLAMYNTKESIEGFAK
                     SCFQYALMRKYPLVLTTKNTILKKYDGMFLQTFQRMYDEQYKADFEKAGITYNHRLID
                     DQVAQMIKGEGGFVWACKNYDGDVQSDIVAQGFGSLGLMTSVLMCPDGKTIEAEAAHG
                     TVTRHYRQHQQGKETSTNSVASIYAWTRGLAHRGKLDGNSDLVKFSETLERVVVKAIE
                     DGHMTKDLALCVYGSSGVKREHYETTEQFLDSVDTALKKAMSA"
     gene            <134919..>137216
                     /locus_tag="LMJF_10_0300"
                     /db_xref="GeneID:5649630"
     mRNA            <134919..>137216
                     /locus_tag="LMJF_10_0300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681310.1"
                     /db_xref="GeneID:5649630"
     CDS             134919..137216
                     /locus_tag="LMJF_10_0300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681362.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649630"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="UniProtKB/TrEMBL:Q4QHI6"
                     /translation="MSTNAQELVRQLTENPEVLESMQHMISLLRANPPRISGSSNGGG
                     LGNVETNGPDRGAQQCVRPPRGGYGTDVDYGHHEPTARRKLHSSDGTGHSATSLSASS
                     LTQEAHSFYSDDRVGARTTVSGHNGATGGASSPTPTFATTGSRAAPQVVTAASRLAPR
                     RSSLLSAPREHRPATAPDEQLISAANKLTEAQRRIAELEKELQRTTQRVDELSNVVQR
                     QKDELQATKDRHTLEMEETRHSYNAVIHRKDEVQEEALRQLLKSRQLMVSAAKYEAVV
                     AAKKFPAQQLEKENNTGADDGMGSAKGLAGVQASSNPNEHGTHPGLAPSQTSVNARHS
                     STLGHGSGATAKYNRALKRDRQNDEEDFVDDAGVASGAHEPGEARYGEAAHQRPPMKR
                     TTLDTSHLQGSADRAVQGRRGVAATKAETSPAYITTPTPAGKASTALVDPRTQSRSAR
                     KRRTPRTPSRTNAERLAGSTAENRIRSQQRLPGTTSLKIESPTPVVSTAWTADRSLTG
                     SRTPPPSSPGMHTVSEAVTKHHQLHPQQHVHQAPYTRPPLMQRAAGRLPPAPHRTVAA
                     PTAVPNTRSGTSSIASGGPTRSPSPVNPKRGAMLPRRFIFTGLKDHEPQRLVSAIAAV
                     GDDAAALASDLDEPPPSSTTHIVLRGTPRSVKALCGVVSGKWLVSPEYVYNSQESGFW
                     LDELEEGGLRIFPPPLKCQRFLLTVEHPSIRAKLAQVIEYGGGEVLPSGSYKRGPSAG
                     DTVAQDVIVITSGDDLLRYATQDRV"
     gene            <139957..>142368
                     /locus_tag="LMJF_10_0310"
                     /db_xref="GeneID:5649631"
     mRNA            <139957..>142368
                     /locus_tag="LMJF_10_0310"
                     /product="putative protein transport protein Sec23"
                     /transcript_id="XM_001681311.1"
                     /db_xref="GeneID:5649631"
     CDS             139957..142368
                     /locus_tag="LMJF_10_0310"
                     /codon_start=1
                     /product="putative protein transport protein Sec23"
                     /protein_id="XP_001681363.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649631"
                     /db_xref="GOA:Q4QHI5"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR006895"
                     /db_xref="InterPro:IPR006896"
                     /db_xref="InterPro:IPR006900"
                     /db_xref="InterPro:IPR007123"
                     /db_xref="InterPro:IPR012990"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:Q4QHI5"
                     /translation="MVIPMSCMYTPLHPIEPSHLVLGATMEELCCANCGAFCSLHSQR
                     EMGKYWVCLSCKRRNSFQNNTAITEQHPALVYETVEFVLANPPTPVVAPPQPQPAPAF
                     IFVVDTCIPSGEMASLRTSLLESLQYLPRNALVGLISFGATVSVWELGASSGVAIRKC
                     YLLRGNTANPPDSLQSMFQVSENHPVRGRLLAPLCDVEGVLTSLIEELEEDGAAVPSS
                     KRPLRATSTALEATTYLMEALAPPQMTAQQQYVLYGKHVKTATAPGGNVKMGKILLFT
                     GGPCTRGPGAVVSTDKADMMRFHRDIIEGDTPYYEAAFNFYNALAPRLIAANTCLDVF
                     AQSLDQVGVMEMRRCIDNTGGTLIIEDETTDIMFLESLKRYWQRCDLRAGTERASAAA
                     PQGMSSSGVDGSYSSEDHRAHCGFAVRMEVNTSVGTLLRGALGPCNVDVEANKRGPTR
                     LTSPLEVGAGGTTRWCVSYLDKGMTLSFLFDTATASNQQSGAASAYEKRFIQFVTRYT
                     TPRGEQRVRVTSVVQPVAPPTAPPDYYTTAAAFDQTCAATIVARMAVSILEKHPGTWD
                     AAKRWLDTLLVRFVRRYSTFTPGQPNTLRLGPCLSLFPSFMYNLRRSEYFMVLNISPD
                     ETTFKRHWLLRESVDNCVLMIQPTLDSYDLANPFATPMQLDSSSLRHDNIVLMDAYFN
                     VHIMWGSIIYQWIEAAYHENPEYANFAELLEAAERDAQGILSNRYPYPRFSRTDADGS
                     EARHVKTRVNPATNYHNSDMQYGAGPNGAVEQADVIYTDDASIMTFMNSLKKAVVTSD
                     GKEEA"
     gene            <144072..>149957
                     /locus_tag="LMJF_10_0320"
                     /db_xref="GeneID:5649632"
     mRNA            <144072..>149957
                     /locus_tag="LMJF_10_0320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681312.1"
                     /db_xref="GeneID:5649632"
     CDS             144072..149957
                     /locus_tag="LMJF_10_0320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681364.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649632"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q4QHI4"
                     /translation="MSVNSSLTYALRCFYYACRTTLLFVVEMLLFLPSYYLVERHDAP
                     SAWLGRRGEAQVQPVLPAAYKYQKAEERDKSNYSESANIVPVGTGGPPLDSSAREVED
                     NRCILSRKSVSRIRSLHISTVSSSWWSPQVLRSVDPSSATHSPETPHLRQQKQHQSLL
                     RSFYGHPQAALPQSRYDGIGGDDDMNGSVGSWSNYTIGATPVAATLNRPFSLPIAEVS
                     GWRDGTSGGELIPISLQSSPMQRSQRLQGQRGAHQRPHGGGVDEEEAACTSFNGFLSA
                     TARDAADIEYQQPCVTDTFFDGLAVSVLVSAQEQQQQQDRLAAVRKRVGIAEAEGLFA
                     RLGHRQCGAASRRAAARTSSTPACVAAARERMRATVPVWCTVVFHSPTPQSSARGRVM
                     ENASSPFRGQYGFLPPWYAVHARAQLLLALVDPLLRIAAELLWCRGWGTLTASSAAQT
                     EALGEPGSIITPSATAASPEHQRLRQHCTRAPPLPPWPMRGSWQDAGVFLLGPLFLCF
                     RVLRSLFYAIVGPPGATAPLDYSTCMSASPTSRSAAGGGGAWHPFRCFETAVQARMDR
                     YTTDTRHIFEPLHKNATATTTTVSFAAATARAGSSITPAPHAFSKPTTSSAKAAGAAR
                     PQGHAASLPHPAFPASAPAPACRKSVGVYWLHGRRPPIWSAAPADDPSTTSAAQPPSP
                     APVVVLLLCPSLLQGSGLYQHTVTRLSCVCQLLTLAGAWQASFATDDAAADRMFLPSS
                     RGTATTRNATQNRDGSTDRENTVQIPAAGAEKAYKPVMLSTSSCEDGSIRGSGAEVNG
                     QPSPPATSSSLPSAARPAARPATQWYAAVPVVELRVPATSPERTDDVSMPPLTLKDVR
                     HIVERLRSNLESCTPPAANLPVPCASTATGRSARPDLFGHAPSPDAAAEVSADPRPRR
                     AVYIVAVGWSEAASPLLELAITQQQPQTSTGSGRSTEDENGGGSGEQSPARLDGLVCI
                     SHTLSSAFQLLPQQRAEGLALQRSTRATSSTTGFTRGVAHAGTSTASSGGALNTIVAP
                     AGSPPLLTARLQAASRMPRILSSLTTGPARLLVLLTRMQLIADALLAHRQHQEQWQGS
                     GLAAVGNARILRTAGELHYADVHAPRQPEYMAHKRAGAPPLQAGPEPMPDISFYHILH
                     VFREAREEVNRAQRGLDRATITWTHQQQQQQTRSAQRSSFLDCISSMSAGNLFALTSK
                     ATEGDVDPRITRAAAAAAQQHSQSTLPQSHSLSPSPASARTASVPGSMTNALRQHALS
                     TAPFSKLVRIISPPDLTASMPLMASSSSVAAVSDALGEANALAAPTATSPGRSGCVLS
                     SLTVDQDSLHSHDQTQTLSFSHHYSYGSPLIMHQDLVRESSALWGMPRLESVTDWEEL
                     AKSAIMVEAQQQQQRLEAANATANDLAPPLSLDPPTLLDCSGRRHFLSPSWAEGEGER
                     FSASDSLAATSSSFVGKPLRCARSHMSTEDVVASCTLQVLSPTARQVARLPGSGAVGT
                     PQTAAATRGVASACNRDKRSGLVSHAKEASTADREGALLVSAATMRPSLLHPDVTSPR
                     DSGDRGSAAPSFASEQLASEAFRSFDAAPAPSALVAASADDGAGNLCMVGAEGKGCSA
                     ASPNVLPSLKEAALYAPERSVKSPVSRYDAQHSLSQPSFSASTPLPQPQQPMPYPPPS
                     RLPALSSQAAALVELRVRSAQHAALIQRIRVPTLLVHASDDSVAPTSTLPFSLLQANP
                     WITTVLTRRGSHAVFMEGASEVWRRPRLVVTERARPADTTLTASSAAVAEGMVYWPGS
                     GLDEVGSARGARDGPHWKTPTAPSSPRGDKVVSPPAAATSQQSPALMAAAHSKMPSPW
                     AQNAKAKRVRSNGTSSSSTSVSNSCCTDDFDDDGDTVSSAIVEWLPVIDEDVDGKRHT
                     GKRQSTASLRRPPKEQQRLAAATTSTWWQVRIDGTTWLERLLFEYVEKVIVCPPAASS
                     PIG"
     gene            <152251..>153555
                     /locus_tag="LMJF_10_0330"
                     /db_xref="GeneID:5649633"
     mRNA            <152251..>153555
                     /locus_tag="LMJF_10_0330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681313.1"
                     /db_xref="GeneID:5649633"
     CDS             152251..153555
                     /locus_tag="LMJF_10_0330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681365.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649633"
                     /db_xref="UniProtKB/TrEMBL:Q4QHI3"
                     /translation="MGTTRASGPVVTSTCSAESGGRGITTTLCASFEFPLRLQSTDGV
                     AVAVAPSGDATFLQNILRDKTDWPAAQKHREQLSAVMPEMDVVGCYVVCASSRWTSTR
                     HPRGGDDRDGSQLSVGGAVKKAKGEAMAGADHIAAIANCVQQQLRSTSILPSTATGFV
                     LLVVYDKEVTSAAGDTDTAAPNPPHSPAAARLPFDCLYVPATTASDASPTEEVTVGPS
                     DMEWIALANETMMPAYHQSSTTTCSAAVKPGLLRRLCSAAYLTSEGPDSREPANTQTS
                     RMASSQNCRAAEELVGSLRLIMRVLVEMTASTLSPTGTAPDDVELLRTVATCLRNVPV
                     SHPSQPPGEPRAPSELPTEEMLSAILALEVQCALHMRSLSKAQQQLLSSSRSAMTAFH
                     SKACSPKAANPPPPLPSAEGWSTHERDKRSGVNTAVPGHGWV"
     gene            155128..157211
                     /locus_tag="LMJF_10_0350"
                     /pseudo
                     /db_xref="GeneID:12982598"
     misc_feature    155128..157211
                     /locus_tag="LMJF_10_0350"
                     /pseudo
                     /db_xref="GeneID:12982598"
     gene            <158843..>160840
                     /locus_tag="LMJF_10_0360"
                     /db_xref="GeneID:5649635"
     mRNA            <158843..>160840
                     /locus_tag="LMJF_10_0360"
                     /product="putative folate/biopterin transporter"
                     /transcript_id="XM_001681314.1"
                     /db_xref="GeneID:5649635"
     CDS             158843..160840
                     /locus_tag="LMJF_10_0360"
                     /codon_start=1
                     /product="putative folate/biopterin transporter"
                     /protein_id="XP_001681366.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649635"
                     /db_xref="InterPro:IPR004324"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q4QHI2"
                     /translation="MRPRRFVHPEAATLFSKWPWVRRVPIFGEAVEGYGPKVIVALGA
                     TNLLCRGLADRILTGQTYAMMMDRYGISVPRYQRLSTIATMGWSIKAFTAMLCDGFAF
                     LGYTKRWCMFISCVGGGAFALLYGLLPAKEASADVAATFIFLSTWGKANVDILSEGHY
                     SRLMRENPKPGPSMVSWIWFWIMVGAIIATVMNGPLADAGKPQISIFVSAALQAITCV
                     FYLFNWYGEKKNRVLRSEDALFILEETRKERERLGLEGVNDGTAGAQHGGAAKGKKSP
                     QHSHSDEDVEGAVRDALNDGQRDNGELVQDVYDDAYDDGEGVAEGDVYYGKPPVPCLF
                     GLFEANTEVISKNWKIFVYSVVMTCAVITMLCANMLADTLGLLVACVVVSTICCATSF
                     WALPLVIAKANVFGYLQQAVYINIASPLMTFYLNSYNCEENFPNFSYSFYNTVAGVIG
                     KFAALAGVSAFNCIFSKCSYRLTFCVTTFAQVLGGMTDIVIVKRWNLYIGIPDHAMYI
                     WGAAVVSEVCYMLGYMPMVVLLSRLCPRGSESVVYALMAGFASLGRSTSASLGAIIME
                     YGLPVFKTQDDGYRCGMENLAWLLFVCNVCAPPLVLPLTLLLPKARICDDVDIDGKAL
                     RRKVDAELMAVETGELQSPPSSAENARATKAQDDEATREKV"
     gene            <165305..>167092
                     /locus_tag="LMJF_10_0370"
                     /db_xref="GeneID:5649636"
     mRNA            <165305..>167092
                     /locus_tag="LMJF_10_0370"
                     /product="putative folate/biopterin transporter"
                     /transcript_id="XM_001681315.1"
                     /db_xref="GeneID:5649636"
     CDS             165305..167092
                     /locus_tag="LMJF_10_0370"
                     /codon_start=1
                     /product="putative folate/biopterin transporter"
                     /protein_id="XP_001681367.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649636"
                     /db_xref="InterPro:IPR004324"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q4QHI1"
                     /translation="MMIDRYGISVPRYQRLSSLSSMGWSIKAFTAMLCDGFAFLGYTK
                     RWYMFISCVGGGAFALIYGLLPAKEASADVACAFIFLSTWGKANVDILSEGHYSRLMR
                     ENPKPGPSMVSWIWFWIMVGAIIATVMNGPLADAGKPQISIFVSAALQAITCVFYLFN
                     WYGEKKNRVLRSEDALFILEETRKERERLGLEGVNDGTAGAQHGGAAKGKKSPQHSHS
                     DEDVEGAVRDALNDGQRDNGELVQDVYDDAYDDGEGVAEGDVYYGKPPVPCLFGLFEA
                     NTEVISKNWKIFVYSVVMTCAVITMLCANMLADTLGLLIACVVVSTICCATSFWALPL
                     VIAKANVFAYLQMAVYIRASSPLYAFYLNSNECPGNLPNFTYTFYGTVAGVIGNFAGL
                     VGVTLFNFLFAKHNYQVTFIATTIMQVMAALFDIIIVKRWNLHIGIPDHAMYIWGDAV
                     VAQIVYMLGFMPLVVMLSRLCPRGSESVVYALMAGFANLGQTTAASLGAIIMEYGWPV
                     FSDNDPCNYDNLPLLLFVTSVCTPLLVIPLSYLLPMARICDDIDIDGKVVRQKADEMC
                     VKVVAAAEENTSEHSAEASAAAAAPKDHA"
     gene            <171382..>173457
                     /locus_tag="LMJF_10_0380"
                     /db_xref="GeneID:5649637"
     mRNA            <171382..>173457
                     /locus_tag="LMJF_10_0380"
                     /product="putative folate/biopterin transporter"
                     /transcript_id="XM_001681316.1"
                     /db_xref="GeneID:5649637"
     CDS             171382..173457
                     /locus_tag="LMJF_10_0380"
                     /codon_start=1
                     /product="putative folate/biopterin transporter"
                     /protein_id="XP_001681368.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649637"
                     /db_xref="InterPro:IPR004324"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q4QHI0"
                     /translation="MSHKEAAPKREKDAASDAAGNDDKYIHPEAASLFARCPWARRIP
                     VFGEAVEGYGPKVIVALGGCYLLCKGVADQILRGQTYAMMMDRYGIDVARYQRLSPIS
                     SMGWSIKAFTAMLCDGFAFLGYTKRWYMFISCVGGGAFALIYGLLPAKEASADVACAF
                     IFLSCWGKANVDILSQGHYSRLMRQNPKPGPSMVSWIWFWIMTGSLIATVMNGPLADA
                     GKPQISIFVSAALQLITCVFYLFNWYGEKKNRVLRSEDALFILEETRKERERLGTELM
                     DDGTAGAQHGGAAKGKKSPQHSHSDEDVEGAVRDALNDGQRDNGELVQDVYDDAYDDG
                     EGVAEGDVYYGKPPVPCLFGLFEANTEVISKNWKIFVYSVVMTCAVITMLCANMLADT
                     LGLLIACVVVSTICCATSFWALPLVIAKANVFGYLQMAVSIRVSSPVNAFFLNNYQCP
                     GNLPNFTYTFYGTVAGVISSVVGMITVTLFNFLFAKHGYRLTFIVTTIMQVMGGVFDI
                     IIVKRWNLHIGIPDHAMYIWGDAVVGELVYMLGWMPMIVLLSRLCPRGSESVVYALMA
                     GFSNLGQTTAASLGAIIMEYGLPVFKTQDDGSRCNYDNLPLLLFLCSMCTPLLVIPLS
                     MILLPKARICDDIDVDGKVVRQAVDKQVAAAPLSSSDSDAVMAAEPLHGNKADERAPV
                     QSGRGQTQK"
     gene            <179695..>181821
                     /locus_tag="LMJF_10_0385"
                     /db_xref="GeneID:5649638"
     mRNA            <179695..>181821
                     /locus_tag="LMJF_10_0385"
                     /product="putative folate/biopterin transporter"
                     /transcript_id="XM_001681317.1"
                     /db_xref="GeneID:5649638"
     CDS             179695..181821
                     /locus_tag="LMJF_10_0385"
                     /codon_start=1
                     /product="putative folate/biopterin transporter"
                     /protein_id="XP_001681369.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0385"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0385"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649638"
                     /db_xref="InterPro:IPR004324"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q4QHH9"
                     /translation="MSYKEVAPKREKDAASDAAGIAAVPEAAAAGNDDKYIHPEAASL
                     FARCPCARRVPVFGDAVEGYGLKFIIALGASNLLCKGIADQILTGQTYAMMIDRYGID
                     VARYQRLSSLSSMGWSIKAFTAMLCDGFAFLGYTKRWYMFISCVGGGVFALLYGLLPA
                     KEASADVACAFIFLSCWGKANVDILSQGHYSRLMRENPKPGPALVSWIWLWIMTGSLI
                     ATVMNGPLADAGKPQISIFVSAALQAITCVFYLFNWYGEKKNRVLRSEDALFILEETR
                     KERERLGLEGVYDGTAGAQHGGAAKGKKSPQHSHSDEDVEGAVRDALNDGQRDNGELV
                     QDVYDDAYDDGEGVAEGDVYYGKPPVPCLFGLFEANTEVISKNWKIFVYSVVMTCAVI
                     TMLCANMLADTLGLLVACVVVSTICCTTSFWALPLVIAKANVFAYLDKAVSIRVGGPL
                     NAFYLNTYQCPGNLPNFTYTFYNTVAGVINTIVGMITVTLFNFLFAKHGYRLTFIVTT
                     IMQVMGGVFDIIIVKRWNLYIGIPDHAMYIWGDAVVGELVYMLGFMPQIVLLSRLCPR
                     GSESVVYALMAGFARLGRTTASSLGAILLEYGLPVFKTQDDGSRCNYDNLPLLLFVTS
                     MCTPLLAIPLSMILLPKARICDDIDVDGKVVRQAVDKQVAAAPLSSSDSDAVMAAEPL
                     HGNKADEREAARGETVQGKPAGGSEK"
     gene            <185774..>187972
                     /locus_tag="LMJF_10_0390"
                     /db_xref="GeneID:5649639"
     mRNA            <185774..>187972
                     /locus_tag="LMJF_10_0390"
                     /product="putative folate/biopterin transporter"
                     /transcript_id="XM_001681318.1"
                     /db_xref="GeneID:5649639"
     CDS             185774..187972
                     /locus_tag="LMJF_10_0390"
                     /codon_start=1
                     /product="putative folate/biopterin transporter"
                     /protein_id="XP_001681370.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649639"
                     /db_xref="InterPro:IPR004324"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q4QHH8"
                     /translation="MLEAPTHPHTAKASHTQPRHPEQSATLLAQQITTMSRKEVAPKR
                     EKDAASDAAGTAAVPEAAAAGNDDKYIHPEAASLFARCPWARRVPVFGDAVEGYGLKV
                     IVTLGTSYLLCKGIADQILYDQTYAMMIDRYGIDVARYQRLSPILFMGWSIKAFTAML
                     CDGFAFLGYTKRWYMFISCVGGGAFALIYGLLPAKEASADVACAFIFLSCWGKANVDI
                     LSQGHYSRLMRENPKPGPALVSWIWLWIMTGSLIATVMNGPLADAGKPQISIFVSAAL
                     QAITCVFYLFNWYGEKKNRVLRSEDALFILEETRKERERLGLEGVYDGTAGAQHGGAA
                     KGKKSPQHSHSDEDVEGAVRDALNDGQRDNGELVQDVYDDAYDDGEGVAEGDVYYGKP
                     PVPCLFGLFEANTEVISKNWKIFVYSVVMTCAVITMLCANMLADTLGLLVACVVVSTI
                     CCTTSFWALPLVIAKANVFAYLDKAVSIRVGGPLNAFYLNTYQCPGNLPNFTYTFYNT
                     VAGVISSAVGVITVTLFNFLFAKHGYCLTFIVTTIMQVMGGVFDIIIVKRWNLYIGIP
                     DHAMYIWGDAVVGELVYMLGFMPQIVLLSRLCPRGSESVVYALMAGFASLGQTTASSL
                     GAIIMEYGLPVFKTQDDGSRCNYDNLPLLLFLCSMCTPLLVIPLSMILLPKARICDDI
                     DVDGKVVRQAVDKQVAAAPLSSSDSDAVMAAEPLHGNKADEREAARGEAV"
     gene            <189722..>191863
                     /locus_tag="LMJF_10_0400"
                     /db_xref="GeneID:5649640"
     mRNA            <189722..>191863
                     /locus_tag="LMJF_10_0400"
                     /product="putative folate/biopterin transporter"
                     /transcript_id="XM_001681319.1"
                     /db_xref="GeneID:5649640"
     CDS             189722..191863
                     /locus_tag="LMJF_10_0400"
                     /codon_start=1
                     /product="putative folate/biopterin transporter"
                     /protein_id="XP_001681371.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649640"
                     /db_xref="InterPro:IPR004324"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q4QHH7"
                     /translation="MQDDFKSGSPRSPNQDAAAATPQRKPATNDGLQSPVDETARFVH
                     PEATSLFVKCPWMRHVPIFNEAVEGYGPKVVVSLGMCYLLCKGVADQLISYSRQPMFM
                     SRYGIDGQRFQRLAGISTMGWSIKAFTAMLCDGFAFLGYTKRWYMFISCVGGGVFALL
                     YGLLPARPASADIAAAFVFLCSYGKANVDILSEGHYSRLMRFNPQPGPALVSWIWLFV
                     MVGAIVAAAIQGPLSDQGKQQVGVFISAVLQCVTCVFFLFNWYGERKNRVERAADAAL
                     LYDEMRKERVALGLLPAQDNSHVRSGKDDVVALASGAPSGAAVGATKSLHPENHLSDE
                     GVLALQQRQREALEEEIRSDALVVGEEEDEELADDEYLPYEVPHPVPCLFGLFEMNKD
                     IIIRNWKIFVYSVVMTCSVVTMTCGSILADTLGLLIICVVISTICCATSFWALPLVIA
                     KANIFGYLQMTVYLQLPGALDSFYLADAECLPDGPHFTYTFYNTVAALIGNIGGLIGV
                     AAFNYIFSKHSYRLTFCITTIVQIIASIFDIIMVKRWNLYIGIPDHAMYICGDAVVYQ
                     VCYMLAWMPMIVLLSRLCPRGSESVVYALMAGFSNLGQTTSSSLGAIIMEYGWSITTT
                     PPCNFSNVPWLLLVGHILLPLLVIPLTLLIPKARICDDLDVDGKAVKGAVRHQVALEA
                     AQAEDGFEENTSSVEANDVATKDLQAERKGA"
     gene            <193936..>195705
                     /locus_tag="LMJF_10_0420"
                     /db_xref="GeneID:5649641"
     mRNA            <193936..>195705
                     /locus_tag="LMJF_10_0420"
                     /product="dihydroxyacetone kinase 1-like protein"
                     /transcript_id="XM_001681320.1"
                     /db_xref="GeneID:5649641"
     CDS             193936..195705
                     /locus_tag="LMJF_10_0420"
                     /EC_number="2.7.1.29"
                     /codon_start=1
                     /product="dihydroxyacetone kinase 1-like protein"
                     /protein_id="XP_001681372.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649641"
                     /db_xref="GOA:Q4QHH6"
                     /db_xref="InterPro:IPR004006"
                     /db_xref="InterPro:IPR004007"
                     /db_xref="UniProtKB/TrEMBL:Q4QHH6"
                     /translation="MSAVVPKFIDEPSSVVAVAVDGLCELNNHVKKIENTNVVVSCCL
                     DPTKVLLLCGGGSGHEPAHSGFVAEGWLSAAVCGSVFASPPTAHVSAGIEYLAKRQGP
                     DGPGILVIIKNYAGDILNFEYAVCQARAEGIQVETVLAADDAVFGTKDISKRRGVAGC
                     CLLYKILGAAAARGWSLTQLKALADRVSRNMRSIGASLSSCSLPGNPASSVIPSGTVE
                     VGLGIHGEKGLFQIPFQGAASLVHFLVGIVTGKGEAGASGKTTAIHSSVKALLLVNNL
                     GGTTDLEMSTLAHHALRELAAAQLTVVGVHSGRHMTSLDMHGFSLTLLIVEDERDLEF
                     MLNTNALQKPLMNFHAPQLSGATVPGPLTALQLARQEAEAAGRAAATPTGSPLCAAVQ
                     RVFEKLMTMEAYFNGLDAEVGDGDLGSGVHRSAIAVLEMLPYLPWEADMRRTFTLISK
                     AVADAFAGTSGPLYGALLIGGGNAAVQALKSGGAVEAVRAALAHGSHNVQELSGARRG
                     DRTMVDVLEGMRVCPAVAAAATTPELLKACHEAARAAADATAMLPAQLGRSRYMEGKE
                     IGKKDPGAELVVAWVEALASESS"
     gene            196736..198835
                     /locus_tag="LMJF_10_0425"
                     /pseudo
                     /db_xref="GeneID:12982599"
     misc_feature    196736..198835
                     /locus_tag="LMJF_10_0425"
                     /pseudo
                     /db_xref="GeneID:12982599"
     gene            <200806..>201291
                     /locus_tag="LMJF_10_0430"
                     /db_xref="GeneID:5649642"
     mRNA            <200806..>201291
                     /locus_tag="LMJF_10_0430"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681321.1"
                     /db_xref="GeneID:5649642"
     CDS             200806..201291
                     /locus_tag="LMJF_10_0430"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681373.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649642"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q4QHH5"
                     /translation="MPCPPGSGLAVALAISVGTILFLGGNFLYEWYTQRSEGVQAKEA
                     ETGYYRLPPPKDCAAACANAIEEDLLEQSLEFGGGLTRQDEYSSGRRSRRGMCVCCFE
                     RRQRFMFVLCRHICLCEPCLMQAARTYEETVLFGAFDGPVKMPCLVCRKVSYVVKIFA
                     S"
     gene            <204791..>205288
                     /locus_tag="LMJF_10_0440"
                     /db_xref="GeneID:5649643"
     mRNA            <204791..>205288
                     /locus_tag="LMJF_10_0440"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681322.1"
                     /db_xref="GeneID:5649643"
     CDS             204791..205288
                     /locus_tag="LMJF_10_0440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681374.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649643"
                     /db_xref="GOA:Q4QHH4"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q4QHH4"
                     /translation="MALAFSAGALVFAGASALYSWYTQETAQRDQGYYCLPPRDSDTA
                     GETGAAAAFKSSFLTASAAADGARETAAKDVPSHSSDALSEGCGVSFSGEVDGGHPCV
                     CCLERHQSFMFVQCRHICLCEPCLIQLGRAYEDNKLRAHFDGPVRMPCPVCRTVGYIV
                     KIFAS"
     gene            <211237..>211488
                     /locus_tag="LMJF_10_0450"
                     /db_xref="GeneID:5649644"
     mRNA            <211237..>211488
                     /locus_tag="LMJF_10_0450"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681323.1"
                     /db_xref="GeneID:5649644"
     CDS             211237..211488
                     /locus_tag="LMJF_10_0450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681375.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649644"
                     /db_xref="InterPro:IPR007513"
                     /db_xref="InterPro:IPR026939"
                     /db_xref="UniProtKB/TrEMBL:Q4QHH3"
                     /translation="MPSGNGCRANQRREREMKKTQGAGVKHTSEDMKKHEQSKNAIQC
                     KVCLQGFPRTVRRPELEQHFEKHAKIGKCFAEVFPDFTE"
     gene            <213345..>215153
                     /gene="GP63-1"
                     /locus_tag="LMJF_10_0460"
                     /db_xref="GeneID:5649645"
     mRNA            <213345..>215153
                     /gene="GP63-1"
                     /locus_tag="LMJF_10_0460"
                     /product="GP63, leishmanolysin"
                     /transcript_id="XM_001681324.1"
                     /db_xref="GeneID:5649645"
     CDS             213345..215153
                     /gene="GP63-1"
                     /locus_tag="LMJF_10_0460"
                     /EC_number="3.4.24.36"
                     /codon_start=1
                     /product="GP63, leishmanolysin"
                     /protein_id="XP_001681376.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649645"
                     /db_xref="GOA:Q4QHH2"
                     /db_xref="InterPro:IPR001577"
                     /db_xref="UniProtKB/TrEMBL:Q4QHH2"
                     /translation="MSVDSSSTHRRRCVAARLVRLAAAGAAVTVAVGTAAAWAHAGAL
                     QHRCVHDAMQARVRQSVADHHKAPGAVSAVGLPYVTLDAAHTAAAADPRPGSARSVVR
                     DVNWGALRIAVSTEDLTDPAYHCARVGQHVKDHAGAIVTCTAEDILTNEKRDILVKHL
                     IPQAVQLHTERLKVQQVQGKWKVTDMVGDICGDFKVPQAHITEGFSNTDFVMYVASVP
                     SEEGVLAWATTCQTFSDGHPAVGVINIPAANIASRYDQLVTRVVTHEMAHALGFSGPF
                     FKDARIVASVPNVRGKNFDVPVINSSTAVAKAREQYGCDTLEYLEVEDQGGAGSAGSH
                     IKMRNAQDELMAPAAAAGYYTALTMAIFQDLGFYQADFSKAEVMPWGQNAGCAFLTNK
                     CMEQSVTQWPAMFCNESEDAIRCPTSRLSLGACGVTRHPGLPPYWQYFTDPSLAGLSA
                     FMDYCPVVVPYSDGSCTQRASEAHASLLPFNVFSDAARCIDGAFRPKATDGIVKSYAG
                     LCANVQCDTATRTYSVQVHGSNDYTNCTPGLRVELSTVSNAFEGGGYITCPPYVEVCQ
                     GNVQAAKDGGNTAAGRRGPRAAATALLVAALLAVAL"
     gene            <216396..>218204
                     /gene="GP63-2"
                     /locus_tag="LMJF_10_0465"
                     /db_xref="GeneID:5649646"
     mRNA            <216396..>218204
                     /gene="GP63-2"
                     /locus_tag="LMJF_10_0465"
                     /product="GP63, leishmanolysin"
                     /transcript_id="XM_001681325.1"
                     /db_xref="GeneID:5649646"
     CDS             216396..218204
                     /gene="GP63-2"
                     /locus_tag="LMJF_10_0465"
                     /EC_number="3.4.24.36"
                     /codon_start=1
                     /product="GP63, leishmanolysin"
                     /protein_id="XP_001681377.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0465"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0465"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649646"
                     /db_xref="GOA:Q4QHH1"
                     /db_xref="InterPro:IPR001577"
                     /db_xref="UniProtKB/TrEMBL:Q4QHH1"
                     /translation="MSVDSSSTHRRRCVAARLVRLAAAGAAVTVAVGTAAAWAHAGAL
                     QHRCVHDAMQARVRQSVADHHKAPGAVSAVGLPYVTLDAAHTAAAADPRPGSARSVVR
                     DVNWGALRIAVSTEDLTDPAYHCARVGQHVKDHAGAIVTCTAEDILTNEKRDILVKHL
                     IPQAVQLHTERLKVQQVQGKWKVTDMVGDICGDFKVPQAHITEGFSNTDFVMYVASVP
                     SEEGVLAWATTCQTFSDGHPAVGVINIPAANIASRYDQLVTRVVTHEMAHALGFSGPF
                     FEDARIVASVPNVRGKNFDVPVINSSTAVAKAREQYGCDTLEYLEVEDQGGAGSAGSH
                     IKMRNAQDELMAPAAAAGYYTALTMAIFQDLGFYQADFSKAEVMPWGQNAGCAFLTNK
                     CMEQSVTQWPAMFCNESEDAIRCPTSRLSLGACGVTRHPGLPPYWQYFTDPSLAGLSA
                     FMDYCPVVVPYSDGSCTQRASEAHASLLPFNVFSDAARCIDGAFRPKATNGIVKSYAG
                     LCANVQCDTATRTYSVQVHGSNDYTNCTPGLRVELSTVSNAFEGGGYITCPPYVEVCQ
                     GNVQAAKDGGNTAAGRRGPRAAATALLVAALLTVAL"
     gene            <219443..>221377
                     /gene="GP63-3"
                     /locus_tag="LMJF_10_0470"
                     /db_xref="GeneID:5649647"
     mRNA            <219443..>221377
                     /gene="GP63-3"
                     /locus_tag="LMJF_10_0470"
                     /product="GP63, leishmanolysin"
                     /transcript_id="XM_001681326.1"
                     /db_xref="GeneID:5649647"
     CDS             219443..221377
                     /gene="GP63-3"
                     /locus_tag="LMJF_10_0470"
                     /EC_number="3.4.24.3"
                     /EC_number="3.4.24.36"
                     /codon_start=1
                     /product="GP63, leishmanolysin"
                     /protein_id="XP_001681378.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649647"
                     /db_xref="GOA:Q4QHH0"
                     /db_xref="InterPro:IPR001577"
                     /db_xref="UniProtKB/TrEMBL:Q4QHH0"
                     /translation="MSVDSSSTHRRRCVAARLVRLAAAGAAVTVAVGTAAAWAHAGAL
                     QHRCVHDAMQARVRQSVADHHKAPGAVSAVGLPYVTLDAAHTAAAADPRPGSARSVVR
                     DVNWGALRIAVSTEDLTDPAYHCARVGQRVNNHAGAIVTCTAEDILTNEKRNILVKYL
                     IPQAVQLHKERLKVQQVQGKWKVTDMVGEICGDFKVPQAHITEGFSNTDFVMYVASVP
                     SEEGVLAWATTCQTFSDGHPAVGVINIPAANIASRYDQLVTRVVTHEMAHALGFSGPF
                     FEDARIVANVSNVRGKNFDVPVINSSTAVAKAREQYGCDTLEYLEVEDQGGAGSAGSH
                     IKMRNAQDELMAPAAAAGYYTALTMAIFQDLGFYQADFSKAEVMPWGQNAGCAFLTNK
                     CMEQNITQWPAMFCNESEDAIRCPTSRLLLGTCGIREYELPLPRYWQYFTNASLGGYS
                     PFLDYCPFVIDYADGSCNQDASSAEEFFTAFNVFSDAARCIDGAFRPKATNGIVKSYA
                     GLCANVQCDTATRTYSVQVHGSNDYTNCTPGLRVELSTVSKTFEEGGYITCPPYVEVC
                     QGNVQAAKDFDGDSDSSSSSSDAADKAAIERWNERMAGLATAATVLLGVVLSLMALVV
                     VWLLLVSCPRWCCKVGGLPT"
     gene            <223401..>225209
                     /gene="GP63-4"
                     /locus_tag="LMJF_10_0480"
                     /db_xref="GeneID:5649648"
     mRNA            <223401..>225209
                     /gene="GP63-4"
                     /locus_tag="LMJF_10_0480"
                     /product="GP63, leishmanolysin"
                     /transcript_id="XM_001681327.1"
                     /db_xref="GeneID:5649648"
     CDS             223401..225209
                     /gene="GP63-4"
                     /locus_tag="LMJF_10_0480"
                     /EC_number="3.4.24.36"
                     /codon_start=1
                     /product="GP63, leishmanolysin"
                     /protein_id="XP_001681379.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649648"
                     /db_xref="GOA:Q4QHG9"
                     /db_xref="InterPro:IPR001577"
                     /db_xref="UniProtKB/TrEMBL:Q4QHG9"
                     /translation="MSVDSSSTHRRRCVAARLVRLAAAGAAVTVAVGTAAAWAHAGAL
                     QHRCVHDAMQARVRQSVADHHKAPGAVSAVGLPYVTLDAAHTAAAADPRPGSARSVVR
                     DVNWGALRIAVSTEDLTDPAYHCARVGQHVKDHAGAIVTCTAEDILTNEKRDILVKHL
                     IPQAVQLHTERLKVQQVQGKWKVTDMVGEICGDFKVPQAHITEGFSNTDFVMYVASVP
                     SEEGVLAWATTCQTFSDGHPAVGVINIPAANIASRYDQLVTRVVTHEMAHALGFSGPF
                     FEDARIVASVPNVRGKNFDVPVINSSTAVAKAREQYGCDTLEYLEMEDQGSAGSAGSH
                     IKMRNAQDELMAAASGAGYYTALTMAILQDLGFYQADFSKAEVMPWGQNAGCAFLTNK
                     CMEQNITQWPAMFCNESEDAIRCPTSRLSLGACGVTRHPGLPPYWQYFTDPSLAGVSA
                     FMDYCPVVVPYSDISCTQRASEAHASLLPFNVFSDAARCIDGAFRPKATNGIVKSYAG
                     LCANVQCDTATRTYSVQVHGSNDYTNCTPGLRVELSTVSNAFEGGGYITCPPYVEVCQ
                     GNVQAAKDGGNTAAGRRGPRAAATALLVAALLAVAL"
     gene            <227102..>228796
                     /locus_tag="LMJF_10_0483"
                     /db_xref="GeneID:5649649"
     mRNA            <227102..>228796
                     /locus_tag="LMJF_10_0483"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681328.1"
                     /db_xref="GeneID:5649649"
     CDS             227102..228796
                     /locus_tag="LMJF_10_0483"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681380.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0483"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0483"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649649"
                     /db_xref="GOA:Q4QHG8"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QHG8"
                     /translation="MRDGVHRFSPRSLARCVDCVEEGGDSAVRRHALIHGSSAVPATI
                     SLPSLSVSLWIRLLPGAPLTPSRQPPSRPRPTHHHYTHTHGHTQRRPRRRPFSCPPLL
                     RQRTPAQLMRTVHPSRGDGSERCACGASTYADLADACLMHRCRSCRRHCCSGIHSLSS
                     VLCLQRACLALSKAKYVARAGRQERQPKLHRRRAAVRGGGAAGGSLNTRAAAHAAADA
                     EGTHSVHRVYSNVRGAARHHVAVSDTAATGAQDRDAVLLHLFDSATAQDGHRPGRATE
                     GAAGGWTASPVVRGGVTRECTTTAVLTAQTLPPPRVPRPRFARPSAWSSEAALIRATA
                     ARISSTHGSRRTSSVMLDPTQAKAVDLAARGFNICVMGGAGMGRSQTLRAIVAALRSR
                     EVHESEETLRAVANAASSPQRGGSYRRADARGPNVARKEGQSGQRGFAGPSPPLHCKR
                     PPSRLPERSRATTSVSRSKPRSSSAACAAPALSNVCATAMAINTFAGIGLGRGSSEQL
                     LHTAQKNAEAAQRWRQCRVLLIDEVSTPEASLFEPLDYIARRVRRCAHVRPLAAFR"
     gene            <229825..>230670
                     /locus_tag="LMJF_10_0485"
                     /db_xref="GeneID:5649650"
     mRNA            <229825..>230670
                     /locus_tag="LMJF_10_0485"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681329.1"
                     /db_xref="GeneID:5649650"
     CDS             229825..230670
                     /locus_tag="LMJF_10_0485"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681381.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0485"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0485"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649650"
                     /db_xref="UniProtKB/TrEMBL:Q4QHG7"
                     /translation="MLTAEAMSRTHRSHSTVVAVPSHVSDALNDTQLVQLLTLKVGTR
                     VLLQCNVAPRYRLVNGSVGIFYRFPAPPLELPARVQALRRRRRWRMHPRQDVCHPPTP
                     DQGGAPPPPPWVQQLLRRGGFGCGSDVLACVETFQAMDVESLWRRVRKQLQRRHGKRD
                     GTPSQRCRNHREVTGTSCVDVGLGKAMQTDKGGTHSFAQPLQQQQQQLKRIPYGAFSP
                     SAHYAHFRRILCNVTPPGSSLAVTVCAFRRGPADQASAPLFARPYRGGTRARAAACGA
                     VSVAC"
     gene            <237335..>238501
                     /gene="MPK3"
                     /locus_tag="LMJF_10_0490"
                     /db_xref="GeneID:5649651"
     mRNA            <237335..>238501
                     /gene="MPK3"
                     /locus_tag="LMJF_10_0490"
                     /product="putative mitogen-activated protein kinase 3"
                     /transcript_id="XM_001681330.1"
                     /db_xref="GeneID:5649651"
     CDS             237335..238501
                     /gene="MPK3"
                     /locus_tag="LMJF_10_0490"
                     /EC_number="2.7.1.-"
                     /codon_start=1
                     /product="putative mitogen-activated protein kinase 3"
                     /protein_id="XP_001681382.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649651"
                     /db_xref="GOA:Q4QHG6"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR003527"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4QHG6"
                     /translation="MHKSNQELSVPKIVGDFKVYNVSGSPFEVPSKYTLLKILGMGAY
                     GIACSCLDGDTGEKVSIKKCRDVFRDVEDGKRVLREIDMMRFFHHENLLNVVNILPPL
                     KREYHSFEDVYVVTPLMDVDMNVVLRSRQVLEESHMQYFVYQILRGLKYLHSANVAHR
                     DLKPANLVTNISCELKIIDFGLSRSVDVPYSELTDYVITRWYRPPELLLENTNYSTAV
                     DIWSVGCIFAEMYNRKPVFPGRNTMDQLRMIAQHIGKPPASIVEHREALEKLNELPDG
                     SLNIPKLVPGLAGNTEGIDFLSKMWTLDPSKRPTAADMLAHPYLAHLHDEEDEPACSC
                     PFLWAHESTPMGVSELRRAFWADIVDYNPSLEQATPPVTTAGGSSSKNGSGHHH"
     gene            <243710..>263917
                     /locus_tag="LMJF_10_0500"
                     /db_xref="GeneID:5649652"
     mRNA            <243710..>263917
                     /locus_tag="LMJF_10_0500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681331.1"
                     /db_xref="GeneID:5649652"
     CDS             243710..263917
                     /locus_tag="LMJF_10_0500"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681383.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649652"
                     /db_xref="UniProtKB/TrEMBL:Q4QHG5"
                     /translation="MTPACIAITFTMTNVQQPSLYQTMQITLESNPLAQDPSITTSDL
                     VLFVPAADIKQCVYSSTPTESTPGYHAVTATGSGGFTGQLILAVTSTEFTTGTTYYPC
                     YLSRSEKSATIVRRGYVSPGSDDTLEVLPPIYTSFSMIPTSANGGEGPVSLSIVQAEH
                     SDRPINQGLSGGHTILLVPCGSISVSGSTVQSNCDDLNALVTPCATVGAASATPAGVV
                     ALSSLQGQSTGKVSGNFTVPYEPDTSGYYMCVPYCYSASAGCGESTTAMSFTVVSSAS
                     ADSSNYILTFGSADPGVYNRMPVLPQARENGLMHFTGAGLSESDAVKVIRAQDMCTSS
                     TAALLPNLKVGALKLTATTDGMTTAQVLFLAPDLVKTQVVGRVCYQRAASGLWSTAYL
                     SASNPEADFTIDILQPTGFELTSSSSSPAVGETLTLAFRGNGLDGSIDKAYLSSSSNG
                     NPCNRDGSGSSSSSSSSGSDTYKRNMYFTCKMSGSSTTTSTCTVMVDPEDTNAAMTLS
                     VCYLKGGSSGQTNFAQVDGTVALQARNPTYAVTPYPMFAGQSVKLAFTGVGLHADDEV
                     RLIAPSGACDDSSSILATATIHSVEEIIQNVVYQYTLVGSAETCIMVCYRQLGSDMWV
                     VARGADGRPAVSSVCAASNIYISAFPARYRIANLGTGGSDGSTAGTLLTVGETATVRF
                     TITSAPRLSFTTTPTAIKVVQAADKCVTTPCGTENVAACARAQRTADYTGSITKTGSA
                     AFTASIQVNGADANYIVCVETSSSSGAYVPVLPTSETSATSTAFGFTTTQQNPILVSH
                     TPSTWRVAMSTLYTTFSGSNLDAKTNVVYAVAASALLALYTASEGTVVAVCPPVPQTP
                     ETVLVSAMVTDSSSSSSLTTATYTRADRLYDGQYVYLCYAWSAGNGDSHITMAGRVNV
                     AAAIPSSYTWQAPTETSNLRAGQPIQLSFTSNLTSLSATKDTVYFYSYVQSSSPNPDC
                     YCDPTACATGKRIVYTSNITVTSATTTIKDDTTVYTAPLGFSNYDYGAIYIICYAAFG
                     QASDTYMGRVTVDLANPTYYTVSSVAAPLNRVGAPITITAVRRCMTAACALTLQDSLR
                     LIPSSVQCSQLSSDSPSGSSSAAEGASVQAIHDPVLNPGAVSLARTFVVDAEGTYRVC
                     YRLASGTTYSDVVFSTSYTRSLLTAVTANPQQATPVPSVPSAGQFVIMNLSCTVMSLC
                     STCTMLRLVPGVRASCWEKVSGTYSSDSCLTTTSVQYPDLYLVEGSYTVCYGSSYTTS
                     RRVPGTLTVTSANPSNYAPTESSGYAVYTNQATDYTLDITGTELTTADTAFLLPDMGY
                     TCHDLRTGEVQNQGELASWLQPSVKPYPLQLTSTGVSWVVSNQSKRFGGGLLNDIDLC
                     PGNGAPCLLKLCYMRSGTSWAPVTLLAPSSLSSLSSRPPGIELFASNPSSVELDRYPL
                     AIGMYVMATVQGAGLLSTDVVTINAGDCSGAATTVSVAGAVYVNAAGKQWYGVLRVTS
                     AASSYAVCYWRSGSATEVATITFAGATNVSTILILSTPLYYVLSPSNFTSMHTPLTRY
                     EELIVGASFTDQGTVGTALSYVQVITADTSVAECNYEPFQSVASGVTPFPVSLTLSSV
                     PGSGASGSLPLYQGRLTVETGAYALCMDTTIGLFRVVKAPPSAAYTAAGSSEVLVYDA
                     VPITYTAVPKSVMLGQVVALTFSSMPASSSDNEIDPAPAALEAGDSVQIIDGTLYECG
                     FPNATVLAAGVVSASGSSIGSTTVSLALPTAYELDGVGVSARGKNHTVCYRKQKSTFA
                     TSPRIGSTVDRNFHIMVEVPTKWATQPQQAQVNAPLNITFYGDLAEEDFLTAADVAFL
                     VSVPDGAEPDVSLCRVTADRSSIASASRIVISQGTMTKLDNVNTQWSVPANVLLESTY
                     VVCYTAEKNGQPLYVSSPATLVVYPTQSPSGAYLARSATSVVNDLTALQGERVFLLFN
                     TTVALDVVLDNGQSSSSSPSLENYDAVRITADSACSAPLGAGVIDPIPTDFGYAPPGI
                     VDETTGLTVPYLNLRIRAEVGSYYVCMRRRNRESWQAYYEFEVVGGLYVCPAVLKISA
                     AAVVAFTTMPTTPRAWVPHTEVQANYDAGFSMANVVQFFFVAYTGTGSVTDSDEINGD
                     SCYRPASSSEALSASVTLVNRTLQVYLVDPMFTQHSFGMAGTYLLCYQITGRNIASIY
                     PTALTVANPSPTAYIVPSLVTVQHAFTMSIVAMDAIFATGASNVAQIYTATDATVMPN
                     CTEASVPSGGTTHFTKFTQTNVSYASVEPTLLAPGYYFLCFLTDGQKRDFVVPNAAGA
                     YVFSVGLVGAQKYTVAPSPAYLGQLLDITITGSQLSSSDHVKLLRVSHDELSSSGGSY
                     AAQCTPNSENADASEAAGAAGSTVQSSSGTVAHYHPRVNETGTFILCYQSSLLSNAWV
                     WVMDIHQFTVSLAHPTHYSLSLATPYETQVLLLYIHDSGDDGSGTAGRLQNTDQLKLV
                     DRGSGARGFDCAADAANSNIIGLISYVSAQSNSSVHVYQICGSTMASVTVCYALSGAA
                     AASPSWAEVPLQSPPPTYIFEGVSIEADPFVGPLRGSSSSTSGTATGWVAPRPYEPFS
                     FYFTTEAAGLEAQRVAFAQSPVTVCALDVSYVAPLLYEKVPERASEFTVSLPYAGSYA
                     VYIGPYAAVTAPNIAHGTPLLVGQCDPCNFTPSYALVGTYVSLSFPSSVGDSLSDADE
                     VRLFPVSQGLKGRPCEATTGAYAGVTLTPDSALSTSSMTVFNVTTGAEAEAKKYLGEY
                     YVCYRKGSASSVNAGSSTATFAVVSKNDGTASIFSVYPADLLTATVCPASPMYALETA
                     VFNVTARDTALYPNVAFSSSDVFVVVPSDVLSSTVGGGCGSITDVDALVAASGGRAQL
                     AKLDTYGNGYSNWYLTFATQMTMMYHSWCFKMQYDTLFRNISSSLQTVLMENPYKVIT
                     TPPVILPTSSPVLIDIKGSEMRSTDQVYIVPANQSCSETCSRPLTPIEWPDVAHTTQY
                     VNSTTTLVTFSNPINVAVSLGVCYRRTGRYLTRLAKITVMEPNPASYTVNFVPRVGTR
                     PTLVFTGENLTGTDTIMIVEPGATCLEGNAVVAGTFVSVSEDATTSQFLLALVGHAVL
                     AQSYTVCYEVSTVGAYVEVSPVLQVLEGGPSSVLSSNTPMRGRATVLTVADPQVGDEM
                     YIACVGCSCFDEVEAVVPYGSVRATAHVREGSISSASDAASISLRVGFNDTKSYPVCY
                     RRRDSGYAQIGGTAYFVTPVPNSPSAVAQLPALAQYQGQRLYYNFSDYTPAVPLGSGD
                     LVMLVQAARACWDNVEMNASGVVVQTSELTGTIESLSIGRWEAHVPSLGPGVPSDTPT
                     PFPLSYLLCYRQVAQLEYVSVPFEMQPTVMRAADPATFETKPKIVEKGMLDVNIKFGY
                     TDTGKEGDEAYVVQFTILTNTVCDDARSTLVSARGRAHPMYILNMSGSAVVGESNTAV
                     CYTRAGATVAEVPQLLTVAESNPSGYLTNVMAGSVARGRQYIEFVIVGSGLSVTSDEV
                     VFTDVPCAMAPRPFQSSSHLARLGDAASNGTTYRVVAQFISLMSPIDVYVCYQHSAVW
                     REVGAALTLNAPQPLTVLVISAGGTQTTPRAGQHLHLQLIDGMPTVPIGAAVLSAETT
                     GTGTWCHNFTAANVQEPALDILSAAILDVSVWQVSGHARLCVRYDDGTPWADVATSVD
                     ATSIYINPANPSAMDVFPSPPRVGQSVTLTFRLLVPSNAGDMVKITAPTYEACEMAAS
                     INGFPPAMPVTVKDNAATTLTLVDSTDPLLYRSFNTTGTYRVCYYSAAEMSWGVVGGT
                     LAAGSVMVEEPVPQSWVIASGHTEIGYEFALAFHDEFSVLKPSSGNDLVWAAPSSVSC
                     GVNPYMCRGCIIFEWNASLSNSSTAVTAANASVRVDSMNLCYRLAEATAALVPGSLNI
                     TTGPIQCVEEDSFISGQQQLITFRLDAGTNVMDDSWRLSFYATTALHCNDRYLEDFVP
                     GSARLQGVTSTSATYLVLWPVGLGVTTREYTICYTHNNLVGPVCTCGQIDANTGECYI
                     SGSPGSPQSFTPSPHPTYVGQTITLNFTVNASMTAYPPTAIKFVTYVDELTVCDGAPA
                     FTPVGATLTKISALLYMYVFKHQYTLGTATLLVCALTDLSPSYGRVASVVVPSSPTTN
                     NTLWIRPYLGLITFPSEADYLRSMQTLNLTFTMASRQEDDVVSKHDRITVVSDPHNCI
                     ESYISAQDPSTLMSMFYLPDTAFLTLPATVLSVSVSLFLTRSLATFAASAAGQGTHYF
                     CYKLRDGTWAPILPKLTIQEALIGSCSVTGALSPSNGDNGGSSGSTTNNGGSLRAMYY
                     APTQILGTALFELLASPSADAVRVVPQSEWCTNDAAAVFTTAVASGSPSSLSRSSGGV
                     EAVFFAPLRGAYKVCYRFGTSTNWSPACTDLSVTDPSPTGATTGCWNVGQTMNMTATH
                     AISDYVFTASDHLRLVQGALPCRHSNGSLTVSSETVTVGDAVQPAYGILLSDVVAGQT
                     TYMMSPAFFRTGTRDVRLCYTDAAGNQFAVPLDFVGDPGKSLFPVQARQPSSAAFSQR
                     HIQVGQRLFMNFTSASSSVTPPLHPYAALPQLYTPGPAFNGTFDGATLLAVSSSTAYI
                     DGRCAAALRAGTLATTSFLGVYGSAAQSGESYVPYTIGNYDPTVAQHYITCYQLATCG
                     VVDSGDPFRVLNVNPSNVYTDVSTPRRGQLIKVLFTRDMAPSAVALTPGSDRGIKQPD
                     LASCWTLTDISGQLVQGTADLTHFTTIFYAQAPELASTTATRSCYKLSEGSWSEVPNG
                     EASVLAANPKSFATNPASVRVNQVNYIQFYGTGLGSNDRVKLITRSLNCSEDSVPPSS
                     LTAYKATDPNSATAGTSEGWKVTEASSDGSTARLNFTSSSTGTLSVCYRLDADTVWTL
                     VYGDLIIYERNPPVVTRTPVTTLEGELFTLNFTASTEGISDLSSDDRVVLYYGSAVNC
                     IAPTTDETAPSVTASPSRTDMLPQSIAYQLDMGTRGNYTLCYKVSASNVPGGYVVVWG
                     YDVVVVAPNPQNMTLYPVRAPSVHRPNELLTHVFAGWGLAATTEKMDSVKVIEASASG
                     STTDTMCQNSAAAAITYYPLYANGTHAEQVWRASPAGMHIPFSVCYKLYGGQYHVIGD
                     TLTITGTASPSGATSAKLSGSSTTLSSGESMSWTLVDADAQSCADNRALLFFSANDCH
                     AAPYYVNMSAILSSSALIAITFPAGAVIVSNCGGMTQLRVPWTYPFDAGLASAAASSP
                     TALLSLCYWSAGNDAVSVLSSNAITLSQGVPPPLDITLSVMAQEVFSFSLSVSPATTD
                     WVVLVVDPSSCVGVSAPANDADFTDLTYSETTGVATVTAAVPGAGMYYVCYSHQVGLC
                     AASTGRECARVVAQVEATAASPQSWSGQPTPVYVSSLLAITLAFPSNGDASAQGTTAS
                     AWLAVMAAEESPHTMRDVWVACVQSQTMKSLRYGLTYSSASGMWNTDRILVRSGPYAL
                     CYTAQSTVEAALHLFGPARNAGPVVLASTVTGVDLPPSMTVTNVNTVVLTGGGLSTTD
                     VVMAVALPSSSVPGLESAVTEVPSDICTNEAYKPRVNSTNPSPAKNTGMTSMLRELVF
                     STTGDYVLCYTATYGLTTSDSDPSNDSESVTGTPVLITPKTFTVSPSVISMTVVSLVL
                     EVGVELHIVFTGSGLMVSDMAALVYVGSIEGSPTVPTVCLGESVIYENMVSVNADGTN
                     ANYKTTPVQQGVHMVCFRKSLATTPILMPTQLCVGVRTAVQAVFKVQPGGCIALLVCT
                     VQPTIMLLSASGLATSAPHSSVSMLLYLSDGTTPAPAGQLSGGTVYSHVSFTNFTFWA
                     LRVSTAGSYVMKASVTLPGGGTLVATSSALKVAGGGEPVVDVAAVSCLPIGILDRTVG
                     STTDTVDCLITALTSDAPNNFTVLVNAGMVSIVTRNGTTSSGLSTYSFTVTAPATSSS
                     ATGIVNYLSILVTPIPPYETLPVQNSPMTVRLATSPSALTTIGCSAGATQLPLSNMVR
                     VGGILMCYVQGIATIHGQAREIVARPEDLKVSNYYNGDVSTSAAVNLGAYPLDVNGRY
                     NFTVTPTTGLSISVAGTVFARDDAGSPSSGATSAWATMANSPQSFILIGVPTAAASRL
                     MCTSTRTGSMTWYTPTEPLQCTATLANAQGPVNGLQSEYSVLLPDGGSVSGFDESAWG
                     VSLVWKLAAPPPPSSSSLVSSLKPVQQHAYAARAMIDTFAAAVRQGFSVQVRYTPSIT
                     VIATYAGGLVYVTSVVKTVPRLKQGATVSVTFAGIGLVTMHRYTLGAISNCSSVLSEA
                     RSTEGSAAGELVLTFEVPSSVFIICFSPQDARTALQPLLTTQWTPESGGPSPSRWTGD
                     DLVLLIVGVAVLFILVVLLVILLWCIFCGREEESEDNIVDEEHIMHHAPARITTIACK
                     AGGSGHNVYMPPRANNRYVLRIADESPPAALPSPAPLPIVTSSTPPPPLSSPPVAPPQ
                     QQHPQQHPSSNTQIRINIHDGDDAGNASPRAPRSQATTPAAATSVTYAGGSGSAPPPA
                     TMRKRHHHCSRRSSSTSSDHRPHQQHQSNFKYADLDRAAPRQPSDSSSFTETSATEIR
                     HSVPPLPPPPLSSVTTLNTTVPAPSANSGLVESPRQAVSTPTADRVPKNLPPLPPPPP
                     PTISLASPMAAQAPTSGPYEHLHRTTSGMTVPGTVDAFGTGLGSLGPCRSDNGATEVL
                     EPITVVGHTSKPMVRSASSPR"
     gene            <265889..>266992
                     /gene="GPD"
                     /locus_tag="LMJF_10_0510"
                     /db_xref="GeneID:5649653"
     mRNA            <265889..>266992
                     /gene="GPD"
                     /locus_tag="LMJF_10_0510"
                     /product="glycerol-3-phosphate dehydrogenase
                     [NAD+],glycosomal"
                     /transcript_id="XM_001681332.1"
                     /db_xref="GeneID:5649653"
     CDS             265889..266992
                     /gene="GPD"
                     /locus_tag="LMJF_10_0510"
                     /EC_number="1.1.1.8"
                     /codon_start=1
                     /product="glycerol-3-phosphate dehydrogenase
                     [NAD+],glycosomal"
                     /protein_id="XP_001681384.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649653"
                     /db_xref="GOA:Q4QHG4"
                     /db_xref="InterPro:IPR006109"
                     /db_xref="InterPro:IPR006168"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR011128"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR016040"
                     /translation="MISTKRHINTNELLHLSKAVVFGSGAFGTALAMVLSKKCREVCV
                     WHIKEEEARLVNEKRENDLYLRGVQLASNIIFTSDVDEAYKGAELILFVIPTQFLRGF
                     FQKSGGNLIAYAKARQVPVLVCTKGIERSTLKFPAQIVGEFFPSNLLSVLAGPSFAIE
                     VATGVFTCVSVASADINVARRLQRIMTTGDRSFVCWATTDTVGCEVASAVKNVLAIGS
                     GVANGLGMGLNARAALITRGLLEIRDLTAALGGDGSAIFGLAGFGDLQLTCSSELSRN
                     FTVGKKLGKGLSLEEIQRTSKAVAEGVATAEPLVRLAQQLKVTMPLCQQIYEVVYKKK
                     NPRAAIADLLSCGLQDEGLPPLFKKSAATPSKL"
     gene            complement(<271076..>273799)
                     /locus_tag="LMJF_10_0520"
                     /db_xref="GeneID:5649654"
     mRNA            complement(<271076..>273799)
                     /locus_tag="LMJF_10_0520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681333.1"
                     /db_xref="GeneID:5649654"
     CDS             complement(271076..273799)
                     /locus_tag="LMJF_10_0520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681385.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649654"
                     /db_xref="UniProtKB/TrEMBL:Q4QHG3"
                     /translation="MLRIILQRLAVQRRIAEQLEAVSLDEVLRRMQSSSLTNPARSLE
                     AHFVLATERRDHERAAPTAASPCAETLREPSDDLLRDALSERLLAEVRRDLSSPTITL
                     DDGGLMLANCLRHGLSPLATQQVFALWQRRMHHATTGASSAAAPRTSISMLGMGKSKT
                     AFARAGGGAAGVSDLAQFQSLVRVMEACLDAHDKQQRELSRFRKRTSSAAAADARKIQ
                     SKSSIAFTLDDLAALVDTVEQHWTLFIDHGTSTTGLLVQFTALALVLTGCASSAAAEA
                     EPGSKFANSLRRLSHLQTDRALLQQRIFGLCDQAIVSLCSQEEEAAAAGDGGIPSRRE
                     SLWWYRPQELVRLSQAMRLIEVYEVEQRRGSRYSSGTGSPVEHSSHGEGDGPRRPGSS
                     VARTSRRDAGKTMSSSSNPVRGTPPSRAQTAPVFPKARWLLRLPTTWWPASSTSLHGV
                     PAEHRKTEAAARARRRLGAYVTHHALQHTSTVTPPPVPSYAVSPALASISLADVEDIF
                     AVVCATASSVASTEAVTAFSWWVRDVFFQQHRHRSLHDVQEMAGLLGIAEVCVAYPDG
                     TQTVLAEALKCLQRSALVLWCVGDTAVTSGPDTPGMLWSRACEVVGDALALATVRAEA
                     QRTLRALVHTVSQHASSCIVTREPSSELARRHQRYGLLVLACLQLQSPDGIITPALKR
                     MILELVFSAPFRRDDADHGGPAAVARALFLFTRPEPALREPASTQGVPRRDRVIPHLL
                     NELTRLVSPAAAALDDGATAAVEDGGGSAQLLQQLTSAERQMLRSALQEVRLQTQHEM
                     KERPLWGPMVAPSSSEAGPGQAARTASLQLPLSLPVTAQVGVVSSADASTSSSDRQAG
                     AMGAKSGLGRACTECHARTPRHRMRASEEHLLIQSEIDTLTRYLRQRRSPG"
     gene            complement(<274637..>278071)
                     /locus_tag="LMJF_10_0530"
                     /db_xref="GeneID:5649655"
     mRNA            complement(<274637..>278071)
                     /locus_tag="LMJF_10_0530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681334.1"
                     /db_xref="GeneID:5649655"
     CDS             complement(274637..278071)
                     /locus_tag="LMJF_10_0530"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681386.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649655"
                     /db_xref="UniProtKB/TrEMBL:Q4QHG2"
                     /translation="MQHTSASPATIPQASPRPAHSLAVIEELLRENTTLKARLQLSDE
                     QRVTQEVLREQLHRFFECVAAHEQASQKVLTDQWQDDGEKSNAPDDGAGVARPSFMNA
                     AVSEVLRRMQEEKRQAEAALAQLQSDTVAPLHAQLEAMEKEKQQLVARVAELEMSMSS
                     TPAPPLMAELRQLRETEALLRQQLQECQASTAATVGTFLSTVENSLLAARQVPELIHA
                     METIKENVRTNQTMQAAQRVLLEEMERRHAIEHEIEETYRREEAKVLRERIASLEDEV
                     SAAAEREEAFASERGGMEAQLAAAQDAIRQLTQQHSEEQVALAQKRQRAEQDASSNPT
                     SIRGELTKFWYEGRDRIRELERQLQTMHTAEANLRVSQGRVAQLEQRKAALLGNLAAL
                     AAEVDRRREEEKKLRAQCAGVEAERDRLLISVAKITGSHISETELRDCCRTIREAATR
                     VAAASATVVADPQAIEEALRRAQKLKSEVAQLQRQKDQLQRFLELHEDRVQALLEQEA
                     FLQVRDSKGGPATATSPEMGSNTSIKGAPEAASATAFSLPQFLEHIRQGANDVFLQNE
                     DAAVRAVRPGGKRGSNRHANASGEVSHDSSVTPHRDSFLSLHQQFVQSQERLLASHRD
                     LLEARNENRRIQAELDSTRSEHAAAAATEEKARRSMEAANTALTHRTTSLTNELQELQ
                     RHYTSAVTMVRTTLEGLSNVLQLYHQSELHAEKLREMVQQERRDMSDMLRREAASWSV
                     GTGTDSHTNAQEAQHSAAAERITAALRDMGAYIAEAVAETTRQATQDQTSYIGKLVKA
                     IQQQEERVQAAKAAFEASAQAQASSLAERISAAQQQWESEWKVKYQAMEAERVQSVMQ
                     QHASVVLQRALEQAVTTPAAASSAASPNSTASAPPEVEESTVHMTDTLQVIRSFLAQA
                     RQRQAQQQQQQQQLQQQEKQTVSAPTSSAAVQTAAAATSVAPAGAPAPPASTAISLPT
                     DAQPPQSLTPPSIIATAKIPNAGAELSTASSSMAKENDGADTSTSFPQLHSAPAVSAP
                     TTDSTALAAEHAPREAPAENEEAETSTQEAEISGDSGPSAPSDEEHPPSHPATPDAQL
                     DETDVQAEPQESMGDATAGASQRGAEEENEEALPSPPSSLPEEGDDPERKTSEEDA"
     gene            complement(<279342..>282608)
                     /locus_tag="LMJF_10_0540"
                     /db_xref="GeneID:5649656"
     mRNA            complement(<279342..>282608)
                     /locus_tag="LMJF_10_0540"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681335.1"
                     /db_xref="GeneID:5649656"
     CDS             complement(279342..282608)
                     /locus_tag="LMJF_10_0540"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681387.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649656"
                     /db_xref="UniProtKB/TrEMBL:Q4QHG1"
                     /translation="MFPPPRLWLVGLWVFVAAGYCACTVADGKLRLPYTKPVIQTCHD
                     DAVHPESGAKASVLPVSFNATVADPFLTPAILMEGVRSTSKAITPQHIFTNAALRLVF
                     DVPNPGLDFVINLTSAQYPLIQDPNGTLWRSALPSTIEVVKQNSKYTYDVGSLNVRSY
                     QSRSESVEVVAGAPAADAECFTLKACCAVNSSYYQKYELVDSPVPPYVCTGVPIPYLL
                     RHFTFSVNSTVKFREAAAGASCEMKANQWTEESATCTANSNAALAGVTASPPHRLPSR
                     GFSLCRQGDNLTNSESGSSPIPVVTAAFCSESRCIGYTPANYRSDRSTCLNYPLGFYT
                     SADENNTNQFSSFEDNAAGLWPYFFNDCKWIDDVTMSSPTTIQDISLQCDVPASTGWS
                     LSYENFSAHLTDTIAPLFPIGRPTRVSGQYVSPTDKDTILFELEYVSFSSFRAGRWTF
                     RICTTRKCVTPTVPVAGDTEHYPSVMRVNVSASKLGLSASPHEPAVSVEVYSAVTPRT
                     SPFRTLLAPSVVYVDKAATPLSQDTVNMTLARDPPERVPSPYAASTSGRTTSRVLCEG
                     DYRFSTVMNNCQPLTDKDCATKYRGRRSKFDPVARACTYPVPPLNGPLVFKPLAEPKP
                     PRTYSPEELRAIFKTVRLPQFLRTMEESYEDYERQMARWEGRPVRLPPGQAAAAEDTD
                     VAAVAAADESAVTYINESPMPGARGLSITCIALTCVLWTVALLRDVLEKFFALGPWHG
                     QRRCAFFAGAVNCWHWLGGACAEGHNEAWPRQRRATSNTTATLTTAQSPAPRSTTQSG
                     QCGEHANPALQKRKGKGATFTADTPLQSTGKSPHGAPREPVTSAPFQPRDPTATPHRA
                     KQDGGQKRHLPRTHNSRDAEREHRQSVPAGATGPASSWGDARPYVSAAHPPAYDVFGF
                     PEAQHAPFGSGAGFAAPGDMPFVGGDYTSQRVWFSDEGVGLGYVPAAFARPHSASSHR
                     RCSCPSSPYPASSPPSLGWHPFEDVYPPVSSPCYAPYDAPLPEFGLNPASTPYPGSAR
                     AAPPSPFAGFNAFPPVSSVRQSSRVEVLSSDSDGAHGDNRAAEAPSPAGRTRRPNSMV
                     "
     gene            complement(<283460..>284755)
                     /locus_tag="LMJF_10_0550"
                     /db_xref="GeneID:5649657"
     mRNA            complement(<283460..>284755)
                     /locus_tag="LMJF_10_0550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681336.1"
                     /db_xref="GeneID:5649657"
     CDS             complement(283460..284755)
                     /locus_tag="LMJF_10_0550"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681388.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649657"
                     /db_xref="UniProtKB/TrEMBL:Q4QHG0"
                     /translation="MPRNRLVVACNASTAGRQAQSLALSVSLSTTLRSSTALALTKSL
                     VDITTRRGSRHSLLHTAVRRYTNVLYRLPPTQTIPTHSPSGEEVDTELFVRQVQNFFE
                     VLRQSQLIERFYEMKSCPYYECLFTNDLFFQHHDLIIPMPKHGREHRSAEISETIRYM
                     RGWGATGDVNHMLQDVKGGRASGGDFISTTHGVLMGYGTSRTNKLSMMTLTGAIAPSE
                     AAAEQARALCVEPIEMLSDSPPLSDVIAFAGQRTFVISDTEHGHNAAQQAVKRIQKVP
                     WQIIKLEPGCSFFSHLGGVNYVYDVLCDQDFPLSMERLGESGMNPFPVEWSEPRKLGI
                     TMRSICMTARFTRGTMNAGGYANSRGHAASSFNYNSRDISKNSRLFVGGSRKHGDQMA
                     PLAAQLEADEIQKPVHQPIPRYASPMHRRGTVVPTEPSA"
     gene            complement(<285362..>286477)
                     /locus_tag="LMJF_10_0560"
                     /db_xref="GeneID:5649658"
     mRNA            complement(<285362..>286477)
                     /locus_tag="LMJF_10_0560"
                     /product="zinc binding dehydrogenase-like protein"
                     /transcript_id="XM_001681337.1"
                     /db_xref="GeneID:5649658"
     CDS             complement(285362..286477)
                     /locus_tag="LMJF_10_0560"
                     /codon_start=1
                     /product="zinc binding dehydrogenase-like protein"
                     /protein_id="XP_001681389.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649658"
                     /db_xref="GOA:Q4QHF9"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q4QHF9"
                     /translation="MSGQAGKQVAPVKCKGWAVEKPALKWSTDAVRLSDVTVPAPDPT
                     QIRVRVYAASINPVDWKRVMFPASGSGPGVAGSALKGFKGMHHKPPNYPYPYVVGVDG
                     AGEVESVGRKVTGLKAGDRVMFHSSLTNAHGGSLCEYAVMEESVAVPIPADGARPFSY
                     EEAAAIPCATWTAYVALFDKLRIEPGRSIFVDGASGAVGSCAVQLAHHMGLYVFASCS
                     PSNADYVRSIGADQVLNYHDGIEMVDQILDATEGYGVDYYLAVTNTQDAESFTDALRF
                     GGAVCLLSGVLIPNSNVLFRRQLSVHYVFLNGLHGHPLTRPQLRYIGDQVAKLYQSGA
                     FRLDVEVLPFAEAAKALDRSATGNVNHKKLIVQVASP"
     gene            complement(<287288..>288724)
                     /locus_tag="LMJF_10_0570"
                     /db_xref="GeneID:5649659"
     mRNA            complement(<287288..>288724)
                     /locus_tag="LMJF_10_0570"
                     /product="zinc-binding dehydrogenase-like protein"
                     /transcript_id="XM_001681338.1"
                     /db_xref="GeneID:5649659"
     CDS             complement(287288..288724)
                     /locus_tag="LMJF_10_0570"
                     /codon_start=1
                     /product="zinc-binding dehydrogenase-like protein"
                     /protein_id="XP_001681390.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649659"
                     /db_xref="GOA:Q4QHF8"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q4QHF8"
                     /translation="MGHKNSSNISSAPVPPPFYVLPGVPVPSLKPSNLDFSATSGKPI
                     LCAGWIAPHGNRSWSRRNVVYSSEIEIPVPQPCQVRVKIYAAGVNPADAHRTAVLPSS
                     PEVGTSGKSRRASRHPRPPFKFPYVVGIEGAGVVESVGWAAASSGERDGSAGALTSAN
                     ARDIRVGDRVAFLADLMQESGGTFCQYAVVDSDVLWKLPEVVCAPPPSTGGLVPGRLI
                     DFVEAASLPAAAATAYIALFDKLRIETQRAIFISGASGGVGSAAVQLAHYFGLYVIAS
                     CSTPNVRYVQSLGADYVVDYTRADVVEEILTYTDNYGVDYLLECAGAFMAEAHSETVR
                     FGGALCVLTGLLSPRSDIVFRRQLSVHYVCLGMQHQDPLARTQLQPLGELVMQLYIQG
                     AFSVNAEQVPFVQAADALDLVASGHGRGKIVLTNFHTNEEKEERLRRRHVQLYEKAQH
                     QYQVEETQKAAGAAAATAASEAASREAG"
     gene            complement(<289728..>292151)
                     /locus_tag="LMJF_10_0580"
                     /db_xref="GeneID:5649660"
     mRNA            complement(<289728..>292151)
                     /locus_tag="LMJF_10_0580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681339.1"
                     /db_xref="GeneID:5649660"
     CDS             complement(289728..292151)
                     /locus_tag="LMJF_10_0580"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681391.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649660"
                     /db_xref="InterPro:IPR022043"
                     /db_xref="UniProtKB/TrEMBL:Q4QHF7"
                     /translation="MLIFWTLSLGIVFSFYLCPFPVYLCCVRLYWTLHRRVVARMDTI
                     AELLKNIDPSRIDEALALLQSLKSNAAPQQPSNSHVPASSSSEACRSSPELELQQLAE
                     NGGQSTELLTESWAEGASGTAEEENDMPLASIGHLLSPEEKKKARDDRRAKREAEKEA
                     RRRMKEEDAALIKSELDARKVICDEEKESRRILKDTERDARKAEREARNKAREAEKAA
                     LKMTKEAPNNLTLFGFLSSTVKAESNKNRLFSPFVQDKRVAPAALQFWRRPEDKISRS
                     EEETSVVNLSSHAMNGGARRDPGKSKSHNVDEESSLLHPPMYCDEGTPSKANVCVRDF
                     NAMIEASNAQEVPVRDLLRQCGCAFHAAVSDPYASFDNEVVFVGFFAIGYDPCQSRPP
                     YFGTYNHLQEGNLNEAELLQMGRFPLRRGIPRLSNIDYEYDSGDDWDVMEGDEDIAAS
                     SSSDSDKDTALDSLDSSDLEFIDDSDSDCDTQRKIMEARQRRLHRLRNKSKLVPSYSG
                     PFVGIPTDEHPLRGFDELERFVPLNAAYFSKLVEEELNAFTSGSAGIPASEDEGLSAE
                     EMEAKRQRALMEAALKNRREMTDTELKALHTIIASNSKVSTQMILAAFKQQQLCVGVA
                     RAEIERTIRRFYERRHRSLVLRGEPWSPTDERLFARVSSSRKPKSPGDGGTGVVTDDG
                     EGRKRDDNEDADDGTDIDDVPEATVERVAETADDASAKASDVGDGTAPAPVTPSETVE
                     EAGHPKPSPPSSGEAKVETWIAKTKPITLTKLSPKASASASVNMAKRPREEELVEDQN
                     DGATTATSD"
     gene            complement(<292393..>293196)
                     /locus_tag="LMJF_10_0590"
                     /db_xref="GeneID:5649661"
     mRNA            complement(<292393..>293196)
                     /locus_tag="LMJF_10_0590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681340.1"
                     /db_xref="GeneID:5649661"
     CDS             complement(292393..293196)
                     /locus_tag="LMJF_10_0590"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681392.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649661"
                     /db_xref="UniProtKB/TrEMBL:Q4QHF6"
                     /translation="MASLAKPSQKGRGKKKGDKKPAKIVPDPDAAYRQQLDETLYIPK
                     VVRKKVLDTYGKAADSAIMANTVAASSSQLDAHRERPISFIKVPRIFWSLGLCLTDDQ
                     IDQIKAMIAQNSQHVSQENSAANLMQQVQRPGSFADREKLRTLLVELLHTHVLTYDPQ
                     VLTCPHPRFPDRVSSVVYSSTEGDIRSCFDKIWEVTGKQMVMGADGRNIRCVAVEQLE
                     ELLVRAQTEEVATKALTERELQDFYFLVKDVNDDVVREDAFLNCFIHAQ"
     gene            complement(<293497..>295284)
                     /locus_tag="LMJF_10_0600"
                     /db_xref="GeneID:5649662"
     mRNA            complement(<293497..>295284)
                     /locus_tag="LMJF_10_0600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681341.1"
                     /db_xref="GeneID:5649662"
     CDS             complement(293497..295284)
                     /locus_tag="LMJF_10_0600"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681393.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649662"
                     /db_xref="GOA:Q4QHF5"
                     /db_xref="InterPro:IPR004147"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4QHF5"
                     /translation="MSAAELQRRATALSRRQVRIFGAVATGCGSLGLYICYKKFFLPE
                     CLREDQRRRVLMPVRRTKPYVAGTSMGDVLLPEVRSMPKVVFFFYVAYRIALLFVGSV
                     PVLWYGFLTYSVRLCPERIFYEKILTFLSSMGPSYIKLGQWMATRPDFFPDKMCKTLE
                     KLYDSTEPHKWSHTERLLRSEFTDGPCKGHNALRYISEIEKVPIKSGSIAQIHRAKLR
                     ESIDGIPAGTELALKVTHPHIREQVSADLAAMRLFVWVGNRIIPGLRYFNLDSSIREF
                     SSLVQSQLDLLVEGDNLMQFRYNFRSFKGVIFPTPLLSLSTEDVLFETFEVGEPLQDV
                     AYSEEHKDVAELGCHMFLKMLFEDNFVHSDLHPGNILLRTNKTDGPRQYYPDGKRKLR
                     FEVVVLDTGLVTTLSKDERNNFISLFAAVACGDGELGADLMIDRLPNSMRNAQDAANR
                     ERFKKEIKEVFDMVAPGTAGFRLSKVQIGSILGKVMDAVRENHIPLDGNFASLVLSVI
                     VGEGLGRKLLPDFNIFAEAAPYLMAFLEDGELCYLANKLQSTYGTTALLRDSVAIVKP
                     EKAGTYVEMAVKKGENMLRKLFTSDRAHG"
     gene            complement(<301738..>303246)
                     /locus_tag="LMJF_10_0610"
                     /db_xref="GeneID:5649663"
     mRNA            complement(<301738..>303246)
                     /locus_tag="LMJF_10_0610"
                     /product="putative endonuclease G"
                     /transcript_id="XM_001681342.1"
                     /db_xref="GeneID:5649663"
     CDS             complement(301738..303246)
                     /locus_tag="LMJF_10_0610"
                     /EC_number="3.1.30.-"
                     /codon_start=1
                     /product="putative endonuclease G"
                     /protein_id="XP_001681394.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649663"
                     /db_xref="GOA:Q4QHF4"
                     /db_xref="InterPro:IPR001604"
                     /db_xref="InterPro:IPR020821"
                     /db_xref="UniProtKB/TrEMBL:Q4QHF4"
                     /translation="MIARLLGAASVGLFSVTAYWTYSTQASKRTQLVVQPGRSLVTTA
                     TAKPSIGSAGSDSSSQGSVRGDAALAFPVVLPPRTPPAQASTLTADFLQQCNEAAAHG
                     LPSTAEVRCYGGYLASLNYERRIPNWVMEVVDYRKLHPGRRPSSPAAAAASRDDDAAQ
                     DEEDEGSDGSRGGGDVSRNRSNFYADDTVPAAFRVGPSSYTSRGMSRGHLAAAQLHKA
                     SQAEMDATFNMNANIVPQDMTLNAVDWLRLEGLTRKLSKEVSVGPQQQQPGRGRQRGH
                     SPPAGNTTTAEGAGGSGKLYVVTGPAFVPRLMRVEHRPDGTEVHVPLSSADASAAPWK
                     SAAPVKLMMTYELTGHPARGTLVAVPSHLFKVFLAEENGGQSHSVAAFMMPNGPIVEE
                     LPLTAYQVPIEQLQRITGLQFFPGMDVTRLPDLCKAHKCDARPSALFQRYRQVAQLRA
                     ADSVPQLQQAYAALQASAAGGKLDEAVVHEFQNRMEELVAAAVGLIDQAERR"
     gene            complement(<305099..>307372)
                     /locus_tag="LMJF_10_0620"
                     /db_xref="GeneID:5649664"
     mRNA            complement(<305099..>307372)
                     /locus_tag="LMJF_10_0620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681343.1"
                     /db_xref="GeneID:5649664"
     CDS             complement(305099..307372)
                     /locus_tag="LMJF_10_0620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681395.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649664"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="UniProtKB/TrEMBL:Q4QHF3"
                     /translation="MGRCIRRVSALKAAAALLLALVAAAAVATTTARAYDHAGITVAG
                     AILVGQNLQGKAGASRILNPFAICANFDTTDAEDTTLLIGGASYFFTLNRYSTYLGFW
                     YGQGSMNLNNGPIDKVRLTGVFGCVTLRPNSSNGLVTSTVYYVQNDGMLYWVSNSVVY
                     LTQVKYGISFVDVTVHDNNVYLLSNQNEIYWCGIGAGGTVVGSACTHITLTGSTEFHQ
                     LITVSSDFRGFAVSSSGIFIAPTSDLYWFNLSGVFIAKSAGVTFVDTKFTSSRDTVNR
                     ETPVLMAASTSAVYSVTTSGATISYTLVSGKETKSCNPALSNVDSDTSPTFCGIARIY
                     PLNTDTVYMTTGGASVVRAIIVSNTTISDTITRTPFPVYFLDNSSIIPLILDGMNYEL
                     VGNSNIPFPYVAINHSTPEVDDSTWDTTFSVDVSNRFFSSVSSAAVVSTPFMGSLHGL
                     QAYYNRTNQILFGDPNVLPMCNLTKMLMIERAVAADARAALQYPYIYTSKAQNFTVNA
                     HPNLTLLKLLMPYPFGEILNESGFFENTTTPAALANVHFNTTMLAAVRNAYTPDFVYD
                     CIFAGNAFPFYILTAAQQQLVRWIIYTAIQEQLAKCAENNPSYTGSDSSSSDSHDDMV
                     PGCVPRVGISNLTELVMPGMPYSNYNIAVFIPESLHYNFSISRCLDGTDWTNVTEYLQ
                     QATVARTRKCGTGCIVSIAVVSAVVAAILVVAIVIATSKRRRLATVVAPALTVEPKFA
                     STLDVSSEEGSRNPLNG"
     gene            complement(<309406..>311127)
                     /locus_tag="LMJF_10_0630"
                     /db_xref="GeneID:5649665"
     mRNA            complement(<309406..>311127)
                     /locus_tag="LMJF_10_0630"
                     /product="flagellar glycoprotein-like protein"
                     /transcript_id="XM_001681344.1"
                     /db_xref="GeneID:5649665"
     CDS             complement(309406..311127)
                     /locus_tag="LMJF_10_0630"
                     /codon_start=1
                     /product="flagellar glycoprotein-like protein"
                     /protein_id="XP_001681396.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649665"
                     /db_xref="GOA:Q4QHF2"
                     /db_xref="InterPro:IPR011042"
                     /db_xref="UniProtKB/TrEMBL:Q4QHF2"
                     /translation="MSQCAAVTTRRSPVLRARGPSPHPLVATALVALCIWLQHTAPAA
                     AQSDSDYYDGTYYYHVIFRSAPGGGDSVDGPSGVGVYGVVGYGGAMVGGGVVFSDMGG
                     SGSAIRQISNAGYLSTVAGNLRKKGIQDGPSAEALFGGIPTGDSRANSLAYGNGGFYV
                     ADTLNDALRFVNATTNVTTTILNADTLNTPNSLAVSIISDKTSVFISNTGYHSVLYIP
                     SLGSPVGEVNFTSNPYFVPGAITVLPHLSRAFIMNATLQMYCWSYIQPGSQSWKVSTP
                     LAVDFGRILQGSEDGNQVLYVTTNGSTIASLDATASPATSPSLVPQKVIDLDTLLIGG
                     KIQLFFQRTSDSWYILTTTQFLIVSATPIHPDESSSSGSSSEGILSGRHKGIAAFPTA
                     AFPTNDSCLMTQVYNWMRIDATEAYNTDDFLNEFVVPPTDFATLVGGDVNVSAWCGNI
                     TTDRSNDGTILILIFWGPRGHDPLYTQDRLAKSPWKGTQAFLKSLNSSGWNLAPFCFY
                     NCTTGCKTITAPKCSAYNIGSACDDVCKGAIASSVVIAAAGVVLLLLMIVSPSNIFTA
                     VVMVPII"
     gene            complement(<312729..>313460)
                     /locus_tag="LMJF_10_0640"
                     /db_xref="GeneID:5649666"
     mRNA            complement(<312729..>313460)
                     /locus_tag="LMJF_10_0640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681345.1"
                     /db_xref="GeneID:5649666"
     CDS             complement(312729..313460)
                     /locus_tag="LMJF_10_0640"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681397.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649666"
                     /db_xref="GOA:Q4QHF1"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:Q4QHF1"
                     /translation="MSTTAYKETVEAPATAARRRKSGRVNYLIENATPAMLCLVRAAE
                     PKPYTALSPEALYEAVQPHDHTLRPSPFIAHQALMDFYKACDGYYGVNREEVDVQQLT
                     SFEHKKTHGGASSGNNSGSNSGATLSSLLSGSASAAPSSSLSAAAGAPPLPPLPSPDD
                     PNLAEKLNDYRIAQLRRNAQHVDNTVYHAHNSSNGGSNSNVANAGSSGVCHFYRTPEG
                     CQRGAACPFTHLDKHGQPVNRVAKS"
     gene            complement(<314430..>315563)
                     /locus_tag="LMJF_10_0650"
                     /db_xref="GeneID:5649667"
     mRNA            complement(<314430..>315563)
                     /locus_tag="LMJF_10_0650"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681346.1"
                     /db_xref="GeneID:5649667"
     CDS             complement(314430..315563)
                     /locus_tag="LMJF_10_0650"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681398.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649667"
                     /db_xref="UniProtKB/TrEMBL:Q4QHF0"
                     /translation="MLNHKRMIVPAEHPFLIPRALFLPCAATGIVEDGRRATGACDVG
                     DCVVAAEGAASRPLHCYGDRPVLLLDCTGALLQRRQRRQRRQELQSRASQLVAARADL
                     LKTKNLWSMRRIRARRQNKELSVPVSAVGDAGNDADRDNEDSTARAPSGAAEGGDSTS
                     QLLSELSRQRKAITHEMKEIRRELLTLLQEKRKQAATRDGCVLMLPSPETGEVQLFPG
                     HHYRTVCFVGDELREVLPSDARDTDVATAHHWQRRTPPLRKLASEGVAREVSEKDEGG
                     AGGEHTSAKVGERPLWAMAELLGCVLYLRQCRRNPHYRPRRGATFDDDNIECQEGREG
                     RVDFDKIAASISYDMVDQYLALPACEMAMYREWAIDKFKLLPP"
     gene            complement(<317168..>322996)
                     /locus_tag="LMJF_10_0660"
                     /db_xref="GeneID:5649668"
     mRNA            complement(<317168..>322996)
                     /locus_tag="LMJF_10_0660"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681347.1"
                     /db_xref="GeneID:5649668"
     CDS             complement(317168..322996)
                     /locus_tag="LMJF_10_0660"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681399.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649668"
                     /db_xref="UniProtKB/TrEMBL:Q4QHE9"
                     /translation="MNPLDYLPPDVFTHTWGAPTRAVQTLGSHVCVVSPRYERMAVAI
                     MAVESIEPAPPPQFEVVCTGHTRTFLPTPHPGSCPLDYTALFVTLHRRQSEKITCRHA
                     SRPVPLLASGSPGIRQLHEAFPSAAAGGWVTARTPPSPAAAYASQNVELGIRGRRVED
                     FATSAGRSTPPPSGSLEGRLAVVERPVPESVAVTPVTTAALSIPVGTVHHRQQQQQHQ
                     SLGTGQPYDHHQRRPRPDPQRMQYRVGRSGSTQPPPLPNLHGGTPSNTGSATTPLPTQ
                     QTEEVAPQPLARLLSSLPPSPAALPRSPAIASSASTSMPRDSTSFVSLAASSLRPSVS
                     RAISTETTEATALPSNIDRHYILMRRDSSFLAGRGDTPGEAAMEDVQQSRWLLSRHPR
                     QRASSGNADAVVDEVGAGAHGEVGTRERLQQQLQRTLERQRQRELLTFDFNDGLGDAR
                     GPQQRTAEHMFLSPDASGAHWSASEGPRRGRAAAAAPYVFRGTGADDNSDEIRADSVA
                     VARGLPLASAQTRSRGSTSPSPQQHDLPLWWRRGQAARGRQPQPDAAQQGHSDDHRLS
                     PSPAAAVGEDAHPRHTGSAPQRTSGASSPTPASSVVVSRSAAPRATSASTCAAQMLLS
                     PSVRVDRGGRSASLHVSLSFATAGVVDVDDTIVTSSCAVLPSPIPVDHLRRPSLPNAA
                     LTDVVPSSRMPSEEAYRAEGAMCLGDSSRRVSALAHPRNSVSCFNNPAVDAIHVDAVT
                     AAAMASTVGHRAWKLGSRCSSCPSASATGRTAASERSSRDDFDFERSTSEPHQDGVFE
                     EDAGAVDEETPFVRRTSPGTRDDTSKESSSQRSSDSPGAAEPQGEIFKSSASAGGRGD
                     DCVRGRRSRRDPRLPPLSCAASLSPSSSSSPAPWHARTDTKAGGMDVDAAVEEADEAA
                     GSTNAPALAATTSPMVYLCDMLRLSFSPDNGADNSRTVGAEIDEAQKAQRAGTARVGG
                     VQGRYTCGPDNRRRHSRTVLTDDDDDSSLCRSAASTSSSPPSQSRTAIRRLMDMEDAV
                     VSDGNLSASPPSLLDVTRGRCGTAASTTTTGPSACTPHRVAGRLALTADERRLQASTA
                     STVAWGRANGSEHSHRGAAAAVVTATPEESSARSSILSIFSTPAQTRLQSLLQASTWS
                     TATPCSHEQGNSNHSSRRSAHRRPQVAHATSTGGRTSPRATREDSDDVEDEIKMGTAD
                     QNPYGRVPTAAATASARPMMPCDQAKRKCDNGGLRHSPGKGHEPQHLVRQGEKGGEDG
                     HVRGSSNSSSSMTPTRLSGVYASPAAARASATVIATPSRTAVAEAAPASASPLHPSPF
                     RSTGSFLQVYHGWRGSTSTAAPSGANWLSLSQEADIQLLARTTRLTHARGGSTTGAMT
                     PKVCDLARSPQQPPPSPPSSPSRRSTGSLSFFLAAAAASPGSGGGTRTSGGGGFSEDD
                     EGRGVRAAGSAVYGSAVARRRSWAPRKQQQKHRWRQQSHSSMGMHSPSVSVRGISRTD
                     SSGSRFSEAFGVAPQRLTFGSAIASVSVANSNTDSVERWPGAYSTPTALALSHPRQQR
                     QHRAPLPPYAFSPGDACRRGDGVEEAAESSRHSLLLSSEQPTASPRPSWALSTSSPLS
                     LSPFAPRTPSGRLSLPSTEFNQAPLRHGETRVGFSTRSPPSTSIASAAEQRTQHVRGS
                     SRRSRRRANRALSFSTLRSSPSALATPTVWAGVEYTLGAATPLGGRIDAPSPSPLNSG
                     RHCRTSSDGSMTRSMESVHIASSGRSRASASLMLQLQPVQPRISSTAPQPTLADELRL
                     FASPVLPTAPIEPLVSSSSATAPLPLTTFIASPPGRTGPPTSTIVPPSTSSLVHSPRQ
                     RPSLPPELLALMQMRTSASSTSAAAAETHRDPGDAPSSMSAQPAESGAMAPPCAFASY
                     STTMQRRGCSERRDVNVEPGQGSPSSPHRPGSSPTTVRRGLG"
     gene            complement(<325778..>326758)
                     /locus_tag="LMJF_10_0670"
                     /db_xref="GeneID:5649669"
     mRNA            complement(<325778..>326758)
                     /locus_tag="LMJF_10_0670"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681348.1"
                     /db_xref="GeneID:5649669"
     CDS             complement(325778..326758)
                     /locus_tag="LMJF_10_0670"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681400.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649669"
                     /db_xref="UniProtKB/TrEMBL:Q4QHE8"
                     /translation="MALAAAWTPQRQFHFPSVNLRTSPVSCGATPTRTFLRRARLSAP
                     SLLSQNAIQYRWIRAKDQQQQQQDRNAGETGKEGEESSTKTEGGDQDGDQQSGSSAKG
                     SKNKKGDKGQAKKKGFMDHVRGLRDDYANFPHIYNSVNAINFIVFTVFCLCSTGSNTE
                     ERWWLEKWGVDNSVRPWTWLLHSFLTNNFLAMTYAMMLLHTMCHHVLPTLGSRGLMMY
                     CGGTAVLSGAIMWLSNYLYYGSTAAPEKQFGPWDVIAALFVMEYLYYGLTPISILSSF
                     SGWIKYACWVGGVCILYFDWQPTLIGTLVGVAFCKGVPRWKAVRPTTKAA"
     gene            complement(<328209..>329336)
                     /locus_tag="LMJF_10_0680"
                     /db_xref="GeneID:5649670"
     mRNA            complement(<328209..>329336)
                     /locus_tag="LMJF_10_0680"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681349.1"
                     /db_xref="GeneID:5649670"
     CDS             complement(328209..329336)
                     /locus_tag="LMJF_10_0680"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681401.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649670"
                     /db_xref="UniProtKB/TrEMBL:Q4QHE7"
                     /translation="MRTSDARPASPSAAPPQSRKYQLSQRPLQLPRPPPRRFLEHPHH
                     NLLPCTSDVKRLMENEYELRRVVRDVLLERLGMEGSHVEPPLRLCTEDSAEVTASPFC
                     AVASVSTPLSSAGESAKQPRCAHDTGLRSMRAPDVDDIAGSSQPTWLMPWLQRLRMEQ
                     EKQLRQMRKMLVVARRSVSPDSSDVDARASSLMKTTGEARDDTRTAEPPHALLWQRHR
                     CLPPADRPEAVEACSTLRAMQETMQAQSTQLARLEELLQETLIPDTARRTSHGAGALP
                     LPSPSVHQVEAAAAARANHTGHRSRSNDTVLPTLTHTAASPKKNVRRAVPSRSGCSAD
                     VPAAAAAAAAATSSRVSTCVSAPSPPPRLHPEKRTLCGGVH"
     gene            complement(<330417..>335390)
                     /locus_tag="LMJF_10_0690"
                     /db_xref="GeneID:5649671"
     mRNA            complement(<330417..>335390)
                     /locus_tag="LMJF_10_0690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681350.2"
                     /db_xref="GeneID:5649671"
     CDS             complement(330417..335390)
                     /locus_tag="LMJF_10_0690"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681402.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649671"
                     /db_xref="InterPro:IPR000357"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="UniProtKB/TrEMBL:Q4QHE6"
                     /translation="MENRVVALAVLENLIHWPLPNRSGYAALARGSGEDEEDGSATAA
                     LVSAGDVEDLSREPRQRKQDRYRAVLLLPHLCHRLGSRWAETEIVPYLMRCVEEDDPQ
                     LALVTGMALLGVALPRRAPLGPTISASGSSSPAAPGATDNNLGAFLSVEDVQPVCSLL
                     AASSAEETRQFTAQVVLPHLFFGVALERDITLESWDRKYVPLSVLQADMTTTETSMEA
                     NEVGEYLESGDVDGGAASTVRLMAAVRKQLLRKHRVTMKARAAAARASSTVSGKDSHT
                     SSSAAAVTDPPAPTEEDVRKRCYDLALEDESVQFVWSGGYTALTGPWCFDGSRRLASL
                     CKDVSDACGRCSSGSGAAACRTMASFRCFRRHHRRVDNGQTLRGEPPAACLPLYGADL
                     DLYGAAYASDADSGSGDDFFSVNVRARALVADLVRWMDALGPPAVAATDTSPSADAGT
                     SRSARLHADGSLSLFDYLCCDERRDALRCRWRSLIKILQGFLESPYPGPVAAAVETVS
                     GLLHAIQAALWEAEQQQQQRAKSSSAGSHAAPLRNKATSIDAGAEVDAWSGIRVPAEP
                     LLTTAELQTFIHRMTRRHVAYCVAAAVSARTVSMPPSPTATSMKVLTDSMGRFMRSAL
                     VTAQGLLADLLLRHHVLMKLDVCSATASTTTSESPHHRLSLGTSCMMLQVGVGPSESR
                     LASYSAWDVSFACVSATAGAVTAATPNMPDDASFLMTTTPAADERTEKGSAKWLPGTL
                     NAVSVFRLHRLVRRALLRALPLCVDFPCILYSCASTRALSNASTSGTSASAASVFSLS
                     AVCPMLLQVLVPPSALPPLLHVLRVTVELQHQAEKYHAAGEKHAGEAAAPTPYTCHVD
                     PAGPTMTVPALWAAMTAAGSVLQLDTAAAGALSTVEESPASVDFALLEAALDAVQRLM
                     AEAAVQLSAAPPIGSLRSASTPVSVAGAPPSHVLDAVCAQLFILLAACLRWVPRYTNW
                     KARWLIAQRLPRLTATFCLLIVRMSSLAGGADVPAASGPTAHQLRAQTWLTHTLHLLT
                     SLWTCAAQFGTAPLHDLVDDEEVEVRCIAARCAAQCFGGATEAVLRLSSSAGAGDERA
                     RAKARVTSQESSLLPSLCKPLVQLLDAITQCVLVAASDGDTRVLCRSAEALAGLSRTL
                     SLLVVTDPSAATRPASSTSTRNEEEPAVWARYLHSNTDTLLRLMTDKRPTVQLALVSQ
                     LTDLLLMRMRKPPHEKRQGQSRNGRAQGQLMGDESDASFTCVPDGDGEENSENDADAP
                     HRSPDEVQYDALLQCLRQLSQHELWRLREQYALLLAHLCGCLLLTAAAAPAPAPHGRH
                     ANPQRIPSMDFSAVNAGRVPGEGGTDETTRGSVTDASVMAQQGGADASLWAHTHPLYQ
                     LARTELLTLLVAVLFDKVKAVRDAALDAVERMCVQLAVASSRSAAGTGAGGGGGARQG
                     SAGTQFGVGYGTEGVDTSADAVATASGSLNANTFVDDVLWPRIYAYAHAWETYLSRSA
                     LLRIAMRLRVDKTSAFIPLLDQLARDPVLNVRLVVAKVILEVLLASSPEVHAMTTPAL
                     FLEAKDGEVASSRTSTPTPMSSNKPELPSGTIAYSILMSKPVPPLLAGSGSGNGRAAA
                     IADVVLPPIQFDEVERAGVILQILRQLLKDPSSDVRDEAAKALKVCF"
     gene            complement(<336290..>339142)
                     /locus_tag="LMJF_10_0700"
                     /db_xref="GeneID:5649672"
     mRNA            complement(<336290..>339142)
                     /locus_tag="LMJF_10_0700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681351.1"
                     /db_xref="GeneID:5649672"
     CDS             complement(336290..339142)
                     /locus_tag="LMJF_10_0700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681403.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649672"
                     /db_xref="GOA:Q4QHE5"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4QHE5"
                     /translation="MSRVRILNLPNDCTEEQLKQHLLRTAPREAPLLEITDVQFIRRP
                     ATATDRNHHHKHQKQRQGSVGAVAAAKAPKMILRMAFVGFRTSAAGHFVAQYFNSSFF
                     RSSRLKVELAKGLNEVGITLNQLRKRQQQQQEETSDRKNKRKSAADGAHASGLTSSTT
                     SREQATTRKRARDGDREDEQKDSDTGATLADSLARRQREFVELRSKATEGPTWAAELL
                     LAPDTSPTAAADDDEQKNFAMDEKTQQRRRHQQAERHTADSGDANDDDEAEQERRALS
                     RQQALGEVSDMDFLSGLAGSSTHSAVDAKVTARREDDADDVAFLCDNDVDGDIPATAV
                     NTASATSPGKKGIDHDAAAMTQEAQEEIARASHRIRLGNIPYIATEEHLKQFAASLVG
                     PVEAVHIPLTKDTRQNKGAAFVRFSSAEDAVRALQLCRGAILMGRLLRVSAAEEDPHS
                     KRVMEREAALASTAAAQAADGALSGANLAGSSSFKKQREADRRGKEGGGGQMTWNTMY
                     MNSHAAVETVAQRLGVRSEDVVGVGAKGAAVRAAIAEAYLTSEVQHVLSDEGIAFDLL
                     EGATQNFLKSRSNTTILVKNLQLKDGNDAAELTKLFVRFGVLETSAFPSAGTCALFRY
                     THPQDARIAFTRLSYKLFKTAPLFLEWAPVGALMEDGEGGSAPAVAASDLGLTAGPSA
                     DGDPEADTGGSSATAVAKAMVYTLFLTNIPFQATEDELHAFLLDACPRLARAPEALIK
                     RLVLQQEQGRAFLTVADQSTLAYCVSKLNGKTLAGRTLSCVVSKHTAQLQQQARVADT
                     TATPQGTTRRCAGADADDDNDNESDPTKTAVLARRRAGSANPDNGGSGTISNSASASR
                     VPPGSDPQKLIVKNLPFEATEKDVRELFSAFSEIRTVRVPRKSHTFSSHRENNHRGFA
                     FVEFLSEAEAARALETLKATHLYGRHLVLQYAKLDG"
     gene            complement(<342674..>344140)
                     /gene="AAT20.1"
                     /locus_tag="LMJF_10_0710"
                     /db_xref="GeneID:5649673"
     mRNA            complement(<342674..>344140)
                     /gene="AAT20.1"
                     /locus_tag="LMJF_10_0710"
                     /product="putative amino acid transporter"
                     /transcript_id="XM_001681352.1"
                     /db_xref="GeneID:5649673"
     CDS             complement(342674..344140)
                     /gene="AAT20.1"
                     /locus_tag="LMJF_10_0710"
                     /codon_start=1
                     /product="putative amino acid transporter"
                     /protein_id="XP_001681404.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649673"
                     /db_xref="GOA:Q4QHE4"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:Q4QHE4"
                     /translation="MSRLPSTASDNEPAHLTQMEDERHRKTLIEGFMSVPEVEGDKGA
                     NNGDPSFQQKDQKVPEYVEMDDDDDMSEVRLAAGELKENTNIYKSAFHVFKANVGTGV
                     FLLPTFYPDAGYVVSVILGVLIGAAVIDCTRLLVDVKIKINRSDVTTYSQVCRYVCGA
                     GLGWFLFVAMCLAQFGFCLMYSQLFGGTMDEFANFKGSKYLWVTVVFFLCFPMTCFSD
                     NLSLLAITSIIATVSVFYSLICCFAMSLMQLSQDGVHPSCDVAGNRIPVGWFNNLANN
                     MMVLEGIAIILPVHAACTQKRLVPKMATLVITGVVAWYILFGLTGYLAYGDSMTTSLV
                     AKVAHSPWGTSVRVFFLLNLIFTYPVQFMSAMQLIDQTAGCKPRSWMGISLRLLINLV
                     IWALAMGMPTSAVNTVVAFIGALPSVCMVMVIPSVLAMHVKYAVEHPDADRNTLQYWK
                     KIFVTAPCFTFKRIRCYVYLVVAVLIMVIGTYSIAVTL"
     gene            complement(<345505..>346971)
                     /gene="AAT20.2"
                     /locus_tag="LMJF_10_0715"
                     /db_xref="GeneID:5649674"
     mRNA            complement(<345505..>346971)
                     /gene="AAT20.2"
                     /locus_tag="LMJF_10_0715"
                     /product="putative amino acid transporter"
                     /transcript_id="XM_001681353.1"
                     /db_xref="GeneID:5649674"
     CDS             complement(345505..346971)
                     /gene="AAT20.2"
                     /locus_tag="LMJF_10_0715"
                     /codon_start=1
                     /product="putative amino acid transporter"
                     /protein_id="XP_001681405.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0715"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0715"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649674"
                     /db_xref="GOA:Q4QHE2"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:Q4QHE2"
                     /translation="MSRLPSTASDNEPAHLTQMEDERHRKTLIEGFMSVPEVEGDKGA
                     NNGDPSFQQKDQKVPEYVEMDDDDDMSEVRLAAGELKENTNIYKSAFHVFKANVGTGV
                     FLLPTFYPDAGYVVSVILGVLIGAAVIDCTRLLVDVKIKINRSDVTTYSQVCRYVCGA
                     GLGWFLFVAMCLAQFGFCLMYSQLFGGTMDELANFKGSKYLWVTVVFFLCFPMTCFSD
                     NLSLLAIASIIATVSVFYSLICCFAMSLMQLSQDGVHPSCDVAGNRIPVGWFNNLANN
                     MMVLEGIAIILPVHAACTQKRLVPKMATLVITGVVAWYILFGLTGYLAYGDSMTTSLV
                     AKVAHSPWGTSVRVFFLLNLIFTYPVQFMSAMQLIDQTAGCKPRSWMGISLRLLINLV
                     IWALAMGMPTSAVNTVVAFIGALPSVCMVMVIPSVLAMHVKYAVEHPDADRNTLQYWK
                     KIFVTAPCFTFKRIRCYVYLVVAVLIMVIGTYSIAVTL"
     gene            complement(<348336..>349802)
                     /gene="AAT20.3"
                     /locus_tag="LMJF_10_0720"
                     /db_xref="GeneID:5649675"
     mRNA            complement(<348336..>349802)
                     /gene="AAT20.3"
                     /locus_tag="LMJF_10_0720"
                     /product="putative amino acid transporter"
                     /transcript_id="XM_001681354.1"
                     /db_xref="GeneID:5649675"
     CDS             complement(348336..349802)
                     /gene="AAT20.3"
                     /locus_tag="LMJF_10_0720"
                     /codon_start=1
                     /product="putative amino acid transporter"
                     /protein_id="XP_001681406.1"
                     /db_xref="GeneID:5649675"
                     /db_xref="GOA:Q4QHE2"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:Q4QHE2"
                     /translation="MSRLPSTASDNEPAHLTQMEDERHRKTLIEGFMSVPEVEGDKGA
                     NNGDPSFQQKDQKVPEYVEMDDDDDMSEVRLAAGELKENTNIYKSAFHVFKANVGTGV
                     FLLPTFYPDAGYVVSVILGVLIGAAVIDCTRLLVDVKIKINRSDVTTYSQVCRYVCGA
                     GLGWFLFVAMCLAQFGFCLMYSQLFGGTMDELANFKGSKYLWVTVVFFLCFPMTCFSD
                     NLSLLAIASIIATVSVFYSLICCFAMSLMQLSQDGVHPSCDVAGNRIPVGWFNNLANN
                     MMVLEGIAIILPVHAACTQKRLVPKMATLVITGVVAWYILFGLTGYLAYGDSMTTSLV
                     AKVAHSPWGTSVRVFFLLNLIFTYPVQFMSAMQLIDQTAGCKPRSWMGISLRLLINLV
                     IWALAMGMPTSAVNTVVAFIGALPSVCMVMVIPSVLAMHVKYAVEHPDADRNTLQYWK
                     KIFVTAPCFTFKRIRCYVYLVVAVLIMVIGTYSIAVTL"
     gene            complement(<351961..>352806)
                     /locus_tag="LMJF_10_0730"
                     /db_xref="GeneID:5649676"
     mRNA            complement(<351961..>352806)
                     /locus_tag="LMJF_10_0730"
                     /product="putative deaminase"
                     /transcript_id="XM_001681355.1"
                     /db_xref="GeneID:5649676"
     CDS             complement(351961..352806)
                     /locus_tag="LMJF_10_0730"
                     /EC_number="3.5.4.-"
                     /codon_start=1
                     /product="putative deaminase"
                     /protein_id="XP_001681407.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649676"
                     /db_xref="GOA:Q4QHE1"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="UniProtKB/TrEMBL:Q4QHE1"
                     /translation="MSVHYVDTFMRAALREAELALEEGEVPVGCVLVRTEANETVYTK
                     LALQSSDAVTNAPPHAALLRSCDQLAESCIAARGRNQTNLQHHALAHAEFIAVQKLID
                     DATRGGDGSAGASSSKTGASEGENGVVEEEKQNRLTSPPTTPPLSSLADYVLYVTVEP
                     CVMCGAMLLYNRIAHVFFGCRNPRFGGNGTVLALHASPRQQQLLLQQPSQPDQSAATM
                     PRFAGTSKSSPSVDEGGIVCRGEWWPGYVSEGGHTEAEAISLLQRFYERENPNAPGHK
                     RRRKA"
     gene            complement(<355060..>355434)
                     /locus_tag="LMJF_10_0740"
                     /db_xref="GeneID:5649677"
     mRNA            complement(<355060..>355434)
                     /locus_tag="LMJF_10_0740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681356.1"
                     /db_xref="GeneID:5649677"
     CDS             complement(355060..355434)
                     /locus_tag="LMJF_10_0740"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681408.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649677"
                     /db_xref="UniProtKB/TrEMBL:Q4QHE0"
                     /translation="MSGHHHTSDPNLTQNQGNMLGDRPCVRQSRLYREGCSGNVMKEI
                     LGQSELSWKTDQTEGCYGGGHVYDHNTEDHRAVPTQQQQQKQHQPPLQPQQQTVSAST
                     GRGLRPGAGYANRQTYNIFSGQ"
     gene            complement(<358611..>364697)
                     /locus_tag="LMJF_10_0750"
                     /db_xref="GeneID:5649678"
     mRNA            complement(<358611..>364697)
                     /locus_tag="LMJF_10_0750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681357.1"
                     /db_xref="GeneID:5649678"
     CDS             complement(358611..364697)
                     /locus_tag="LMJF_10_0750"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681409.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649678"
                     /db_xref="UniProtKB/TrEMBL:Q4QHD9"
                     /translation="MNRAFLSDLAWRISLHPSCRAELRRHWPAPHYHKTPHDIEEAEE
                     QPRCQATGASPPVAAVASQDESKKSGGGGSWAFNPYETFSLRLKRKRKEPVKAGCRSR
                     CGEAALPGQHQQQQQQTRMDASQAKAMRQIRSNSPSSNSTSSPARVVGVRLNTSSASS
                     LTRASKLSSSLVVTAKPAAAVANAKRAAANKSKSTSAPAASSSALASGQVKAVAAAHP
                     SPSTLASASSQQRVGRVVERSASLPLIRAAAAAATVTKAAASTATKESDEVPTSVVDD
                     SASAAPAKSKRDKNKAKSVHVDANDTKLKTVRNRAAATTTGGPSIGPAVAKKKKTAGH
                     CSSTIGSNAADSDNGSERAGYIRDPLNIRLPHSPPYRGRQTAGRNGHRPVHVTIRWSG
                     ARQRRRRFFAQYPALAQPEKAMYLQQLICRAEPSPSLDGREVALDAVASEEKHYSGAQ
                     EKVPHQGFTPPRVPRSVNFSDAATTVGQSAPRPPSTVAGTFLSDSTPRADARLQQQQQ
                     QQKLCSGDRKAGHTTTTTATTGRRASLSSTGGHAAARLHARMRSQGEDEKVALYAVAS
                     NASINESNSGALPVRPFARHPPLKGTSTLSQSTNTAARTSALSISGSEMPTPSSTDNY
                     SATLHSAVCRPNSLFIVRSPPQDYADEAAAYGSYYYSRQVGVAGNSSGPLAAMGPIGS
                     HSLHSSSGGVASASGPNRLRVTYVTANACSTTRTWCQHHHSLSHSTDRGSSPYQPSSL
                     APANPSASQSMASALSCATLSPHVPQQQQQQQRQKGGGPRGVAHIQRPHPLNAGGPSL
                     PDPRPSGKVWYNLDSPTLVNSAASRTGDGGGDGDGGDAHAESAFSALPSPSPSATSTP
                     LPSTTLCAAAAAAGPRIMMRSATIRGDAATHAGGGTGTPPPLNVKTVMAQRHCSCLLC
                     RQQQQERSSPAPVGDSAPVATACNSGPLPHFPHENSSSSSAAGTVAFSPPTVHVASNP
                     SCSDSQPRRQKLQQSSIISAPSPRPPQAPVPLGVAPGSVQPLAGKRATSTQHRARAGE
                     GAIDEPRSSGGVGSRETDGAPCHRTSVHAQRQSSHFSFTNLAEIRRTGELLKLPQQHS
                     HSKVPATNQLSAESSLHLFATGEGGVDYSNASSVQLTQQYLDSSPQPVPCLTTPHTRR
                     DSERDLQAPSFWHPVYTATRLYAASESTAWLENNSFATVTATPAMSTVWGHGTSTGPH
                     AGYLCNSNNFMFSEPATPLCWTQQRNSSGLVPSHQRVSSCSLASTSLLSHPHLHTPSF
                     GTMGSTLPQGARRTPLGLPRSPSLVTSTATPTAAAPQVFCKYQRPERQRRRRRFPRLL
                     PGTRCPGMAGRLAFDAHRAAVRSGAIAEAEECSYYLSHERCTSASAMPGTSLTTPHHR
                     STVRQSSPSLSPLLSGSPLCVVSLADCRANFSHDAASTSTTGDGRNAKAHWDEGTEES
                     DEMGDEDEETTFGTPRFLFHIPPCCDDPYHRDEEALEMLSITTTSSCAFGAGLDGLRW
                     QDWMPSSPLETSEVMLRTVEQAAATATEAAASTHARDSNRLSTIADSNNRGIKDALGS
                     GQAETEAGARAAHAVDSFVTGSAAAAGLGAPSSSVATSSRQPLGAFAEGGKVVSTDIA
                     APRNSEDLVCVTCRAMDSASAGGIGEGATDLHDSPTGASHDFSNSLNAPGGGKRPFIA
                     EWIVSKLQKRMEKKKKMQRKQLEREAAAAEAAGMDNTLQFRLEGGSESLPSPAGAPRA
                     HSRTSSMSDCSDAGPPCGGYFSQAFKSYGSRCLLCSSPMMPTGAKAAQQHRQRLAYLA
                     AAYQTELVIHEQKRREAEENRRGLEALVHRYRAKMTPAAAVAGYYYEAHVVTSPTIFR
                     PHAQPHKESLATSSLKPTTTNATAAAKAAYTVSEGSSNGVNPSGSRSYSIGSEEHAGD
                     AAVEAHSAMSFWFPRIPEQGNATPPPPPLTHTSKAGKGRSNTISQQQSDTTGRACAKT
                     TAAASSSEAAKLKPSCAAAPERQPHCKREHRDCHAFAVPSTVEAERVRVALDTVKTKK
                     QAIESWIFGLRL"
     gene            complement(<366803..>368710)
                     /locus_tag="LMJF_10_0760"
                     /db_xref="GeneID:5649679"
     mRNA            complement(<366803..>368710)
                     /locus_tag="LMJF_10_0760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681358.1"
                     /db_xref="GeneID:5649679"
     CDS             complement(366803..368710)
                     /locus_tag="LMJF_10_0760"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681410.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649679"
                     /db_xref="UniProtKB/TrEMBL:Q4QHD8"
                     /translation="MTGTPPLWRRLQPLQPTLPLFAGSNHSARKTTTEHAAAAPRRMS
                     YSFVVVPPPVPAATPAFEAHVSTLLRHVPHPTFITCTSYSPYFTSAAAESLAAAADTA
                     DESANAMEASVTQQALSYLHQCVAADVGLVLTVTATRATSHAESVQSTQGGDQDSQQH
                     PKQHTSSSSASMVPTTTTLTGASRGGTAAILADFIGRTSAAPATKLGTANSQEATRHR
                     SRGLMVLRGDDGGYTRQCMIAAQKGGASASPPSLSPNPYVDFADGVDLLRFIHSTLRG
                     RDGEAMCEITGDEPAGAAVCLCIGGYPQGHVLDRQWGADAATAAAVPSAQSPLPCQTL
                     ASLRFLDEVDTVFADTEAQLRRAQGTHSAPRPPSLESCVEAAEALFARLGAVRRLWTT
                     PSYYPPSVRAACTRRTVANKVFLRPPGTRQCVADSAWDGCGSAGAHVVVTQVITSATE
                     FFDYVEDIRNALRSSVPPARGVPCDRGRDGAAATEARGASVPCLQLRAASALPSSSPS
                     LVIVPGLMAPLRAEQFLRSALQLKVIPSVPFQRALREYEGALHSAVETLRSAVSSNAI
                     DVYAEAKERAEACFQEWMVAITVDIVRDLRARGYTHVNFSAFQYGCGDAVGCVVAALA
                     AEGREEVVEEP"
     gene            complement(<369352..>371052)
                     /locus_tag="LMJF_10_0770"
                     /db_xref="GeneID:5649680"
     mRNA            complement(<369352..>371052)
                     /locus_tag="LMJF_10_0770"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681359.1"
                     /db_xref="GeneID:5649680"
     CDS             complement(369352..371052)
                     /locus_tag="LMJF_10_0770"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681411.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649680"
                     /db_xref="UniProtKB/TrEMBL:Q4QHD7"
                     /translation="MSTTQAALFPFRHHWRVPVTLAINTTVPNGAPSATESGGCTQPQ
                     SPGEQAAAHAAVTPDGIDAVVTDFVFAQSGRRLLLVRGDSPPDLRLCLSEDSPNGPLS
                     GALGAGIAVEASPLQQAHRALCTGAELIHHVSTLRDQQLEGHRPCDGDTRASALELCV
                     AGYPQGHPLDRTWGATSAAYSAPAEAAATGSVATRDSSVAAARQRSLEFLRAFEEDFD
                     AAEHAFTAAVRVAKRRACVVSAEKRSSDISVDDGTPSAASGEPRERARHLCTPQAVMP
                     ELKEPCRTLGRLGAVRRLWTSSSIYAPYVRAACIHRMLHEKVLLRSPSEPEHRRIRSG
                     SFHGGAAAPVIVTQMITTAQGFTGYVDEIQRGLRAWAATAGGGEQPEPAGDGPQQQHP
                     VHAAAPTALTPPISVIPGVLLPHPTDVHVLLRSLYYTKVIPSARMQKALEVYASELMI
                     AWRQLADEPPRRKREPALQDDTFLQALTESNGSAATLEVSEDRVAQVEARVREVRRCA
                     SCRLTSVWLSETVDLLHDLQRHGQARLHLFTMFNDKVGVRVAQLLAAYDAPRGASAEQ
                     "
     gene            complement(<373377..>374636)
                     /locus_tag="LMJF_10_0780"
                     /db_xref="GeneID:5649681"
     mRNA            complement(<373377..>374636)
                     /locus_tag="LMJF_10_0780"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681360.1"
                     /db_xref="GeneID:5649681"
     CDS             complement(373377..374636)
                     /locus_tag="LMJF_10_0780"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681412.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649681"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q4QHD6"
                     /translation="MKLRCFLLRYYPPGITLEYETSAGQVGQKTIGLLSLTPTTPLEP
                     LVDKIIAEEPLLNGKYHDQIVTYLQRLVEKLIAGNNPNQTFTLFKSLRAHMLPLTNCA
                     FNKNGTKFVTGSYDRTCKVWETATGNELVSLEGHRNVVYCVGFNNPYGNRVATGSFDK
                     TCKIWDGESGQCLHTLTGHVTEIVCMSFNPQSTLIGTGSMDNTAKVWDVETGQELHTL
                     MDHTAEIVALNFNTYGDLIVTGSFDHTAKLWDVRTGTVVHTLREHRGEISSVQFNYAS
                     NLVVTGSIDRTCKLWDVASGRCVSTLRGHTDEVLDVAFSVSGNMVASASADTTARVYN
                     TATCHCIASLNDHEGEISKLEFNPQGTKIITASGDKRCNLWSVETGQVLQSLVGHTDE
                     IFSCSFNYEGDTILTGSKDNTCRIWKS"
     gene            complement(<376605..>377270)
                     /locus_tag="LMJF_10_0790"
                     /db_xref="GeneID:5649682"
     mRNA            complement(<376605..>377270)
                     /locus_tag="LMJF_10_0790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681361.1"
                     /db_xref="GeneID:5649682"
     CDS             complement(376605..377270)
                     /locus_tag="LMJF_10_0790"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681413.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649682"
                     /db_xref="UniProtKB/TrEMBL:Q4QHD5"
                     /translation="MGKAEQKKKEKIVEDKTFGLKNKNRSTKVQAYVQQVKQSVDQRN
                     PQDRKSQAELLARRAAKEEKRAREAELAKLFNDVDQQQRKKRDAEAAETAEGDDQYMC
                     HPEEYLFRPEDFDEVEQDDERLEEKLEAEREKLKDRTDLTPVTEASFQAWKQRKREEA
                     AEKEAARVRRAKSGDGKLRGWDLWQMDQELFVDDENADEFYEREELEGLDAGEDEAAF
                     DLS"
     gene            complement(<378035..>381292)
                     /locus_tag="LMJF_10_0800"
                     /db_xref="GeneID:5649683"
     mRNA            complement(<378035..>381292)
                     /locus_tag="LMJF_10_0800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681362.1"
                     /db_xref="GeneID:5649683"
     CDS             complement(378035..381292)
                     /locus_tag="LMJF_10_0800"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681414.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649683"
                     /db_xref="UniProtKB/TrEMBL:Q4QHD4"
                     /translation="MTQKRKLRAVGGDAECLDVLLNSERYQSEKDARELRLRGVATLG
                     QWKEQPDRVQLSAYTRGLLEAAYSRLSRHRHRSQTDEVMAWLTRAIQRAVADELMAPK
                     RLTDGAAMADSSTPPYLVAVNASAVRDAEAALANTAAERHATPVAAQPATTATAAEQG
                     DDSGGPAAVAAPFSDSAHNEVADENVAARRRGPRQRPVVSDVVPKASEAAAVEEDGVA
                     ESEEVEDVLDEDAEEVAPLTAEERPTRRPAASRSPQPSPAAAATPAGRHSSKRAPEAA
                     PTAPRQQQRQPPPSHGVEEEVEAADADEDDEELVEEVEEEVEEAEEEEAAATTAAPSS
                     TAPVQPSSPPAPAAAPAPPATAATAAERRERLVRLAELMMKQFNTADGYLHPTNKAER
                     EAQEQRGDILVLDEDTAQVDPLVMFSTYHAATITDADPVGVRALKTIWTSYNKHQMAL
                     EEATDDAAVEFYKRESVNALLYGSVLMRALAREEQVVVLEGTPLPPYGFPLVSSDTRP
                     FAVFAAAGASSSSSATAVTDMTPGKVLTAAQAYKMFFNSKEKRYSPFRPAIDQSAGCS
                     VVRLSGTTLHLYYTSMKDHIIEKDVRLPFAEVMLGVLHLLRHKVLPRVNVVHYHLIAT
                     KMADPSDSTDFMLRSTATIDLTNPFTREELARLRALATPLGMADEMDEYRCIDDLVMD
                     IEDSSGASVVHSLLHNREDLEATLTATLAQLLPEDGDRAAGAAEAAEDAEEKDEEDVE
                     VAAPPPPSRKARGAAAAPASSPSPGRSNRRRVVPETDEEDTVRVADEKAAEAVPARTS
                     RGKHRQSAGTPLPTAAAAAHAARDREQEEAMLEEAIYNQWQQQRGTSKAGAAAATTPK
                     SMAVAQHSDNDGASAEEAEEDFDEEYEEVEELEELEEAEKELPPARASARSSLPSASA
                     APGAGARARDAGASSPAPPASQAQGSSRAVAAVDAAAADEEEYEEDSVEEEEEEAEEM
                     EVVTAPTIPRAPAGRRAVPVAAAPARPSPPPPPPSPAVRRAPQKLDDDDEALQVRTRR
                     GARRSTARARAPPPTAHEDFEEAAAAAVEGAPEVAAEDADEDQWFKKRPKRRYFQ"
     gene            complement(<383381..>388858)
                     /locus_tag="LMJF_10_0810"
                     /db_xref="GeneID:5649684"
     mRNA            complement(<383381..>388858)
                     /locus_tag="LMJF_10_0810"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681363.1"
                     /db_xref="GeneID:5649684"
     CDS             complement(383381..388858)
                     /locus_tag="LMJF_10_0810"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681415.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649684"
                     /db_xref="UniProtKB/TrEMBL:Q4QHD3"
                     /translation="MAAVSGPTLDARVEDIVKVEETLASELTLPKVVQLLIDPQAEGV
                     ERITMSEFVAMQPKRQLLALGGRKDWQQWMEQSTYYQQAARLAAESPAQDLAALQQAG
                     IQSLQQWLEHPQLVKVSARTRSALDTAVAQSVEAYMAEVVKVVNTSNQVEDILSHWVS
                     DVMGKFVLDSLQIPIDRASQAMWAKRKEWMPAEVVRNRGGVPPSMASASSVSSPSSAA
                     VFGNDVTGRSPLQSVESRMLGEMLSGCGGSVAAPAPVANASQRQQQQSTLRPGEACTL
                     DHYLRFVQKVISSVRQDYVANHAAMGAAPGGRGDDQAEREITERSYGVIAAAFTQLLE
                     QAVVCQLPPELQALQKNGYLALDRVPGLLKRAGSLLELRSVPVRYFVFHSSVDEAAAV
                     AATTSHGRSSPADASLSGGAVSGLAVQAPPPYASGTFLTGSNRLDVTLGEWSGQPDPP
                     SSTARESGGVVDDATEQEYLSMLHRLRRRIETLAVTSLYEVIAQPERFGGNGFSAAEA
                     IGLDQLFGPVKLLEDRLTTLLHYPPAAADKPIHFIEAGPLSGKTALLEQLIERTTRPG
                     DKVVLVRYGGSATPYLPDLDDHPVAFAARFWFRVALASCPCLIRTEELYSRAPRSVYW
                     WGHENNWSWERYQSLLQSAHNAGTGHRQYQQQQQQQQQRGASSAAVAAPAQLASILVD
                     DVDRALSAMQVKWGNAATLSSFMTTSAAGGSGGMRGGALGHLAHSSSAAAASRKACSA
                     AGVDADAADDTGEGDADDGDDADAPARATAAAAHSPSLEQQRQQVISLWLSTGKSVEE
                     HLYSCFTQISAAVGQVNFVFAGTAATPLLLAYCPAPCRRYYLPLSGGVGLQSRLRVLP
                     LLATLHALHLTHRLDMPGLLYEVLKNAPALAGKALELFWSHRVSLMDLRTGLPRLTMG
                     NGSAHPQLLHSYVPRELFAELPVYITLLQDPRRTRRRLVELLQRQLSSPTGYLSTELD
                     TTPQDVKDGLVLPHNHASSQVHPFALFAIFSRQDAIDERVFNSEGQLLEDSELQRDGD
                     AEDEDGVKDEDDGGGANAKPKAAEASAAAARLRSSTGVGSNERKVVRAWAEVWAEYRS
                     VVSALSTTPARKRDAMRILLHGALLLRSAAVAGAQLELNLKVPSFGFPLLASETRVRG
                     SSVHHPRGTAAAAGESRIRSATPETVRRAVSAYKMFFSNAAPSHFPFRPMVGLNGGCD
                     VVFVCGSTLALYNIVATTAQLRHTVARFAEALLGVLHVLMRQVLPADKVRAVQYVTVV
                     SLDEAQPGVEASPIGNGSGGGHANVYARRRGSVVAGGVSVDVFNSVAAPTVPYYLDYD
                     AVFEDHVIDRLRELQQSLGITKDFRTLSELIDEIEHTHRVRVLQNVVSTPEEVESLFS
                     PTLLQLVPDSTVLPAYTSAVVSATDLMAQAMSRGAGGRRASDVAADVDDDDDADYVNI
                     GEEDVVPGAEVDDVASEARLLRDAAAGKSTAGGISPSEDLNAADGDYVHESAALLEAM
                     MNDELDSMTNWTAQLHRQREETARDLQRDLVMEDRINYNAPPPSIGASAADAAVTGVA
                     PSKSSRAPGQTAADDAEADALAWLHDVITPESLIAGLKGSNPGAQVSAPSSPSTATAA
                     PGVAASPQSPASPMAGMSLAAAGGGLASHASFAGSMASVTGPWTPNPIPPPVAASDGA
                     GGERSSVAAGTPTTTTEEGERGAGAAAAGDVAETGESGDGEDDSGEGDEEELNAVKPR
                     GAEGSRRKGGSKAGSKTTTVASRRPRRESHSSNGKRSSAASRQKRSASMSRSDDRATA
                     RSAPQSTSQTKRRKPLTSKKNQAAPSSSSSRKKKSNSSRRR"
     gene            complement(<391138..>392340)
                     /locus_tag="LMJF_10_0820"
                     /db_xref="GeneID:5649685"
     mRNA            complement(<391138..>392340)
                     /locus_tag="LMJF_10_0820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681364.1"
                     /db_xref="GeneID:5649685"
     CDS             complement(391138..392340)
                     /locus_tag="LMJF_10_0820"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681416.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649685"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:Q4QHD2"
                     /translation="MTTPGASPGGVEYSKKRQDDAEASELRRRMVQRATDAQRAGQEP
                     LERQEGLSESDKWWPPENQNWSGRMFGTPFDVNKKKLDGMFVPELKEVFSPEKPLELS
                     YEGDNFFINPDFHMADETFEETRRFVPPPSFDPAIDEIDDDGFTDSKVMFDIQAALEE
                     DKKRLEAFGNPMTVEDQVDHLLAPQRDGQENIQQRQEFNGFVHWGLLHGAHMVLEENQ
                     DTKRAHEFVNRYMRDIDLFEKWLEHPKVRAHIQKKFGIDMSAKFDKLMALTMAMYTRS
                     KIQVYEDDPAGALKSLTASMSFITEGADLKKERHRKALGAVLVARGMIHCKLKSFHRA
                     DDDLTRALAFVKANRSATLYQLRAEAREALGHIDEARADEERAAQIWEEAEVITPGMD
                     GAPRKFVT"
     gene            complement(<393324..>397940)
                     /locus_tag="LMJF_10_0830"
                     /db_xref="GeneID:5649686"
     mRNA            complement(<393324..>397940)
                     /locus_tag="LMJF_10_0830"
                     /product="putative protein kinase"
                     /transcript_id="XM_001681365.1"
                     /db_xref="GeneID:5649686"
     CDS             complement(393324..397940)
                     /locus_tag="LMJF_10_0830"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001681417.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649686"
                     /db_xref="GOA:Q4QHD1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4QHD1"
                     /translation="MYRKDVHDDATATRSSRPIVVVTINADESEQEDIDGEDTILFGS
                     DVVDATRSDGDARQSQLDAPPPPHPPLVASTAVAVEQHLVMSPEVLPTHPLRLLLHGG
                     ASGRGSSTATLDLRGCTTPPPPLLQPTVRGTGKRTSYGNNNDADSRSRQSAERSPEAL
                     MADSESKPISHRWQRQLLAGGTPATQRLREKDALQDGGHRQAGSPPAHAAETVKQLFT
                     EPARSISVTSTPADDSPNGTLIMSHGSEEDGVEEADAPGLHRRQRQHHQHLPPPLDVS
                     SIATHSDSESRWSVGRATEGPPLPPGSATAVTPPPLPSLVPRASSAGGVQLFHRHHRH
                     NSGGFTDGICRGASTRLLSAQLSALKDDEASPSLQRKAVASAAQSLPAPAGHLRMGGN
                     TSRQSSPSSSYVWLKRTAGGDAVEASHPAAPTSSATSTLFPAHAPFQQQQQQQWSSYA
                     CPHLSFTSPSSSQLSRLVDMDVMTESDADAEGGHAATTTTPQQLRLREPPVWRSPQIT
                     QLPKSLSVSPVSLRGDGRKGGVKGDAASSLPQSLSQTQPAAHSASAASSSTGEATQTL
                     VQASANAAGGSQAPLRVVPSGSTAAPAASRPSTQLITKAAATRPIASPGTMWICLDDD
                     DYAGDDSHSEGEGGVGEAKMAAPLHNGSDAPLVSVKMEIDAETGAVYTPPERTAAAAA
                     SPSPSGSPHKGGVAVGGEEQPEAPGRLRSRRPSPSKADSVGAGVRADHSNIPVLSPVQ
                     ARRRPPAEKSHPIAEILSPTFRPRRRPPDTSADPSHSLSAGSATLQRLSSWPASHCYI
                     NLDDDTEDEDAEEAPPRQRARNAHALDGVVYSAQPMSSASVADALPAPLRASPVTGVD
                     ARSQLSLPLIIDDDDDEGAPEGGGETHTKESGDQEVRREGLSPKPPKPKRGTRVEGAN
                     EVVAHEEDDDDMLKSPQKPHVKDFIFPNRLDPELRPSSPLYRSIHAYQQQYQQQQLAQ
                     GKEEEVHAAGHAAAAASPLQEGVNADCRHLPQSAAIPVVIGETKGASPDDVAAAGQAG
                     QKRSRAKDAKTGAAAPVLPDWGRPADTLLRDFFPTKFTKKSFMEAAKNVMSPMHFLEA
                     GDFWAAFASAEFVGEGSFGLVWRCLTVDGDLVAVKSCPVILRTKANIEDSFSTIREIA
                     TMRFLNEMQVPYVLPLHSAFFVHAQEALPPLAQEALEWRQRLRKRAEEAALEVEVRLL
                     ARGGNRRASHTGAEEDVEDAPLTLEQQVAVQMERLTAAEGPEEQATRARLQSVRLPRF
                     LSITHDDLTQSDATVFLVMELCDGDVEGISRSDGVAKGMVYCVSSALAAMHELGLLHL
                     DLKPSNILFAYEHGPSQQRLQRFSASGPATDAVKFYLSDFGNCRLVGPDPMDEVQDSY
                     GTFEYMDLRALRDAVCGRPTDAFSLGATLYELLYGRRLYPKCVDPRCGGEEDHSRECF
                     VEAASQPVVLPTVGPPTTAAMVTLVTTIGLDAAAAGHARGPHANGGTGSTSGLICSGP
                     ALTPLQYLTLALLRKPWAERMTAEECRRYLVRTFHITQTEDSSP"
     gene            complement(<399893..>402079)
                     /locus_tag="LMJF_10_0840"
                     /db_xref="GeneID:5649687"
     mRNA            complement(<399893..>402079)
                     /locus_tag="LMJF_10_0840"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681366.1"
                     /db_xref="GeneID:5649687"
     CDS             complement(399893..402079)
                     /locus_tag="LMJF_10_0840"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681418.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649687"
                     /db_xref="GOA:Q4QHD0"
                     /db_xref="UniProtKB/TrEMBL:Q4QHD0"
                     /translation="MDHLYRTTVEPVLLRERQQCGEDAEVADLASVLHRVPKLDFHCH
                     LNGSVSASLLAHLERLLIHGGAPVNGADGDSGKVGDAEAGHILFFDSQEKRRQDVLTG
                     MPVDSADRAAAAATPTERMHYCFTVFDAIYKVMTNLAFTRLAVQDMLFTSAEENIIVM
                     EIRTSMRDGLRRTFRRDAADEEVTKPMYVDTIIETVEHILSGGLVDLATGELLTAGAS
                     AQVLAWGAASVTQRCAAEDETGEQAAAAPWWQLYERVYGSLLQPPCESSCVQERRRYF
                     LEHIFRNLTVRMHVRLLLSVNRGATAAAAWEAARLTTKTQQRQVMEFHSWCTAHMRER
                     NGEEARRGSANNDSSSPGSPTGATPSSPSSCLHRRLRETCWVTGMDLSGNCYKGKYAE
                     LEPALAAARRGEVEEQDSNGIRVTASITIHAGEKQDPQELHEMVLFVPERWGHLVFTD
                     PANLSAILTAQQGIELCLTSNMLTGGHSHVVDHHLGDLLQLWESMPESRRRRGSDAEG
                     RSGFPCYAATEAVRLAHRQARAMRRCGNLTAVAEPSGAADADGKDTASTAVLPNISFH
                     TDDRGVFGTTLSKELLLASQHPAIGQLCNRLTANAAGATNSDAAAGAPSTAALAHFFW
                     LLGRLSLTQLFELPLPVQLLAAALYAHYSCASKSAAAHESGALDVLQEAEAGDWRDWP
                     SFVRVCNSVAASPVEATATLSSTPLPSRLSRWEWAWLTECFDRYYD"
     gene            complement(<402859..>403233)
                     /locus_tag="LMJF_10_0850"
                     /db_xref="GeneID:5649688"
     mRNA            complement(<402859..>403233)
                     /locus_tag="LMJF_10_0850"
                     /product="putative nuclear transport factor 2"
                     /transcript_id="XM_001681367.1"
                     /db_xref="GeneID:5649688"
     CDS             complement(402859..403233)
                     /locus_tag="LMJF_10_0850"
                     /codon_start=1
                     /product="putative nuclear transport factor 2"
                     /protein_id="XP_001681419.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649688"
                     /db_xref="GOA:Q4QHC9"
                     /db_xref="InterPro:IPR002075"
                     /db_xref="InterPro:IPR018222"
                     /db_xref="UniProtKB/TrEMBL:Q4QHC9"
                     /translation="MSFEDVGVGFVQHYYNFFANQRDQLAGIYRPNTLLTWQKEQVQG
                     VDAIMARFANLGFTEAAFKQDSIDCQPSMSGGVIVIVNGEVKLRGEEHSLKFNDFFHL
                     AQDNGQWYVSNQVFNLVGGGGL"
     gene            complement(<404299..>404889)
                     /locus_tag="LMJF_10_0860"
                     /db_xref="GeneID:5649689"
     mRNA            complement(<404299..>404889)
                     /locus_tag="LMJF_10_0860"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681368.1"
                     /db_xref="GeneID:5649689"
     CDS             complement(404299..404889)
                     /locus_tag="LMJF_10_0860"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681420.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649689"
                     /db_xref="InterPro:IPR019002"
                     /db_xref="UniProtKB/TrEMBL:Q4QHC8"
                     /translation="MGRIKVTPKGKVKKNIPITRVGKKQYLKRRFAHVRAVDVAGANN
                     RFTQKYFEGNNTAEQTFTRLGLAIDPSAPKSVAEKRKAKVRPQTRRVFEEQNELAEHE
                     KMVKETKIGRPVSEQEGSTIANLIERYGTDLKRMTLDRKLNPFQLNMRQLQRQIVNYL
                     KWEKAAFPKQFAEAEEKGLFSVEQFADPHLRSGQRT"
     gene            complement(<405855..>406247)
                     /locus_tag="LMJF_10_0870"
                     /db_xref="GeneID:5649690"
     mRNA            complement(<405855..>406247)
                     /locus_tag="LMJF_10_0870"
                     /product="histone H3"
                     /transcript_id="XM_001681369.1"
                     /db_xref="GeneID:5649690"
     CDS             complement(405855..406247)
                     /locus_tag="LMJF_10_0870"
                     /codon_start=1
                     /product="histone H3"
                     /protein_id="XP_001681421.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0870"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649690"
                     /db_xref="GOA:Q4QHB5"
                     /db_xref="InterPro:IPR000164"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:Q4QHB5"
                     /translation="MSRTKETARAKRTITSKKSKKAPSAVSGVKMSHRRWRPGTCAIR
                     EIRKFQKSTSLLIQCAPFQRLVREVSSAQKEGLRFQSSAIMALQEATEAYIVSLMADT
                     NLACIHAKRVTIQPKDIQLALRLRGERH"
     gene            complement(<407083..>410580)
                     /locus_tag="LMJF_10_0880"
                     /db_xref="GeneID:5649691"
     mRNA            complement(<407083..>410580)
                     /locus_tag="LMJF_10_0880"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681370.1"
                     /db_xref="GeneID:5649691"
     CDS             complement(407083..410580)
                     /locus_tag="LMJF_10_0880"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681422.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649691"
                     /db_xref="UniProtKB/TrEMBL:Q4QHC6"
                     /translation="MMSTAPHTPPPHPAGLNCSEHIEARLPARLQGSSGAHKPAMSNM
                     TPPDPRLGHVADTTYGSSNISDIPHEEPMWRSSEVAASSTAERYEAAQKPFVGMPTIA
                     LQPPPPFSMRHSTAAPFSSSPVQLSSLGDCAGDGTSNHSSSSSSSHSASHTSSHYLLA
                     IQRDLESIVRLQQLQLQERRVSLPSEASTTGSVPRVWIDSEVVAAPSATGVPYHITAT
                     VDSADSAMHLQSIDHAKQSWFEGNAAAHAPPHQQQSPQPLPLSYHPRLTVAPAGAHAA
                     KASDAAPQLSLDPWQSSLQGDNDMLLSPSPHVVSGASISAGAGGFVMHQQQQPQPPPP
                     PPSSSPIPASLVEYQRYLMQLEHQQRQHREVLRRHRRQRKEEMMAAAQRGATMITVPV
                     SMTTPPRQRTGVGAATEDRRDRSPPLAMMKQTLRQRRGDGRGIRSVDTLCGNASSSAS
                     SKTAPSVTQQRGRHSQKQWHTTTPSPAPAAEAQSRDRSGGRRASSSRGRGCGAEDAGP
                     SAARGAGIPAVALRDAPARNEHRQSTPKQEQRRKSNMRNSPTNSRSRYVSPQRLATAV
                     VNGRDVQHLLLHTPPLIAGSLPRSFLLASGLTDATPLQVYAETATLTPPQSSSPVEAF
                     ADALLMDVNGALGTVGDGASAVGSLPPPPPPLMTTHSFAGTAITRETTPFTAVGGTAT
                     VPAPIVFAIAPSGAVVMPPGDVADDHRDEAEMAPAAEQKFWHHRSRDQHQGTSRESNL
                     TTMTTTTPASSTESSPSRERGAHTARAVGGARMHVKGGAATPAAMQPSAAIAAILQHP
                     DATATAHSHRQQRSRSADPILVHGNNGFNWRLTRRRVRGAGATTTEAETHHNYPDVHR
                     KTRHHLHNGHHHRSVEGISSTTPEHGTGTPRSSRYRYNSSSTTRQRKQSRQLSKHTPH
                     NADGADTRSDGHDGSMKHTVDAARQPPASPGGGDKAHGRAMPGYGNRNATTAAATPSY
                     SCPAGGDAVSRLAHLRPLPPSRKAAAIWHDVKLMWTPVPASQTPFAAVYRYHPHTHPP
                     TSFHGQQQQSLVHRDVSPSASAGRTAEIARGHTTGRASAAAVRSRGASRALTGAAGAS
                     PSAQPPPSIVLPHTQQQMASAGAPLLCMTDSLIGAALRDVLPVCRARQREVAREVARR
                     RYQTLPAGVGAATASATVL"
     gene            complement(<411517..>411996)
                     /locus_tag="LMJF_10_0890"
                     /db_xref="GeneID:5649692"
     mRNA            complement(<411517..>411996)
                     /locus_tag="LMJF_10_0890"
                     /product="putative FKBP-type peptidyl-prolyl cis-trans
                     isomerase"
                     /transcript_id="XM_001681371.1"
                     /db_xref="GeneID:5649692"
     CDS             complement(411517..411996)
                     /locus_tag="LMJF_10_0890"
                     /EC_number="5.2.1.8"
                     /codon_start=1
                     /product="putative FKBP-type peptidyl-prolyl cis-trans
                     isomerase"
                     /protein_id="XP_001681423.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649692"
                     /db_xref="GOA:Q4QHC5"
                     /db_xref="InterPro:IPR001179"
                     /db_xref="InterPro:IPR023566"
                     /db_xref="UniProtKB/TrEMBL:Q4QHC5"
                     /translation="MQKQMNAVDQAFMASLDAKSDVHQLASGMRFKILKKMADTASTK
                     SPNLSDPCSVHYHGSLTNGKVFDSSVDRGHPATFSPSQVIKGWTEALQYMVEGEEWEV
                     YLPPDLAYGTRGAGGVIPPNAALVFKIRLLKVMQGGKPGADGHRKLEQALSKTYAEL"
     gene            complement(<412849..>418134)
                     /locus_tag="LMJF_10_0900"
                     /db_xref="GeneID:5649693"
     mRNA            complement(<412849..>418134)
                     /locus_tag="LMJF_10_0900"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681372.1"
                     /db_xref="GeneID:5649693"
     CDS             complement(412849..418134)
                     /locus_tag="LMJF_10_0900"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681424.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649693"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="UniProtKB/TrEMBL:Q4QHC4"
                     /translation="MRVWAKVPFEVPAWVWLNTRHVPFLSRWGEIGGEVVIPKRLFIH
                     THTLSILPSPSISSSLSRIPAPRPHSIHLSLPDNVGGRPSCPHPAAPSLPPPPSTLHL
                     ALIGKSSTARSPGRGSNSTSCSTNQVCDGSRCASVGSAAGVDPPLTGVALRSCPSRLF
                     LVPARSAKAARRADRRPKHLQRGVMQPPQCHSAASPCLASSARVPLTPQYHAPPPRQQ
                     PSVQSSVELVQSAYAVLYNVHARATQLVDEAEAYLTGAYGATLTATPRARAQPSKDTA
                     STHHSAASAAAESLLQRCLEMQALLQPEGGNAAASPSPANHLASALSLLAECLPSDWK
                     ALLVVQPEEGRAGGVGVAAASAQEAPATAPTQEEAASAADGNGVSGEGTSVSSTKRGA
                     SKPAVATFAVCPSDLVQLGLLLRRQWTLQRDLDLLVVALRDICAVFAAGRAAASSVDN
                     LRVSALEDVPPPLMTVAVILAMLQLPRTSAMLEVHEERMRAERLPVGGGADATPPYPY
                     PCVATVLPVWLWRASYATTWRCGESPSVPSASRTTAAPVKAVVSALASALQITKQLFK
                     WEAHVARYVSIVLEAPPSGSLQQQQQQDNAPSGVGSRSAAGAAPPLHVSDKDFLFDVQ
                     ADMSLERGACNEVQLLWLTAAAAVVAAAAEADVSCGGALDMSSGALASSRVRKRCDKV
                     EQTLRAIWSTSAVARALLPGVLLLLGCSAARRRSGPEKPTSEAQSRGMHYWMEAYSLG
                     RQVLGSAHPVVAAAAALLPNSAVSASGERQAPTSAPASRTAAHLRALTAAPSNARNSV
                     TARISGEDPPLLLHPLPPPPPQQQQLMPAGTLTRLPPLPPLTLSGPEPSRLAPAPSSS
                     ALLCSLRSVPTSTAMVRSSRSGPPLPLGRTPTLPLTVSSTAAAADGVANLFRRPSPQS
                     SLAASRLPCSRSLRHCYRLQRPADAFTLRSDVKDAVLLADDKERAKKKDAARRRRERK
                     NQPQSPTAALLLSAISPKSAGAAGVLASGDDADGSTRRQTRRDRNFLPAPGAPASKLG
                     AAVSPTLPQPKVELESQQQQQDQDQDQDQEGLQEPQQSERSEGAPVDLGATLKGVQTV
                     KPEAEQRQDSGDGDGSAADAEAGGAPAPPTTNAAVTADQHRGSICTGRLSGSNHMQLR
                     GDGSAPRTHVVDAAGAVEENVEEEEEEEEEETLPERNARFQREIIKYYAELNERRARA
                     ALTLQRAWRSSKARQILYAYRQALYQYVYTIQKAAALAIDGLLSCAVEQRRRQAALHA
                     RAVSDARRRDQEQREVSAAQRLTRTVRQWLQRQRERRRLRKELGIAHDARLRLYAITA
                     VKVQQWWRRVVVEKAYWRRRTAEVEEQRRLQAEVERQAHAAVTIQKRVRGIQARRCVA
                     QLRETRKAEELTLRRRRDAAATALTIVLQEYVLRQGRLHREALAREESRAEAAQCIAV
                     GWRCCVERRRLELAVERARQLRTSSTCIQRVWRRYAAGRQRRYLRQLRRTLQEERLSR
                     EAHTYEVIRLLQCFGRSAQAQLLVRRLKARQGRTFMENLFLIQAAGRGALTRAEMGRM
                     HVAEQARQRAEAAALETWRWRAICLLQALLRAHASAALVQQQRRTMLAEKLVVRTTAA
                     HEMRADAAATVLQRAVRRHRMQRRTAAAEAEAAAALAFLSAMARRLQQAWRAFAARRE
                     RRYRAAAVAQCARKRLEREEVWQLVWQDQFTELDMLCMLERQYIEEQQHVKRVRLYKY
                     LCDPNGATNDDCGTQTPGAFNADADLLKWATLYDE"
     gene            complement(<418873..>419499)
                     /gene="Rab11"
                     /locus_tag="LMJF_10_0910"
                     /db_xref="GeneID:5649694"
     mRNA            complement(<418873..>419499)
                     /gene="Rab11"
                     /locus_tag="LMJF_10_0910"
                     /product="putative small GTP-binding protein Rab11"
                     /transcript_id="XM_001681373.1"
                     /db_xref="GeneID:5649694"
     CDS             complement(418873..419499)
                     /gene="Rab11"
                     /locus_tag="LMJF_10_0910"
                     /codon_start=1
                     /product="putative small GTP-binding protein Rab11"
                     /protein_id="XP_001681425.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649694"
                     /db_xref="GOA:Q4QHC3"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QHC3"
                     /translation="MEETNLSFKIVLIGDSGVGKSNLMTRYTTNEFNQETPSTIGVEF
                     MTKSVKIESRDAKIQIWDTAGQERFRAISRSIYHGAKGAMLVYDITNQTSFDSIPTWL
                     QELRVFVPATCCIFLIGNKCDLEHLRVVKKEVADRFARENGLSFLETSALERTNVDKA
                     FEWLAKSVYEVVVTPQTREADRTAPKQGRTVNMNPSESQEAKKSGGCC"
     gene            complement(<421552..>422151)
                     /locus_tag="LMJF_10_0920"
                     /db_xref="GeneID:5649695"
     mRNA            complement(<421552..>422151)
                     /locus_tag="LMJF_10_0920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681374.1"
                     /db_xref="GeneID:5649695"
     CDS             complement(421552..422151)
                     /locus_tag="LMJF_10_0920"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681426.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649695"
                     /db_xref="UniProtKB/TrEMBL:Q4QHC2"
                     /translation="MACASVCDAILTFLRKFFSLILALAMAFFTMLYVIGAGVVTTQA
                     KSFSKSGFAHFLGIVFSIVSVIGYLILHFVPRKAYRLLYAITFLMLTTMFLVAHSMGL
                     AAPVVADCNAAGSLNFTGNYTGIGSIGSILDDNNENVTIGRLGEPVAQCKSNALLFAA
                     SFVNMFLYVIALFDVQTVLLARVKSKTYGERFVEMGISS"
     gene            complement(423038..423790)
                     /locus_tag="LMJF_10_0930"
                     /pseudo
                     /db_xref="GeneID:12982600"
     misc_feature    complement(423038..423790)
                     /locus_tag="LMJF_10_0930"
                     /pseudo
                     /db_xref="GeneID:12982600"
     gene            complement(426546..428855)
                     /locus_tag="LMJF_10_0935"
                     /pseudo
                     /db_xref="GeneID:12982601"
     misc_feature    complement(426546..428855)
                     /locus_tag="LMJF_10_0935"
                     /pseudo
                     /db_xref="GeneID:12982601"
     gene            complement(<436075..>440013)
                     /locus_tag="LMJF_10_0940"
                     /db_xref="GeneID:5649698"
     mRNA            complement(<436075..>440013)
                     /locus_tag="LMJF_10_0940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681375.1"
                     /db_xref="GeneID:5649698"
     CDS             complement(436075..440013)
                     /locus_tag="LMJF_10_0940"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681427.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649698"
                     /db_xref="UniProtKB/TrEMBL:Q4QHC1"
                     /translation="MDCGNADRGIGFRSSPPSSPANVSSSTPVSNKQLSPPTGSLRAR
                     RFPSQRVVCADGSHHTYSHNNSIGSAGGGIVALARMESQELFGAYPPMPTLQHRHPGD
                     SIVPLLGRPSLDSVCELLSNASPTSQAAVPTLSFYAAKDNVALQDYCTLPNQNSVPKS
                     VTVIYSQPSSPSDAYLRGVDYVSARGISVTEDNANEDRVKVRVEGYYENNGVGVLIPN
                     DLPPSTLLYVLTASDGRDLMFKVIQYSLQLTICFLKTPSLFSPEAQMLMGPMAERLYR
                     NYNTIRHGRSLFKMGRGLLNLFTLQTVCERMWMKYKRGISHTTCAIMLPVVSCLEKGL
                     MAMGASPLWGRYLSCRLLRWAQAAQVTPGRGRSEEPEDSVVPYRCIQQRAHEQPSTPS
                     AKDALQTDGVHTTSGVEKAEQSVTAAQAASGSVAGLESLKGNVGFALQKVDGGGAGSS
                     QPTPPCAMVDSQTSTSRVQSEQPSPTTGDGAASKGVGKLSLLPRAPSGGLSAEDWGGR
                     ASEIATALPTPNAESKRELTDPDALPCVPSGPAAGSASAMSSGAEGTAAPQAKPPHVP
                     DTPFSGVELGHQEHQRHGLTPSTTANATASAFSLATADWVDSAGRKTLLHPLKQSSSI
                     NTPTPTASSSITGDDVGDHLQEGVESNIIHNGTPLIPAARSSSYGSITSQLMPELASG
                     GGLTPADGPLSVPNNWRIACAPTVPPSRSDELVVDSALPCSSVELLKPLKPTEALSTV
                     ASPSEELTKVDGTTNSSFTANSADTRTPPPQLLSAADVSTNTQAAMASSGDNTGTAIY
                     DIERNSRHASSLRDRCTVSTSAPQPPVTAVLQASELPVMTPTRAASALKDDPPLSVAT
                     YGKESEISIISSSTSSCLQEHQGNHAGALSTYLRELQPASAALPARWRKGVLQFNPVL
                     MTLLGIRNLAAACRRFLRDITLVSTERFGTLRLVEVHRHTITHIINRCWLVVSIIDLL
                     LNTVRLLQPGWVKYATARQNIHCRCGCYGDNDPSDKVWRTHGFIARRKTDLFFPPLDL
                     DYGAPFVSSLSYVEAADPAQLMPACRRCGCLYREVLSDSDQEGDEAEVADASSGVSMP
                     PSRTLAAMSKAALAATAASFSEDGHHKGESHRSAARKSLSTPGLVEREKPRWVQLYNE
                     EVMLGESQQQRLRSPGARQEKQNLSTGAQQDSPVKQLEKARSNSTLKSSAGDGQPADE
                     MLQRRKSGAARERPAESSAGILFVPWMMRKFFDYVWLLRVHPNLTSTVLLEARCIAEL
                     YLAYKYCFGNLEAFMSDAPLSAILNPYGALAGIVSASVGLLRVVESAPSS"
     gene            complement(<441195..>441518)
                     /locus_tag="LMJF_10_0945"
                     /db_xref="GeneID:5649699"
     mRNA            complement(<441195..>441518)
                     /locus_tag="LMJF_10_0945"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681376.1"
                     /db_xref="GeneID:5649699"
     CDS             complement(441195..441518)
                     /locus_tag="LMJF_10_0945"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681428.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0945"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0945"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649699"
                     /db_xref="UniProtKB/TrEMBL:Q4QHC0"
                     /translation="MLYVQGSSVREGGESTARHLWGFAKSYVKHVGHAYLEFLGPLLL
                     LVAVNMAVETHDSERFGLGWLYCTSLKDDRVREEKFPSYEPSSAAQRRRSEAASAVEY
                     AAATV"
     gene            complement(<442497..>444098)
                     /locus_tag="LMJF_10_0950"
                     /db_xref="GeneID:5649700"
     mRNA            complement(<442497..>444098)
                     /locus_tag="LMJF_10_0950"
                     /product="putative eIF-2B GDP-GTP exchange factor"
                     /transcript_id="XM_001681377.1"
                     /db_xref="GeneID:5649700"
     CDS             complement(442497..444098)
                     /locus_tag="LMJF_10_0950"
                     /codon_start=1
                     /product="putative eIF-2B GDP-GTP exchange factor"
                     /protein_id="XP_001681429.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649700"
                     /db_xref="GOA:Q4QHB9"
                     /db_xref="InterPro:IPR000649"
                     /db_xref="UniProtKB/TrEMBL:Q4QHB9"
                     /translation="MLSNVPEEPEKLVREVSDLAEAFITNLKRGKLAAARSGGESLST
                     AAAVEMADVMSTIVRLFQNAEKDLHSTTIQLLKAGYPAAEVASMQVSRLLILVARTGD
                     AMLRAQFATLFLMNVTRRVLSIVRESAANSKATDAELEDEAKTILNDLASDDEAAVVE
                     TPADTSSSSSNRCGMDDSTDPASPSLSAKGMKPALKRDTLVSQPLSRRGLSVRFAGTS
                     TSSEEASGGHMRQLQQHSTSVASDFGGPLLQHTGSIVATEIPGRQLLKRAPSRCEQVL
                     EGGGGEIEFPVRMEIFYQDALDAIDEFKRELEGMTEELCRRSTRQLHSSDTIITLGCS
                     HTIRRYLLEAAQAGHHFKVFILEGAPLPAQATQEFAEALCSRGITAQLLPDSSAYVVM
                     SMCTKVLVGAENVLANGGMLASIGTHVLCAAARHFAVPVLVATTTLKMSPYYPSDQLC
                     TRLVRIARSGAQEMPWSTYGSPEDVWPSPFGVSVSDSGRRLTIHAPVTEYVPPELITL
                     FLTNDSELLPSQIHRIVRANYSDAD"
     gene            complement(<445442..>447859)
                     /locus_tag="LMJF_10_0960"
                     /db_xref="GeneID:5649701"
     mRNA            complement(<445442..>447859)
                     /locus_tag="LMJF_10_0960"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681378.1"
                     /db_xref="GeneID:5649701"
     CDS             complement(445442..447859)
                     /locus_tag="LMJF_10_0960"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681430.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649701"
                     /db_xref="UniProtKB/TrEMBL:Q4QHB8"
                     /translation="MPPGQMAVSRHKPRRASAASFRKNTSSEVASICQQLHDALQQQS
                     RLEVQRQQQLVQYRRRLRTLCDDNATLRNIIHAGERRRRDAEAAAAAGLVMPTGARAH
                     NGAPNEPATVTEAEVEALSQRIYLARQRRNKVLHEIKADEAALDAEAKSQESLMEQAQ
                     IALDPAKLLMGANRPVYLRMMRLEQLVDKVLSKQRIAGVVLANYRHHLGVLSTEAAQY
                     DAQQTLLEREYADRHRDHLKLLQLYDTARAAYSTAVEALQVVQRSASRMRTAKEKALQ
                     QKRREVDKGLVATQQQERRVVDRQQQLEEETQMLEAAENTKAQLEQQRMNSRAALTVL
                     RVTSASREDGTGEPSTGTDERVAAYEVAFRGMMRVAKVSTLDALVEAYQAEIEQQYRL
                     QNDLTYVREAQEALVQEVQHLRERVKQTKYCVGAATRLATESAVFDAASAIVGTAPSP
                     LMERELHTFVREEKESLAMYVGANEANQALVMEVAERVNHLAELVADYRADVRVPSIQ
                     CTAALAKSSSSLPLHVAVLAQKLLALAADAAGEADLGPSSTLSSPVKDARHGEGAVHD
                     DKVSSSAAAVVSSVQIVIPANNRRVPLAHEGAGGGVGGPGPSGRRGRTAADVAGISSS
                     AARALLHPHRAGPGGHEGGALRASANQRRRRSSAAAGAGFIESPEDEDDVRLAVVAAL
                     PPPGGRVLDFHGASTDTSELHSGIFNGSDAGGGARGGGDGTGGDNGSSHRAAAVTRGR
                     RPFPKLPRHMVTAGATSAHQANVQSLARAVEDDQEDPLRREEVKRMSEMIRTRQKLEA
                     EKDSRRP"
     gene            complement(<449408..>449929)
                     /locus_tag="LMJF_10_0970"
                     /db_xref="GeneID:5649702"
     mRNA            complement(<449408..>449929)
                     /locus_tag="LMJF_10_0970"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681379.1"
                     /db_xref="GeneID:5649702"
     CDS             complement(449408..449929)
                     /locus_tag="LMJF_10_0970"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681431.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649702"
                     /db_xref="UniProtKB/TrEMBL:Q4QHB7"
                     /translation="MAVLSVFSLRSPQPPQPTSPPPPPPSPPPSLPSLPPQPHRPPPP
                     HHHVPHQGDRPREAHHHVEEEQEGAERGVRREDVASPLAPGHVRDPRDPQVPEEHEPA
                     DPVRAVPAPGARGVERAEGGPALPEQRYHGAAGGDGGVRCVADGGHEPRLHPREARDD
                     PAEGHPAGAAPAR"
     gene            complement(<451656..>453575)
                     /locus_tag="LMJF_10_0980"
                     /db_xref="GeneID:5649703"
     mRNA            complement(<451656..>453575)
                     /locus_tag="LMJF_10_0980"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681380.1"
                     /db_xref="GeneID:5649703"
     CDS             complement(451656..453575)
                     /locus_tag="LMJF_10_0980"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681432.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.0980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.0980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649703"
                     /db_xref="UniProtKB/TrEMBL:Q4QHB6"
                     /translation="MSGHGPNCSAITNGVEHRYAHVKWFHAVNSQASLLEAAQAIDQL
                     FYDEHEGGARGSEAKINHGTLADKNARGGGGGNVAVACGFSNAPACTVIGIEADIQWH
                     PTLETAILRRDPLPSAVADVCSGDGNGSKDRNSHDDRSPAATTTADAAEDDTLPLEAF
                     LQTLAETVKGWRQRAACLATAPIRSPAAAPPLRVIVKLQFGALPAAQQLLTHAEAHTW
                     AGLEELCWQPHSEGSAAAAVSGTARQHASLSVIDHSADASVTPSEAQRQPSMPVASHP
                     PAAVAIELWWSADVVAQSGVTPHPLSVAAAPASVVQRLMARTAQVLGPRVPLGFSLGW
                     VLCPRAVPAGVLAMTKATAASPTTASATTVMPQPQYVFYSLLEDAAVMKSFLDGLWKE
                     LESSAHRHSNGTAVEPGGGTTLSGIVGREGMEKRSDQAVVSASAPPSAARLVRLITFT
                     MMFESVFADVYTAKERQQAFESSLAATASLNAAARKADETRRVAAAVLEHTTKLFSAP
                     HVTTSATLKTCVSGTAGKVVETEQLEEESRKHAAAPTAATMTPSDDPRAFPTFRKAIR
                     PPSPASLAVVASVAQSTPPTKIDEDDDDAFQSNVDRAARVFFPCCSIDTGRVPMQRTS
                     LALAAAEKRDNGVGC"
     gene            complement(<454910..>455302)
                     /locus_tag="LMJF_10_0990"
                     /db_xref="GeneID:5649704"
     mRNA            complement(<454910..>455302)
                     /locus_tag="LMJF_10_0990"
                     /product="histone H3"
                     /transcript_id="XM_001681381.1"
                     /db_xref="GeneID:5649704"
     CDS             complement(454910..455302)
                     /locus_tag="LMJF_10_0990"
                     /codon_start=1
                     /product="histone H3"
                     /protein_id="XP_001681433.1"
                     /db_xref="GeneID:5649704"
                     /db_xref="GOA:Q4QHB5"
                     /db_xref="InterPro:IPR000164"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:Q4QHB5"
                     /translation="MSRTKETARAKRTITSKKSKKAPSAVSGVKMSHRRWRPGTCAIR
                     EIRKFQKSTSLLIQCAPFQRLVREVSSAQKEGLRFQSSAIMALQEATEAYIVSLMADT
                     NLACIHAKRVTIQPKDIQLALRLRGERH"
     gene            complement(<455790..>456992)
                     /locus_tag="LMJF_10_1000"
                     /db_xref="GeneID:5649705"
     mRNA            complement(<455790..>456992)
                     /locus_tag="LMJF_10_1000"
                     /product="putative ARP2/3 complex subunit"
                     /transcript_id="XM_001681382.1"
                     /db_xref="GeneID:5649705"
     CDS             complement(455790..456992)
                     /locus_tag="LMJF_10_1000"
                     /codon_start=1
                     /product="putative ARP2/3 complex subunit"
                     /protein_id="XP_001681434.1"
                     /db_xref="GeneID:5649705"
                     /db_xref="UniProtKB/TrEMBL:Q4QHB4"
                     /translation="MAALRLFERKLDTVASTSPAPPHRLYVFGDCIYELSSLPGSHTS
                     KGAGEPPSKPPVSCSAAAPTTGAAALRSGSGNGMEGGTHTRVPRAEAGIALSCAEDGT
                     RPPASTSYPSIVIQFVCPIPHAQLNRYNNLDHALSTALREVAPHCTYGLPSPIPAEAA
                     SAAAASLSSIALCIPAYVTPKERCAAAAFAADLSLHALRPVLEGLLQHSSATMQQECL
                     LLLPHTETMTDTAASQPVVDSASIFSAAALFVTATPTPTAPVSPGTSSSAKMAPACFY
                     SGTVSLTVCIGTDDKGEAALMRRYLDAFADVKRAPVLLLVRESAEPPPGVAAEAGTAM
                     TAEHLYAWWCTFVLAPHQMISAASVEQLLRWARELRPTVLFHVHRERMAMHALLRQQL
                     STYAARFD"
     gene            complement(<458358..>459383)
                     /locus_tag="LMJF_10_1010"
                     /db_xref="GeneID:5649706"
     mRNA            complement(<458358..>459383)
                     /locus_tag="LMJF_10_1010"
                     /product="nucleoside phosphorylase-like protein"
                     /transcript_id="XM_001681383.1"
                     /db_xref="GeneID:5649706"
     CDS             complement(458358..459383)
                     /locus_tag="LMJF_10_1010"
                     /EC_number="2.4.2.-"
                     /codon_start=1
                     /product="nucleoside phosphorylase-like protein"
                     /protein_id="XP_001681435.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.1010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.1010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649706"
                     /db_xref="GOA:Q4QHB3"
                     /db_xref="InterPro:IPR000845"
                     /db_xref="InterPro:IPR018017"
                     /db_xref="UniProtKB/TrEMBL:Q4QHB3"
                     /translation="MSNSGCGLPGDVDPDLPLTPDGVTYHVACSSERLADRIILVGDP
                     DRVKMVSTYLDAGSIVYEASHREIKVVTGAYHGVPVTVLSTGMGTDNVEIVMNEVHIL
                     KEYDTQKRRWRARVGDDTPADPLETPFDPSRVKLIRVGTCGTPNDAVQIGCLAITRYA
                     VGMDNTCQYYDAPAVNHTVDVKEVLAKVQATSLGKVQVYATKAAPAITQGLVDACTAL
                     NRKVGVSEQQPYYVGTTCSGSGFYGCQGRSVGRFRGHLTVPHLTEELGDLRFNVSEGE
                     QRVANIEMENSALCYLSNLLGYQAGTVCVVIARRSRTNRAFATPEQLAKGLSHAITIA
                     LETLIKE"
     gene            complement(<460768..>461940)
                     /locus_tag="LMJF_10_1020"
                     /db_xref="GeneID:5649707"
     mRNA            complement(<460768..>461940)
                     /locus_tag="LMJF_10_1020"
                     /product="putative carrier protein"
                     /transcript_id="XM_001681384.1"
                     /db_xref="GeneID:5649707"
     CDS             complement(460768..461940)
                     /locus_tag="LMJF_10_1020"
                     /codon_start=1
                     /product="putative carrier protein"
                     /protein_id="XP_001681436.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.1020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.1020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649707"
                     /db_xref="GOA:Q4QHB2"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q4QHB2"
                     /translation="MLTESSLMEADNAIYEPSVAHGSTSVHAPRHHHTHTHQAHQQHS
                     SASHPHSSPLGFLTHDVEEDPPLHEHTTSVNRSYSDLHQGAFLCYAFGLCALRTALQH
                     PMSLALARKQTSAAANKMTTWGVLSHIFEHEGRWRGLLQGIGSLSMGCALSEVIYLCI
                     FEWAREQVPIDSTATRDAVSGYVADVMCRSVHIPLSIIAYRQMTASPSRRMNSWRTLQ
                     HMYSERGLRTVFAGLGTTLVVGCQWTAIWWAMYGQLKNFLYDTSGPHLQRLSEKSKAS
                     QRGGDATDGGWRLPSWCTSSDDNVLINGAASVTASAATAVLFNPYLVVRTNLQVTPGA
                     TLWSVTRQLHRRCGFRGFYSGLLLSVNACVVDGVLASTSYEYAKLWADRTRDGHAR"
     gene            complement(<463650..>464789)
                     /locus_tag="LMJF_10_1030"
                     /db_xref="GeneID:5649708"
     mRNA            complement(<463650..>464789)
                     /locus_tag="LMJF_10_1030"
                     /product="RNA-binding protein-like protein"
                     /transcript_id="XM_001681385.1"
                     /db_xref="GeneID:5649708"
     CDS             complement(463650..464789)
                     /locus_tag="LMJF_10_1030"
                     /codon_start=1
                     /product="RNA-binding protein-like protein"
                     /protein_id="XP_001681437.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.1030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.1030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649708"
                     /db_xref="GOA:Q4QHB1"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4QHB1"
                     /translation="MPPKSAVKKVDSAAATGKRKKLSFAESTVKAAAAAIQTTHVNVP
                     VRAAAKHAPLAAAPRKKGQNAKKTTATTSSAARQRAATDLKRSGIVKAKRAEEEVAAP
                     PVPSDEENSRDDEDDMLNGGAAVDSDTDDLSDMADRTPSDDELGAGKQASSSASRQRD
                     SNGTVEPYRAVRLSFLPPEFQEPQLYKFLNQFGATVLNCFCVRSKRTHRSRGIAYVEF
                     DKESAIPLVVEECNGMVLGGKAVRARAVTMRRRMPSRQMVDRRRALAYAYKTRGAPLK
                     QHDVRRKGPVGLLIKAVRTEKNNNNYLKSLGIDFQTDFFQSQLATLPPVLLKKKRSRS
                     KKSEKGTVATAGMAKAVVKTTDIATVASKSSPKRATRKAPATKTK"
     gene            complement(<466088..>469705)
                     /locus_tag="LMJF_10_1040"
                     /db_xref="GeneID:5649709"
     mRNA            complement(<466088..>469705)
                     /locus_tag="LMJF_10_1040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681386.1"
                     /db_xref="GeneID:5649709"
     CDS             complement(466088..469705)
                     /locus_tag="LMJF_10_1040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681438.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.1040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.1040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649709"
                     /db_xref="InterPro:IPR010441"
                     /db_xref="UniProtKB/TrEMBL:Q4QHB0"
                     /translation="MTQASASEVVSVGRRSTAIGKESSLAAPSLSIATTPFSLRTGAA
                     LPREILAWLQSLQLGGSVKYPKRDLANGYVIAHICARYWPHVPLHSFENKAGAASKQS
                     NWFVLQKVLRQKGVDVSAAMVDGMMNGADDCASTFLQQLYTVLTGKHADTEAVPLEDA
                     LPDVPASKVPVYVPTSTGGAAARTRHVGGANGPGLSAKVDSRSDFMGGGNKAASLFGA
                     AAADVRILDDTSSKDVRNATPVLLPPLQPSLPMPAHTQPATSPASGLTEEAAAASKPF
                     FNVAVRAAWEVSTVLLTQQASASAAEDAAGAPIPVQVSSLAGSWFCMKVREAVPVDAL
                     EALMEGDEAALAPRPSLSATLRWLSAVPSGDGGVEGEMKAALWCTGGDGHNVQQALLR
                     TGAWQAILGAVPELAQILVHHGGHGLDALVDCLFASVMSAQSRIRGGGEGDAGGGASF
                     AFVRNAVHFSAVLLATLSDLDVYHAIACFETYFAASPTFVQALRGLRWSLAADYATVI
                     TAVLPANRRLAATVLSSLWGTIEYAVRDSAAEETALYGEAAAGDGESNPMGAEDMAEV
                     CLLVLLRTLLTSLQPISAGASSRTPLEAPISSHAQIEASGRAMTSAVRRTAPCSSRNT
                     TITASTSQDAVSNTLVQLAEKRSAAVLQQSVICCASATGVGVDEALVAVATEKEAAAV
                     ALAVQVLRMELHPSLMAAWVAGGRFFDVYNALFPSSDNAATPTPPNASSPTLSVLRAR
                     WLRWCLQRRFELSLSSPSPATSAAAAMSLSPLAQQRQRVSHAVAPFGVRDGGGHRATT
                     TTLAQAHDLSADSAEMRALLTGVQVLCHELSSVAESLKPADAQSRVLVACALAESLPF
                     LPARYKAESTGADGGSAFAEDAAEAAFKVLMHEATPAQMRSILACASELRAGAAVQRG
                     GELEDEAQWMVHRYVGPLKPSGLLVVESDALLLVKAALGVLSSGGDHTGNSGGSRLSP
                     SFSGAGDRDVKLTGGTGGARRLAARAAVMAREGQVDEKIAERVRWLASLLVEGRACVR
                     SGTPPLFPWRSTGDSGAVRRSPSSLREDTATVASAASEAEVLEWQAVLSHCYEDLVLV
                     IQAASSRLRQRGGAGAGGNPNAAETHFSEVVGKELLMLAQKAEGVVCSLWRELAPILA
                     ASAASRSKSESEQRFIGAATPSVVANSALISSPPFSFLEDVSHEEVATAVRWICAVAG
                     V"
     gene            complement(<470256..>471086)
                     /locus_tag="LMJF_10_1050"
                     /db_xref="GeneID:5649710"
     mRNA            complement(<470256..>471086)
                     /locus_tag="LMJF_10_1050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681387.1"
                     /db_xref="GeneID:5649710"
     CDS             complement(470256..471086)
                     /locus_tag="LMJF_10_1050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681439.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.1050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.1050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649710"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:Q4QHA9"
                     /translation="MGGKEAVACVVYECVSVSVALQRVDMLRHCPLHRCLPIGVACRV
                     LGFQTPPTSKHDLRKRFVQLTRECHPDLHADDEKAATAKMVQLTEAYTCLKELLEHRV
                     QYHQGAGLRPRPSSASASGEGSAAARPHEDAWAEVAASFRAPGSSISLRGFTLPWQRT
                     TSNSVISSLEAKMLEANVSFSDFVRYARHLEKDRQTKENRIHADAAMADGTHGFTSEY
                     FESVNTNSAIRRGTERRGLPMTHLMTLGAFYYGRRLRNGIAQTPRTAWRTLRYVFLGH
                     "
     gene            complement(<471745..>472710)
                     /locus_tag="LMJF_10_1060"
                     /db_xref="GeneID:5649711"
     mRNA            complement(<471745..>472710)
                     /locus_tag="LMJF_10_1060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681388.1"
                     /db_xref="GeneID:5649711"
     CDS             complement(471745..472710)
                     /locus_tag="LMJF_10_1060"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681440.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.1060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.1060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649711"
                     /db_xref="UniProtKB/TrEMBL:Q4QHA8"
                     /translation="MKFHLHVVDGSAPARGGTAPFPSPPTATEATQATAVMLFAHMTL
                     RCGHLSDVLAVSASTTPALARAAALQPQQNQLHSSAAQLGNADTSVSEDTQVLQMAGK
                     LLCGVIDNGAAAGLPYMDMDGGDARITPYAYFNSSFSEAEQSLRRAVCILAESGTAAP
                     PPYFDLIATTDMATFDYIIEYYQQQRVRHGGAVTKGRGTKPVGVMHIVADDPSRAALV
                     LQRVVELMLKRSGWTFSVDAHAAAEEEALAAQTEEDDDDDDEDGGGGGGTAGGRGGVV
                     SAGTGGGGVQAGARSGSADSWVNHIDEAVHLFAQLFGVDVLVALV"
     gene            complement(<473392..>475170)
                     /locus_tag="LMJF_10_1070"
                     /db_xref="GeneID:5649712"
     mRNA            complement(<473392..>475170)
                     /locus_tag="LMJF_10_1070"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681389.1"
                     /db_xref="GeneID:5649712"
     CDS             complement(473392..475170)
                     /locus_tag="LMJF_10_1070"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681441.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.1070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.1070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649712"
                     /db_xref="UniProtKB/TrEMBL:Q4QHA7"
                     /translation="MWHLPPHKSAHDSISSSLAASSSAVAPSALSEDVARLLAWGRHA
                     LLAQRQQRRASSTSRACADQASISPRPLPVSSSAAPVTTPVAPGSDVRSWGLPAQGLK
                     VSVSTSDFSRATVGAPYTVEQARKRLAELAELEAANTRVFESRWALLSLGRERLLRLH
                     RKQREGEAPSPRTRHLQRLTVAVQAIVEGEASLKEHLRDVLRGLAELYEQHRQHHGQT
                     EEDADHSASAREKTTALLESVHGGGSCDPAEDAGAKESGPDSLRSLADAVVRRTRLLL
                     ESHCESQRVRAEQRRAATARLQRRAESEQALQHQLERLRAAVAEATEEEAHERRRLAE
                     LRAQCAAAERAAALQNASALREQATKEALQRLRQLHQQATFQDAVARQEVAASEARYH
                     QAKAAYDMAISDHHAAEEALAAAQQAYRDSKRRREDAESDLERVQQALKSTSDKCDEV
                     HAARAQAAADCAAVDEALYRKRRARDGWLSGEKCDGNSGVAAALCLGGASAANGAAER
                     YATLQRELPRLKRHLQRSVEEVVALERTEAELRDTLERERSALDLLRRQKTSLEAHLA
                     SLESGVGNALGVVAREKADSQGPGVW"
     gene            complement(<478113..>480461)
                     /locus_tag="LMJF_10_1080"
                     /db_xref="GeneID:5649713"
     mRNA            complement(<478113..>480461)
                     /locus_tag="LMJF_10_1080"
                     /product="putative eukaryotic translation initation factor
                     4 gamma"
                     /transcript_id="XM_001681390.1"
                     /db_xref="GeneID:5649713"
     CDS             complement(478113..480461)
                     /locus_tag="LMJF_10_1080"
                     /codon_start=1
                     /product="putative eukaryotic translation initation factor
                     4 gamma"
                     /protein_id="XP_001681442.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.1080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.1080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649713"
                     /db_xref="GOA:Q4QHA6"
                     /db_xref="InterPro:IPR003890"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4QHA6"
                     /translation="MNKNYPGRITSAPLAQQARGLSLRPGAPASFLDRAQPGGAGTGI
                     GAQQSHHNNNLPRAPRAKPPTQLQTPAPAPPLPKEEAEEERSGAAEVAPSEVSYPEDH
                     IYDVEDFIKLRKCQAPVPSEVMEYARAMWKEMPENMDDMENNSLRDNLFREQNASTMS
                     KVMTDRKINNEVLGILGKVTASNLEKMKKELTDLPIRQSTKEEIDEVIKVFFNKSTKP
                     EDSCYTHLYVQLIAHLISSIGEREEAGRMIRNEVLRQCRSTFMNSGTEAVELEKRMAT
                     MSPEDAEMERIQFSGKQKANIQFLGLMFTSRLVRQKVVHAVLDSLLYGPGHRRHIPTD
                     YSLIHFMELLQVCGPHLDTAFYEDPLPRYRETITELSNSHPQKRIQFLLQNFLETMSN
                     NWVPLHGPGARRTEGGGNAAQGNANNSGSGTLLNNNGRGGNLPTMPLAPMPIQEAQPR
                     IPDYEEFSKVMDDFFMSSSVDEIVSIMSSIPPEVVVVYCTKWLGRYINTYKYTAERTR
                     LGELFETLMKKGALTTEQAQEALLQHVQKSAEEELFTDIPKYFVHWASLIKHGHSVFP
                     YSLHTKVLNMLVDHHVGIEVIANMVRDVEADTKPEQLKDLKPQDRFRVLQALLRYTPP
                     MFVHESDDDQQPKQTVLDLVGTIDPEVTYFNELCTSYDDDNFHASPALSDMQKQSPFL
                     CASAFFTFVRYDVNFLCTQYKELLRKIFTARPADTLLVEVYLQWKCLGCSHRFFFAFI
                     RKVLDVVNNRLDVLNKLSVQLRTTFKEDTLVSLMEEAIKERK"
     gene            complement(481156..483849)
                     /locus_tag="LMJF_10_ncRNA1"
                     /db_xref="GeneID:12982602"
     ncRNA           complement(481156..483849)
                     /ncRNA_class="other"
                     /locus_tag="LMJF_10_ncRNA1"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460094.1"
                     /db_xref="GeneID:12982602"
     gene            complement(481920..483807)
                     /locus_tag="LMJF_10_1081"
                     /pseudo
                     /db_xref="GeneID:12982609"
     misc_feature    complement(481920..483807)
                     /locus_tag="LMJF_10_1081"
                     /pseudo
                     /db_xref="GeneID:12982609"
     gene            complement(<484586..>485119)
                     /locus_tag="LMJF_10_1090"
                     /db_xref="GeneID:5649714"
     mRNA            complement(<484586..>485119)
                     /locus_tag="LMJF_10_1090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681391.1"
                     /db_xref="GeneID:5649714"
     CDS             complement(484586..485119)
                     /locus_tag="LMJF_10_1090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681443.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.1090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.1090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649714"
                     /db_xref="UniProtKB/TrEMBL:Q4QHA5"
                     /translation="MQAVLTHIHKANVKALVLSRMNITMVVLDGMAMLMLIVTWAVSV
                     KREQGGVLARYAAGIIGFMLLAITMMLSILVQRLQPRLSILYAHQAMAVLSLILSSLS
                     MGMNDVVVDLCNRGKQVDKTQCGSHIAETIAEVIIALTMVFGFGSSQQRIVTFIDKGI
                     LDGIKGRSNAGGLTQLP"
     gene            complement(<486831..>488108)
                     /locus_tag="LMJF_10_1100"
                     /db_xref="GeneID:5649715"
     mRNA            complement(<486831..>488108)
                     /locus_tag="LMJF_10_1100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681392.1"
                     /db_xref="GeneID:5649715"
     CDS             complement(486831..488108)
                     /locus_tag="LMJF_10_1100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681444.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.1100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.1100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649715"
                     /db_xref="UniProtKB/TrEMBL:Q4QHA4"
                     /translation="MSENRRYLKGLKDKPHHVTIALEDWLAARRGKVKSLAHLYGVSD
                     EEVRREIRRGNVENRTFRIRHVVPLFASREELLCTENLRRMAKERNLDLKALQRSKRT
                     VAHAYDAGVRSVPPALPLDIGGALAQVLTTRVTTCFGLHLIVTAQNEDAEQQSAPSLL
                     MDVAVRAHLERLPLPVLHRLISDLCEVRAAWKRDLLAPSAAAAVQEQALLGRESINAL
                     LYHVCLWQRRYPLELLSAVLSFYDEHKHLFSPATSERCSASVQLESLLEEVQCLQYPD
                     LSDVPGLIRCDVFMTYPHMPLGEQRQLMHTIAAAVVHRKAAGGLQRQSSCMGTEEKYV
                     TDNLLRHSRTPPDPRLLLRSFVVDGAAAIPERFCTDMPTQTYHEMRAAFERHKHDGVR
                     RLAAQDYGQAVTELTPPPPPPPPQPAASSVPSS"
     gene            complement(<490532..>492103)
                     /locus_tag="LMJF_10_1110"
                     /db_xref="GeneID:5649716"
     mRNA            complement(<490532..>492103)
                     /locus_tag="LMJF_10_1110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681393.1"
                     /db_xref="GeneID:5649716"
     CDS             complement(490532..492103)
                     /locus_tag="LMJF_10_1110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681445.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.1110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.1110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649716"
                     /db_xref="InterPro:IPR009604"
                     /db_xref="InterPro:IPR025852"
                     /db_xref="UniProtKB/TrEMBL:Q4QHA3"
                     /translation="MIGPNESSNADRLEYLYLNLVGQTVLIRTVDGALCEGLFVSRTD
                     ADLAANEAGVFISFPRNLPSKVHSALDASELSDETRLFRYEDIIMMEAKNMKLRTETP
                     GAGHVHSYRGEHDLKTLDWAAEGADELLEADSHVTGQWDQFKANERFGVASTYREELY
                     TTKLDESKLSKEQIAYAERTAKEIEGSGTRNLQHRLERTDVTTEYVDEGAMFSDVARD
                     ARGSKRSAQATRKEAAAATSAAPAAPAATPAATTATAGRGAARQAAPAPAPPPPPEEP
                     VTLPPPPAPEVGSAQQKTVYSPNPSATPFVPPLKSFLANVASLVANNDNCYACPTDWP
                     GDIDFYDRDVSHYSRPQTLVQPNMHHKYNQPVMNPMPGRGAPMNHHQHHAMNPHPAVY
                     NAGGPMGGHMGNPHVQQQHPQYMDPSNNNGMMSPQGPGGIPGPSPARMQQQQRASKTS
                     QPQQPVHTAAQTIPPPQQQQPHQQQQVSAIDSSGPQQDRAAPGTKKLRRGGMATAARQ
                     DGGEGAQGGGKKGGK"
     gene            complement(<493237..>493656)
                     /locus_tag="LMJF_10_1120"
                     /db_xref="GeneID:5649717"
     mRNA            complement(<493237..>493656)
                     /locus_tag="LMJF_10_1120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681394.1"
                     /db_xref="GeneID:5649717"
     CDS             complement(493237..493656)
                     /locus_tag="LMJF_10_1120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681446.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.1120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.1120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649717"
                     /db_xref="UniProtKB/TrEMBL:Q4QHA2"
                     /translation="MHDANRFGGRTAYLREIGPIDHKKKGRLFKRDLPTLQFNVDVWC
                     AQQTLRKQWKGRDWDVVEMPFEMAPKELQRVVPEKYTDVPIMTDPARHDYMNIRRKVF
                     DREDMQDALFASGGAGQSPYPAIQRVDKAAMTLDKYL"
     gene            complement(<494780..>499348)
                     /locus_tag="LMJF_10_1130"
                     /db_xref="GeneID:5649718"
     mRNA            complement(<494780..>499348)
                     /locus_tag="LMJF_10_1130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681395.1"
                     /db_xref="GeneID:5649718"
     CDS             complement(494780..499348)
                     /locus_tag="LMJF_10_1130"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681447.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.1130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.1130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649718"
                     /db_xref="UniProtKB/TrEMBL:Q4QHA1"
                     /translation="MSSSAPAAVEMRGCDEAGPRKMSHRTKHRKEVKRYHQRQQNKHL
                     REEAKARDAQLFLFETTELVARSAEQTRDNVHDAPVETVLTSSALMTVAQKGAAVASI
                     AAGSQPPRPTSEQHLHQQVQLAPASTTSAAAAVTSAHALTSASPSSWDFEFLLRASPA
                     STSAASSPAECSGVDSCATDAVALSTIEDATACRSLSVLEPLQSPAVVSAVQRGRVAL
                     PAAASRDLQISATTASGDRLPPESCAPQHSNARPSANWDRISALPIYSGASSTITKLL
                     NSTHVQRVEGVEAIPMQAPLAPGTDMNRPPRNYLTLDPVHNVHQHAPGFLRNQRVALQ
                     HMLASAVMEWKDMQQNALIVSSAEAMRTIFEQVYVPERPLALRVQRIGPTLVIDSRAS
                     EPSEVHEMRQQALFGKALYLMKETHGQATVEADETAAGAAGQLALALPERRLSSTAAS
                     DVHFGANLHRYSQVLRWRMDATEVLIGIDAPIVMDQRTNTEQLVRMKGKVPVGPADAE
                     QRETLRCWFDAMMANVSQVGTYVHHDGIVQSHQVKKTMDILDSVEARMAAAALSFTSR
                     ALQWLVKKCRRDGGTYAVVRDYPLEYVELYELPDLDDSAAFVEETDKYFGCAAAAAFA
                     SADRDAAGRVADGEAYIESEVPATTSSGYRIGGPPTASQLNRFNWNFGKTCFNIGQHL
                     FRSGDLSRASDALPLLHRSLRLLLPSCREDLAARETVAELVRMVPALVARKLHADAAQ
                     TAAAVASNSAAGCPKNAAASCVAGLCSSPEVYRDALLLCGRFEIPLRHMLVEAGTWEG
                     GQLMRAFFARCLVVCSAAACAVVALSLEAYYCGCHHLRALRMARNEVKAKEGKAALRG
                     VAHREEVMAAISSCTQDLLQVVVEGLVRLEEASELVGPLHSAAAAALAEAPTGTCTTD
                     ESISVNGATPVSKEDRSSKEESCPATFPMGSSRGSLTERGSQPSPSATSPAHTSEPSE
                     LKKCSRGADMVAVSASCSAVLDPRTQVDITPLRSALCELYGDVAAAAMSDAASGFSIR
                     VLTELGRRMEARLQQRGLKLPTTLVWLTTLKADVVSLSFTALRFYGRIGTHTRRHLVK
                     LALVYYLVGKEHHRTARYTKALEALHRAKSLLHASHKAAEDAVFGAVFGSHGMLQWAD
                     VMQLLGDVYRSVVERKLDGALGVAAATLAQPLLVGPLYELPEDADSFFTQALSAYTQG
                     GSDKACRSAKAYTLLLYASVLMERLAVSGVPATHSASQHIAQLIREAEELAPSTFAQE
                     REWQTLRLFTVTSAATQDTALARAVEEILLRTTTATSAAASSSHVRQSLPAAVAGGSD
                     DTADASVAMKESHLADANVAQRGGCRWERLVTLPPWPMLMELQKALVCCAMVEREASQ
                     SQSRPREATKVASTEAKYRGLLRWVGRTAGYLTSVLEYCKTRSGELQGAAARHQWQSV
                     LRSWREQEPCLLMHRMVSMIALRLLGAAQALLPSTKQQEARGAVKQIACALDHAATVK
                     AGGAEGHAAAVQRLLRDLNTLLAPFVEW"
     gene            complement(<501568..>502650)
                     /locus_tag="LMJF_10_1140"
                     /db_xref="GeneID:5649719"
     mRNA            complement(<501568..>502650)
                     /locus_tag="LMJF_10_1140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681396.1"
                     /db_xref="GeneID:5649719"
     CDS             complement(501568..502650)
                     /locus_tag="LMJF_10_1140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681448.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.1140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.1140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649719"
                     /db_xref="GOA:Q4QHA0"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q4QHA0"
                     /translation="MGNRTSHEQPTATGVTDIELRLAPHNFYLVFGKPSIQFARDRVR
                     GPLIYDVEVEYDDDENLVEHATTLDLTCAVPRRQKIELISAPSASPQAVGASKGLALA
                     FQIAATQPPERVRVYAGASVEYRDRDGVRLKTSGVVAAGSVCILDTTETDGLTTVVTN
                     PLVLPQLLQPLKYEEAASTLTNSTVQRVSYAPLAIEVLVGATEDPINKTQQCAPADKA
                     AHEATPPRSQLLQPSKKQIVQYTFLEAPEEASLRPASSLGGSEARTSHRFTCKVSKQL
                     LQVGNEVYDLEDVFDDGREDAVRDPGADEEDEEGLCVICLTNQKDTTILPCRHMCLCN
                     ECAAHLRLSDNRCPLCRGYIDRVMTL"
     gene            complement(<503734..>505176)
                     /locus_tag="LMJF_10_1150"
                     /db_xref="GeneID:5649720"
     mRNA            complement(<503734..>505176)
                     /locus_tag="LMJF_10_1150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681397.1"
                     /db_xref="GeneID:5649720"
     CDS             complement(503734..505176)
                     /locus_tag="LMJF_10_1150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681449.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.1150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.1150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649720"
                     /db_xref="UniProtKB/TrEMBL:Q4QH99"
                     /translation="MSFFISKTCDVFPPRRRGQSDGALRKELNARGAPRDSAIITKTE
                     LDIIRGMIDGRFPGSLSSTAATAVAPRTHTEAAEEHRRRMQEFDAERARNGVTPRTAE
                     EIEQAQLRQVNLEKARLMLDEECDEVKAMNRVITEAKCVATREAQRREKQKRMEEEAA
                     YNRQMDALMAQEAETAQQVYLERERQRMEEQRRNAAMIKVQLHERYVERVRRLERHQQ
                     EQDAMSRHIERLQVEEKAEKLRRIDAARRLMEEAAIANAEQIALKQREREMELEEDRK
                     MAEYIKQKEARDEAYAEEQARIRREKDMEIARLRANQQRVQDKQAELEELRARRVQEA
                     YIREERRKEKEAAERESAMHADLQQARLAQVEERNRQKALEKVQEQEELDRMLAVQKI
                     SREQELERQARTRRLQEENSLALLKQMMEVEERRRRQRQEEIEEGNQLRKAARERQAA
                     LEAIRDRKLGELEELDVPEQYRRALLKVGK"
     gene            complement(<507720..>508370)
                     /locus_tag="LMJF_10_1160"
                     /db_xref="GeneID:5649721"
     mRNA            complement(<507720..>508370)
                     /locus_tag="LMJF_10_1160"
                     /product="putative rab1 small GTP-binding protein"
                     /transcript_id="XM_001681398.1"
                     /db_xref="GeneID:5649721"
     CDS             complement(507720..508370)
                     /locus_tag="LMJF_10_1160"
                     /codon_start=1
                     /product="putative rab1 small GTP-binding protein"
                     /protein_id="XP_001681450.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.1160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.1160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649721"
                     /db_xref="GOA:Q4QH98"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QH98"
                     /translation="MANPNTPGGDCDYIFKIIVIGDSGVGKSSLTVRLSEDVFYKDYA
                     STIAIDFRMHQMNYMDKRVRLQIWDTAGQERFQSVATAFYRGANGVLLCFDLTHRPSF
                     IHLEQWMERVKQQALPGIPCLLVGCKSDEARSSRQVTREEAVAWAQQHNMAFIETSAK
                     EKENVQTAFQQITKFIFEDMKERNGKTPTAGDNAAGRSQSVNFDRQRSNRKENKCC"
     gene            complement(<510129..>510794)
                     /locus_tag="LMJF_10_1170"
                     /db_xref="GeneID:5649722"
     mRNA            complement(<510129..>510794)
                     /locus_tag="LMJF_10_1170"
                     /product="putative small GTP-binding protein Rab7"
                     /transcript_id="XM_001681399.1"
                     /db_xref="GeneID:5649722"
     CDS             complement(510129..510794)
                     /locus_tag="LMJF_10_1170"
                     /codon_start=1
                     /product="putative small GTP-binding protein Rab7"
                     /protein_id="XP_001681451.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.1170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.1170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649722"
                     /db_xref="GOA:Q4QH97"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QH97"
                     /translation="MEEDLAYKIIVIGSVSVGKSNITSRFCDGAFYPDLVPTLGMDFK
                     YSSCNTLEKRPRCVRLQVWDTSGQDDFVTLTTAFYRNCQGALLCFDLTNRQSFEDLDQ
                     WYERLERYSPVVPPLILVGCKLDLVESHLDEQGEGIVLGSHRQIAKSEADAWARYHSC
                     LCYLETSAKENRNVSQAFQQLATCIASVANPGAKHAGRILGPGGRLLVEEEKQQKRQC
                     CAN"
     gene            complement(<512803..>513225)
                     /locus_tag="LMJF_10_1180"
                     /db_xref="GeneID:5649723"
     mRNA            complement(<512803..>513225)
                     /locus_tag="LMJF_10_1180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681400.1"
                     /db_xref="GeneID:5649723"
     CDS             complement(512803..513225)
                     /locus_tag="LMJF_10_1180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681452.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.1180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.1180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649723"
                     /db_xref="UniProtKB/TrEMBL:Q4QH96"
                     /translation="MILGVGAGTFAVLVTVGVAILIALVGSYLAPQSSLFIILGCTVL
                     PFTVYGCILTSPHGPAANTTTVVPVTYYRERQLPSNTDVIDKFLPVRIVIVIVMALGL
                     FAGVAFHILTLVNSPPYEAPRVHCLRQKLEEAHPTWYR"
     gene            complement(<515235..>516428)
                     /locus_tag="LMJF_10_1190"
                     /db_xref="GeneID:5649724"
     mRNA            complement(<515235..>516428)
                     /locus_tag="LMJF_10_1190"
                     /product="flagellar protofilament ribbon protein-like
                     protein"
                     /transcript_id="XM_001681401.1"
                     /db_xref="GeneID:5649724"
     CDS             complement(515235..516428)
                     /locus_tag="LMJF_10_1190"
                     /codon_start=1
                     /product="flagellar protofilament ribbon protein-like
                     protein"
                     /protein_id="XP_001681453.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.1190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.1190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649724"
                     /db_xref="GOA:Q4QH95"
                     /db_xref="InterPro:IPR008805"
                     /db_xref="UniProtKB/TrEMBL:Q4QH95"
                     /translation="MDSAVEKQNLFSATNSRGIAAASSVDNAASASNQMNTKTKKQLF
                     MLQRAERLKDPKVRKMGIDREALDAQVREKEALRRLEKERNDYYDRQALLMDRHACAL
                     QQEVNSIRAAREKELQDYRQTFQKKEMGREWDLNDPEARRKELPARIGDDDPRNGPSS
                     LQKFEGEDLDYASRRAAQRRQQRQWAQQQVNEKLAKKWMEQERDRAFDDRNEEVNYRL
                     YEVEQKVAEQRRLMEKNGADFNRALAEQQRREAVRAKEEDTRLGLQEMAYQMDSDFLN
                     ERETVVSELGASVMAERYKGMSEKQKALLRAGQDEQLRELRRRRLLEVEEQRQWSLQE
                     NMQLRMANALDRQRERERRAECEQLAETHKMQAQAAAERKAQLDELYKNAVDEDYFKY
                     WDRCL"
     gene            complement(<517666..>518235)
                     /locus_tag="LMJF_10_1195"
                     /db_xref="GeneID:5649725"
     mRNA            complement(<517666..>518235)
                     /locus_tag="LMJF_10_1195"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681402.1"
                     /db_xref="GeneID:5649725"
     CDS             complement(517666..518235)
                     /locus_tag="LMJF_10_1195"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681454.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.1195"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.1195"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649725"
                     /db_xref="GOA:Q4QH94"
                     /db_xref="InterPro:IPR001876"
                     /db_xref="UniProtKB/TrEMBL:Q4QH94"
                     /translation="MLRGHGRLGARFLRRPCGAAAAAVVYPATSGTVAEMAMTSSNAC
                     TYVRSFSTATPLCLARRLAGNHRRQRSREPTKGDWLCQCGEVNYQSKRECYKCGAPAP
                     PLPPGVRRPSLPGEDPHDWACPCGQMNFRGAVVCHKCQQPKPVPPPLPGKETTLWTCP
                     NCKGVNRNNRKFCFKCSAASPLVEFKPQQ"
     gene            complement(<519624..>522812)
                     /locus_tag="LMJF_10_1200"
                     /db_xref="GeneID:5649726"
     mRNA            complement(<519624..>522812)
                     /locus_tag="LMJF_10_1200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681403.1"
                     /db_xref="GeneID:5649726"
     CDS             complement(519624..522812)
                     /locus_tag="LMJF_10_1200"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681455.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.1200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.1200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649726"
                     /db_xref="UniProtKB/TrEMBL:Q4QH93"
                     /translation="MAVLQQSTSAYSIIFVSRAASECLETLFVDADELTQFTLSVYEL
                     LCVRDAGLNAAAKLALRQLVCVAVQRGYHYSHTLAQMPSSVCASCSSSIQAGDQGDRL
                     RVGCEVLADLVITLSERRMATFATDVSIAKSFRDDHLLSVFRLAVRVVKEVQPSCRTV
                     MAAGLRLAQHVLEFDFACDTMQIEAEENPVTRTYPDSWAADLLDLQLMDRLWFVYRIP
                     DLEPDVAHTLLEVLTSLVSLRKSLFTDVELRPRWYAIVLLQTHLVMERFLHLEDEETL
                     SAFARLLNRMKPNCDLRELMQLAEFSPWLRSLCSFTRQCLANWKHASTSLLSLLSVWA
                     RLIEAKSYATQDTAEMLHCGLQVVGCYLECLHSRVQMFTMELAKFMSSDTAAMRQVNS
                     NSMPVEYMLDDDEEGVRLEVGFLLKVVIGCGEEGWKMLEANSERVSQSVLAHVRPNAS
                     AVSIDHIVLMEEAAWSLHLLSAALHADGAIDSGAVRVLAMLLHSLILLQRFSTHVVFL
                     DSVPGPVRGHIAAATTRVLAAILSKTVSVYVVSNRKTSAFVEQLSSQLRQCGEMDTAG
                     TFGAYFLNVAVHALWTVLSATNIPDEVRVAALQLLDEWTSTSSVLRLLKETRSYTYLM
                     NLHNESIPAPLQHPVALKARYLFIRCVAQVRFLDASALTDSVVNTLMEPVLARISQAV
                     YGAATGGSSAESTDRLTLALCDMRGILSCTERRPYRVVMDMIEPFLYPVADAVLLESS
                     CGEETVTQLLELVNEMALNKNQRIVFGAQSAKPVHIFRYVSRVVVRSARLVHLILGGS
                     ATGPSAQTPSPPLVEWGWKVMRLGLLAAYHVLQGGWCNLGVLQLYEDTALTNLLSSVW
                     GLLCRLPVHEYMVRSKVCTAVIKVVNVLAARFFHDFWAKQPPPEVFTVVGFVESLAFP
                     ASINAVEAAQQSDALQAMDRLVNCCWVRTAYPIEDLQQAAVMKSTLLRADAMVFHRLV
                     TCALERSVAVDNHGMRKLLLPLFYVEGSAVGEVAQYFCSRATTPAAAHALQVQFSDIQ
                     RHVTGNGDITSKTVDELANALHTLMSTLKESL"
     gene            complement(<524455..>526158)
                     /locus_tag="LMJF_10_1210"
                     /db_xref="GeneID:5649727"
     mRNA            complement(<524455..>526158)
                     /locus_tag="LMJF_10_1210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681404.1"
                     /db_xref="GeneID:5649727"
     CDS             complement(524455..526158)
                     /locus_tag="LMJF_10_1210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681456.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.1210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.1210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649727"
                     /db_xref="UniProtKB/TrEMBL:Q4QH92"
                     /translation="MRGSTSANAFSDASVQSAVLEEWKKRSAKHKEAASSLREKVRQL
                     RSDVEAGRRAAQWMQERDALNCEQEACEAALDAIEKSLGNVVPGADGERHQLELSALK
                     VLLSQQLTEVGALRHTSTAQQPKTSSSGAASADRVAEIREWIAEELRKCEASIEELAT
                     PSAGFEHQQNAVVECRAAARQAQLTFAALCDCYHPAHQLRVTFEAALKSAEEDTLARI
                     EDARVPTVAATPQDVLRTVGLIVKMGQSARQFDISAATMTALAERVSAVYPGMPSAQV
                     HVAIEESIALRKARALSQAAVSDFQRTNTSLLSSCESAFLVAQQSDKQRQERAEAARQ
                     RVEAQNRRRAHLTEERAAYEAVVRQRQSVEERTQAAAAAKEKALQAKRAIEFQERLRL
                     FEAYEVQQLALRQKERELAELQAQAMEEEKAARMRRNEERVEYRRQRDEQRQSEKKKR
                     EQEVLALRAKKQDALQRFFASVDKQIGVEADPQRFLKATSSSAQTERYTTLAQTVMPS
                     ITGFSDEQIMKDPRVRLYHALLAAGLHTTPYGREVATRGYRVSAAQQSSEGNPLRREF
                     S"
     gene            complement(<526964..>527110)
                     /locus_tag="LMJF_10_1215"
                     /db_xref="GeneID:12982603"
     mRNA            complement(<526964..>527110)
                     /locus_tag="LMJF_10_1215"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721735.1"
                     /db_xref="GeneID:12982603"
     CDS             complement(526964..527110)
                     /locus_tag="LMJF_10_1215"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721783.1"
                     /db_xref="GeneID:12982603"
                     /db_xref="UniProtKB/TrEMBL:E9ACQ9"
                     /translation="MFVFVACRLVLFPSFFFIPSLLCCCCWGRGLNDCDRNERGRSDR
                     KTVW"
     gene            complement(<527291..>528211)
                     /locus_tag="LMJF_10_1220"
                     /db_xref="GeneID:5649728"
     mRNA            complement(<527291..>528211)
                     /locus_tag="LMJF_10_1220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681405.1"
                     /db_xref="GeneID:5649728"
     CDS             complement(527291..528211)
                     /locus_tag="LMJF_10_1220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681457.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.1220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.1220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649728"
                     /db_xref="InterPro:IPR019156"
                     /db_xref="UniProtKB/TrEMBL:Q4QH91"
                     /translation="MAVASKGRIADVNQEELTKIGPKIDDVLSICLASFDSLRDMAFK
                     FQYEQAAEKAAYQSGETKPDPMTQLMHVLQRMVDLTLGTAKAVYDQTLLEWRRRKGEG
                     DADSPASQLASSQSMTSPEVLRNSSVEDFAAGSVAWIERGSHLSLLSLEVLSSVLLAH
                     HYLRRDLQKYMLDVNVLDYLEKVFSMERDHELCYFPEGFKTECMRLIANLTHNNVDVN
                     AALVERDTFLFNILSATQIDEENPGMVEWAEFALRNICESSAAAREKIRKLAPQGVTD
                     QSREILAGRCSYSFSSTGKVQLHTQKPPLH"
     gene            complement(<528878..>529810)
                     /locus_tag="LMJF_10_1225"
                     /db_xref="GeneID:5649729"
     mRNA            complement(<528878..>529810)
                     /locus_tag="LMJF_10_1225"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681406.1"
                     /db_xref="GeneID:5649729"
     CDS             complement(528878..529810)
                     /locus_tag="LMJF_10_1225"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681458.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.1225"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.1225"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649729"
                     /db_xref="UniProtKB/TrEMBL:Q4QH90"
                     /translation="MHCSGVDTLPMIWMGTSVFAVSGRSNATPSTTPPPTSAAMHRSD
                     IPNRMGDCHWHRQKWPGVGKVRCPLGFAPRRVRALNPDATHGVFTGYQCQEAVYGKEI
                     GEAIVFDGAMPGCLLLHCVVVARTYALAARAVSSLLGVTLPFEIMQPISLTPLRLVFS
                     VFMEFLTLGSVVNHAKTMVFIDKLKTMVSRSVGLSAGNALTTSSGAAPPTFAEAWNQA
                     KAMTNKLFEEREWQCPCGHKFRAAGEWVACAPIYCEVPSCPNPKYYIDGPGRALLEAN
                     PSGVKLEEVSNTGGGVTSQPDSGKKPGGVGSRFR"
     gene            complement(<531747..>532484)
                     /locus_tag="LMJF_10_1227"
                     /db_xref="GeneID:12982604"
     mRNA            complement(<531747..>532484)
                     /locus_tag="LMJF_10_1227"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721736.1"
                     /db_xref="GeneID:12982604"
     CDS             complement(531747..532484)
                     /locus_tag="LMJF_10_1227"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721784.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.1227"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.1227"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982604"
                     /db_xref="UniProtKB/TrEMBL:E9ACR0"
                     /translation="MVLRHYRWLPLELEPDYKDGYTCDHCHHDFLEAPFYHEETTGTD
                     YCLECGNAAGYTPFSGLVASLLFSSQDNVLRDSDSNSIALFAYRVDSQNAGICFANGS
                     NLVLHLQMNGNIRDAIFYTVKEGSIESKLRVSTTDLSRRFSWLSSGLLKHFDVEVQLH
                     TLPVVPVPLDDFCVLAYDATDDLIEIHLNEAYSQLLDVRDGKEIVTRAEMPVCAFSSH
                     ETVGCSKSEVTDLLRLLRTKAEALKRS"
     gene            533083..533155
                     /locus_tag="LMJF_10_TRNALYS_01"
                     /db_xref="GeneID:12982605"
     tRNA            533083..533155
                     /locus_tag="LMJF_10_TRNALYS_01"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:12982605"
     gene            complement(533198..533268)
                     /locus_tag="LMJF_10_TRNAGLY_01"
                     /db_xref="GeneID:12982608"
     tRNA            complement(533198..533268)
                     /locus_tag="LMJF_10_TRNAGLY_01"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:12982608"
     gene            complement(533325..533397)
                     /locus_tag="LMJF_10_TRNAASN_01"
                     /db_xref="GeneID:12982607"
     tRNA            complement(533325..533397)
                     /locus_tag="LMJF_10_TRNAASN_01"
                     /product="tRNA-Asn"
                     /db_xref="GeneID:12982607"
     gene            <533673..>534419
                     /locus_tag="LMJF_10_1228"
                     /db_xref="GeneID:12982606"
     mRNA            <533673..>534419
                     /locus_tag="LMJF_10_1228"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721737.1"
                     /db_xref="GeneID:12982606"
     CDS             533673..534419
                     /locus_tag="LMJF_10_1228"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721785.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.1228"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.1228"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982606"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9ACR1"
                     /translation="MESSLTAGGEMRMNSCRLCASPSVTLFHTDKMREYYRCHQCSLV
                     FVPDRFMLSSAEEKAVYDLHENIPGDAAYEKFLSRAAQPLADYLSAKNHSRRTPYQPQ
                     GLDFGCGPAPVLAKILSAAPYNFSMDVFDLYYFPETRYCLERAEHYDFITATEVVEHL
                     RDPLSVFRTLWHSIRPDGGVLVIMTKRVHGTIERFRNWHYTRDPTHITFFHTASFQWL
                     ADSLPSNGETCETRFVSADVALLIKRKSDS"
     gene            <535179..>536165
                     /locus_tag="LMJF_10_1230"
                     /db_xref="GeneID:5649733"
     mRNA            <535179..>536165
                     /locus_tag="LMJF_10_1230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681407.1"
                     /db_xref="GeneID:5649733"
     CDS             535179..536165
                     /locus_tag="LMJF_10_1230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681459.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.1230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.1230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649733"
                     /db_xref="InterPro:IPR015045"
                     /db_xref="InterPro:IPR023296"
                     /db_xref="UniProtKB/TrEMBL:Q4QH89"
                     /translation="MGSNASHTEPQVPRECTMVAKRKEFELTKVIQEATFLTFKGLDT
                     HDVYNCCVPFKISGTYHIFGRVERRSEWVNSHVRLFRKTGHDEYTLVEHAMQYQLEDP
                     FLVKINNEALFGGVRVTKDHGKVSGYVCDFYRGKIDDLHYFTSGPQNMKDIRLVVLAD
                     GKIGVFSHHKTSNTCITGFTIIDSLDDLCSQVIDSAKPIDHTLFGDAWGGVNQPYLLS
                     TGKIGCISHHGYLDTDAHGEVINVYCITSFVYQPSANKCYDYKILGTKNCFPDYPAKA
                     LKLIDCAFVSGIVMREDGKCDLYSGVGDTREGRMVIDYPFEGHGTIADDLDF"
     gene            <537861..>538826
                     /locus_tag="LMJF_10_1240"
                     /db_xref="GeneID:5649734"
     mRNA            <537861..>538826
                     /locus_tag="LMJF_10_1240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681408.1"
                     /db_xref="GeneID:5649734"
     CDS             537861..538826
                     /locus_tag="LMJF_10_1240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681460.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.1240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.1240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649734"
                     /db_xref="InterPro:IPR015045"
                     /db_xref="InterPro:IPR023296"
                     /db_xref="UniProtKB/TrEMBL:Q4QH88"
                     /translation="MGLLNTKPCSLIPAKEAFEREKKIYDKAILSFDGVNGYDVYNCS
                     VPFTYDGKTYIFGRVEKKDEWVHSNSILFEKVGENRYRRHPTSITYNLEDPFVVKIHG
                     EMVLGGTHVTKNGGKVSDYRCEFYHGTPLNLKYFSSGPSKMKDIRLVELADGKIGVFT
                     HFRTEGSCLTGFATIDKIEDLTVEVINSAKLINHRPFGDAWGGPSQVYLLSSGLLGCI
                     SHHGYLLDQKDDIQLRIYACTSFVFDPATYDVYNFKIIGTKGCFPPCEPKLPHLADCA
                     FVSGIEMRDDGKCNLYSGIGDVAEGCIVIDYPFEGYGKIVSDVAF"
     gene            <540628..>541584
                     /locus_tag="LMJF_10_1250"
                     /db_xref="GeneID:5649735"
     mRNA            <540628..>541584
                     /locus_tag="LMJF_10_1250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681409.1"
                     /db_xref="GeneID:5649735"
     CDS             540628..541584
                     /locus_tag="LMJF_10_1250"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681461.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.1250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.1250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649735"
                     /db_xref="InterPro:IPR015045"
                     /db_xref="InterPro:IPR023296"
                     /db_xref="UniProtKB/TrEMBL:Q4QH87"
                     /translation="MSTFETVKEEKLEFEKNCDQHIYEKALLTFKGVDGMDVYNCSAP
                     FKYEGRTHIFGRVEKRLEWANSYVRLFVETNKDEFTLVPGNMVWQLEDPFVSNIDNEM
                     FLGGTHIRKTNNRVFTYYCDFFRGTAENLSYFTTGPDNMKDIRLVKLANNKIGVFSRP
                     KTAAHAFIGFTVINNVMELTPTVIEEAPPLNVIHTGAWGGVNQAYLLSSDKLGCISHY
                     SYIDKDEDGNEITVYTNYSFVLNPYLREVEDARIIGTKGCYPKCSPKVHKLLDCAFSS
                     GIVMREDGRCDLYSGLGDAHEGRITIDYPFEGHGTLIDNLHF"
     gene            <545949..>546896
                     /locus_tag="LMJF_10_1260"
                     /db_xref="GeneID:5649736"
     mRNA            <545949..>546896
                     /locus_tag="LMJF_10_1260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681410.1"
                     /db_xref="GeneID:5649736"
     CDS             545949..546896
                     /locus_tag="LMJF_10_1260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681462.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.1260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.1260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649736"
                     /db_xref="InterPro:IPR015045"
                     /db_xref="InterPro:IPR023296"
                     /db_xref="PDB:2B4W"
                     /db_xref="UniProtKB/TrEMBL:Q4QH86"
                     /translation="MKQVKAAFEANKRVYESVLLTFKGVDGYDVYNCSVPFSYKGKTH
                     IYGRVEKRDIWAASHVRLFEETGKDEFTAVPELSWELEDPYIAKINNEMIFGGTRVRK
                     NGNAILSYYGYFYRGTPDELTYFTRGPGCMKDIRVLQLQDGRLGVFSRPRVGRKASIG
                     FVILNSIDELGAEVIAKAPPLDILSENAWGGVNQAYLLSSGKVGCIGHYSYEDTNEKQ
                     QPQSVYVNYAFVLDPQSRAITGAKIIGTKSCYPPCEPKVPLLADCVFASGIVMRSDGK
                     VDLYSGVGDSHEGRITIDYPFKGHGTIIGDLHFPMASSL"
     gene            <548109..>549050
                     /locus_tag="LMJF_10_1270"
                     /db_xref="GeneID:5649737"
     mRNA            <548109..>549050
                     /locus_tag="LMJF_10_1270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681411.1"
                     /db_xref="GeneID:5649737"
     CDS             548109..549050
                     /locus_tag="LMJF_10_1270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681463.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.1270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.1270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649737"
                     /db_xref="InterPro:IPR015045"
                     /db_xref="InterPro:IPR023296"
                     /db_xref="UniProtKB/TrEMBL:Q4QH85"
                     /translation="MSFKEMRLAFEGSKNIYESSLLTFKGVDGYDVYNCSLLFQYKGK
                     HHLFGRFERREKSSDSRVRLFVETGKDEYTVVPDQLTYQLEDPFVSKVQGSLFFGGTQ
                     VIKSGGNVTGYFCDFYHGMPQLLTYYTTGPDLMRSIRIVQLADGTIGIFSCHKTEGSC
                     LIGFTTVNSLNEVTREVIAEAKPINNAPFLGAWGGVNQAYLLSSGNIGCICHHGYLDK
                     DANGEQRNVCCITSFVYDPKRNNTHTFQLIGTRGCFPDCPSKSPSVADCAFASGIVMR
                     EDGKCDLYSGLGDTHEGRITIDYPFKGYGTVVNDLVF"
     gene            <550067..>551017
                     /locus_tag="LMJF_10_1280"
                     /db_xref="GeneID:5649738"
     mRNA            <550067..>551017
                     /locus_tag="LMJF_10_1280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681412.1"
                     /db_xref="GeneID:5649738"
     CDS             550067..551017
                     /locus_tag="LMJF_10_1280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681464.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.1280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.1280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649738"
                     /db_xref="InterPro:IPR015045"
                     /db_xref="InterPro:IPR023296"
                     /db_xref="UniProtKB/TrEMBL:Q4QH84"
                     /translation="MSSPQVVCEAKKAFEANKRVYESVLLTFKGVDGYDVYNCSVPFS
                     YKGKTHIYGRVEKRDIWAASHVRLFEETGKDEFTAVPDGMTWLLEDPFVSSVKGEALF
                     GGTRIRKVSNRLLSYYCDFFRGGIEQGLYFTTGPDNMKDIRCVELANGSIGVFSRPKT
                     DVYTCIGFTIIDDLSELTQKVINEAEPLNVLHPGAWGGVNQAYLLTSGKVGCIAHYSY
                     NSKDDKDCPTSVYLNYSFVLDPETKQAEMERIIGTRSCYPDYPVKAERLIDCAFSSGI
                     VMREDGKCDLYSGLGDTCEGRIAIDYPFEGYGAVVDQLSF"
     gene            <553368..>554303
                     /locus_tag="LMJF_10_1290"
                     /db_xref="GeneID:5649739"
     mRNA            <553368..>554303
                     /locus_tag="LMJF_10_1290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681413.1"
                     /db_xref="GeneID:5649739"
     CDS             553368..554303
                     /locus_tag="LMJF_10_1290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681465.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.1290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.1290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649739"
                     /db_xref="InterPro:IPR015045"
                     /db_xref="InterPro:IPR023296"
                     /db_xref="UniProtKB/TrEMBL:Q4QH83"
                     /translation="MLLKALKASFEANKRVYESVLLTFKGVDGYDVYNCSVPFSYKGK
                     THIYGRVEKRDIWAASHVRLFEETGKDEFTAVPELSWELEDPYIAKINNEMIFGGTRV
                     RKNGNAILSYYGYFYRGTPVELNYFTTGPDYMKDIRVVPLQDGRLGVFSRVRTRAEVY
                     VGFSTVDTIDHLTTEVIATAKAIDFIRPGTWGGVNQAYLLSSGKIGCIGHFAYNDTKP
                     SGEPLMVYINISFVFDAETRQLDTEHVIGTKSCYPACPAKLPVLEDCVFASGIVMRSD
                     GKCDLYSGLGDTHEGRITIDYPFHGYGNIVGQMIF"
     gene            <556391..>557872
                     /locus_tag="LMJF_10_1300"
                     /db_xref="GeneID:5649740"
     mRNA            <556391..>557872
                     /locus_tag="LMJF_10_1300"
                     /product="phosphate-Repressible Phosphate Permease-like
                     protein"
                     /transcript_id="XM_001681414.1"
                     /db_xref="GeneID:5649740"
     CDS             556391..557872
                     /locus_tag="LMJF_10_1300"
                     /codon_start=1
                     /product="phosphate-Repressible Phosphate Permease-like
                     protein"
                     /protein_id="XP_001681466.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.10.1300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.10.1300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649740"
                     /db_xref="GOA:Q4QH82"
                     /db_xref="InterPro:IPR001204"
                     /db_xref="UniProtKB/TrEMBL:Q4QH82"
                     /translation="MANVNPYLWIVIVGGFVSFLTGAGVGMNDLANAFGTTYGARILT
                     LTQIVIVASVCEFGGAVTLGGEVTSTISSGVADPKDFAKQPYVFMYGMLCACGAAFCW
                     LAVATWLRLPVSSTHSICGGVIGFALVYGGGGAVSWAKRKDDFPFFSGVAPIVASWFI
                     SPVLTGAVSAIIYSLVRFLVLRPKNCVKRAMYTLPVVVAIAFFLESFFVLFKGASKRL
                     KWSVGKAAWVATCIGAGAGVLSCVFIPLLKRLVARDEAHAFAASEERPSTTEGSTQRE
                     PLNDEDVHKAREVTGDVVSQSEASDSEQSEERQVTGASGLQVQQYEWRAERVFRYLQV
                     FTAICASFAHGASDVSNAVGPLAAIYQVYQTGGVEKSSSVPIWVLCLGGAGLVLGLST
                     FGIRLMRLMGEDLTVITPSRGFSAELSAALVVSFASGYGIPVSSTHCITGGVIAVSIV
                     DVGFLNIRWLMVLKMYGGWVFTLVVTAIISAMFFAQGASAPAM"
     gene            <559962..>561941
                     /locus_tag="LMJF_10_1310"
                     /db_xref="GeneID:5649741"
     mRNA            <559962..>561941
                     /locus_tag="LMJF_10_1310"
                     /product="putative pteridine transporter"
                     /transcript_id="XM_001681415.1"
                     /db_xref="GeneID:5649741"
     CDS             559962..561941
                     /locus_tag="LMJF_10_1310"
                     /codon_start=1
                     /product="putative pteridine transporter"
                     /protein_id="XP_001681467.1"
                     /db_xref="GeneID:5649741"
                     /db_xref="InterPro:IPR004324"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q4QH81"
                     /translation="MTVGQQTGNVVGGADVLCATPPAEQLGEEDKGYVHPDTAALFDA
                     SPFMRYIPIFGTAVVPFGPKCVMSLGIVYILSKGLAKTLLNSSRYAMFMKKYGVTTAV
                     YQRISGIGSLGFSIKPLTAILSDTFAFFGYTKRWYMALSCIAGAVCAIVYGVLPFKQS
                     SAGIAGAMIFISVFCIANIDVLSEGHYSRLIKRHPIPGADLISWIWALIMVGAIIAST
                     IQGPLSDSGRPTIGIFLSAGLQAFCVFFFIFNWYGEKKNLVERKEDYIFLLKQEAQMQ
                     ETDSEPIKEGVGMHDITTGKSKTKSTVLYHESSPQNSDGELVNFGELDDDVTEYDFVA
                     TSCMCGIFGVNKEIISRNISVAVYGVIMTAGVVALTVLNIMGTTYQLLYGCVSISVIL
                     CATGFLCIPMTIMKANFFGWCQQVCYILISGGTDNFYMSDASCLPDGPHFSQTFYNTV
                     GAVIGNAAGVFGVYLFARVFSKQSYRVTLICTTLVQILASIFDIIIVERWNLYIGIPD
                     HAMYIMGDAIVYEVCNMLNFMPLNMLISRLCPKGCESTMFAILASFSNMGASTSSTIG
                     AILMETVWPLSSSPPCDFSNLRWLLISGHFITPLIAIPLVIVLIPGTRICDPIDPKDV
                     EALSIFQKWLNKFYATSSAHAKPQPKSLPDSERQQ"
     gene            <564927..>566111
                     /locus_tag="LMJF_10_1320"
                     /db_xref="GeneID:5649742"
     mRNA            <564927..>566111
                     /locus_tag="LMJF_10_1320"
                     /product="putative fatty acid desaturase"
                     /transcript_id="XM_001681416.1"
                     /db_xref="GeneID:5649742"
     CDS             564927..566111
                     /locus_tag="LMJF_10_1320"
                     /EC_number="1.14.19.1"
                     /codon_start=1
                     /product="putative fatty acid desaturase"
                     /protein_id="XP_001681468.1"
                     /db_xref="GeneID:5649742"
                     /db_xref="GOA:Q4QH80"
                     /db_xref="InterPro:IPR005804"
                     /db_xref="UniProtKB/TrEMBL:Q4QH80"
                     /translation="MKSVLKAGREKDVDVVVPPKELTIKQIQDQIPAKYFERSAVWGM
                     YYVFRDIFQVLALYFIMYRAVMPVLSALGGVVYGVAGANIVSWTVVGAVKFAAWTVFG
                     IAQGLNGFAIFVLAHECGHQAFSSYRLLNNAVGLLLDSVILVPYHSWRISHGNHHKHT
                     NHLTKDTVFVPRKEQRVIGLVEETPLVMLWNMFVIFTFGWPAYLVANIASQDYGRRTN
                     HFEPSSPLFHKDDGPDIVLSNIGIVAALFILGLCTYQYGAYNVFCWYVVPYLWTNFWL
                     LYVTYLQHSDLRIPHYTHAHWTFVRGAIATVDRDYGFIINEWLHYINNSHVVHHLFSQ
                     MPFYHAIEVTRHHIKDIIGDAYVTDSRSLVEMLCETWRECRYVIPSEGISVFYSFTGK
                     GA"
CONTIG      join(FR796406.1:1..570865)
//
DBGET integrated database retrieval system