GenomeNet

Database: RefSeq
Entry: NC_007255
LinkDB: NC_007255
Original site: NC_007255 
LOCUS       NC_007255             622644 bp    DNA     linear   CON 16-JUN-2017
DEFINITION  Leishmania major strain Friedlin complete genome, chromosome 14.
ACCESSION   NC_007255 CT005253
VERSION     NC_007255.2
DBLINK      BioProject: PRJNA15564
            BioSample: SAMEA3138173
            Assembly: GCF_000002725.2
KEYWORDS    RefSeq; complete genome.
SOURCE      Leishmania major strain Friedlin
  ORGANISM  Leishmania major strain Friedlin
            Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae;
            Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Rogers,M.B., Hilley,J.D., Dickens,N.J., Wilkes,J., Bates,P.A.,
            Depledge,D.P., Harris,D., Her,Y., Herzyk,P., Imamura,H., Otto,T.D.,
            Sanders,M., Seeger,K., Dujardin,J.C., Berriman,M., Smith,D.F.,
            Hertz-Fowler,C. and Mottram,J.C.
  TITLE     Chromosome and gene copy number variation allow major structural
            change between species and strains of Leishmania
  JOURNAL   Genome Res. 21 (12), 2129-2142 (2011)
   PUBMED   22038252
REFERENCE   2
  AUTHORS   Ivens,A.C., Peacock,C.S., Worthey,E.A., Murphy,L., Aggarwal,G.,
            Berriman,M., Sisk,E., Rajandream,M.A., Adlem,E., Aert,R.,
            Anupama,A., Apostolou,Z., Attipoe,P., Bason,N., Bauser,C., Beck,A.,
            Beverley,S.M., Bianchettin,G., Borzym,K., Bothe,G., Bruschi,C.V.,
            Collins,M., Cadag,E., Ciarloni,L., Clayton,C., Coulson,R.M.,
            Cronin,A., Cruz,A.K., Davies,R.M., De Gaudenzi,J., Dobson,D.E.,
            Duesterhoeft,A., Fazelina,G., Fosker,N., Frasch,A.C., Fraser,A.,
            Fuchs,M., Gabel,C., Goble,A., Goffeau,A., Harris,D.,
            Hertz-Fowler,C., Hilbert,H., Horn,D., Huang,Y., Klages,S.,
            Knights,A., Kube,M., Larke,N., Litvin,L., Lord,A., Louie,T.,
            Marra,M., Masuy,D., Matthews,K., Michaeli,S., Mottram,J.C.,
            Muller-Auer,S., Munden,H., Nelson,S., Norbertczak,H., Oliver,K.,
            O'neil,S., Pentony,M., Pohl,T.M., Price,C., Purnelle,B.,
            Quail,M.A., Rabbinowitsch,E., Reinhardt,R., Rieger,M., Rinta,J.,
            Robben,J., Robertson,L., Ruiz,J.C., Rutter,S., Saunders,D.,
            Schafer,M., Schein,J., Schwartz,D.C., Seeger,K., Seyler,A.,
            Sharp,S., Shin,H., Sivam,D., Squares,R., Squares,S., Tosato,V.,
            Vogt,C., Volckaert,G., Wambutt,R., Warren,T., Wedler,H.,
            Woodward,J., Zhou,S., Zimmermann,W., Smith,D.F., Blackwell,J.M.,
            Stuart,K.D., Barrell,B. and Myler,P.J.
  TITLE     The genome of the kinetoplastid parasite, Leishmania major
  JOURNAL   Science 309 (5733), 436-442 (2005)
   PUBMED   16020728
REFERENCE   3  (bases 1 to 622644)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 622644)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire, CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR796410.
            On Jun 1, 2012 this sequence version replaced NC_007255.1.
            Data release policy www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..622644
                     /organism="Leishmania major strain Friedlin"
                     /mol_type="genomic DNA"
                     /strain="Friedlin"
                     /db_xref="taxon:347515"
                     /chromosome="14"
     gene            <3071..>3994
                     /locus_tag="LMJF_14_0010"
                     /db_xref="GeneID:5650355"
     mRNA            <3071..>3994
                     /locus_tag="LMJF_14_0010"
                     /product="putative exosome complex exonuclease"
                     /transcript_id="XM_001687549.1"
                     /db_xref="GeneID:5650355"
     CDS             3071..3994
                     /locus_tag="LMJF_14_0010"
                     /EC_number="3.1.13.-"
                     /codon_start=1
                     /product="putative exosome complex exonuclease"
                     /protein_id="XP_001687601.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650355"
                     /db_xref="GOA:Q4QFY3"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR022967"
                     /db_xref="InterPro:IPR026699"
                     /db_xref="UniProtKB/TrEMBL:Q4QFY3"
                     /translation="MSSSVVIVGDSICGGDGDQKLSTSHDEVYLRGFNTFAGNNPSDR
                     ALLHEGAGEVVAAISGHIEVTERVISVKGLLPRYQPEIGDVVVGRIVEVSGNKWHVDV
                     NSTQTAIMLLSSVTEPGGILRRRGRGDELGMRQIFDQDDLVAAEVQRISPDGVMSLHT
                     RAADKYGRLSGLGILVSVRPSLVKRAKHQFVELADYSTQLIIGMNGNIWICSVQPSTS
                     DAEETEHATDARQNVARVANCIKALGAAQVQIHPASIEASVAASLDAGLSVFDVSLPK
                     NRDALVARVADMVGMQHRRPTGGGACARTLV"
     gene            4772..7591
                     /locus_tag="LMJF_14_0020"
                     /pseudo
                     /db_xref="GeneID:12981143"
     CDS             join(4772..5338,5340..6767,6770..7591)
                     /locus_tag="LMJF_14_0020"
                     /EC_number="2.7.1.137"
                     /pseudo
                     /codon_start=1
                     /product="putative phosphatidylinositol 3-kinase 2"
                     /db_xref="GeneID:12981143"
     STS             6040..6368
                     /locus_tag="LMJF_14_0020"
                     /standard_name="ABA003"
                     /db_xref="UniSTS:539111"
     gene            <8111..>8923
                     /locus_tag="LMJF_14_0030"
                     /db_xref="GeneID:5650207"
     mRNA            <8111..>8923
                     /locus_tag="LMJF_14_0030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687550.1"
                     /db_xref="GeneID:5650207"
     CDS             8111..8923
                     /locus_tag="LMJF_14_0030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687602.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650207"
                     /db_xref="UniProtKB/TrEMBL:Q4QFY2"
                     /translation="MVAWGPLQRRLFAYIARHPQFQQAVRNVGQRVVAHPTFQKAKQS
                     AYSAFERAGTRAARSSSVSGAKESGNTEGSALSAWRRRINDGWHKHKAGVMSFIAANF
                     MAILIFVQVSPMLWHSLKRGIHYLTAAPSNAEGERREKPRKLKAEAAEVQSSFKAEAP
                     SDTMRGAVLRSVPPPQTPWGSRTEHGEPASGPSQSWQTSSSLFDDTVGTKQKPDVQQS
                     FSEMHKDVFRTPDGSAQINFDTSFLVKMGDETTFTSSLAREALTGSVSSHSL"
     gene            <9806..>12874
                     /locus_tag="LMJF_14_0040"
                     /db_xref="GeneID:5650208"
     mRNA            <9806..>12874
                     /locus_tag="LMJF_14_0040"
                     /product="putative j-binding protein"
                     /transcript_id="XM_001687551.1"
                     /db_xref="GeneID:5650208"
     CDS             9806..12874
                     /locus_tag="LMJF_14_0040"
                     /codon_start=1
                     /product="putative j-binding protein"
                     /protein_id="XP_001687603.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650208"
                     /db_xref="GOA:Q4QFY1"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR024779"
                     /db_xref="InterPro:IPR027417"
                     /translation="MCERYTAANEYEKAEMRNSLYMREYPLFAYSMRHQRALFHPADY
                     VSRILQFCSYYVQAPDADVLSLQDRSPFLHISPIKEICTQLRLIARGTPVAASDSESP
                     VPEQLRLHAESDVEKLAAERATAMSIAASSGGASETEQLSLFSGVAPSALFQKDAVEE
                     VNKDAEDTMEDLTGEETVDAVHSFQAEYLTLDGFELVTKASIFYDREGEGQCIVAVYI
                     PGGVPEDTCRAAAAVLEPAATKKNLRAPTNGGLPPDTGIVGYYDYLTNPTQHKCRETE
                     FSRRNWGLLAQSEPLLKHLDKLYSQLAPMHHHLQRVAIPSQYQLCGTVFSTITVNRNF
                     RTAVHTDRGDFRSGLGVLSVINGEFEGCHLAIKRLKKAFQLKVGDVLLFDTSLEHGNT
                     EVVNPEIHWQRTSVVCYLRTGLMSSVCEMERRKHLNRLILEQLLNTEVRNTTVNINGA
                     DSSLPPLFVPTRLASHLAPVQLAALGFIVERTEKQSGCVVAMTMGLGKTLVALTLCFS
                     QLYLAPQADILILTPKPIISHWVDEKNKWGMHGLHFPHFVASDGLNSLEFEQQLLEYE
                     RQKNNEKPKSGHIFVINGEYLAGFLRRFKRFTPLVMIVDEGHRVAAKGNKLTESLDRL
                     RCNLRIVLSGTPLQNDASELYRLVGWVNKGVSRVLPPKRFQELANDINQFVEGDDGAF
                     YNAVVAQEYIQDWMRGFVFREMENDLPPLHDYLLICGSSDVQREYEEKLGLTETAMTA
                     LKATEHRPHHLSTHPACYLAFISDSYQSMVSGWTVRALSNTSRQRVSQLEEIDTMRLE
                     QYVQLVENEQLDAFIDLSGKMRVLVDIVLRVQARKEKLIVFSLYVGSQDLIHRTLTAL
                     RVCTFTVRGRDSQDRRRRAMQEFSENKDLIVLVLSTKIAAYGLDFTAANHVVLFDSWW
                     NPQVDAQAIARAYRRNQRKPVTVYRLISATENKFVLRSQTRKIALFKCILHERTSRQA
                     LPDELEDCAANEKDEERRNFWAKLKMTSLAGDTRALLNVYRYQESVRESE"
     gene            <14310..>16511
                     /locus_tag="LMJF_14_0050"
                     /db_xref="GeneID:5650209"
     mRNA            <14310..>16511
                     /locus_tag="LMJF_14_0050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687552.1"
                     /db_xref="GeneID:5650209"
     CDS             14310..16511
                     /locus_tag="LMJF_14_0050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687604.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650209"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="UniProtKB/TrEMBL:Q4QFY0"
                     /translation="MKRGVRQAKSLHVLQRLLGPVVALYISRCRAKADLARKASLYHA
                     PSIDALKQLQIFAKWPDSALQEWLSHGVMVVHKKGTCIGFACEPPKAARVYWVIAGKV
                     AQVPTKSELRECADELLHLPPNAPKTGPVVLPAHFLEDAAKAALPPLTPTQERIKESL
                     ATYHAGHLVDAERLLLGGGRRRSLRCQTDAVMLSFPFSLFSKEVQCLPGPLRSDVIDV
                     ARTVAQRAMAQLGEMPSVHSLTSANPVLQSLPLRDLRALRLQLRPFVFLQFDVICHDV
                     ANSDNVFFLSLGKVLIEDCKSCSSTITSKVSTAVGLETFVPCCFPDYYDQKLRAKAAT
                     YCEMWCIPTAALLALCSAATQLRCVQAAAQLLVDKTRRLAPASALRTCPCFAGISEAA
                     VAAVARALQVRVYCAGDTIVASKRAPSTGILVVAGVVVVHSNRKRAPEPLRTGQARYF
                     CECFVKMALEESVISQSSSIVLHGSPGAIFELMEALDTASNDIKIMLDSAQEYVNGRY
                     GTGASNLSKAQNAAAERVKAYKRRCAGAAPTASPPSTSIDAVDNLTVLENELLASLAL
                     QLQALHPDTGDDAKFNVLRVGELTMVDDDAPSDHRPGAECFSLDDEGRLITCTLPALV
                     TSARPLTEIPVAPSPVIVAPRTDVVAASLQQREKTKEKTSSTQETAAVVPRSLRTAVR
                     AAAPAAAGQCSVLSPRLTALRTTATRLREEADGVDKRREYQRQLLRVKRSL"
     gene            <17072..>17647
                     /locus_tag="LMJF_14_0060"
                     /db_xref="GeneID:5650202"
     mRNA            <17072..>17647
                     /locus_tag="LMJF_14_0060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687553.1"
                     /db_xref="GeneID:5650202"
     CDS             17072..17647
                     /locus_tag="LMJF_14_0060"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687605.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650202"
                     /db_xref="GOA:Q4QFX9"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QFX9"
                     /translation="MPSSVAYVLGTESCGKTDLVHQLEYLTLGLVRTVPTACTPTTGQ
                     EVTKLNICSPAGKGKVTVEVRELGGSLVNTWESFIESRKARDGGSGDTSFLLIYVVDG
                     VAPHQLPLASTMFRYLTQGRHAPCAGWPTLITVQKCASVNAITAEEVRSFFLDEVEAP
                     ANVDVVEVDSWNGIGTGDVLKGIEAVFGGLQ"
     gene            <18340..>19179
                     /locus_tag="LMJF_14_0070"
                     /db_xref="GeneID:5650203"
     mRNA            <18340..>19179
                     /locus_tag="LMJF_14_0070"
                     /product="hypothetical protein"
                     /transcript_id="XM_001687554.2"
                     /db_xref="GeneID:5650203"
     CDS             18340..19179
                     /locus_tag="LMJF_14_0070"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001687606.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650203"
                     /db_xref="GOA:Q4QFX8"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="UniProtKB/TrEMBL:Q4QFX8"
                     /translation="MSDFEVVSSEDEEAGMITVGRSAEVPPYGHLRPFCKGKLLWSPE
                     ASHWMLVLLALAGGTLLFMLLWGSLRYTSPNILPNRWMMQLPDIIVALLAVVSATLLL
                     CTSLTNPGILPKNNLPPSLSSSAAKDYCTTLPYCMTCHIYRPSQSGHCRRCNNCVALF
                     DHHCRLLGCCIGELNRRYFLLFLFSTAVCSAFISACLGYFVVVVPPKGNLVLYILFTV
                     GLVITVLLSLVLAGYLLHNLRLIRMGLSHREYMNGAASRSRGRASFFANLIQVFFPRK
                     ECG"
     gene            <20157..>20993
                     /locus_tag="LMJF_14_0080"
                     /db_xref="GeneID:5650204"
     mRNA            <20157..>20993
                     /locus_tag="LMJF_14_0080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687555.1"
                     /db_xref="GeneID:5650204"
     CDS             20157..20993
                     /locus_tag="LMJF_14_0080"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687607.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650204"
                     /db_xref="UniProtKB/TrEMBL:Q4QFX7"
                     /translation="MLRQFIVPVRQTTQRAGLATPPLFGVQKCYVNMNRSVQTRWEID
                     SQTASQKRTEYDFDKEQWMKQMRFASMDCIMDPDITPIRYTSVAGVKKAFRRFVTMRK
                     LMDRRPDFDPVQLKELFIHFKTLSHEKSPDCFKTLQRITTHGEADRILKEIKGRMNED
                     FAKKSWRSLKQQGAKSTYEMEVDSFDLVTCYMGQMSQEDWLQITYRCEFRQRESKEYD
                     WETMMEYPVFEVRLGDGVKAPNTHPFIVVGVLKKDGTRYGKDSQDAADLRKQFDRTGR
                     WF"
     gene            <21613..>22770
                     /locus_tag="LMJF_14_0090"
                     /db_xref="GeneID:5650205"
     mRNA            <21613..>22770
                     /locus_tag="LMJF_14_0090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687556.1"
                     /db_xref="GeneID:5650205"
     CDS             21613..22770
                     /locus_tag="LMJF_14_0090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687608.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650205"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:Q4QFX6"
                     /translation="MDRLAGSFLSNGDVANASSLYNSLEKLNPTRYSRMARICRVLLN
                     PQGVPLPHRHLDICEALLDPLVPPEVLLRDSAENVQKSFQRLAVCAHPDKNPSPSANE
                     AFLRLTMMKDKALELLRNGVGRKCDGATEAPPGKAADSNGGKGKPKMQGSGPAVPTVA
                     HRRRPLRPGVPLPAAATAVTSDINTAAAVSSKISQLRRTKITLNALKRKDIADDFEIF
                     SATQRTTAVQSEVSHSDVGEDHLATTVPVMSTKERARCANRRRSQSSAPQEKTTTVPR
                     ASSPNSNPLLSSSLYYAMPVSPHKPLSPSPQTLEDPTGSVKSSGAGDRDASALYSPFI
                     PTAAIPADSDAIRRQIDEACLRLREMRLQHTTVRLDLDLSFEAYERSKQPQ"
     gene            <23977..>27066
                     /locus_tag="LMJF_14_0100"
                     /db_xref="GeneID:5650206"
     mRNA            <23977..>27066
                     /locus_tag="LMJF_14_0100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687557.1"
                     /db_xref="GeneID:5650206"
     CDS             23977..27066
                     /locus_tag="LMJF_14_0100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687609.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650206"
                     /db_xref="InterPro:IPR001715"
                     /db_xref="UniProtKB/TrEMBL:Q4QFX5"
                     /translation="MSASRQAPKVSATARATKFSTIRKLPTAEHSTSPVAAAPTSSEE
                     PSRLALISFDVDATIDTVNLLHEEQHRVSEEDATDKRIGRYHYAQLVARLNEQRSLYQ
                     STAMFVETMLKEVNHSTEASVAMKASAATWGLKLLAKHAGHGAINAVLESLLPALYCE
                     YNPKKLCSAPPAVQLQVRRPDVIMDNPYFTHSMFVDEVQVDKRSATKLQKSLEAALRA
                     NDQRRSIVCHLIERRRQQQLEVTFRCWRHHVRQQHLLRMMGDNTAKQRAEEMSRLRVQ
                     TVFYHWKLLVERSRSTYLTERLHEAAFQLENAKNQFQLQCYRADRLVKTAKEATEEME
                     RVSQINKGLQRQVDELKEEQVRKEREYKEKLTRNVTQVLKLLETYDSLARVLLHSKQA
                     DEYVMPEKPLLARHSQSGDGGQEASENEGQSLEVNAVTEASWENPSGSALQWLRQWCD
                     GVLGQASGRTEPFKPIRSFGADFSNGERYLYIFQHVFPEVIPTVLQIHNMDVESRLRR
                     IRGYVADCGLRYRLVPSDLLNEREDLLVCSLSELYQQHLLRKWDQMVSRSVTELNAFT
                     EGDMKAALLGCTASSPTEDAADVPIEQLDEAAVRAHVSDYVERVKAMSEEFRTSLAVE
                     NEVVKASTAIAVQEARLGGERLQGTPIPLVDEAERCAFWKLPSGALDDLRGTKKLNSE
                     EKMWNLIVTQTLPEVLQAHVDTTSRLFFLFAGENAKSLSEVAFWRLVECSGMLVGGME
                     VPMDWIARQYDHVVTPQLDAALRAVARNQSEMSVQKLRQVAYQEMDIRSATPQQFVEL
                     LVRLAMASEKGKHGLVEGTRRLLQGLQLLTNEISPVARALQEPEAQHVLRFFNEDLFR
                     VYLFYVKKQESSRNTQDASMATQFGGRFASQMSITMLLTMLEDCRFLLDSSGRRNSSI
                     GASADSTRPLFFINAAQVRKVVSALGSFCKGAMSGGLSFNLFVDTLAVLAHHWCPDPL
                     VPEPRRLAGFLAHTVQQLSARHINSTLLLGTVPTIRLEGPRNVDFSQEARPSVGTVA"
     gene            <28026..>29597
                     /locus_tag="LMJF_14_0110"
                     /db_xref="GeneID:5650210"
     mRNA            <28026..>29597
                     /locus_tag="LMJF_14_0110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687558.1"
                     /db_xref="GeneID:5650210"
     CDS             28026..29597
                     /locus_tag="LMJF_14_0110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687610.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650210"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:Q4QFX4"
                     /translation="MWNGPTYAIARVRWDSVVRTFSACGTSLASPQRRFSSWFEEQPG
                     GGQHNVEDKAVAAFAVNADRLEKGKTIIKKKAHGIPFHISDAEAVDNVCRHHGAAVEI
                     HSVERFLMPFWLTETSAAGTFKADLLQHDRMNITQPHYFLWLEGPRYQFNYPFGEYMP
                     MNQVSASYREPLKVVERCLTGTHVPSMLLSRFELLHEVEKMEHRPTVIPFTMSTVTAL
                     SVIERRVNRRVVLDRIDRELRKFHGSFLKSNVSVMSLQMVASSIRPAFLPLFKLTVST
                     ISHSTPVPAFICGATGKVVGPVLHVQRRKRLGLAAAAAVGTLLSLAPLVEPGVATAAA
                     LAVVASSGFVQQAVQRARFVREQAHQMAQLKSVGVLNLVADSTGYRWTPEEEEKEEYE
                     YREELRRQARARDAFEQRVKEEAARDRVRAHGTHFDPKNRRRTDLADVDPRGYYELLG
                     LKGKEFSATAKDITKAFREAVRIHHPDVHPEGEAENKKRHMQRIIEAYKILHNPKTKK
                     FYDSGEMSGKSQETS"
     gene            <30393..>31463
                     /locus_tag="LMJF_14_0120"
                     /db_xref="GeneID:5650211"
     mRNA            <30393..>31463
                     /locus_tag="LMJF_14_0120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687559.1"
                     /db_xref="GeneID:5650211"
     CDS             30393..31463
                     /locus_tag="LMJF_14_0120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687611.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650211"
                     /db_xref="UniProtKB/TrEMBL:Q4QFX3"
                     /translation="MTSSMSVPPPPPAAIPLPSSATAVPLPPSCVVPPPPPAAAVPLP
                     PAEATPPPPSAPSVPPPPASVIPLPQPPGINAAVSAAAPPPPPPPSAIAAAPLPPEAA
                     PPAPTSVVAPPPPMQAAPGVTAPPPVQPISVEAWRTLESATREPVPNMAATRYLAVEE
                     RVRDEVCRLFILSEYDVGTLMVNIAQSLQHVGRHDVGLLRNENNTAFTITQSTAHARQ
                     RDTLMEQRRHAVADAVERINQAGSDAEREFAEVAQRVAATAPPAAPVKDTPTAAAPTF
                     RKSAYELLMEQIAATRRRRSPQNRRVASPEQRPKRAAGGAGCVEYPTSYSGNYLLRRY
                     GGTYDLQRQYSHYRYYGFPPSK"
     gene            <32354..>33412
                     /gene="IG-NH"
                     /locus_tag="LMJF_14_0130"
                     /db_xref="GeneID:5650212"
     mRNA            <32354..>33412
                     /gene="IG-NH"
                     /locus_tag="LMJF_14_0130"
                     /product="putative inosine-guanine nucleoside hydrolase"
                     /transcript_id="XM_001687560.1"
                     /db_xref="GeneID:5650212"
     CDS             32354..33412
                     /gene="IG-NH"
                     /locus_tag="LMJF_14_0130"
                     /codon_start=1
                     /product="putative inosine-guanine nucleoside hydrolase"
                     /protein_id="XP_001687612.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650212"
                     /db_xref="GOA:Q4QFX2"
                     /db_xref="InterPro:IPR001910"
                     /db_xref="InterPro:IPR023186"
                     /db_xref="UniProtKB/TrEMBL:Q4QFX2"
                     /translation="MPCRKIIIDTDCGGDDAIGIMTALADPNTDVIAMTAVWGNVNVN
                     QGMENIGKLLDVFERDIPFYKGAEAPLVSDPETVQWGGFGKDGFGDADFPPSARVLVQ
                     SKTHAALAITELLRAAKPDEDAVYQLVCLGPLTNIALAMRLDPEVFHVLGSETEPAIT
                     IMGGASEAKGNSNLTSEFNMHCDPEAAYIVFNQRSMRPVRVVSWEVTVDCSMTWTFFD
                     KWIGRQENGKKQQNRFQVFIEKVFQRLETFTRPLPDGTKANTGDAEATQDNTCVIPDA
                     VAVVAALYPESILDRFITYCTVELHGRETRGQTCLDWYGTKQSMAKRGRWCNCELITR
                     VDNARFLEAMNGILEYNV"
     gene            <35340..>36917
                     /locus_tag="LMJF_14_0140"
                     /db_xref="GeneID:5650213"
     mRNA            <35340..>36917
                     /locus_tag="LMJF_14_0140"
                     /product="putative histone acetyltransferase"
                     /transcript_id="XM_001687561.1"
                     /db_xref="GeneID:5650213"
     CDS             35340..36917
                     /locus_tag="LMJF_14_0140"
                     /EC_number="2.3.1.48"
                     /codon_start=1
                     /product="putative histone acetyltransferase"
                     /protein_id="XP_001687613.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650213"
                     /db_xref="GOA:Q4QFX1"
                     /db_xref="InterPro:IPR002717"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR016197"
                     /db_xref="InterPro:IPR025995"
                     /db_xref="UniProtKB/TrEMBL:Q4QFX1"
                     /translation="MSSSAVPAYEGKQKVYALLNGTFHAAIVLEVAEDATEGGFLYYV
                     RYVEQDSRLDQWLQASDIKERHQGRTHHGSSCTHQQYTPSGIKTRRQSHVTEQQNAET
                     AVLTGEGVGMPTEVSANAKGGGAAPHLVKVSKTRARRDSAFFSRTKNIYSICMGPHEV
                     ETWYFSPYHLARPEVQQRLQAASQCVTGSTELQLVQSTTSPGGTSGVSTGIADVGGGA
                     GGTGNVSVGAGGSGRGSGAGMRQWPIATRSFSLHICPYCLRPFLDNAAVVRHLQQDCL
                     RHPPGNEIYRDPVRRLVVLELDGSLEPTFCEHLALLSKLFLEHKALDHDMTPFLFYVL
                     CSVETHGLQVLGYFSKEKQTPEPYNLSCILVLPQYQSRGIGRFLIELSYELSRREGKV
                     GTPEKPLSDLGEKLYLSYWADSVTMAIARAMEEGHCVSVDYLVQATAMIQADVIRALQ
                     HQKLLNGHQLTISEDIVERCYTKRLTKERDITSYTFYTHLLSWAPGFYEEFRGVPPAP
                     TFVPWRDPSAPHSRTGG"
     gene            <37761..>38306
                     /locus_tag="LMJF_14_0150"
                     /db_xref="GeneID:5650214"
     mRNA            <37761..>38306
                     /locus_tag="LMJF_14_0150"
                     /product="putative 60S ribosomal protein"
                     /transcript_id="XM_001687562.1"
                     /db_xref="GeneID:5650214"
     CDS             37761..38306
                     /locus_tag="LMJF_14_0150"
                     /codon_start=1
                     /product="putative 60S ribosomal protein"
                     /protein_id="XP_001687614.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650214"
                     /db_xref="GOA:Q4QFX0"
                     /db_xref="InterPro:IPR000206"
                     /db_xref="InterPro:IPR013823"
                     /db_xref="InterPro:IPR014719"
                     /db_xref="UniProtKB/TrEMBL:Q4QFX0"
                     /translation="MHRALIASGLMSRCTLAHRYCSTKPAGDNAKLDDLATAYSQLTL
                     REVSDLQRLIFKKLGHSDEFYEKALLRGLGGGGGAVMMAPAAAAAVAPAADAPAADAL
                     KTEKKKVEKLTYDVKLEKFAPEIKIKLIKELRTVTNLSIADAKKAVEKCPGLVATNMS
                     KDDAEKLKELYEKLGAKVELL"
     gene            <39132..>40187
                     /locus_tag="LMJF_14_0160"
                     /db_xref="GeneID:5650215"
     mRNA            <39132..>40187
                     /locus_tag="LMJF_14_0160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687563.1"
                     /db_xref="GeneID:5650215"
     CDS             39132..40187
                     /locus_tag="LMJF_14_0160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687615.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650215"
                     /db_xref="GOA:Q4QFW9"
                     /db_xref="InterPro:IPR000953"
                     /db_xref="InterPro:IPR016197"
                     /db_xref="InterPro:IPR023780"
                     /db_xref="UniProtKB/TrEMBL:Q4QFW9"
                     /translation="MTYYTVEEITDRRINENDGAIEYAVKWEGVAGELTWEKRHQLTE
                     NCAETVQAVDQRCMDATDEELERWRDGKWKRGAKRAHDAPPLVGTTTERRKRSRSVSP
                     AAGEDLEQVEVLNGLLLRPPCGAQNAEEEGTILMLGEVVLAEEASAILNGTGSYRKKC
                     RTATVSTAVAFHTAPALDIEKRWRGIHGQSLLHSIEVAQSITPFHPHFRLHGCDPATR
                     CAMALEVERSSHLRIISIAPPLMTHSGAVFGLPVALDPLVGEKDVEQLRQSVQLESPL
                     FGSAAQELVKPHVEQMVVRYIIPEVTPATDDDTATPTTELFPVHGRIASMPLSVFRVV
                     FPQLLIDYLLTNSVVLR"
     gene            <43493..>45550
                     /locus_tag="LMJF_14_0170"
                     /db_xref="GeneID:5650216"
     mRNA            <43493..>45550
                     /locus_tag="LMJF_14_0170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687564.1"
                     /db_xref="GeneID:5650216"
     CDS             43493..45550
                     /locus_tag="LMJF_14_0170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687616.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650216"
                     /db_xref="UniProtKB/TrEMBL:Q4QFW8"
                     /translation="MPQLQQLSSHHAAGSAQPSVKHPDAPQPSTASFHAPATPVPRAV
                     LFNTAGGFAYQVMTSAIEKATTPTVSIFTVRRIPVANSRALSLHLAAATSCRLPFCVV
                     EGGVTWSDVVTTLMLPQPERPPSHMGWNVQVLGQDVDSGAWVPITPSLSSRLETRYFL
                     CTDVEVLFGHYQTSVLYMQAVPLTPETAGPDWRTPLQQSSATGAAPPPAPIKAPRQGS
                     ASAPSSSASQPRATTDAHTASARLAGKARPCSLSADLGLAAQAPSTPLLSPPSAHAMW
                     SLAAFVKQQERWGRRCQELRQRAAGVTPQEALQQVREELRFCRAAFGVDGVVTPTCAD
                     KGVATWALSLLEHQCTTLADNVHAACTEGRNDHQFLLRLARSRLGRAFQLACKVIHVA
                     DSVLSAAGAADDAGVVLSDFPRDWLALLLASLRLRSLRHLALARACGAVPNGQPQSSW
                     TMEALVDEAVQTAGWILEALFSICERGEIPGLAQAALAETLLTCALSLAELAAYLSTN
                     TSHRCELMAAAVHVCRVRFQLTRGDGDAHWLPQCVSDVVARMQTKFGRIPLTSSAFTE
                     YAALIRQLRDSAECAEMCNREAAAHAGAPPADVKPEPLPLGYTVTRLPVTAAVDAAFV
                     RGNTLVRELRRTAAAVQRAVQRSSTAPSSWKDPPQSQHRRAGPESTEHGQTRSSPQAS
                     EAA"
     gene            <46644..>48158
                     /locus_tag="LMJF_14_0180"
                     /db_xref="GeneID:5650217"
     mRNA            <46644..>48158
                     /locus_tag="LMJF_14_0180"
                     /product="putative carboxypeptidase"
                     /transcript_id="XM_001687565.1"
                     /db_xref="GeneID:5650217"
     CDS             46644..48158
                     /locus_tag="LMJF_14_0180"
                     /EC_number="3.4.17.19"
                     /codon_start=1
                     /product="putative carboxypeptidase"
                     /protein_id="XP_001687617.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650217"
                     /db_xref="GOA:Q4QFW7"
                     /db_xref="InterPro:IPR001333"
                     /db_xref="UniProtKB/TrEMBL:Q4QFW7"
                     /translation="MQAYEELKQLHLQLHNLRHFLALGGWDMQTMMPPKGATARANAL
                     AELEAHVRQLHTAPRVALLLKEALLVKDELAEVDRANLREMVRLHELASQLPEELLRR
                     KARLTTLAQQLWVKCRAENDVAAWLPTLQELVDLEREEGRLRAGTSGKSPYDALLGAN
                     EPGMTVAKLDAIYADIKSWLPALYKEVLENQKDVDASLTELQTPISKEKQIALGRQLM
                     TDVWRYDWGAGRYDEAPHPFGGMVKEDVRMTYYWSPDNYTKCLLATIHETGHAKYEQN
                     CGPRELLGQPVCEARSGGIHETQSLLAERMIAKSAAFAEYLTPLLKLHLGAQPGLTVE
                     NVRKINQLVKPSYIRTLADEVGYSLHVILRYEIERDLIEGSLEAVDVPRVWNEKMKEY
                     MGLETLGRDDLGCLQDIHWAAGYWAGFPAYTIGAIGAAQLMAAIRQQLGDDVVTQCIR
                     TGHIDPILAKQKEMIWDLGCLLETDELLIKATGEPLNPRHLREHLERRYLRKED"
     gene            <49394..>49993
                     /locus_tag="LMJF_14_0190"
                     /db_xref="GeneID:5650218"
     mRNA            <49394..>49993
                     /locus_tag="LMJF_14_0190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687566.1"
                     /db_xref="GeneID:5650218"
     CDS             49394..49993
                     /locus_tag="LMJF_14_0190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687618.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650218"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q4QFW6"
                     /translation="MTDIDIKTYSDDASLGKEAPTVESAHPIKGEKIAITEDKVYVLY
                     FFNTFYRGADICNDEFTALSEEMADKAVFVAISTDADIAKTEKYLGKEIIDENTKKRL
                     RLDPSHICYDEGKAISKSYAEVSNLSVMSCPMAFVVKDGKVAWRQQFLQTHTVNQSNF
                     REQLSRVLAGEELESNGPRPKVEVEEEEAEGMDGDMSLF"
     gene            <51605..>52177
                     /locus_tag="LMJF_14_0200"
                     /db_xref="GeneID:5650219"
     mRNA            <51605..>52177
                     /locus_tag="LMJF_14_0200"
                     /product="hypothetical protein"
                     /transcript_id="XM_001687567.1"
                     /db_xref="GeneID:5650219"
     CDS             51605..52177
                     /locus_tag="LMJF_14_0200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001687619.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650219"
                     /db_xref="GOA:Q4QFW5"
                     /db_xref="InterPro:IPR028233"
                     /db_xref="UniProtKB/TrEMBL:Q4QFW5"
                     /translation="MDSQTPHGDVVDEATMAVLPEHGLIFSEIKQMQLLLCKPKLLPV
                     KSYSLEKLEKMEKKLAREAKEKRDANRAQRQAPLVWTSPDLTAGEGVKTIPAPSPLVT
                     VAPAPPQNVASTPLRDGGATPPSAAPAVASSASSRGAASQETLSFTPVHTEGETCADA
                     SMSAPERSPRISPSTDVSSSSPSPSASTTD"
     gene            <52581..>53915
                     /locus_tag="LMJF_14_0210"
                     /db_xref="GeneID:5650220"
     mRNA            <52581..>53915
                     /locus_tag="LMJF_14_0210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687568.1"
                     /db_xref="GeneID:5650220"
     CDS             52581..53915
                     /locus_tag="LMJF_14_0210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687620.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650220"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="InterPro:IPR025254"
                     /db_xref="UniProtKB/TrEMBL:Q4QFW4"
                     /translation="MYDDVEVRRREEARQHTAASLIQRRWREHAERRSLEQDAAPLRG
                     TGGNGVLLVASDAFGDVVGRRGGETDEALRPLKSDGFDELAQTVQTPEEKRRACVEEY
                     RALLAKRKALLENNLVYQQLLSRHYAEQRRRNGEDEVAQLTTPDAEAAYWALVRQVAE
                     ERQRVAARSTALKKDLELQRQRYEPIMEEAATQERNFQQYIQELAASVRFMRSNRPIP
                     TEAIEKYIELEAVQRSAIHASRVRYLQLKNRLLRLRRVAKGGAALSSSAPTATAAATG
                     QDGEESNAANHHMFLIDFEQLKVENTSLNEKIEERSEEVLKLRNKVTNTIHIATHVRE
                     KLDCVRAENAELRQHVASTDEELGGARDQLAKSKRRRDAHLRANTRMKERMPLVGSRD
                     LLMDYEKRKAVIYNYRTRLVQLTDRHKELTDSIKKEESTIVSLQHELSHYPK"
     gene            <55791..>57155
                     /locus_tag="LMJF_14_0220"
                     /db_xref="GeneID:5650221"
     mRNA            <55791..>57155
                     /locus_tag="LMJF_14_0220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687569.1"
                     /db_xref="GeneID:5650221"
     CDS             55791..57155
                     /locus_tag="LMJF_14_0220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687621.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650221"
                     /db_xref="GOA:Q4QFW3"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="UniProtKB/TrEMBL:Q4QFW3"
                     /translation="MMRPITYFPITTEILAENDASFTVPDVPTNAPHLAGIDIGVRRN
                     DWSRGNSASVDRRYSEVVDLRELLTYQFPTLIMSPLPRKSSVSDIETYFSASDAFAAQ
                     RHNLQFFLNEIACMPEVIFFSEWVAPFFLDPRDTFETGTLLRMRAALRDLRLATHPFR
                     ECSKRHRSFTEYTANKIAAKSSSLVRSVAGFFFSSKNDGSATDGRGGDGHPNGGGSVP
                     VPTSSSSFTYDWTYLPSSAKSDACAWVRVCEQLARRQQALKASARSFEKYLAALAHMK
                     DAQLKVAQSFENYERTLRSSPALDALGGEYHLAVSMIDAVTQKEREYIERKYLNMCLR
                     LGFEANLIDAVLDAVDVVLGQYQFLSSAQLMNTRDRTHEEALLYTQTVSRALLADYRD
                     RYKFFYEKRMRNLVREQVARPAIECAAAVQQVMKGSELLRVVQDAFYTEVNPTASSPA
                     TAAA"
     gene            <61572..>67103
                     /locus_tag="LMJF_14_0230"
                     /db_xref="GeneID:5650222"
     mRNA            <61572..>67103
                     /locus_tag="LMJF_14_0230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687570.1"
                     /db_xref="GeneID:5650222"
     CDS             61572..67103
                     /locus_tag="LMJF_14_0230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687622.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650222"
                     /db_xref="UniProtKB/TrEMBL:Q4QFW2"
                     /translation="MDGLFGEKDCHRHPPLDLTSRAFQPKKYIQRVLANVSHAVFEGQ
                     LVDKVGVAEEDTGEALKQLIRDNLGVFIDSKDAMDAVYNSDAELFTGEALEAITRSFK
                     SASTSCESLVRPITATFLDVQKSRKSQDMLDKFFSVLGVPGAIYDSCGSKVAQRRQTA
                     TALTAADDSTSSDDDEDSASREGGAGEARGLSGRDDQPKKEPRRSAKRKASCDYDGDS
                     LEEENEYEEDESDNDENDTAAAAAKPHGTLEGPADSTAPADMYVLESGEEIYFWYGTP
                     LVRLKDVDAWRQHVDHVANYEAAVLHLRRAMLYLEETYSLIDGAMLTEDDGEPSKATQ
                     ASAATGDGRFPPAGQGTTSAATEGAVAGSSKNVSAVCRSVFAYKFSMALLRAALYLCS
                     QLAEELIYASPADTVLIEDTLSMMMDTSIASVKLHHFCAVLQEALGEGDRHEQLLTKL
                     RTRLSSGGATAECFSPKSGRTVSTPGVSDDHTVSFSPNRPVTEAGAGGAAAASASSVT
                     APRRGTTAYQHPVQFFISIVQRQQKHLFHTSAAGLLREASGWLSKAQTDAARGLKERH
                     RQQEQRQKLRIAAAGGVDAGEGAAAELLSGSDICGRRLSQNLHLGVSISGDGGFIGNA
                     NDSFLQEGSFTQMNARGVGRRRQSSAGSPTSGDGDGDGDGAAIAASGSATVCSDGTPT
                     EENRQTVGIISDAYVSRLLDALNTPESPFPTSTEFRVGTLDMDAVLVSSCLQIRIHSS
                     SLLNQLFTRAEVESAVMAQARSLNTFALRLCTECVGTLEHVVGSYWGGIATALHSGVF
                     DFVPELDSPLHTILTQLLGNTAAPAAAGAGGAAAAGSGGNGLQRSPSVILSGTHSRSL
                     SRVGEIDDNAHVSDDGAAVTGTANHGAAAADARGRAAGAGVGSGSIEQLPCIRFIPTL
                     PHVFHPAAADAGDESATQQPTRPKRLRDISVQAVHHMISTAATTLQALFLAFINRSVV
                     DGFVSALAQYRASDLRRYSRSERVELHAAVLYEVILSQWERMMNLVSDAMLRLKIVIG
                     ESSSSATITSEAQVEEVGDLLQELEVLRSTCLRCYLHGIGVLSKAYLTALPLLQRHTD
                     KSLDARVRSRLSRDSVSSHAVHKLLNVLSVVMDRCVPFFARDTEVYDSVDLFAVKSGS
                     LRDDADEDAVAGERGGGDAGARNPASRRRRLLRQRSENDPSGRGRCGDRSGTERRGRG
                     SESCAPAALGDGTDVVVDPISELIAQFHRRLVMESLQDHEELVLALLSHLLLAFVDML
                     QLKCRTATTDVTLHPAERERCVVECMADTLCLATTLTPILTEHLLAPCFFELIARQLP
                     ELCATPVDVAAMLQSKQQQYSQVYLSVVEEHCQLAVDAMMNAYLALAQQPITDLVRRQ
                     GFVQPLFDWQRVSPHTTAAVRPYIADAIACIARAHETLNTIRQPVLGSAATQRLVAHL
                     VRTFLTSFTSDVNVLELSVECSSSFLVYGLTLLEAEAATILRVVDSVVAHVKANPTTN
                     ELLPELAVTRENLVAVTKTLESYATSVGEAIVAARNSEGGGASEAVIALSLLSRDKRQ
                     ERRDGMVQAAMHTLAYMLEAINTELEESSLSSAALLQLRSAAEKGDGAAGNGLRSAVA
                     ERIVQRIERRKEGYELRRARAAAAAEVERQRKKALVSAASPEDGTGPAVGSDSGAGTS
                     GRRQPLRRRTDGSKLVLSSAGLGDDKDGDAESAEHLTPRTVQESERESLKAAEAASNV
                     FRLAQDQRQKRRVRRVSKVDTADGRGADGAAEAGEVSAGIAKSGPTPATVPPPLSVPL
                     AGYAAGGNDDDGSEGAEAVPARNRVSRRARRRVVSGDDDGGVPVRHERRANRFRRSNV
                     L"
     gene            <68060..>68488
                     /locus_tag="LMJF_14_0240"
                     /db_xref="GeneID:5650223"
     mRNA            <68060..>68488
                     /locus_tag="LMJF_14_0240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687571.1"
                     /db_xref="GeneID:5650223"
     CDS             68060..68488
                     /locus_tag="LMJF_14_0240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687623.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650223"
                     /db_xref="GOA:Q4QFW1"
                     /db_xref="InterPro:IPR001310"
                     /db_xref="InterPro:IPR011146"
                     /db_xref="InterPro:IPR019808"
                     /db_xref="PDB:3KSV"
                     /db_xref="UniProtKB/TrEMBL:Q4QFW1"
                     /translation="MAANCIFCKIIKGDIPCAKVAETSKALAFMDINPLSRGHMLVIP
                     KEHASCLHELGMEDAADVGVLLAKASRAVAGPDGSMQYNVLQNNGSLAHQEVPHVHFH
                     IIPKTDEKTGLKIGWDTVKVASDELAEDAKRYSEAIAKIQ"
     gene            <69164..>69682
                     /locus_tag="LMJF_14_0250"
                     /db_xref="GeneID:5650224"
     mRNA            <69164..>69682
                     /locus_tag="LMJF_14_0250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687572.1"
                     /db_xref="GeneID:5650224"
     CDS             69164..69682
                     /locus_tag="LMJF_14_0250"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687624.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650224"
                     /db_xref="GOA:Q4QFW0"
                     /db_xref="InterPro:IPR009779"
                     /db_xref="UniProtKB/TrEMBL:Q4QFW0"
                     /translation="MAPKAPSDEALLDACISANRLEYPEQSLIFMALIASFQPVYFSH
                     AINGFDWRHVPNLVLYIVITGFTTYMLRQAYAVMVQSEFWGRQRHFAEVSDEKAKALR
                     RLRLQVALGYSLFFLNSVFFVVSTCLMAYIFRHSDPRASYILSPTLTAALLWLIAQKN
                     EESRQRRMRLHK"
     gene            <71973..>74141
                     /locus_tag="LMJF_14_0260"
                     /db_xref="GeneID:5650225"
     mRNA            <71973..>74141
                     /locus_tag="LMJF_14_0260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687573.1"
                     /db_xref="GeneID:5650225"
     CDS             71973..74141
                     /locus_tag="LMJF_14_0260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687625.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650225"
                     /db_xref="UniProtKB/TrEMBL:Q4QFV9"
                     /translation="MDPSAAFRSFPTQERGILLADTYKPLSLYAADVQVRLSGSAAQV
                     ILSLEYVNETNKLVRAIAAYPAPSSYQLQCATLQGPAREISARSYVRSRPLRSVEAGS
                     ALCAEPLVDTAVSTVATQSVPWDVSPGESVLMKAVYHAPISVTHRTGEIVFTLPASLI
                     PAVQRPPDVQRGYMKFLDARSQLRHLAQQGGSLRVCVDAQLLVPLRGVVTLEKGPEVV
                     PEMGVTGTSVNVHYVGDTHFQMTYHDDLPKTAYMQVPLCVRAPVAETSEPLRLHTVAA
                     SLPPTSAPSDHPTAEVAAAMVVSIAPFLANCPINAEIMFVVDVHSAALGARAAESVMS
                     AIRSLNGTASLVNVILCRDAHRGGAVSLLPDESVQSSAVPQESMLAFMKEEGVQTSSS
                     KGPATLSPHLPSLLHDITTGRGITTSIPAGYVRNVIVLSDGGSQPVDADAVAMVCQVT
                     NAGRACRVHAVALAATADHAVLEALAEACGGCFASAAASGSSEAGGSAVDEAVQAAVS
                     AAAVPCLVDIRTKWDVTGGDIAVASSVQAAAAAPSPLRMATDADGGSIACVPHGTQRL
                     LYGLLASANSQLAVRVFGRVGEMRLEYTASSAIQPPPQSDAADTAAAADATDEESGRA
                     PPMLMTAAAAARIAYLTHILHTTSEDEALEVIALSKRYMLPSPYTTLTDGNSGPGGEH
                     KLGGVVHLPSMQAAAHVELAIRARRVELQAAAALRALRPA"
     gene            <75306..>76790
                     /locus_tag="LMJF_14_0270"
                     /db_xref="GeneID:5650226"
     mRNA            <75306..>76790
                     /locus_tag="LMJF_14_0270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687574.1"
                     /db_xref="GeneID:5650226"
     CDS             75306..76790
                     /locus_tag="LMJF_14_0270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687626.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650226"
                     /db_xref="UniProtKB/TrEMBL:Q4QFV8"
                     /translation="MLSSGGVFVQDYGTSSRVGSTVTWSISGGSLFRGSSADSPVITS
                     NPGIDDIPDDVHRTVIQQLAQSFRYAPYVKGLLLLWVPLVLVLALTPSTVDASSSALP
                     LVPVSRTAGNALFWCALLLIVPTNTLLIEYVNDLVVRHDSPSLNIAANLLAEHAAELT
                     FSFFAMAHSKRSLCWVKPMLLGCTLLNLLGVLGSSILAAPLADGTSVDLGISSWTAFS
                     ASGVVFSTVVFLLPTVYSVTVVGPNAVDQLRRQHTPAKVVEEQRMYTMLFISRSLALC
                     ALAVYALYLWKVMQANSNYYLSSDSPEAPLSLVYALQYHELLRGTREVDLGSRYSQRF
                     AVMGTLVCVTTLTTLCLMLVVTLPAAKATTSVPLPFILVILLPCVFEAGGAAASVLLS
                     QAGRPDIAAIIAFTSIVHLYMFILPVLVLVGWWVLQAPLELSFHPFLACCCFVSTLVV
                     AQVVSSNRVRWLEGETLLALYALIVCICLLGRWHLCIRADDSDY"
     gene            <77879..>80773
                     /locus_tag="LMJF_14_0280"
                     /db_xref="GeneID:5650227"
     mRNA            <77879..>80773
                     /locus_tag="LMJF_14_0280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687575.1"
                     /db_xref="GeneID:5650227"
     CDS             77879..80773
                     /locus_tag="LMJF_14_0280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687627.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650227"
                     /db_xref="GOA:Q4QFV7"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:Q4QFV7"
                     /translation="MLSSGLDEQFLHRCCVQLSAPLVDPAVLSTEQGNAIQFAKQHAA
                     AHPREVARALVWRVVDSADDTLDQSVNEDRAGAWSVLTAVIAECGDASSEVFRTSLGD
                     HLASLLPYLVGYRWHTSVRSIQEDGLHSSAEVVLNYDKVVPASLINGFSTRNVDSYAV
                     ATMNRRYRKYLALWKSVWRPDVYQTLKDMVKRVEATGNFLPPVAEDVLVVPDGYRESL
                     WRLRRTASRPSIALELLRNYGWPMTMIPRENNNTVRAPSYVLPKTEAELRQLDPAMHR
                     TVFQWLKTMHQKRGGCAGCDSWDHTDTRCPCEGPFWRSPSDESAMKTHRALVATVTGG
                     AALPVLTYVQSARILYASHLRLPLRVPEALDIITKLIRDEKPYEELLAAFDTVRGAVT
                     GPRERHALWRHASYHLLPSKTVFAKPHDEALSPCMTKIRNLFRSSRRFQEWEQLMDAV
                     DVLDMCFRRRDVSSRVRRNLEEVQATASFFFCLVDGSLAASFNPATYARVPEEVEALA
                     PLKDNLCRVCLEPFHTAVTCPLVCEDEEAEHRRHSTGTSATKPVIEEWDLQVARRVLE
                     DNECLFMKYPAEAYRLAAAMERIDVDDRPAKDFRKAELQLAVKLIHERRVAVCPQCNV
                     TGHSLRNCERRAYRALSRESLRPIDVRLDPHKLRQCVRRYASEDALHGELLDAMDLYG
                     RGAQLLPTAFMKAIREMDDARIPLAAARYATDTVQSFLLFSNSTDLLQHLRQFRSARF
                     PEVCIFCDSYHHRSEDCTRCREDERGYLQELRRTGLTLWTYLLHRDAYDQLLPTDYAR
                     GKESVLALVEQFETDYRPGGVGRSRFFKDNDLPDMTPGAMMASTYASITETPTPTQTR
                     AAAAETSTGATEAATAETVGAAGGEAALSGDEEDALGHVSDSSDEKHQSARTNCVLSE
                     EEHPRKKRPRSDGDGEQADADARAGEEARVRQDTAEEPPTARAHVEQGAQ"
     gene            <81984..>82826
                     /locus_tag="LMJF_14_0290"
                     /db_xref="GeneID:5650228"
     mRNA            <81984..>82826
                     /locus_tag="LMJF_14_0290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687576.1"
                     /db_xref="GeneID:5650228"
     CDS             81984..82826
                     /locus_tag="LMJF_14_0290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687628.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650228"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q4QFV6"
                     /translation="MSRTLTTTQPSVASSPASSSSGSTHQRPSADQLAETVHQMDEEN
                     ALEFVSIDATSRDQVFHFLHDHPDATAVVNAVGLLTRNYEDARQVNGDVMTNIAAGVF
                     HPKLAQSVQKVVYVSAEPYNLYSRRILGSKHLLKGYFHGKRIGEKAVLENLGNKGVVL
                     RPSFIYGTRHVLVASAMNPDAVSTLSLPLGWIGLPLDKLLTAIGGGKLLMPPVCVDVV
                     AEAAVRACAWANQPGKDIHGICDVYRMRDICNAVDPSLHEDRNGTVTASTASKEASTV
                     KNDR"
     gene            <83609..>84331
                     /locus_tag="LMJF_14_0300"
                     /db_xref="GeneID:5650229"
     mRNA            <83609..>84331
                     /locus_tag="LMJF_14_0300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687577.1"
                     /db_xref="GeneID:5650229"
     CDS             83609..84331
                     /locus_tag="LMJF_14_0300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687629.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650229"
                     /db_xref="UniProtKB/TrEMBL:Q4QFV5"
                     /translation="MGSWDSAYEDDAMDTRKLYCKALVHASGGSRLARDWIAGCAALT
                     SPDPSLIYTALQHAATEADVEELREHILGRLLAQESPRRGGRSGGSCDNEVRTSFGMY
                     EESEREVVVPGTGNVAVKRAVAPNCAGQSSIHERDGKDGASEATSPPITSEGIRDAEH
                     YLLQRSREVRCFMYDAMTASLFHSNNDLRTVEAARRHTFWIGLTQFGLSFDELTALWR
                     LVEAELLLKKEKIKVLGQPWGE"
     gene            <85092..>85949
                     /locus_tag="LMJF_14_0310"
                     /db_xref="GeneID:5650230"
     mRNA            <85092..>85949
                     /locus_tag="LMJF_14_0310"
                     /product="putative proteasome alpha 3 subunit"
                     /transcript_id="XM_001687578.1"
                     /db_xref="GeneID:5650230"
     CDS             85092..85949
                     /locus_tag="LMJF_14_0310"
                     /EC_number="3.4.25.1"
                     /codon_start=1
                     /product="putative proteasome alpha 3 subunit"
                     /protein_id="XP_001687630.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650230"
                     /db_xref="GOA:Q4QFV4"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q4QFV4"
                     /translation="MSHRYDSRTTTFSPEGRLYQVEYAVEAIQQAGTVIGVCTKDGVV
                     LAGEKMVPHPLFDSENMQDKNISGEKMYKIAEHIGCSVAGVTSDAYALLNYARLSALR
                     HQYTFQEPIAIEDLCRILCDEKQLYTQYGGVRPYGVSFLLVGWDRYYGYQLYSTEPSG
                     DYSAWSAYAIGQNDQVAHSLLKKDWHENMTLEDGMLLALRVLGKTMDTAKIDLGRVEV
                     AVMRKVPASNVDQLLEPFKHHPKTAPQFQILAPSELKPHAERADQAREAEEQAEAERQ
                     RQQEQALES"
     gene            <88724..>91135
                     /gene="AAT21"
                     /locus_tag="LMJF_14_0320"
                     /db_xref="GeneID:5650231"
     mRNA            <88724..>91135
                     /gene="AAT21"
                     /locus_tag="LMJF_14_0320"
                     /product="putative amino acid permease"
                     /transcript_id="XM_001687579.1"
                     /db_xref="GeneID:5650231"
     CDS             88724..91135
                     /gene="AAT21"
                     /locus_tag="LMJF_14_0320"
                     /codon_start=1
                     /product="putative amino acid permease"
                     /protein_id="XP_001687631.1"
                     /db_xref="GeneID:5650231"
                     /db_xref="GOA:Q5C8V6"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="UniProtKB/TrEMBL:Q5C8V6"
                     /translation="MRHARERSGATDGAHAGDGDLVHASSQIKDVVSVNGISLGCGGI
                     EDEKLATAANGKSVRVRRNVEVIFHPELRRTKEVIRRPEWVRRAGECVAHRGSLSTIA
                     LFGIMFANCVGGGYGFEDGIGSAGPLITLIVCGILPWMWAFPTGLAVAELSTAVPSNS
                     GVLMWTNAAFPPFMSFMCILATIFITFIGNATYPNLTAEYAQQLGNLKLAPVAGVKVG
                     VVALCCILNCVGVEIVGSSSIILCAITILPFTLLTVIQLFSKGFNRAVLYVDVKKVNW
                     AEFFSILSWNYANIENAGAVVEEVANPRRALPKAMMMLMLSTYVGYVMPMLAGVSAMG
                     VDQDYSKWKAGHWPEVAKVIAGDWLKYMLFAGALLSGIGFTLTSMCCTSRLLAGMGTM
                     QMFPKKVSRVIGYYHPRLGTPIPAIFINSLVTLVFSVSMEFTSVVSLCQSIYCLRMLL
                     IYASLVKMRIDYPNLPRPYALPFSTCTTALVLLPAAAFSLMASIVSAMTSLGIGMALV
                     GFVVVGSGVSWLYCRIFARNGFQGVIVQCEVSSGDDAEAGAADSANDSALSEGIFYAD
                     EERNSGEPVDDLLLGILPMPLAAPGPLASTVLPRGSEVSSSQWHVRHGMTDRDAIGSQ
                     AGEEMIGMEYALQDGPSTDIMVVNSSATAHALGSSTAVCSPTSSFHTYRVACGVETTM
                     RHRHRARSHGAGGGGGGATNSGNYGPAVSGEESGEDPDITPAEHSGGGFTLSATGLPG
                     QVLSTSPPQLILSPQQVLLNVPAAGSWSSSRSPTPASGPRSPILTSAINMSTTRKPPP
                     PPTSL"
     gene            <92563..>94413
                     /locus_tag="LMJF_14_0330"
                     /db_xref="GeneID:5650232"
     mRNA            <92563..>94413
                     /locus_tag="LMJF_14_0330"
                     /product="hypothetical protein"
                     /transcript_id="XM_001687580.1"
                     /db_xref="GeneID:5650232"
     CDS             92563..94413
                     /locus_tag="LMJF_14_0330"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001687632.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650232"
                     /db_xref="GOA:Q4QFV2"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:Q4QFV2"
                     /translation="MRFNSNSGAAAEGGHSTSPRMFSPPLTPPSSHPMTSTWPNATAA
                     AEQARQPHYPLHPSSPPLLDLTRAMDETDRSSCAAGANSGQRYFHTSLLKETEQDRAA
                     DSFHHAWMTTPQSKSTGELAPNGTDDRRNPSTTLWHRSSGAVQPISNRDREAANCSDI
                     DCSDVECNCNGGRLLRDEGSGADNLHHVPAVRLTTEEEQAARLRAYNEMVAGAAVGSD
                     AGGGGGGGDGVIAANSRDFVSDTLHTILPNGVARWFSSSVNAVVHTSSSMVPDGVKSA
                     ASTLSNTVGVGAQQVGDAIDRLPDLVVNAIPSAVMSDCVKQLFTDFSNTFRSFFRTNI
                     LSTPFVFRQAGLIGGIVLLSFVAITSEYATEAYFGAKNQMKNAHKVVPCGEVPLIIWG
                     KWYPLINFFYGVIHLVGLTAFSSSNAVVLLGAMGMKGSSAQALGLILPSLIVLPLVLM
                     ATARSQQPLAIMSNTHVLNSVILMCVDFTYKSRPPMKLWSYSPSEFFVALGVTVYALT
                     GIGSTVTVERVMAPQRYLKLLRVSVPISWAPLMAFGLSGFIAYGNHTCSVMTVSLKSG
                     PLRTAASALLFFASLTIISLCELSDRRLLGITRLTHYWDITPNLLSHTSL"
     gene            <99176..>102436
                     /locus_tag="LMJF_14_0340"
                     /db_xref="GeneID:5650233"
     mRNA            <99176..>102436
                     /locus_tag="LMJF_14_0340"
                     /product="inositol polyphosphate kinase-like protein"
                     /transcript_id="XM_001687581.1"
                     /db_xref="GeneID:5650233"
     CDS             99176..102436
                     /locus_tag="LMJF_14_0340"
                     /codon_start=1
                     /product="inositol polyphosphate kinase-like protein"
                     /protein_id="XP_001687633.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650233"
                     /db_xref="GOA:Q4QFV1"
                     /db_xref="InterPro:IPR005522"
                     /db_xref="UniProtKB/TrEMBL:Q4QFV1"
                     /translation="MHKSLSRSTFNAVFEHLSAEEQRASRQRSVNASFDHRPQQQQPL
                     RPMSGQALDTAVEVVALCDRAEGESTTSQAEEPLMPLLRDMNDDSTDALKLCNSSDEL
                     DGYCSSCEGSLPDNSASSSSEDASRATLSTSVAAALRKDARRKPHSRHHRHRYRGRGS
                     LIRSAARDEEWQRLVAMSFDESTAMAKAADSDTTTMASPVVSTPAVAAAGGAAREGAF
                     KGMCTPYPKPITATTNTKTSLAMISAALNVESRTAEADTRSNSDSPCSKSGNAVGNTL
                     DAVLLHVQVPALARDGRGGESARALRSSAASLCLLGKRDSCDAAEVSIDRAAGDQCIL
                     ETSPTAMSRPPILSPAGTLSLAGTAVITSNGNNNGSNSSAVGAGDALQVTSCDAMAPP
                     PVEEAACVAPAAVGLMKSSTVNVYDGFVTLTAAANPLQEATQGPSAEPRPDKTLSISP
                     AGEAAAETTGVALQAAPVAGVATLTSTNATIPLGHAAAETSSKHLQDSSGSPTHVDLS
                     SSSSVGGHHLSVTEGSVFLKQSGSRREEAFYNMIQPYQEALVRKAVRQAPHTVQHWSQ
                     HHAGTPCAGVQQGAASTAAAASPSSKAGHLSPLHASASHRQRDDDSDSVVADPDDVAA
                     MCEARWEAYQQYEAEDMSNLNILASEQLAKKNAGCERQRGGGGGDCAGLLYNSPSSPT
                     SLRQVDKDLVELAARLWWTVRCRHFYRTSAPAYEVQRQAAEAASLSPLSSLAWPPAAT
                     TCGSGGAAVTYSLDTAPASQQPHHAPHDSLEALPPTLPLSPMSASMIEQEKAEHRGEA
                     AAALAPSVSGTATPCMVGSFAASLLEGLTSSSSAAERQYAVQKHRALQLFAAFVPRYH
                     GTRRLFARDVLRCESKKQPQQPGKQQIVVDADNDDDEDNNSGDKKICHMIMLEYVCYR
                     FRRPCVMDIKMGSRQYGLHPSAEKKRSKERKARLSTSARYGIRLAGYRRWNADEGRYN
                     CRSKLQCRCLSLNEVKSEMSTFLLHSREMEQVFRRQLQRLRVAFSQQTIFRFYTSSLL
                     FVYDADDPLKTARVTMVDFAYTYESKELLQGGDPDADFDYDVGYLKALDTLLSLLA"
     gene            <104841..>106871
                     /locus_tag="LMJF_14_0350"
                     /db_xref="GeneID:5650234"
     mRNA            <104841..>106871
                     /locus_tag="LMJF_14_0350"
                     /product="putative threonine synthase"
                     /transcript_id="XM_001687582.1"
                     /db_xref="GeneID:5650234"
     CDS             104841..106871
                     /locus_tag="LMJF_14_0350"
                     /EC_number="4.2.3.1"
                     /codon_start=1
                     /product="putative threonine synthase"
                     /protein_id="XP_001687634.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650234"
                     /db_xref="GOA:Q4QFV0"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="InterPro:IPR004450"
                     /db_xref="InterPro:IPR029144"
                     /db_xref="UniProtKB/TrEMBL:Q4QFV0"
                     /translation="MLILLITGSASKELKAQVRAVLVDEAQLFSASEASEVESSSVFV
                     LCIDAEDSAVMEPLYQGYHYRFIWSAQSSMAELVSAVRHLLDSIASAQAHKDKRIGGF
                     FMSTRGASEASNFLDVVRDGLASDGGLYILKQIPTMPDSQIYYFCKQRNLPYVEAAAM
                     ILEQLVDASITPSTLYPLILQAYDPSRWSDKDDICPLTPLLMSGETTPTREGEADAVY
                     GLIPSASFNAPERWAANMSVMELFHGPTAAFKDFALQLFPRCFGAATVTEAKDKYIIL
                     AATSGDTGVAAISGFVNAGGHSQVMVLYPMRGVSPVQQAQMLSFDDGTQVRAYAVDLN
                     FDFCQRTVKELFSNAALRDELAVAEPTAVRLSSANSINWGRLIPQVVYYFWAYRHHVQ
                     HPPAGWVFGDPIDVVVPCGNFGNILSGYIAKIMGLPLRKLVVASNQNDVLYNFVKTGT
                     YDMRNRTLAVTSSPSIDILKASNVERFLYLLSNGDTGLVERLMNELDTNGVFTLPDGV
                     RAAMQAVFTAGRCSEEDCAATIKSVFELSGGSRLLDPHTAVAVFVAQQFREEELLRRD
                     LTNPTSSDTGTDVPPLVIASTAHWAKFPAPVLHSLRGEGAQLGEPAPSVAAAIQEVRA
                     LYAEIKKAAPKQQAHPALSHALDMAEKMAKEVRAVGADVAAIEKELRDFSKC"
     gene            <108685..>111804
                     /locus_tag="LMJF_14_0360"
                     /db_xref="GeneID:5650235"
     mRNA            <108685..>111804
                     /locus_tag="LMJF_14_0360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687583.1"
                     /db_xref="GeneID:5650235"
     CDS             108685..111804
                     /locus_tag="LMJF_14_0360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687635.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650235"
                     /db_xref="GOA:Q4QFU9"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR011124"
                     /db_xref="UniProtKB/TrEMBL:Q4QFU9"
                     /translation="MECPLSRVPFASIVVEEENGDGVGVAETPQVEAGCTGNVLTCAV
                     DAVQQQPQQHRVHFAAFRASKAGVVHVVQDTAPTWHERAASPASNSSLTGSSGQVTHG
                     LRLALSGAAAVTAAGSSTHSSPSESKGTVSFSRTLHLRSTAGPPQATTETPAQPSPQR
                     VPPNKSSSRRRTLKDGAEAEETVTRAGSSSKTTAAAKHRSAAHESRRGGGRTDESASR
                     RIHARPVRQSAASAAVAPPRSAASVPPSSSLVSASPEERAAEAHRLAVQATRPSSLSV
                     CFDWWMYLCYYDTHALFTSQTTAFEVPLRPVATASASVFYAELTRCFAAWRRQHWDSL
                     VVLRDVEPVDAGARHRGTATATRVVRDLVLLEYSNAVWYESLRVQRLMVQLLLSGSGG
                     SWSFGVGCFDALLTALGAPPSVESPLCPAPPGPATVMPPYHVAPPGPPSGMAGTAANS
                     PTTLVTVTRKDAAVGPLPTDGLSIRVPTATRMLSLLHVLDVLWNTLPTSIPFRMPVSE
                     MEAPGYYRSTRDPVSLCQLYEEAFCGLTAPTHRACVRQRAHITRRLLEVQAYPPSRIG
                     SGNAVGEEVQSCFFSPTHLRERLTTLKANCDDYNGGGSELSQQASALLSAGVKALRDS
                     QAEEDSWTAYQVREEAHVREAPLAASNEHAAPQPGTAGARFLEDLPSLFPPSEAAAVV
                     PPNLRQPPPIGEHAADVNSTSGHGESSRHRRVLHLRSANSNDAAASLSSSTSNRDLKD
                     FWVQCDDCNAWHKLATRLNPVPDTWTCGFLGLSCSSRKKKHKADKRTLKKATTEGAKR
                     TKASARRHCGARGGPKIDGTDAAPNTVTAAPHNLGGQGDDSGGGGGDDDDVPLVDMFP
                     VAAGAAMVAATAKPPKRRRSTPRKPRTIRQKPKKARVVLPTPSSSSSSSSSSSGSSFD
                     NDSSSSSKSDSSDSGPDSDSGLSDGGKGKATPAQPILHAPRHAKSSTVATHKLPRSTA
                     VASSIGMCFATAAAAEATGAGAFHAGSATLQQLMQAVAELEGRPPQDNPFDQLEEIKR
                     LEKRLSAMD"
     STS             112892..114209
                     /standard_name="ha3106"
                     /db_xref="UniSTS:515650"
     gene            <113187..>121952
                     /locus_tag="LMJF_14_0370"
                     /db_xref="GeneID:5650236"
     mRNA            <113187..>121952
                     /locus_tag="LMJF_14_0370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687584.1"
                     /db_xref="GeneID:5650236"
     CDS             113187..121952
                     /locus_tag="LMJF_14_0370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687636.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650236"
                     /db_xref="GOA:Q4QFU8"
                     /db_xref="InterPro:IPR026084"
                     /db_xref="UniProtKB/TrEMBL:Q4QFU8"
                     /translation="MHNGHHRKIDGHLDSIEDYLRRMTRPPQTRYDPPSLHQVPYTAF
                     FLASSSHEGGPSYQCANEQAGLQASTVYDMPPSCAGPLSTATNTLVAPRAMRDSTAVG
                     TAAAYLVDPAPAPFTGIRPPTSSLTRLPRALAEAAPPHTAALLSSRAKFPPFSQQETT
                     PMHSRGCSNDSSSTTSASETAHEKGTTPVSNSTAASSPLIPAVQPPPLASLQDAAAAR
                     EQAAVVSARRRSCGPRSPLPFASSQDKSQGRSMRALLEGLEEHLRASPLLPQSSQQMD
                     SDRHPGSSRHCHERHGVHPTSLLQPGITELPQHREDNSAAHERAVHIIRDLATATSPT
                     TDDHLSSLLSSLGGSPNSCETPFCRRLRHLDHLLGDGAAHDDAISTPRFCYRHDDISA
                     LAGTYGSSEPRAARCHDPPAAEEPVTKRRLLLASMPSVFYANVSDEKTRLRQAYTTRH
                     EAASGADVPTPSRHEAASGADAATPLRLEAASGADVPTPSRHEAASGADAATPLRLET
                     ASGADVPTPSRHEAASGADAATPLRLEAASGADVPTPSRHEAASGADAATPLRLEAAS
                     GADVPTPSRHEAASGADAATPLRLETASGADVPTPSRHEAASGADAATPLRLETASGA
                     DVPTPSRHEAASGADAATPLRLEAASGADVPTPSRHEAASGADAATPLRLETASGADV
                     PTPSRHEAASGADAATPLRLETASGADVPTPSRHEAASGADAATPLRLEAASGADVPT
                     PSRHEAASGADAATPLRLETASGADVPTPSRHEAAAGADVSTPARRDAEDSAAAGYLG
                     LSDKVSVDASRLSGSLGVRYGSEGLSGAVRYRGVDEANAAMRQDAEGDVLATLNSFRS
                     ADVHNSSIPSSPQQQEQLSVESVSTELTALTAISIGGGLCGPSLRGRGYVSNEEDVSG
                     GRCLATRLWARRQSVPAAQQLRALRRRERQHRQSVVKREVEGRYAIRLREASDAADVG
                     LEWLRGADEDTVTATSFTLSSSPSRLVGQLPHRVKDGSRREAGGSRRNDRLADDGATA
                     EVSRYESRSSRSGRTLSSSKSSMSVIDNAEQQRAFKRACPVGREAQALMSSLEVATGT
                     AAEDAATAETHDSPAASLTGTPGMAVREVGQLGGNPAPKGAIARAGEERTQQQESDYA
                     ATPDLAAKPTSAAKEDASPPSPHKPPSSHWKGALSCSVDAAADTPVDETVHAAATVFQ
                     GDDGVSNAHIADASMPHPPPPPLEGHSSPPSDLWTLDKRESEGDGGEGETEATITSEG
                     HKRSRGNDEYEGSKHASGGSSSAGHSIPSGAGPLSARAAATAADNDAQPPSPPSGDKR
                     ISSSISSASSSSSVFIVQRIRTQPHLSPSASADASSTGTEGATVDVEHADASSATAFK
                     WVGASSAAAADNVAEYHPVAGAGMVHAQAKADAAVQANVEERGGSDGGGGSSRNAADN
                     EDDRGSGRSHSADAVVFVGVPVLREKGAAVDERPKKDDDAPCPSHLTPQPAEPSLPPY
                     ATARTSTDVPVPVRGAATAMTTSPSVTTTTKPLSNDHGAQHSTAVRSPAPASITAHSH
                     PDEEQPQSRRNARTTSSSGASSGSFFYSLPNQGTVRAVSSDESREQQLLHQANTTGEM
                     ISPVYRRTKVAPAPHAWHQRPCEQPRTDEDTGPTAADVSFLREAWHGGCSPDVGGGIY
                     PDYDSQRASTGGSLRGCSSGSRESAENAARHSAAVPAAPKQPAISWTIPLDWADSLDE
                     MDCRYPSAAHAAPDASTVSSIPSSAAAHSDACAAARTSHRYQKTRSGAPRRRPPPHLR
                     PGRPWAHLLTRGLRAVFFSTSSGSGSNDDSSGEARAQAAKEATGPGEAACADAGAQDT
                     FFTAVLPAVPRRSGPWYATLAQCTKKEHHAAPVSLAKAAPWQPRRSVCRASAAHNAEK
                     ARGFEKWARPGAGTQSVNVLRESASLYATATRSKVPTTTTYATPGRRWTAGFAVSASP
                     VRTRTLPPPPCSAASAATATGLQTRAASAPTYSASEAARNTAERLLQLRRQRQPAGPT
                     YVQLYERERYSHLRASANVWRPIPATRTATSRGIRARQAAPTPIRAGACGRAAASPRS
                     AVVWRLTGAPQPRVTEEGRAVRQQEQWVLPLISTPHEAVAARRLSEPSAYQPRRLSAA
                     VIRGGMTSNASSSAPTDAARQTECAGENVRTSNVVRAQSPLSLSGTPPSSSPLSLPPP
                     PPTVATAPRHAAPTAPSMKDAAEEGPGDGDKACKPLKASDQAASTAHTSELAHGTTSL
                     GHVGFSATAAAGEEGATRGRDETEQAEENDGEGLLRTRSDADSRSARRVSTPTPTPPQ
                     PPQQPSGASLQRTLADDTPTAASTFADAEHHHATKTTQFVPTPPGDKPEHGPQSQPLL
                     PSPHALGPHQVVLSKEDEAHAAGLVEPHAGSDDAAQLLSQQGPAEPFRGDPAATGGTE
                     RGHGFALAAVGTAEMCHTVANSLGASTPETAANPYRSIYAAGQGQDVGVHTSRAGTPV
                     DQESLLSPDTDAALLSIFPAPPMASEVHAGHCTPSAPSPFSPATAVSALTIAAAPGLA
                     TSADIRCQPGAPSTPQLSHLHVADESPAPLPQPAQLTPQPSPRVAEPRAGAASAADGN
                     DRVIPPPPEQQQRREILENRIARLETSLMLQRQQRQQTEQRRFRDHDHNEEVPADYFE
                     TATDGDEDRLRSACGKDVELRKHNMQSSQPRRRGRSVDSVGGRGAVAVSGKGRGASGQ
                     AQRSMLSAPQTQDHHLLAPASAIHWAARPGFSFSGGVTGTGAVRRQGLPGAAVTTSPH
                     MDHGSRSGLAVALPSSEAVSASAAPGASIASYTRLASRRYGSAAAFAVATPADPRYSH
                     ATTSFLISADWRYQRMYVDSMYFPEATADSTSRGAEAASEDHKEESRWLEATSGAPED
                     PANSESGRATPAAAVRRASSANNRSADVFVCRPPH"
     gene            <123258..>125081
                     /locus_tag="LMJF_14_0380"
                     /db_xref="GeneID:5650237"
     mRNA            <123258..>125081
                     /locus_tag="LMJF_14_0380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687585.1"
                     /db_xref="GeneID:5650237"
     CDS             123258..125081
                     /locus_tag="LMJF_14_0380"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687637.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650237"
                     /db_xref="GOA:Q4QFU7"
                     /db_xref="InterPro:IPR007603"
                     /db_xref="UniProtKB/TrEMBL:Q4QFU7"
                     /translation="MSHPTARGAGEKAPLVRGNFSETHGDPYVEELGPGALVYTASLI
                     RDDRTSRTSGTISTVDCDPTDDDADWDVEKAKLRNCRNAKQQQTQHTFHTTGGKPSSN
                     ELWRFRTRGCQDCWAALFFAALIVVVLLWGMEQVWQLQLTERDLAVIAGVAEGKGYAD
                     THTVAAVAGGSVHGKVLHGVAALRAGVAALWAGVEGLEPPADAHNSDASSPSSYAGMI
                     GAVVQALIWCATAATTTILVAYGGLLLIAVYPRQLIFIQSAVASMFSAASAGVALAQG
                     AGLMAMVFAFLAFTPLLWIYLIHDRIPFTTTMLCATVSVLQRHRSLFVISLGSAIASW
                     CFVLAAVVCVLPSVLRFLAGTASSADIAYPVILVFGIFWVQEVLTALVHVTVCGVVAT
                     WYFAGEGNMPSFPVQASFQRATTTSFGSVCLGSLINAIASFVRFLIDTVRTSSDGDNF
                     WMCIMSCLVGCIEDLVRYFNQYAFVHVAVYGCGYVDAAKETWALVKQCAFSAIFNDLL
                     TGQVIGILTFMSAVLVALLTALVTWNAAAVALMFFMSLIVSSIFYNPVSSCVTTIYVC
                     FAEVPVGLQLSFPELYAALVDADAGYTQRREEASVYGTALV"
     gene            <127875..>128777
                     /locus_tag="LMJF_14_0390"
                     /db_xref="GeneID:5650238"
     mRNA            <127875..>128777
                     /locus_tag="LMJF_14_0390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687586.1"
                     /db_xref="GeneID:5650238"
     CDS             127875..128777
                     /locus_tag="LMJF_14_0390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687638.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650238"
                     /db_xref="UniProtKB/TrEMBL:Q4QFU6"
                     /translation="MGLLGKERAGSFKATDNSGRRFLWTIDNFSQFPLDITLDSDNVT
                     CFTKVKFHLHLTLRPCGAVGIYIHYKKPPIPKYSYYLTNSKCEGTRQHTAHSLPDGAE
                     RCGHWNVCSHTDVKEFLGEDDKLLVHFCFDDDTLVVNQLGQSDISVTWSIPKLKMQNL
                     CPYSSRGFFVGDALLVARLDIKPKDGHTGLKCAQNNVATYIIFVFCRKGNVPPHSIEL
                     VDSSGNAYFQVAKNEDEPALTALVDRSVVEKNVGSAGSLLIRINFSTSGNPLDLLNTL
                     NGLGSTEGERKGSTGDGRSVELDE"
     gene            <131323..>132255
                     /locus_tag="LMJF_14_0400"
                     /db_xref="GeneID:5650239"
     mRNA            <131323..>132255
                     /locus_tag="LMJF_14_0400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687587.1"
                     /db_xref="GeneID:5650239"
     CDS             131323..132255
                     /locus_tag="LMJF_14_0400"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687639.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650239"
                     /db_xref="UniProtKB/TrEMBL:Q4QFU5"
                     /translation="MGLLGKERAGSFKATDNSGRRFLWTIDNFSQFPLDATLDSDNVT
                     CFTKVKFHLHMTLCASGAVGIYIHYKKPPIPKYSYYLTNSKCEEMRQHTAYAIPEDSE
                     RCGHWNVCSHTDVKEFLGEDDKLIVHFCFDDDTLVVNQLGQSDISVTWSIPKLKMQNL
                     CPYSSRGFFVGDALLVARLDIKPKDGHTGLKCAQNNVATYIIFVFCRKGNVPPHSIEL
                     VDSSGNAYHRIERNGDQSALTALVDRSVVEKNVGSAGSLLIRINFSTSGNPLDFLNML
                     SGLGSAEGERKGSTGDGRSVEVGNKRELYNVMDD"
     gene            <135171..>135746
                     /locus_tag="LMJF_14_0405"
                     /db_xref="GeneID:5650240"
     mRNA            <135171..>135746
                     /locus_tag="LMJF_14_0405"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687588.1"
                     /db_xref="GeneID:5650240"
     CDS             135171..135746
                     /locus_tag="LMJF_14_0405"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687640.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0405"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0405"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650240"
                     /db_xref="UniProtKB/TrEMBL:Q4QFU4"
                     /translation="MVASRDAAVLAALKQLEDVRERLHSALREAAFSFTTAQREEEST
                     RGCFVSLDAVPTAQGTLEALVSLTQTSATTSTSGVEETGCGESDEAARIRSSSCAWEM
                     LLVSGDRRKKQMPAAASQHAPPAPNCGSEASDLFPPDPIYYFSEYPSSALRECQEAYR
                     RVLRCAVETVNAQQRALAEAVAMTMTDAQES"
     gene            <136385..>139585
                     /locus_tag="LMJF_14_0410"
                     /db_xref="GeneID:5650241"
     mRNA            <136385..>139585
                     /locus_tag="LMJF_14_0410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687589.1"
                     /db_xref="GeneID:5650241"
     CDS             136385..139585
                     /locus_tag="LMJF_14_0410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687641.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650241"
                     /db_xref="GOA:Q4QFU3"
                     /db_xref="InterPro:IPR010678"
                     /db_xref="UniProtKB/TrEMBL:Q4QFU3"
                     /translation="MGRPDGFFKKLKAKEKRASSRKQRGTRGASKEDRRRKHNERVEL
                     YAAKREAEQLAAVSSSSDDEPSTDSDAEEYRHTKSLRKLQRLLGVTPSSGPQATSHKR
                     ARRQPTSASRLRASDDDEDEKMADPWNSSGDDDADDANARESPSADGKRNRRPPLQRR
                     RTRHEPDQAKASSTFANDDDLDGEDWRLYLGGASDSDDDNESAEGGLEVDGEATELEE
                     ETDDADNVVDKDLLMDIDDADDGDSNHGSDDDEGSEDDDNPLFELEQGDGDAEEAGDD
                     DDDGADLFDDVMMYDDEAEDDEDEEREDTFVEDDDNDAAEGKVRERDAQRRLLLERFE
                     LSTSSVSVLQRCGIVGVANDTKGSISNTVVLTEKDEWMRKYHLDLHGTLDKTPLKPLP
                     VPHAALELLAESNKLLQVRAAERLESTLDKKELGIFFASPEECAAVHPENVAVLATAH
                     AQQHLLHAPFDVKRSAASLPPPSTPQVAEPWTECPPYLHPVLWEKWTAFRAHRNLPTF
                     TAEERGLLDLLQGYADLLDTLHCWQNSASRREIFVLHLLNHWFKARSVVLAHDALLAE
                     QREKQRRRRREQQKRRNGNGGATLGRDAFVADAEWPAERSSPGRQGRQSKSKGKAAAS
                     QQSKPKKVAKADETSSEADSEPQADYLDVDEQELELRDRGFSKTRLCVFCPLRNHAYK
                     FVYSLVSILQADPSKCPKLAMFEQDFTEIEEAVDPTFKRRPRDYQRAFEGNIDDSFCV
                     GLRLEPELVHVYSHPLNSDVLLCSPLGLRRRIEKNGDVLVSLSSIEVCLLEDTQMLFQ
                     QNWMHVTAVLELLNKRPTDTTHGLSDLRRVYAWALEGKSGRHRQTIMSTDVCNATMLS
                     TFRTASVNNSGKIVLQRRADPGVLSRVLVPVRQHFIRFDPSSLATVDDDRFEFFTKQV
                     YEAKINAMAERDVRIIVFVPSYFDFVRMRNYLHREYRESYVALCEYTSLKQQRKALGQ
                     FSDLERPVLLVTERFYYFKRYFVKLAEALIFYSPPMFPEYYASLTNRLVATSPNAFTM
                     TLYCRYDTHELNRLVGTSRMLQLLERDSGVFSFVTS"
     gene            <140732..>143185
                     /locus_tag="LMJF_14_0420"
                     /db_xref="GeneID:5650242"
     mRNA            <140732..>143185
                     /locus_tag="LMJF_14_0420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687590.1"
                     /db_xref="GeneID:5650242"
     CDS             140732..143185
                     /locus_tag="LMJF_14_0420"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687642.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650242"
                     /db_xref="GOA:Q4QFU2"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q4QFU2"
                     /translation="MASPAFEFVQGNERLDWGVLVSIDVERLMKSTTVDTLQRIVENI
                     AFSRVTRDEAALFTPDHILHLFQLCQVVIQYLVYSQEILAEINVKLNDQIEGQQATAQ
                     EQEALLQRLSDETNLLKKQVKTQRRTLLAYEYNAQAALARGLAGSGAAGAAGVPATLY
                     VCPYCGDEYHKAESMQSHLRKRHNTTAASPSLPVADTATSHPPPTAGSQTVSPAPARG
                     PIATAEASEPLQQLRHRVEQLEKDKEAMERQQRENLLLMMLGATRSNTTSPPPQQPQQ
                     QPAPAPTSTNVQPPVSPPPPSPSSPLPSLTAVPSSTTTETAVNVIPEHLKGIPVVPDI
                     SAMMNYNLSCQREASESALRRQLVDLEAEIRALRASKLAAAPTVLTEAPPPPSPSAAA
                     AACSPATPPSTPGLGVTASKDAPAVGRPAWVAELENAQKRQHQQQQQQSSVSAGPPSL
                     APPLTPPPGPLPLPQAAATPIPPPPQQQHVYATGATVPSLVPPPSHSQSSSTQPQFTS
                     AAAPSIQSVPSLCAPPPLRSSSPAPQPSYNIQQQQQPSPAVPSPTPSVPDLSAPAIPI
                     PSPTTAPTTEGGAPPAATPTPSVSLPQSPQVHPKPYHRVDSSTNSSLTSTSTVPPHRA
                     VSKGWPGTSTSLTSSATPAMATAASTSATTIPLPSTTSAGALAPVVSSPGLGVGSYFS
                     SCTPVPAAAAPAPAPLSVIPPPATHDSSTQHSPPPPVTAPELSAPHPMPVPALRVTNT
                     PLSHAPSLPVPVLASGTRGGSIGSWPPPAPVPSAANAPVPTPSAVPGAIKSFRALSSS
                     SSSSSSSGMRFRVDRRYEF"
     gene            <144013..>145329
                     /locus_tag="LMJF_14_0430"
                     /db_xref="GeneID:5650243"
     mRNA            <144013..>145329
                     /locus_tag="LMJF_14_0430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687591.1"
                     /db_xref="GeneID:5650243"
     CDS             144013..145329
                     /locus_tag="LMJF_14_0430"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687643.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650243"
                     /db_xref="GOA:Q4QFU1"
                     /db_xref="InterPro:IPR004206"
                     /db_xref="InterPro:IPR023577"
                     /db_xref="UniProtKB/TrEMBL:Q4QFU1"
                     /translation="MCACLSLWVWVCGAIINLSLSLSLCTPPPQFACGSPAHMRGLQR
                     VPRYRDPLVRNVARMLLRGLQEQHHTPSSTRLELEVRLGSILAHTRARQLDIPIPVAS
                     PALMDETARNVYQFHAGISRPLLHGMQAALLEAGLATRNDMDLQGGRVDVHVFLSNDK
                     RLHCRYQPLHGETHGARADGVKTAASNREVPPYNPLCLTQSITVLSAEKKSRLAMLDM
                     CCPGWCADLRLALSKETEVPVELTDATKERAIASRCRARTSVPVGRLFSVQMTQSIFS
                     RDVWWYPPPAARSYLEMDAGASSSPPAVTGTTVFGVGTVLPTPVLFYPDKAAGRIGRS
                     DAETTIEVEVEINLRALMREWKRVYGGAAASAYLSTSALVDTTCAGTSIAGDALLKPS
                     IATATRDDDADMHATVLAEREDPYLLRVAEEVMAVVQLLTKVRVVE"
     gene            <146050..>147702
                     /locus_tag="LMJF_14_0440"
                     /db_xref="GeneID:5650244"
     mRNA            <146050..>147702
                     /locus_tag="LMJF_14_0440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687592.1"
                     /db_xref="GeneID:5650244"
     CDS             146050..147702
                     /locus_tag="LMJF_14_0440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687644.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650244"
                     /db_xref="GOA:Q4QFU0"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:Q4QFU0"
                     /translation="MFWKFLVSGLVGSACSAYHRGPTNVSLALDPPTLSIIMDPSKDI
                     VPIRAVIVGGGYAGSKTAYQLDSMFAVTHIDEKNFYELTNDIIPIITNPWKEDVNPKA
                     CRRMMVLHRYYLKRSNVVTGTVIGVDAKQVYLRDGRTVPYDLLFLATGERKPFPFQTR
                     ERTISGRVQELKRFNEFLQSCKKVAVVGGGPVGTSLAHDLASTRPDLQVHLFHQRAEL
                     LPRLPGVCRRHAQEKLLSNPNLHLHLLTRVTDIDGVVLPSNGDKAASSSSPARHSCAG
                     QLVNPPTSNAAVAESSLTLATTNAPWWRSLLNTVWPRRGVVPDQYSVHYDTLQSKVQQ
                     QPSILQQVYYGKRDEVAECGVVQARGVEEGFDYVFALTGDTPRPIQCDELEGRSRKLP
                     NILREHETRDGHYRVSTLMQFLDHPNIFGVGRCTNLPVMRGYGSSDIETRTLFRELNS
                     VISNPTTMFLHSRDGVQLAHMRIPRIHVRLGVDDAVGCTPWSGGMTGVSSVHEFMQDR
                     SYLLREFQKPVFYKQQDQAKVKQRMSQWMEEEITDIVDFSHC"
     gene            <150379..>151365
                     /locus_tag="LMJF_14_0450"
                     /db_xref="GeneID:5650245"
     mRNA            <150379..>151365
                     /locus_tag="LMJF_14_0450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687593.1"
                     /db_xref="GeneID:5650245"
     CDS             150379..151365
                     /locus_tag="LMJF_14_0450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687645.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650245"
                     /db_xref="InterPro:IPR007052"
                     /db_xref="InterPro:IPR008978"
                     /db_xref="InterPro:IPR025934"
                     /db_xref="UniProtKB/TrEMBL:Q4QFT9"
                     /translation="MADERFDSMLLAIAQQQQGIDGILDTFFSFLNRKTDFFTQPDMA
                     RRSVQQAMSRYLAEAEEKQRKAKEAQAAAQQQQQQQQQSARTSSRVEVLESEEEVNAV
                     AAAQAAEEAAQRKQELERAQREVAEAKAKKEAAGNEAETGATEAFADTGDAPRGLPPT
                     AANGFAYEKYIFSQSLQEAEVRVPLPAVNVKGKQVSIVITSSHLTVGMKGQPPIVDGD
                     LYSKVRAEECMWTIEDGHTVVVTLYKVNSMEWWKTIFQGDPEIDLQKVIPENSKLDDL
                     DSDTRQTVEKMMYDQRQKMMGKPTSDEQKKQDMLRKFMEAHPEMDFSQAKFC"
     gene            <152236..>153615
                     /locus_tag="LMJF_14_0460"
                     /db_xref="GeneID:5650246"
     mRNA            <152236..>153615
                     /locus_tag="LMJF_14_0460"
                     /product="cystathionine beta-lyase-like protein"
                     /transcript_id="XM_001687594.1"
                     /db_xref="GeneID:5650246"
     CDS             152236..153615
                     /locus_tag="LMJF_14_0460"
                     /EC_number="4.4.1.8"
                     /codon_start=1
                     /product="cystathionine beta-lyase-like protein"
                     /protein_id="XP_001687646.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650246"
                     /db_xref="GOA:Q4QFT8"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="InterPro:IPR006238"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q4QFT8"
                     /translation="MMHAISAAKTTINRTILTALEEERQYLEQAMLPVSYKFPKGADY
                     SELPTYPKRPHFDQAAKHPSTQVVIFDGCPNDPYHPTSMPIYQTATFVQPDIEEFGPY
                     DYSRSGNPTRTAIETLVANLEGAHAAFAFSSGMAALQTLVTTLNAGDTILASSDLYGG
                     MHRLLTQITSCLGMTVVFVPMWDTEAVRQALVDNPAAKLLHMESPTNPLMRIVDIRAV
                     CEAAHAHNVKVSIDNTMMSPLRCTPLALGCDYSIHSATKFLCGHSDTMCGLICVKSEE
                     DVKRVAFLQNAQGNALAPFDCWLLLRGIRTLSIRVEKQELNAVAVALFLSRQSHVVSR
                     LHYAGLNPATSPQISSLTEENFYLHRSQTSGPGSVLSIETGSVKRSNAFVRACKLFKL
                     TVSFGSCNSLVEMPCLLSHASIPKEKRTLPVDLIRLSVGIEQIEDILADLTQAIAAAV
                     AIHDNDGSC"
     gene            156254..157510
                     /locus_tag="LMJF_14_0470"
                     /pseudo
                     /db_xref="GeneID:12981165"
     CDS             156254..157510
                     /locus_tag="LMJF_14_0470"
                     /pseudo
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /db_xref="GeneID:12981165"
     gene            complement(<166987..>167814)
                     /locus_tag="LMJF_14_0480"
                     /db_xref="GeneID:5650248"
     mRNA            complement(<166987..>167814)
                     /locus_tag="LMJF_14_0480"
                     /product="hypothetical protein"
                     /transcript_id="XM_001687595.1"
                     /db_xref="GeneID:5650248"
     CDS             complement(166987..167814)
                     /locus_tag="LMJF_14_0480"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001687647.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650248"
                     /db_xref="UniProtKB/TrEMBL:Q4QFT7"
                     /translation="MRAGTNANCEPLTEISSLRTSRRPSSLHRRKSKIGGRTVLYIPC
                     RERVLIALAATMQVITFVLLIAAAATDVFMVDGTRAIRIGADLEAVSTALGVSVTEGS
                     KPFCYSLWGARRCGTSTFHTEKWYTEHGIKDKGFPSSVTYTMMLGAAAFAVLAACYSF
                     INIIGITVVVCMQDFTAVLCAWSFSVLITILISWALSVGVYARSMATMNSTTIVGRKV
                     RVKDYCDFSSSFALAMAAFVLQGFQFTFTTVYTRVFENRMKSVVAEQKQINRELSPE"
     gene            complement(<172554..>173384)
                     /locus_tag="LMJF_14_0490"
                     /db_xref="GeneID:5650249"
     mRNA            complement(<172554..>173384)
                     /locus_tag="LMJF_14_0490"
                     /product="hypothetical protein"
                     /transcript_id="XM_001687596.1"
                     /db_xref="GeneID:5650249"
     CDS             complement(172554..173384)
                     /locus_tag="LMJF_14_0490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001687648.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650249"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4QFT6"
                     /translation="MRTGTNANCEPLTEISSLRTSRRPSSLHRRKSKIGGRTVLYIPC
                     RERVLIALAATMQVITFVLLIAAAATDVLMVDGTRAIRIGADLEAVSTALGVSVTEGS
                     KPFCYSLWGARRCGTSTFHTEKWYTEHGIKDKGFPSSVTYTMMLGAAAFAVLAACYSF
                     INIIGITVVVCMQDFTAVLCAWSFSVLITILISWALSVGVYARSMATMNSTTIVGRKV
                     RVKDYCDFSSSFALAMAAFVLQGFQFTFTTVYTRVFENRMKSVVAEQKQMKEAPLNHA
                     "
     gene            complement(<178111..>179757)
                     /locus_tag="LMJF_14_0500"
                     /db_xref="GeneID:5650250"
     mRNA            complement(<178111..>179757)
                     /locus_tag="LMJF_14_0500"
                     /product="hypothetical protein"
                     /transcript_id="XM_001687597.1"
                     /db_xref="GeneID:5650250"
     CDS             complement(178111..179757)
                     /locus_tag="LMJF_14_0500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001687649.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650250"
                     /db_xref="UniProtKB/TrEMBL:Q4QFT5"
                     /translation="MHSDHLQGPSSLKALTTTRHSHHGTLEASEKATLCGAEVVRPTQ
                     TPSAKSRSRSRDLADEDDEVAHALPLQGRRHSSLQERLNAFCDASSAIMWTDGEPHTT
                     GTATASPLAARVTETASDRNCSEKDEKRRLMKEEARVRAELHWLTDDLAPRLRVACTE
                     VQVQLEKLQQDERHVNAVRSSASSCRSPDSPHLLATIDREHERVAGLLERVEVLQAEL
                     EREASADAVGEPQKSQPSNGHDVTASSTRCELGESSPPAAFRARSIDAGPPGPLEARH
                     SRHDDVATQGLQSPDLCMVEKLRLLVAEELETVDSYRSQKLALQQRLSRLAELIEDVA
                     AEEASLKKSETALHELLDGRTSEPVVDFAWPRTLQGLTDEEDAALRASVHMFDKYQRK
                     LQLITDGGQCSASANVPSSSADMSLLANSSAAASSPTAAAGATERSGLRTATCAATPN
                     RRTHSNGGASICSESSAVATPTSSRVEHLRQVLRTGDRELAQLQAKLKAAQEYCDTYG
                     PIARELDAQLQRGERILAERTKYLADLQAAESGEALRSVC"
     gene            complement(<184088..>185491)
                     /locus_tag="LMJF_14_0510"
                     /db_xref="GeneID:5650251"
     mRNA            complement(<184088..>185491)
                     /locus_tag="LMJF_14_0510"
                     /product="putative stearic acid desaturase"
                     /transcript_id="XM_001687598.1"
                     /db_xref="GeneID:5650251"
     CDS             complement(184088..185491)
                     /locus_tag="LMJF_14_0510"
                     /EC_number="1.14.19.1"
                     /codon_start=1
                     /product="putative stearic acid desaturase"
                     /protein_id="XP_001687650.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650251"
                     /db_xref="GOA:Q4QFT4"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR001522"
                     /db_xref="InterPro:IPR005804"
                     /db_xref="InterPro:IPR009160"
                     /db_xref="InterPro:IPR015876"
                     /db_xref="UniProtKB/TrEMBL:Q4QFT4"
                     /translation="MLQAVQNLFTCSVLSTDETKPKVEREVPQWSKGNFQYNWIGIYI
                     IGVPLLFVLLGLYLRVPLSFSLLQWLAFFAVVTGMVGVTTGYHRLFSHGAFTGGQAMQ
                     WVCAFVGAGAFQGSIKWWARNHRVHHKYTDTSKDPYDARRGFIFTHFGWFIMRMDYDL
                     LGDADVSDLKDSLVVEFQRKYFAAIATMTGILIPLMVAGATTGEWAGAFFWVVWLKIF
                     LVHQFSFFINSLAHTDLFGATRPYADNKTPHDSVVFAIINLGEGYHNYHHQFPNDYRN
                     GHLWHHIDMTKWYIFMCSFLGFCDNLQRAPRTVVDRAAAAQAVCMHGRKLQEAVEKVK
                     QLEVPADKEYAWDDVRAEVEQGRKLLVMDGYVLDLERPIPVDPAWAQKDKKISWLNMH
                     PGGRALLLAYVGKDATAAFNGGVYGHTTGAHNYLPELRVGRMKERPASSASGEEGSAA
                     VCTGQCVTLPRRCDVPL"
     gene            complement(<187379..>187708)
                     /locus_tag="LMJF_14_0520"
                     /db_xref="GeneID:5650252"
     mRNA            complement(<187379..>187708)
                     /locus_tag="LMJF_14_0520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687599.1"
                     /db_xref="GeneID:5650252"
     CDS             complement(187379..187708)
                     /locus_tag="LMJF_14_0520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687651.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650252"
                     /db_xref="UniProtKB/TrEMBL:Q4QFT3"
                     /translation="MTRQADEQKSMRKVTGSGEAEKTSKLRTDDLAALQERMKKLHAE
                     VTQQSEAKEQRARELAAVPVADEDAQVVAAALMVTPECARSLLQKKNGDVTAVLRDAV
                     GLPKARA"
     gene            complement(<188479..>189993)
                     /locus_tag="LMJF_14_0530"
                     /db_xref="GeneID:5650253"
     mRNA            complement(<188479..>189993)
                     /locus_tag="LMJF_14_0530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687600.1"
                     /db_xref="GeneID:5650253"
     CDS             complement(188479..189993)
                     /locus_tag="LMJF_14_0530"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687652.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650253"
                     /db_xref="GOA:Q4QFT2"
                     /db_xref="InterPro:IPR013099"
                     /db_xref="InterPro:IPR015449"
                     /db_xref="UniProtKB/TrEMBL:Q4QFT2"
                     /translation="MELRERVGKLSRAQAPTAVPPTSNPMTQRLVSLEHDQMSHQWFR
                     GVMAFLAFMCFMLSIFQVSGYAGNLVVHVLILALSLAGEVCIVLVYRIKTRFAGVTNP
                     ASHAVNSLHSPYLSLMLCEMLVWIIMAPPGVKGTSSWARVLDSFIVLRSYVYVMYVTR
                     LSTQSVFKRAVASLCGYRFNSLYMFRHTFMSRHAIATACGFVVAWLGLALLYTKGEEV
                     SYADAVYFCSSTMGFVGYSDVVPLTWVGRFTAFLAWCLGLLVIAWCVSLMHALLRVTP
                     AERNLHTLFRTNKLCAQVPGEAARTIQRAWKLYLAKLEKRNPLSIQFNALLLSSQACS
                     FRSLRREFVESEMAFIRSTYTFDDALTALSRQSSLRTTPAGSPRSPMSTALSASGGTP
                     KSTTGRRSFSLFKEVKLKSPQISPLPPGADVETSCLDGGAPPPASSLTSLPVLELRGL
                     INQRQLTHSGAGASAMASDITRRLAHLDETLSILIRKAERMAPRMLASSTEVAS"
     gene            complement(<191497..>192996)
                     /locus_tag="LMJF_14_0540"
                     /db_xref="GeneID:5650254"
     mRNA            complement(<191497..>192996)
                     /locus_tag="LMJF_14_0540"
                     /product="ion transport protein-like protein"
                     /transcript_id="XM_001687601.1"
                     /db_xref="GeneID:5650254"
     CDS             complement(191497..192996)
                     /locus_tag="LMJF_14_0540"
                     /codon_start=1
                     /product="ion transport protein-like protein"
                     /protein_id="XP_001687653.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650254"
                     /db_xref="GOA:Q4QFT1"
                     /db_xref="InterPro:IPR013099"
                     /db_xref="InterPro:IPR015449"
                     /db_xref="UniProtKB/TrEMBL:Q4QFT1"
                     /translation="MKRSITKGPRLLGRRIKHFLKDDLYINVSYQEAPPKMVARELTA
                     LEVLSVYHRWLRGVQALLSIAVFILSLLSIGNSAFLVNCTIFIVSQAAALVICKTYQV
                     KAQFSGVTNLLFEGRNIFTSPYFLHMVAEIVLWNIQTPPFVFVGKQFFELLNYFIFLR
                     LYSVIVYLNNAMYVHRTFCRVMSAISDLPLSTSFLIRTGLLHHKTRVVVTVVICAWLT
                     VGCLFARTQNLSLGDALWFSFQSLSTLGYGDITPSTLSGRAVAFIAWIVSYVIMAFLI
                     ITMYSLLQASDRSHNMQTLMECHELAHSLRGRSARVIQLAWRLHKARKVGPHEPSVKQ
                     KVYTLALSWLLTHMIAAVRRTRQQLNGAVRSLNETNIHPLTGLSAYQYNEYLQLTEKA
                     ARQLQRAKDVDRVYLALRDRDVLASSLSRRDIESIIVLPGDSLEPIDTALPAALTSSS
                     GTAASVAEMAEWRDRVAHLEQKCARLAEVLEAISAVAATHPPSMAVSQM"
     gene            complement(<196113..>197783)
                     /locus_tag="LMJF_14_0550"
                     /db_xref="GeneID:5650255"
     mRNA            complement(<196113..>197783)
                     /locus_tag="LMJF_14_0550"
                     /product="hypothetical protein"
                     /transcript_id="XM_001687602.1"
                     /db_xref="GeneID:5650255"
     CDS             complement(196113..197783)
                     /locus_tag="LMJF_14_0550"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001687654.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650255"
                     /db_xref="UniProtKB/TrEMBL:Q4QFT0"
                     /translation="MLLPVFLESVCRCVLVYLRASAHVKECLPPFTHRPHIDPRLLSI
                     LLGCCLSLSPPPLPPSCAPLHELLVRLRVGLTVRVDKGRTHTPHLSHTHSRIHVHTRE
                     PPPLGAHVPLKPTPTSFLQVTSAFILSFFSFLLSLCVCVCVCNGRVERGGGKGNSGAC
                     GLCVHHGKKIYALFVFAGDFVRIRVIREAAASERMAPCACCAIQQRPCTFLALLLAAV
                     VCLPSSSPSLILPGVLHAAALLPSRDLFLRRAGSTYNYTMYSGSAVTGESHFTGLTTY
                     PYVFSAGMNSAIVAMLNGFLSSVKSNVSAVGGGFHECIDNKLGAVDGTACFKTLLAAA
                     PPADCPAANKLCCPLFWRVESQGLRTTMAQVIPQTLFWNGATSVNGFFTNFSRSYLDA
                     NRNCSKPLLSPASPVNLAMDAYGEWRFVGLVTTYTLLETAINRSASSAAPIFGENPQD
                     AITNTIRSQQPFYKIITVHIAGGVEALLLLLLFLFVVVAGPYSIGRPAIRVRELQLLT
                     VDLVSQYRRKSACAFLDELSSSEGCRSPRMRSRSRSSSAGSGNGDGGG"
     gene            complement(<201768..>203153)
                     /locus_tag="LMJF_14_0560"
                     /db_xref="GeneID:5650256"
     mRNA            complement(<201768..>203153)
                     /locus_tag="LMJF_14_0560"
                     /product="hypothetical protein"
                     /transcript_id="XM_001687603.1"
                     /db_xref="GeneID:5650256"
     CDS             complement(201768..203153)
                     /locus_tag="LMJF_14_0560"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001687655.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650256"
                     /db_xref="UniProtKB/TrEMBL:Q4QFS9"
                     /translation="MFAVAAPLPAVQALLLTLLLCASAFTSVVVDASPAYLLAQRRGQ
                     RFAYEAKSDPVIDVDGLLPNASCSFLYAFTEDMNIFIKNLISSSVMANFGTGAEEHGF
                     DHCNLLSLPQNDWNTTYTLSGCFKTLLHAGIAGDCVADNPLCCVQYWRYPTSLPDRLP
                     SDQIDPRLIFWDGTKAVNGFYTNFSDKYRAHYWNCSSFRPWPECSCTYGANSTLAVDA
                     NGEWRYTRRYMPFLTYVEHRVDSPTGKAAAQLTLLDTTSTPAWAAVHQFGDIPLPVPI
                     VVLAGLVVVLFISLLLMYLCGYKPAVKEEKELCAKIEDVQARTAKAEEKLAAKRRRNQ
                     RRSSSHSISPESAQLHVLSPKPHQQQHAYAAASLQSQGTQSQLQTRGSFMAVRNRTDA
                     VHQRTSSRADSTCSRKSSPVTSAVSTVNDPPANSILKRAPSTGSMKSAASRQSPQSFQ
                     NPLIGRQTFGV"
     gene            complement(<206100..>209639)
                     /locus_tag="LMJF_14_0570"
                     /db_xref="GeneID:5650257"
     mRNA            complement(<206100..>209639)
                     /locus_tag="LMJF_14_0570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687604.1"
                     /db_xref="GeneID:5650257"
     CDS             complement(206100..209639)
                     /locus_tag="LMJF_14_0570"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687656.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650257"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q4QFS8"
                     /translation="MVEKTYLRYVVGPQGGAVVSNASLAMDAAVVPSRYAAAGSSARP
                     RTGSLGRGSRGGSSYGRGEHATSGRAALSPVVATSAAAIFVPSLEAVRVYSVRSGELL
                     HTLIPAEAKMPVEVTTLHVVPMEANQRGSKFSADADAHSGSGTAMQQYSTGWMLFVGY
                     SNGCVAVFSCSAANNYGLPVCRFYALGHRVDTQVLAVAVDSPRSTLCSAGQDTDITVW
                     DLVSQEASFRLRGHRGGVVALAMVPSLSMRTGTVGDMGGSSGNASGTACDRTLLLSGS
                     ADGLVKTWDLTLRQCLHTVIASDTQVTAMVADSQGRRLYCGLRENYLKVYNTEPLLAS
                     ASQAAAEQSSAANARNGTAAEAQLEDGAILDHGTVPRKYHKPITALDFSHDSAFMVGC
                     TSRTVEVFHMLTAEEVKRKLYRKRKRRRGPGAAPAKAGAAVGGAEVVDKEASAGSGRQ
                     AGKKASRKKSKMDDTVAEDDGTQDGDEDDAAPSHGGTTASAATVVAATAAEEVVSLRA
                     FFLPQKIRSVCFVPPTSREQLSEADTLHIAVTYSNNTMETFTTTLTTSDREGASVLTL
                     TDLRPRHTFDWKGHHSDIRELAFVDTDTALLSISREKVMMWSLTVKEDLFDSDHLDHH
                     DFYDAKEANLARVDFKGALNNVGSVDVEDATCMSAISSLLCCVGQQDGSVLLLDVASS
                     AVLFREPAIHVGGVKNTVRKPDGAGFVTLGADRRLLLWSIGLTEDKKNVQSAGSRGAA
                     KKTRMTGADRDDDDDAVTAGAGGSGATLLQEQEIELTEVPLCAAFSPDSRFFGVGLQN
                     NNVQLFFADTMKPYLSLFGHKLPPTSLSFSTDGTLVASVGMDKSLRFWGTDFGDCHRA
                     IHAHDDYITQVEFLEDTHYVFTVSMDGSVKQWDGDNWTMIQLFRQHQRGLWAVSVTAN
                     GTCVATAGADRCIRCFLRTQDIVFPHEEEERMAQEAMDEEAAKRAALQKLDGADVNGT
                     GAAEVGIAGQQTATTAEAAERLMEALDIVNVEQQRKQCGDDTTPRHPMLLNMSEWEFL
                     WSTIETIRPSELRYTLLSLTSIHVDALLTALESMLTEKAVLNYEMASKMILALVMMPA
                     ESGSTQGLRAAAIRGEVSEVQGARRLAVLRRRISEGLDESVSRMDYSVAGLQLVRQYL
                     EDTEKIKFFDCSKVQGYKRKYHSRALSPSEDKH"
     gene            complement(<210896..>211276)
                     /locus_tag="LMJF_14_0580"
                     /db_xref="GeneID:5650258"
     mRNA            complement(<210896..>211276)
                     /locus_tag="LMJF_14_0580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687605.1"
                     /db_xref="GeneID:5650258"
     CDS             complement(210896..211276)
                     /locus_tag="LMJF_14_0580"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687657.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650258"
                     /db_xref="UniProtKB/TrEMBL:Q4QFS7"
                     /translation="MPLCASPVRLQLCRTPSVLGAGGKWWKEGPPDYTRANRRRMELE
                     QQRIESSQHLPPIEPTAEQACHLYRRLLKEGYKTLVVTDKDFYRRKVRYELEVTSRQT
                     SSRVRGIMFEKGHWMLENKLGGII"
     gene            complement(<211859..>215995)
                     /locus_tag="LMJF_14_0590"
                     /db_xref="GeneID:5650259"
     mRNA            complement(<211859..>215995)
                     /locus_tag="LMJF_14_0590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687606.1"
                     /db_xref="GeneID:5650259"
     CDS             complement(211859..215995)
                     /locus_tag="LMJF_14_0590"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687658.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650259"
                     /db_xref="UniProtKB/TrEMBL:Q4QFS6"
                     /translation="MIDSGLCLSPSVEGALAVAVGAHTGAGVTENGGADEGHGGSRYL
                     SLAAASSVASAACALTWLLTVFLPRPQVPALAIGLTLSRPAFAGSGNEVGAGTPMQWC
                     YVERGATPSVPHDALWAHWTAMVQPPESRRAGSRLASAPCFAEGDHDDDFIVWGRLQH
                     CTERATTILFGGQPADSVTPKSTRLCALLAVLGDVRACATRQSTSNPLPVLLSDETSV
                     PQRLLFQWFTFLGLRSTSSLECRPSGELSTEIHAIVSTRDWLAELSACNSICSLGHWL
                     HLVSQWLTFRVLEAALELLPSVLRWKTGSASAAETHLLFRSDVDSSRCCSANLCSGPD
                     STACPARQKGGLAQLRPSCWMRYRTTASAPAAASPSTASIAAALPELPKAEAVLVCVL
                     ERLMSAAIGPADGSRKSPGRPATAHALILEPEAHGVVTCRLHLGSRPPKWQRNGLPVR
                     GVSVPPLSQSFSTRHPARSSAPPTARAAHAPVVAALLSWYAVDFEAVFGRLYRVWRLA
                     QRYHSRCPAKSCGEIGAADAAALHNSDPWRGVVDAAVRCYTDDAGCSGQAHEGPALGS
                     LGRCLLLAIWLSLALVDVDGGVGAAAPCPPMTWKGTLYYSSRRNVLHVRDWGTALHLR
                     HVASCLSAGDDQAMGGDTANAGALQDGNSRGKECGAAVKEAVSTVVNSFARARTAAVA
                     AQARARLQAQSTTHLPFSEAQDPRGHTTTTSRGAGDSTSRSTCRLLHICGDDGAAAED
                     NDECVLLSWSCDTAEEESGPREGGSGVPLVQQPQGKPRRGGDDPLASTDLLVGTSPQS
                     LWLDCSIEEFAEANDGTIGQPLVTQVPAPQVKEGPEHSALDPALVVPLVKLESHLREL
                     LTRNALSEMLSLIGLTRGLAWRTCDDGEVAARQRPARHARSHHVRAEAQRRFGGSSAL
                     PVDEVRLHEDEQPPSPAAAAAAAHVDVSLSTRHAPAALASSKATRLQEDEEPTRSSLC
                     RAEHRMRQYVYARCTHVGALLLLQSREARGRLHLSQVWELEQEEWQARWSTVLVPECV
                     LRSLLHEKSAAGAWRALTQQEGPQQRQPHGCRHRNRRLGSASQWHQRGPCGSAASLKV
                     GPSPPTPTADEVRTHRMILLCGDVEEVDRGAPDRPAQRSPRAKAYASHSPPPCQRNQQ
                     EPQSPLLAPLHSPSLTMRPRRAPPQTCPNKPAARVPVSAYAPAAAARSAVPVLSISLC
                     ETPPSAPARASTRRCLNELPLNRRRIDAGFARIAPSHQLVSPPSTAAIRWCLPAEDSD
                     ALVDHETPRRKASLPKHEDTHCDTAARRRPSAGERASAASVKCNLADSESRGAPLGTA
                     APVPSKAKERLATHAGPRISAAPPVLTHVATHIASTTSVPPRRLRRPVVTWSDDMQQY
                     "
     gene            complement(<217534..>219000)
                     /locus_tag="LMJF_14_0600"
                     /db_xref="GeneID:5650260"
     mRNA            complement(<217534..>219000)
                     /locus_tag="LMJF_14_0600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687607.1"
                     /db_xref="GeneID:5650260"
     CDS             complement(217534..219000)
                     /locus_tag="LMJF_14_0600"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687659.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650260"
                     /db_xref="InterPro:IPR029026"
                     /db_xref="InterPro:IPR029028"
                     /db_xref="UniProtKB/TrEMBL:Q4QFS5"
                     /translation="MMPWVAGGNVASGAPLTAAAPASSCTPPHGTTSPPCDAVTKAVC
                     ASPTSSTPTLHGKPYKERKMRELDPLTRWRCRRCGVMLQPPLDAATGKPRYGVMMTEH
                     LEGVSSGGTACLATGVVVCAAGTMRYEKVLHEDTLSHSQPSKRPRDDAGEGLARGRAT
                     EEESVVAGTRESQRHEHDGVDKTTACEALRRLLRRCQQGARQHGNANASPSPLLFIVV
                     ENPKTPANAGGILRAMRCYGLHGPAAAAATVAASTEEVTDLCASVGASMHATVEAAAE
                     SAEGSVRHRVGSFIYSGTRLQKAMAHSEYAHALRTDPTHAGRDIPQLCVPALDVLFNV
                     LRDEYGYQQKEPRSPSPSSVRVVAVELVEGAIPLPFYAHPFSHPTQDVALPRVEQDAT
                     STVAHVPMVFYILGAEDGTLSAHHVQHDVDDVVFIPTTGSMNLAATVNVLLYDRLSKE
                     CCGVHPGVAEAASTGSRWKGVFDTRNANNRMRWTRTPH"
     gene            complement(<219733..>221145)
                     /locus_tag="LMJF_14_0610"
                     /db_xref="GeneID:5650261"
     mRNA            complement(<219733..>221145)
                     /locus_tag="LMJF_14_0610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687608.1"
                     /db_xref="GeneID:5650261"
     CDS             complement(219733..221145)
                     /locus_tag="LMJF_14_0610"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687660.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650261"
                     /db_xref="UniProtKB/TrEMBL:Q4QFS4"
                     /translation="MRGLQLSGHAWRPCLSSAAVSLRTFSSCTTSTSGAAVVVTASRR
                     NGAVLSAVYITQRLYRTTQQKKGTSDAANSDSGTTVGTSVGADATSDDAMDLIWSDMP
                     DVHEPNHEATLTSGPHEHRAAAATRAPKSSPHEESRASDASDTAASLPEPPVSHVWVS
                     MHNMPRNWLHEDIVEMIHQVAEHAGIAASEAPLLSESAAGREGDVAGEGGEEGHTGEG
                     TSSALNHVSSPFVRRLHIPFGRRTGLVYGSPKLLLTSRQLADYLLHRLSFDPDDFRSR
                     VYFTRTKPEELPSGFQQQQQPREGGGAEGDAANGDGVAQVTYTPIEETVEREQDEALR
                     TLVLDRYLFAPDLLLDIAKSHQRRLVTKNEKVLLDAFVDGEEDSDADEEDEDGGDVED
                     DDAVGGGSGADGDAESAAATLTRRHRRRQRHRATSTGGPGKRKSPLTRRVRAGTQKHL
                     GRGSMHNMPIPKPYVVGRNL"
     gene            complement(<221924..>223930)
                     /locus_tag="LMJF_14_0620"
                     /db_xref="GeneID:5650262"
     mRNA            complement(<221924..>223930)
                     /locus_tag="LMJF_14_0620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687609.1"
                     /db_xref="GeneID:5650262"
     CDS             complement(221924..223930)
                     /locus_tag="LMJF_14_0620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687661.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650262"
                     /db_xref="UniProtKB/TrEMBL:Q4QFS3"
                     /translation="MILHGALSQERDRLLSSYLKSPITLSFPPPLPLLALPSPPSFFV
                     YKKNVFFFRLGMGDARSASSKASSPSCVLAATPRDFGRSAEPGDSPRPPIIAVLYRPG
                     QAKRERQPARGGRGGGQRRLVSYFLPALAAHVRHGKQWTTYPLSFLYPYRPSHSLSTP
                     PHTPSIITDPRITRRKLASVLSLFYLQSVTMMASGGDEQLDALVDSILQSSDHLGSID
                     QITQRLPSPQQQQLSNPAFTSSTQQREHTSSDSHDTGVRAHMHAVSPGGSSSSVGNFV
                     VAVPAAHHASASTSRATATHLDTEDGEKGEEEDDLSALVERILAGPGVRGRPSTSSAS
                     SPRFSQVPPPHIGNSGATSTSGLKGATRVKGGSSSLSRTFGAGPASPNARMQAVVRRL
                     TLWYERKEAKRVQAVYEALEREQLDCTFEPRINRLGVEVGGSVVVDEDDRPLHRRHYS
                     ADEYPRRSSASSKARGSSGSRAVSHTNTISMSSSSSRVTPHVCEYIPSLQPPSQPITG
                     ADAFVERLRRAQDERDTVREAEEAKRLHYYDPTTFRRDLTVPVPFEFVETRPRRLAAA
                     MTAAAGGSPSRGPGDIVGVTRTSIPPFSARAAALAACGDAGATPPRPAEDGFRDVNED
                     KRLTPENTFLSLAPHIRETLLFDRQMELQLRRATDSVRRVTRGE"
     gene            complement(<224673..>225353)
                     /locus_tag="LMJF_14_0625"
                     /db_xref="GeneID:5650263"
     mRNA            complement(<224673..>225353)
                     /locus_tag="LMJF_14_0625"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687610.1"
                     /db_xref="GeneID:5650263"
     CDS             complement(224673..225353)
                     /locus_tag="LMJF_14_0625"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687662.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0625"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0625"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650263"
                     /db_xref="InterPro:IPR005735"
                     /db_xref="UniProtKB/TrEMBL:Q4QFS2"
                     /translation="MLFGQLVCYGCQRILTYPLGAISCRCRLCSRVNAAQNLQIRCGT
                     CGQELHAPINTLALLCPCCGTVTDIPEELLPPLPSCVDLGGGEGTEKVIYVSHPTLPP
                     RPRPNGEANMNATSFVGSRRLSTQLRGEGRRRSASFARRRFSSEEGEGTAAQGNQEET
                     VVDVDADGAREAGRAHNADGKCRDIIGPMAPDQAYVSSAVTEPSRGAQRVAPSRLAPT
                     VMIATRIL"
     gene            complement(<228957..>229874)
                     /locus_tag="LMJF_14_0630"
                     /db_xref="GeneID:5650264"
     mRNA            complement(<228957..>229874)
                     /locus_tag="LMJF_14_0630"
                     /product="putative fatty acid elongase"
                     /transcript_id="XM_001687611.1"
                     /db_xref="GeneID:5650264"
     CDS             complement(228957..229874)
                     /locus_tag="LMJF_14_0630"
                     /codon_start=1
                     /product="putative fatty acid elongase"
                     /protein_id="XP_001687663.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650264"
                     /db_xref="GOA:Q4QFS1"
                     /db_xref="InterPro:IPR002076"
                     /db_xref="UniProtKB/TrEMBL:Q4QFS1"
                     /translation="MASLISYIVNYDGYPLQAYLLENIDVIGYIASIYLVIVGKGDRI
                     LSWWNKRKAPAADAQAKQNGASKETVAALKSCYTAASTYHLVLCIACALVSCILVPAM
                     AQSVLVNSFFATMCLWDDALIYKGAVGFSLSAAVVVKVVEQLDTFFLVLRDYIVASPE
                     QEKKQVRRVRPSHWWFQVLIALYFWHTYSIGTSCFTMIATITMAISAARNFFYMQQDA
                     AQAQGKTAMATKSNREILALDMAEWISCSALSVYASYMNYTHERGCMTVQANVRMALV
                     MYVTAVVLRFRELGKGSEAPVARESKKNH"
     gene            complement(<231875..>232717)
                     /gene="ELO1.1"
                     /locus_tag="LMJF_14_0640"
                     /db_xref="GeneID:5650265"
     mRNA            complement(<231875..>232717)
                     /gene="ELO1.1"
                     /locus_tag="LMJF_14_0640"
                     /product="beta-ketoacyl-CoA synthase"
                     /transcript_id="XM_001687612.1"
                     /db_xref="GeneID:5650265"
     CDS             complement(231875..232717)
                     /gene="ELO1.1"
                     /locus_tag="LMJF_14_0640"
                     /EC_number="2.3.1.119"
                     /codon_start=1
                     /product="beta-ketoacyl-CoA synthase"
                     /protein_id="XP_001687664.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650265"
                     /db_xref="GOA:Q4QFS0"
                     /db_xref="InterPro:IPR002076"
                     /db_xref="UniProtKB/TrEMBL:Q4QFS0"
                     /translation="MQWLDNYGDHHYDGHAVQMWLASNVDVCAYIAGAYLAFVFTGPR
                     LMEALFHGKPPTGIKKAWALWNLGLSVFSLYGWLRVGPPLLRRLMHDGLHNTLCTFHE
                     DEFYTTKVGFAIGMFAISKVPEFIDTVFLLMSGVKLAFLSWFHHVTTYLFAWYSYQQG
                     TSIFICAAAMNYFVHSIMYMYFALSEAGFKKLVKPFAMYITLLQITQMVGGLFVSGYV
                     LVQKLTEGAGNPCSGTSMSAARTQLVIYIFNFYLFSEMFIKAYVLPRKAGAALRRPSP
                     SKRS"
     gene            complement(<235918..>236775)
                     /gene="ELO1.2"
                     /locus_tag="LMJF_14_0650"
                     /db_xref="GeneID:5650266"
     mRNA            complement(<235918..>236775)
                     /gene="ELO1.2"
                     /locus_tag="LMJF_14_0650"
                     /product="beta-ketoacyl-CoA synthase"
                     /transcript_id="XM_001687613.1"
                     /db_xref="GeneID:5650266"
     CDS             complement(235918..236775)
                     /gene="ELO1.2"
                     /locus_tag="LMJF_14_0650"
                     /EC_number="2.3.1.119"
                     /codon_start=1
                     /product="beta-ketoacyl-CoA synthase"
                     /protein_id="XP_001687665.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650266"
                     /db_xref="GOA:Q4QFR9"
                     /db_xref="InterPro:IPR002076"
                     /db_xref="UniProtKB/TrEMBL:Q4QFR9"
                     /translation="MQWIDSWGANHYDGYAFKQWLLDNHDIAIYVAVGYITFVFQAPK
                     LVSKYLNLPANAKSSALVPVINKTWAVWNILLSAFAFYGTTRVVPPLLYNLKTYGLHD
                     TLCTFRPDEFYTSDVGVALGLFTISKVPEFGDTFFLVLKGTKLRFLSWFHHTAMFLYV
                     WLSYETGSSTLICAAAMNYFVHTIMYFYFFLSEAGFKNLARPFAMYITMLQLVQMVGV
                     MFVSGYVIAQKYILAGQGIMDGMEGSCSGTTMATARLQLGIYTAFLYLFGEMFVNNHV
                     RPRVAKKAD"
     gene            complement(<238373..>239227)
                     /gene="ELO1.3"
                     /locus_tag="LMJF_14_0660"
                     /db_xref="GeneID:5650267"
     mRNA            complement(<238373..>239227)
                     /gene="ELO1.3"
                     /locus_tag="LMJF_14_0660"
                     /product="beta-ketoacyl-CoA synthase"
                     /transcript_id="XM_001687614.1"
                     /db_xref="GeneID:5650267"
     CDS             complement(238373..239227)
                     /gene="ELO1.3"
                     /locus_tag="LMJF_14_0660"
                     /EC_number="2.3.1.119"
                     /codon_start=1
                     /product="beta-ketoacyl-CoA synthase"
                     /protein_id="XP_001687666.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650267"
                     /db_xref="GOA:Q4QFR8"
                     /db_xref="InterPro:IPR002076"
                     /db_xref="UniProtKB/TrEMBL:Q4QFR8"
                     /translation="MEALDNYLIDHYDGHAVQKWLVNNVDIGVYIAAAYLTFVFKGPQ
                     LVDFIFRGNPPTRLIKMCWTLWNIGLALFSMYGVYHTVPLFINNLRKYGQKDTLCRFR
                     DDEFYTGKNGVAMGLFSLSKLPEFGDTFFLIMGGKRKLPFLSWFHHVTIFLYAWMAYQ
                     QASSIWIVLASINYFVHSIMYTYFALAEAGFKKLVKPFAMYITLLQITQMVVGLYFTF
                     SFISYHKADPKGCNGSTMALARGQCMIYFFNFYLFSEMFIKGYVLPRKAAAGESAAAT
                     APASKKRN"
     gene            complement(240345..241988)
                     /locus_tag="LMJF_14_0665"
                     /pseudo
                     /db_xref="GeneID:12981172"
     CDS             complement(240345..241988)
                     /locus_tag="LMJF_14_0665"
                     /pseudo
                     /codon_start=1
                     /product="putative fatty acid elongase"
                     /db_xref="GeneID:12981172"
     gene            complement(<244332..>245216)
                     /gene="ELO2"
                     /locus_tag="LMJF_14_0670"
                     /db_xref="GeneID:5650269"
     mRNA            complement(<244332..>245216)
                     /gene="ELO2"
                     /locus_tag="LMJF_14_0670"
                     /product="beta-ketoacyl-CoA synthase"
                     /transcript_id="XM_001687615.1"
                     /db_xref="GeneID:5650269"
     CDS             complement(244332..245216)
                     /gene="ELO2"
                     /locus_tag="LMJF_14_0670"
                     /EC_number="2.3.1.119"
                     /codon_start=1
                     /product="beta-ketoacyl-CoA synthase"
                     /protein_id="XP_001687667.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650269"
                     /db_xref="GOA:Q4QFR7"
                     /db_xref="InterPro:IPR002076"
                     /db_xref="UniProtKB/TrEMBL:Q4QFR7"
                     /translation="MFPVEEYVNGHAVQQYLYDNVDYACYLVFAYLGMVRYGPGIAKA
                     ILGENPAPQPAADGRRAKPAADPEWLRLSMIVWNFMLSGFSICGAIVLVPALLSSIKN
                     NGLKSTVCEYRVELAYISPRGSWLAMFVLSKIPELVDTLWLILQKKKTPPFLHWYHHV
                     SVLIFAWLSYSVGNSTMAVFSTMNIFVHSIMYMYFALCACGVKKLLRPFAPLITALQI
                     LQMVGGTALTFYSYAVNVSSYNAGIEDVNKLPCAVPKSAARFGALMYLSYLYLFCELY
                     VNSYIKGPARDTTAKKAA"
     gene            complement(<250240..>251139)
                     /gene="ELO3.1"
                     /locus_tag="LMJF_14_0680"
                     /db_xref="GeneID:5650270"
     mRNA            complement(<250240..>251139)
                     /gene="ELO3.1"
                     /locus_tag="LMJF_14_0680"
                     /product="beta-ketoacyl-CoA synthase"
                     /transcript_id="XM_001687616.2"
                     /db_xref="GeneID:5650270"
     CDS             complement(250240..251139)
                     /gene="ELO3.1"
                     /locus_tag="LMJF_14_0680"
                     /EC_number="2.3.1.119"
                     /codon_start=1
                     /product="beta-ketoacyl-CoA synthase"
                     /protein_id="XP_001687668.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650270"
                     /db_xref="GOA:Q4QFR6"
                     /db_xref="InterPro:IPR002076"
                     /db_xref="UniProtKB/TrEMBL:Q4QFR6"
                     /translation="MVQFLESFRCDNVCQWMADHIEVPVLIVGLYMVMVLYIPDAYMK
                     NREPFDLRQLNMAWNLLLTVFSICGAYYCLPQLYRTIFVPEFTVHDYTNGGDIQWKGG
                     VYNAFCNWNNNIFYDGPVGAFLCLFILSKIPEMIDTAFLVFQKKRVIFLHWYHHVTVM
                     LYCWHSYMYKISGGLVFAGMNYGVHSIMYFYYFICSCGYRKYVRPSASLITFLQIAQM
                     VVGMFTEVYTLHILYFTNRRCDSNATNARLGFMMYMSYFILFSKLFYESYLKPAPPRS
                     AAAKHNDATAVPNGEPAAVKKAQ"
     gene            complement(<254654..>255736)
                     /gene="ELO3.2"
                     /locus_tag="LMJF_14_0690"
                     /db_xref="GeneID:5650271"
     mRNA            complement(<254654..>255736)
                     /gene="ELO3.2"
                     /locus_tag="LMJF_14_0690"
                     /product="beta-ketoacyl-CoA synthase"
                     /transcript_id="XM_001687617.1"
                     /db_xref="GeneID:5650271"
     CDS             complement(254654..255736)
                     /gene="ELO3.2"
                     /locus_tag="LMJF_14_0690"
                     /EC_number="2.3.1.119"
                     /codon_start=1
                     /product="beta-ketoacyl-CoA synthase"
                     /protein_id="XP_001687669.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650271"
                     /db_xref="GOA:Q4QFR5"
                     /db_xref="InterPro:IPR002076"
                     /db_xref="UniProtKB/TrEMBL:Q4QFR5"
                     /translation="MLNPFRYLDDFRGDAVCAWMRANLEIPSVVTVLYIVMVLYVPRT
                     FMKHRPAYNLRALNLIWNLGLSLFSCCGAYYCLPEVFKSLFISEFTVRNFSKGETVTL
                     HGSFYKGVCGWNADVFYDGPVGAFLCLFILSKIPEMIDTAFLVFQKKRVIFLHWYHHV
                     TVMLYCWHSYMYKISGGLVFAGMNYGVHSIMYFYYFICTCGYRKYVRPFASLITFLQI
                     AQMVVGMFTEVYTLYHMYVSGKGCQSNATNARVGLMMYMSYFILFSKLFYESYLRRGK
                     KHGSMVASTGTGHQCKRLLCTGQAVATVKGASDDTLASDAAPSMLAKQVPDVYQVKRR
                     HKYIEVKKKNDTNCKVATDSPDREIL"
     gene            complement(<260122..>261099)
                     /gene="ELO3.3"
                     /locus_tag="LMJF_14_0700"
                     /db_xref="GeneID:5650272"
     mRNA            complement(<260122..>261099)
                     /gene="ELO3.3"
                     /locus_tag="LMJF_14_0700"
                     /product="putative fatty acid elongase"
                     /transcript_id="XM_001687618.1"
                     /db_xref="GeneID:5650272"
     CDS             complement(260122..261099)
                     /gene="ELO3.3"
                     /locus_tag="LMJF_14_0700"
                     /EC_number="2.3.1.119"
                     /codon_start=1
                     /product="putative fatty acid elongase"
                     /protein_id="XP_001687670.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650272"
                     /db_xref="GOA:Q4QFR4"
                     /db_xref="InterPro:IPR002076"
                     /db_xref="UniProtKB/TrEMBL:Q4QFR4"
                     /translation="MELAAPSITVTAASLTASSPSLPNPFMWAHHYITSFKGGKAHQW
                     MCASPHIPLLIVAGYFLLVHAGPRVFSRLLGDKPMPGLTPIVAIWNLFFSIASTIGFC
                     YCAPFLFRVLIMTNRELPGLAPKKDRTTGEWDQHPHVRGGLFTSLCYWNRNIFEDGAT
                     AFWVLIFNLSKIVELMDTVFLLLRHKPVPFIHWYHHASVMLFCWHAHVSGISNGLGFA
                     VMNMLVHSIMYFYYFMCACGQRNLVRPFASMVTLLQIAQMFAGMALILYTTRLYVTHP
                     GGCDTSASSLAFGTVMYLSYIILFVKLFRDNYVLQKRDGRERRLDAKVG"
     gene            complement(<266794..>267765)
                     /gene="ELO3.4"
                     /locus_tag="LMJF_14_0705"
                     /db_xref="GeneID:5650273"
     mRNA            complement(<266794..>267765)
                     /gene="ELO3.4"
                     /locus_tag="LMJF_14_0705"
                     /product="putative fatty acid elongase"
                     /transcript_id="XM_001687619.1"
                     /db_xref="GeneID:5650273"
     CDS             complement(266794..267765)
                     /gene="ELO3.4"
                     /locus_tag="LMJF_14_0705"
                     /codon_start=1
                     /product="putative fatty acid elongase"
                     /protein_id="XP_001687671.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0705"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0705"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650273"
                     /db_xref="GOA:Q4QFR3"
                     /db_xref="InterPro:IPR002076"
                     /db_xref="UniProtKB/TrEMBL:Q4QFR3"
                     /translation="MDILTRHLQAMADAVDFPYMDRWLEDYIDIPIVAMALYLVLVHV
                     VSNTFMKNRPAYNLRTLNIVWNLFLSLFSFVGACYCVPRLYELVTAPAISGLEPSSLR
                     YVANMTPAMRRNIVIPPGFREGVDAVSVRGSLDTSMCVFKDDMYRRNISGLLCLVFMF
                     SKIPEMLDTAFLVFQKKPVIFLHWYHHVTVMLYCWHAWMSPTSSGLWFVSMNYSVHSI
                     MYFYYFVAACGYSKLVRPVAPLITFLQIAQMVVGSIIAVYVFYMDQLGGGCDCRSSNA
                     KLALMMYVSYFILFSNFFRSRYMKKKPKSTSPSTRPVRLYNDCKKYE"
     gene            complement(<272256..>273383)
                     /gene="ELO4.1"
                     /locus_tag="LMJF_14_0710"
                     /db_xref="GeneID:5650274"
     mRNA            complement(<272256..>273383)
                     /gene="ELO4.1"
                     /locus_tag="LMJF_14_0710"
                     /product="putative fatty acid elongase"
                     /transcript_id="XM_001687620.1"
                     /db_xref="GeneID:5650274"
     CDS             complement(272256..273383)
                     /gene="ELO4.1"
                     /locus_tag="LMJF_14_0710"
                     /EC_number="2.3.1.119"
                     /codon_start=1
                     /product="putative fatty acid elongase"
                     /protein_id="XP_001687672.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650274"
                     /db_xref="GOA:Q4QFR2"
                     /db_xref="InterPro:IPR002076"
                     /db_xref="UniProtKB/TrEMBL:Q4QFR2"
                     /translation="METVRGFWDRVNDYPRNFKSEHGRDFLDRYPDYPVYSTIAFLLV
                     VFYLPGYIERHSIRLPIRYLVAAWNLFLSVVSTYGTIQVTMQIPYLLRTRTLHNTMCE
                     LPIADGRDDNLVSRRAAVVYAHQQGLMKRGVVFKWVRTPADIQQRDAALFYDGPSTFA
                     IAMFGYLKTPELLDTLFLVLQRKPVSFLHWYHHIVTAIYVWLSSYMPMPSGIVFCAMN
                     YFVHSFMYFYYFLVMMGLRKSIRPFAPVITLLQVLQMFIGMYITVYTYFQYWLGPEYS
                     NTLFFQFFEVVLSNAYYAYCNAKSIVTTGALASQVPAFDMSDRFWGCDSDPTCMRMGM
                     LMYGSYCVLFAVLFKELYLDKRVHENSLVLARAHCSSDQAN"
     gene            complement(<275534..>276727)
                     /gene="ELO4.2"
                     /locus_tag="LMJF_14_0720"
                     /db_xref="GeneID:5650275"
     mRNA            complement(<275534..>276727)
                     /gene="ELO4.2"
                     /locus_tag="LMJF_14_0720"
                     /product="putative fatty acid elongase"
                     /transcript_id="XM_001687621.1"
                     /db_xref="GeneID:5650275"
     CDS             complement(275534..276727)
                     /gene="ELO4.2"
                     /locus_tag="LMJF_14_0720"
                     /EC_number="2.3.1.119"
                     /codon_start=1
                     /product="putative fatty acid elongase"
                     /protein_id="XP_001687673.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650275"
                     /db_xref="GOA:Q4QFR1"
                     /db_xref="InterPro:IPR002076"
                     /db_xref="UniProtKB/TrEMBL:Q4QFR1"
                     /translation="MEALRAAWDWINYRPRRFSAENGRDFLDRYPDYPVYATVLYLLA
                     VLYLPDLLARRQINLPIKYIVAAWNLFLSVVSTYGVFCIYGHIQDVFSVRTFHNSVCE
                     LLATSGANDIITLRAIRVHAHQQTLIEQRHLPVKWVRSTPEVAKEITSLYDGAAGFSV
                     AMFMYLKTPELLDTLFLVLQRKPVSFLHWYHHIVTAIYVWLSSYMPMPSGIVFCAMNY
                     FVHSFMYFYYFLVMMGLRKSIRPFAPVITLLQVLQMFIGMYITVYTYFQYWLGPEYSN
                     TLFFQFFEVVLSNAYYAYCNAKSVVTTGALASQVPAFDMSDRFWGCDSDPTCMRMGML
                     MYGSYCVLFAVLFKELYLDKRVHENSLVLARKEQQAREDKVKSKMNGNGVTTPAAAGA
                     KPTAA"
     gene            complement(<279453..>280631)
                     /gene="ELO4.3"
                     /locus_tag="LMJF_14_0730"
                     /db_xref="GeneID:5650276"
     mRNA            complement(<279453..>280631)
                     /gene="ELO4.3"
                     /locus_tag="LMJF_14_0730"
                     /product="putative fatty acid elongase"
                     /transcript_id="XM_001687622.1"
                     /db_xref="GeneID:5650276"
     CDS             complement(279453..280631)
                     /gene="ELO4.3"
                     /locus_tag="LMJF_14_0730"
                     /EC_number="2.3.1.119"
                     /codon_start=1
                     /product="putative fatty acid elongase"
                     /protein_id="XP_001687674.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650276"
                     /db_xref="GOA:Q4QFR0"
                     /db_xref="InterPro:IPR002076"
                     /db_xref="UniProtKB/TrEMBL:Q4QFR0"
                     /translation="MEWINTPASFKGSSARNFLDAAPDYPLYAALLYLIIVFFLPGLI
                     EQRGWKFDITYLVAAWNLALSLVSVLGSYYCVQNLFHTIWIEKGFHATCCAQLSVHHS
                     KNFGGKQLRNDYYAPSPDGAFDHSNIHKHNPRITTYTHQLLDKNYDGPRAFYTALFMY
                     LKTPELLDTLFLVLQRKPVSFLHWYHHIVTAIYCWHASYVLIPSGIVFCAMNYFVHSF
                     MYFYYFLVMMGLRKSIRPFAPVITLLQVLQMFIGMYITVYTYFQYWLGPEYSNTLFFQ
                     FFEVVLSNAYYAYCNAKSIVTTGALASQVPAFDMSDRFWGCDSDPTCMRMGMLMYGSY
                     CVLFAVLFKELYLDKRVHENSLVLARKEQQAREDKVKSKMNGNGVTTPAAAGAKPTAA
                     "
     gene            complement(<286543..>287448)
                     /gene="ELO4.4"
                     /locus_tag="LMJF_14_0740"
                     /db_xref="GeneID:5650277"
     mRNA            complement(<286543..>287448)
                     /gene="ELO4.4"
                     /locus_tag="LMJF_14_0740"
                     /product="putative fatty acid elongase"
                     /transcript_id="XM_001687623.1"
                     /db_xref="GeneID:5650277"
     CDS             complement(286543..287448)
                     /gene="ELO4.4"
                     /locus_tag="LMJF_14_0740"
                     /EC_number="2.3.1.119"
                     /codon_start=1
                     /product="putative fatty acid elongase"
                     /protein_id="XP_001687675.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650277"
                     /db_xref="GOA:Q4QFQ9"
                     /db_xref="InterPro:IPR002076"
                     /db_xref="UniProtKB/TrEMBL:Q4QFQ9"
                     /translation="MVRAVLQAMLNIGGLPSRFVGDIAETFFDDYFDVLVYSEVLYVL
                     IVFLGPKAMESREPYRLRYLIAAWNLALSFLSLCGTIGVSIMLMHSLEERGMYETTCY
                     LDKSLYDGELTFWLFAFLLSKIPEMLDTVFLVLTKKPIIFLHWYHHLTVTVFCWYAGY
                     TLIASGVWFASMNYAVHTVMYFYYFLCSLGMRKLIRPIAPFITGAQLLQMVVGTIIVL
                     YTFYYGYISERGCGVDHRTIRMGLCMYGSYFVLFATLFVRLYMKKGAVTKSRKTEKAA
                     AAGRPNGKSVDGVTNGCSGAAMKKQ"
     gene            complement(<288660..>294533)
                     /locus_tag="LMJF_14_0750"
                     /db_xref="GeneID:5650278"
     mRNA            complement(<288660..>294533)
                     /locus_tag="LMJF_14_0750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687624.1"
                     /db_xref="GeneID:5650278"
     CDS             complement(288660..294533)
                     /locus_tag="LMJF_14_0750"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687676.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650278"
                     /db_xref="UniProtKB/TrEMBL:Q4QFQ8"
                     /translation="MSQRITPLTRNQLLELEALVRNLISAVTQQHAQPSATLASVEEQ
                     SWPLSASSTPTSVNHSNSGSCTKVCASTPLSNGGAGGGLCAAPSFPGTVHDAQAPQLP
                     VAAPSDQDDDPSSYLVDGGLSDPHHRLNHPQPDPAAAAPADHAVLHGAFIDVLADPWT
                     ATTWRLYDKIEYIVWWSYRPPSCTKCGMQDAWMPSGDVEFQCAFCLSGAGTTRSNAIV
                     EDTTAAKQDQAGMEDSGDDDDDTGGFAAVGGRPRAGKQPGSSGSGAGGGGPIDAYIFF
                     YEWLQRIPLLGPAGPISAASAGSSGNRLDGAARPASQRAPASSSAHGAGTHAGVFPSS
                     AGGNHRAERHGGTAASNAAGAGAGRGTGSSSSSVLLPAGESLPMVLRAAYDMGTLLTT
                     PGLPRGTAPGLRAAALYLSLLLHRFVSLFPLFCLAGRIPASAATAGATALAAVEASQH
                     RGPHEAAGAEAHCTDVELQWVDVELIGALLGVSVPSFFESTEVSLQHLQNVFTVAAAY
                     GVPSVLWHPGRVPGRVETMKALKEKMEPLCPVPFAAAGVSGLCPEHTAMIVALELARR
                     VDAQPIAVSSTSPAAAAQNAQRIGMWLDAFGLYPTRTVYRDAHSYHQYVVTAEKRQDS
                     GDGAADGDAAQDRHLILASWEKTLTELAGMKDPQLIAAAERHTRRHDGNDDRAKRLFL
                     TTSTSPFYKRFEWILTSPCANALLHVFAAVFRMTPMELADMALRSGIYQGPASGFIAT
                     LRTAVLRGAYDVMPLARRLSPLTSSWMCTYMALHSGDRLPLLTALRQLNDAQNSTRDR
                     QAALTRLVQRVLRKHQAPQVYQLNFVLRVTDEVEKHFNGVYFLSSVLWQEGLAIFTCL
                     RSGRKTITLNRYTNRMSLCYMNAKEKHVDHLSMHVVPPVVAAVETEATRLVMEMALGI
                     STASVGDPWGNVVRSLDKCARVRRRMRVPMLASRLDALASIREHASTVTRQLQQFPSY
                     FGGAGGQLISMGPTLLGYGDAETLLASAPPLDVQQLRRDLQWNYLCLPHVSLLAGLSE
                     DRVVAMYASLVGLLELIHLRLVESAAAASASSTAAALSNWVEELLYVDDEEQRVQAEV
                     DALQQGLDSAAATGWSPPAYRNSHPGTPKLSRSPKSKFLAMSASTNAPLGSASSAFAA
                     SCGGGGGSGVRHNNGRPRGFSPPLARQPYTMTPPSVAPIRSPIPRSSAATSAFTPSHN
                     AVSTPTAHRLRTPPLGCAPNSCSGGGGGGSWRARDVCVADGLPLPDLELAESTADIAQ
                     PTSNLLLGARQQPQPLKGQRCRRRRWGDSDDDGDAVGSDDEDRGLPKAFTDGDGDGDE
                     QQERMLKKRATEANMERQRCDDVMRLLRQALPPYWEVLLGAATDLSASLLSTSGGDND
                     EDEDEDEAESTTRSGRRRRASPQDRRTRRPGPTTASRPTRRGDGGSADTGKGAGALEL
                     PSEALVTHKPFSMFDAEECRRRLRRLYTFISTYERRRIALLQLAAEGKLPKMATAAAA
                     ARSPKLHNGSPLTPARATATAAGVGFSTPLRLSPPPRLVSPLLPPKPVGGDGGTTAAQ
                     RSPPHCQQVSPPIRAAAPQPRQRGEGAAGGGGSPRPSPSLSPVSSSQSSRRSPRRQHQ
                     RRSPPQQSSARLKSAQKSASGLSGSVNPSKQRSGKHTFGDVRGNGAGAAAAAVAVEDG
                     VGDNFALPPSEVAWQESCVRAATLSRGAGVMAGKGTARRAEHVSGGGEQDRRTSPPGR
                     WCDKPSANENGDDNDEERTSSSSSDVEREGDSHGCRQPLSLASSEDDEQQRQTPSMRV
                     MQPQKRWRPSSDREDGDKDADEDHPRRRTESRNGDENTDEASRAEEQHRRKAKKTGRR
                     RRRQEQTLQQHQQRKQVSSRSPLHSHEPSKDGASCSPEVRAGRGRPGSVDSVSSRIGS
                     PGLPPRPSRAEMEVKGSPVTPSQAVPSIRARVKRSAYAAATSAAPVGDADAYDADTN"
     gene            complement(<295418..>296668)
                     /locus_tag="LMJF_14_0760"
                     /db_xref="GeneID:5650279"
     mRNA            complement(<295418..>296668)
                     /locus_tag="LMJF_14_0760"
                     /product="guanine nucleotide-binding protein-like protein"
                     /transcript_id="XM_001687625.1"
                     /db_xref="GeneID:5650279"
     CDS             complement(295418..296668)
                     /locus_tag="LMJF_14_0760"
                     /codon_start=1
                     /product="guanine nucleotide-binding protein-like protein"
                     /protein_id="XP_001687677.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650279"
                     /db_xref="GOA:Q4QFQ7"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QFQ7"
                     /translation="MDNQDDARDADHLRDMESVATAHRMSAIGAPSSSLVMASHAAAS
                     SIVSLGGPSTSLDTDAVASPASAHVASPRPLSTSIGSDAFANAGGALLVPSVVGQHKK
                     FLRTHKVLIVGEAGVGKSNLMHRYCYNEYDPALPSTIGVEFCSREVRIPSGPVGVTET
                     VMLQLWDTAGQERNAGVISNAFYRNAVGAIIVYDVARRESLLSVQRWAAQVTHLARDD
                     CVCVVVGAKLDLLDANAAATSTSAGSLEALQQEADRISHAMGMRNFMTSALSGKGVLE
                     AFTHLILAVDAVQAASLHNNVIFSGRYQTGCSSQVSGASVREAQTQTAAARVPASSAD
                     VTDGAEGLRGWPEGDGASSSLSRVVSTPLVSGYTGASPSAGRMQRQPSSHAKKTLDLR
                     GFGSSEAGPGAYEASPTCGGGRGC"
     gene            complement(<299260..>300450)
                     /locus_tag="LMJF_14_0770"
                     /db_xref="GeneID:5650280"
     mRNA            complement(<299260..>300450)
                     /locus_tag="LMJF_14_0770"
                     /product="hypothetical protein"
                     /transcript_id="XM_001687626.1"
                     /db_xref="GeneID:5650280"
     CDS             complement(299260..300450)
                     /locus_tag="LMJF_14_0770"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001687678.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650280"
                     /db_xref="UniProtKB/TrEMBL:Q4QFQ6"
                     /translation="MVVLLLPATCFSASLAAKAVDDHPVTVHEDAHARSARLASAAVK
                     AALDVKESNAHVLRRQMVREMNKQKWYLLDGDQLIPRDGKKIAHPPPPCEAPLTEAHE
                     ETLECVSSSPRAAQTRVHPGLYSTPAGDHHRDHATAHAPQNAALVKKRQCRTERRAPV
                     TSSHRKHKAMADGAVGSAAATYADAETPRIPLDSLRLVIRFEEEAAAEDNVEVHEHGV
                     GKHASRQRSAPHHSRRSQEHSAHGHSRGRVHRRMRAGSSHVHRGHGASVLLRQPEQGV
                     RSLAAAPQPVIEVADAEHNAIERRSDGGAAAALVSADATSVTSTTLSEEDLWHRCLVA
                     NSRDSKAALMKALQEGRLREDCLIVAAEVGNDIPSNENSAKGAVAMMSLFVSTLFGAF
                     LFAF"
     gene            complement(<301435..>301995)
                     /locus_tag="LMJF_14_0780"
                     /db_xref="GeneID:5650281"
     mRNA            complement(<301435..>301995)
                     /locus_tag="LMJF_14_0780"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687627.1"
                     /db_xref="GeneID:5650281"
     CDS             complement(301435..301995)
                     /locus_tag="LMJF_14_0780"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687679.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650281"
                     /db_xref="GOA:Q4QFQ5"
                     /db_xref="InterPro:IPR001787"
                     /db_xref="InterPro:IPR028909"
                     /db_xref="UniProtKB/TrEMBL:Q4QFQ5"
                     /translation="MLRSANPTIAKALQPLIEGPKFAVVYCGNHQYKVSPGDVIAVQR
                     LRAPIGSQIALKKVLMVGGPRFTAIGRPLLEHVRVTADVEEQKRMRNVVSLFSTPGRR
                     RLRWLDAQHAATILRIREVVYEPTVVGELDKYDGVLLKDFHADRHPNPVFTANDGYDL
                     YYPKDWNKVEEASAFLEMMEAPPTEK"
     gene            complement(<302671..>315168)
                     /locus_tag="LMJF_14_0790"
                     /db_xref="GeneID:5650282"
     mRNA            complement(<302671..>315168)
                     /locus_tag="LMJF_14_0790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687628.1"
                     /db_xref="GeneID:5650282"
     CDS             complement(302671..315168)
                     /locus_tag="LMJF_14_0790"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687680.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650282"
                     /db_xref="UniProtKB/TrEMBL:Q4QFQ4"
                     /translation="MMQKRGDNIIANATPFLARTTTSGAQSAVSSSPSPSVAVGTSSS
                     ADRKKQCASSAPHTLGAAASPRVSSADASAMLVTAIAQYVQHRLTVPAAIDDAAVDEL
                     HSIEKSGARKKLSSPSTSGAACSTALQRVGDSDGDVNAVHLVACTQQVEAYLLRCLLH
                     VELTPGRLPNQPEVIGEALGAPSAATAVGTMEASPQVHRAARRVVTTTSQAASAEDEQ
                     SPPPRHPAASIVGDKNSWRGNTEARSRSQRSSVSAAAEASSSPRVRTSSGGTKAKELY
                     YTYTNQGMPPPQPRPRGGNPAAVASTPPTRLPSRSNSAAAIDTTKNAAVTLPPPADNS
                     EGAPPAHARGRSAFPCTRGGAVRPLHPTEIRAALCSWPSRIAQYVLATTFAEQELRSA
                     AADAGGGADVDAPAAHGAARSDAPASHAHEEGSASATASSRVAEGVEDEAGVVIDVLL
                     RRLCDMLQHTRLAADMGDAGAGQPPSIDFPSFARFYLADGDAGNIVSDSDTDEHAPRQ
                     RFGKGGDVHLYIMQLAQVLLSVLTPGGAGASGFARQDEVDSMGGLALSGDIATDIGML
                     LKHTPLITAPRHPSELPARTPALGIADINAATPLVTARGALWRALRSLLNFSPSSSHN
                     PTMCTTPLVVGLVRRYTSGRSDGSSSGSGGGGDGLRVRFLPVADLIRPAGVTTTAAAA
                     PASDDGLRDRQDAAHDPLRTPIFYTAVFLEVAGEDVLHSTANHEDAVTLEEESTSKVR
                     YEADVPEVYRDRHRRRMEAQNRRGVHYSSSATHGGGVVRGGRSNVNGDAGAPASATNG
                     LEDATALSARDRCLSRRECALWEKLLALAHFVHVSGTPAEVETTARYVTLVIRRRRGA
                     RQQSQRNPLQASSANATPVSIAESAALPSVPAFFFTLTETSALRSAAAAAAEARQALF
                     CNDQDDSDDHDVVPFDALQGALRETGSASSTAAAAGRSNFFGSSGRGLRALLGWGKGA
                     ATAPPDQPVSPSSSLRDRNTDSGIRARPRREAGGPPCRAPPAEPPPPAVQDESTEVLI
                     IDWMHDALIPLFFETTVSGSVAPHQGSAAPAKPSEGNEHDDSHDDESAVAATAGRRRA
                     PYHLRSQRVLLGRVQAVTPSMVYGSFITTASSATVALACDMDAVMEAVVRDGMFDANL
                     LPYLLLNQLFFATDGSSADAAHDTFNSPPSRARSAPVPERTPEHPRSAAAEQQSSQQA
                     AIQSHGLRPIYSLPTSATTAASAHSPNAHARRVSFLENASISTPLRLDTRLPVAEGGA
                     GSPLLRQSPNTPSAISPERSSSIAGSPRSILKSGRRYKREKLIRSSAPAASVVPFRSL
                     FLWRLLAAEVLGSGDRAHGASKQEQQQQSLGNISAVSTTLCTTSAAYLRYTQALAVRV
                     ASDVATGILLAGLLAEQYACYRQLRGHDDQTRRDDSSAVTERDHSSTHRGAAGSEKEH
                     HSSDTPAEVNAEAARWGALRCDDLLPLANSAALAFARAALAPMLCYDDDAPAHLAGVI
                     TEVKSGVDFSDACDEDECKRERRDNPGSDQSSASATSYVDGHRGQRDVSNDGATPHHR
                     RASAPPIISLLSPSLPADVLNRLQTLSVVCLLHIRQEVLESITRPLDVVMRRLTWALA
                     RLHLHALCRPLDDFLRRGSAQGVHTEHQFWQVVREVLDMYGECLMLPHLLADAGAPLL
                     ASEAAVNRHEGGSKTNARAHEEEPSGVSSEEGNVISPLTQHQASATPLSFTAAVPLTT
                     RIGMAIPKLRLSREQQDHHHHHQQQQQQPVVRSSRRGGVGFVPLSFINASFDPAHSSS
                     LLPAQRTVLQPTPSRWSVTRALGGWNPHSVDPDDSYDLQSFAFDGRAMRLTSDAAQGA
                     GCRSSSSAVNSATNDFVKAATSALGLQRSPPFVSLCTHGTMTGSQARVPLEAGTGTDM
                     ATTAPVLGNRFSGSRTSGNANSMVASNSRLCQLVSKHGFEAALELHHGCAGDASCDVD
                     AALPLLLLHTPPRAMEVPAVAAPDTAESRNLGRSPSGIFDFIAVATPHCVATAAGSAA
                     GGYEGSPLCAISSGSDASQRRVQQAQVSSHGSSFLTPTFAVPLLRRLQTVSTKSARDG
                     KDAEEGEEGQPRQSPRTTQQQPQRMAHQGHTPLVGARESGDAVTGAPARPAGASPLSP
                     EGGAEVAAMASGTSVKRLVVHVGRGVAVESPLLSPFVTEAKRMMVETLLLRWVLPWWA
                     QRTLNMEQEVPMMRGKGSDDAHAGGATATDGEAAPNWPAQPLMQRGCSVSPPTTRSTV
                     STAPAASYERRDGSARASAAAASQLTKQMAALQRENAELHGRLCSTQRLLADIHQTCS
                     GLRMAARQYEQAVALQKEERAPTAAASTTAVTDSSLSLADGTDTLASPQQLDLISPSP
                     LSSTPQVVPGKGDVGVGSPRDDATPEKMMATDSAASPLESFSVTLPLADSVPPQLLYF
                     AQTEEGRERVAELCQRIIVLLSGAANVDDNKDNAKSSPPSVIAYGSDLPSRLPSSTSH
                     SFLLHSLSQGMQGSPCLSSPETTSVELAATAVLCSDCSVRRRHSVVSHGPSQLFSPLQ
                     PQSFRRTSTALTLMSLAPAGALAMSNTIAAETPCSTPTPIAVLILGASSDPSTGSSPA
                     RLSRQSSWQQQHMRPLPPSSPSAQSSPPSVASQHVAGPAFSSADVDVQRTILSAYPTA
                     APSHVSPVPLTPKGASPLPRRAPLWNQATPVTPVRHTPPQLRIGSADDVEPDAHTSDE
                     QQHSRTSCFAAPSAGSVGLHDTQVGTPYHDLHQHHGRHGENGNGNRDDRQAPPSTLSS
                     PSVHSSNFARQTSSVLESRGSDVLSSPMPPPLSPPSPSSSKMFSEASSEPPFEVNSRS
                     YENGSAVTTTIVHTDTQHAVLIREDDSDMQDSAAAASAAGSDGGFEAPKDDEGDVVGA
                     VAMAVGGAKLTEKHVEVAEDASCTDHEDNLSEQPAVLQQTVEAPDLQPSLCDISLPLP
                     RVLLAAPLPQPSCRRSPASLGFRRSPEGTLSTSPVTRRVSAGTPSSSIFSSSSPSPPT
                     VQCTNSDVTTNGERHVAASDDETEHASHESDGASCCDGVLPVQRAIANDADEACDAAG
                     QEPISTKAAVLPTCRPSLSTREDANGSSPASASSTGREQAALHALTAATVSSSPWRER
                     APVRNSEAAVTALADLQQRLSGSNSAVVELRQQLQQVEQELREKAKAMTCLTEQLTAT
                     EAALGAAWYAATVAEEKAQQQQQRLSTPSPPPPPRASVATSTENLLLSPSAFSTLSDN
                     ERANKVDSRSVASTPAAATVETVVGESKAAAAPAASIPAATPPPSSADSSPPALRAQP
                     LCRVHELEDELRNANFRMDQWRALLDAERHAHMVQVDQLTRRLESEQRRSARASRSRS
                     RSLSPLVSGAGPLPCAERSARDEARAAQPPAPPPSLESFPPPAAEVPRSSLTTGDGEL
                     PPASPREQQRINTLMEQLHVVEARAAEERTQRVAAEDGIRVLERERRVIREQLEALEN
                     ERAIAQVQQRQKEHDSDQREAALRRELESHVQTLTAMHAAQAGSEELQRHLKGELDVE
                     RRARAAAADSAAAHMATRDRLMRDGEEAQQQLRCERDRALQREKEALAHAAAEAQAAQ
                     LQIAALRQRVESTTDQLRTAEADSREHRHRCIVAETLAAARESAQKALEDRVMVLEEE
                     LSSARAARKQWQQDTDERERALRHQYEEAAASASAAMEAQRRANSEQLQRSEDALHAM
                     QRAQAVRDEGHRTAFEDVTRKLADAEQAAHLALDDLYRERETRERTAAALQEAQSEKE
                     ELHRRFEAVLEKLHLAELDADEHSRQRDCIEALKLELEAARTQQQEAAAKAEDAFRRE
                     VETHMRTIAALQEGRSAHDELRRRLEEELQSEKLARAADTAAHKAALVSAQGQVSQAE
                     QRAQDIADALRREEEAHARTLAAMQAAEEANRQLRRARAAQETHAQQRARSWLSAREA
                     CLLKWIEAKTLLMVDAWGIVGAERQPQQTPSLASPSPTAAGTPPARLERTSERRSRGR
                     GKRHGRPPPAPDAVAPVQAARAGPRAQPEMVVVSVDDPLGLRYELQCKARHIASLEER
                     VHQLEEVHAVDQQVVSTLQKLVAQEEMRNGNGIAAAARLPPPPPPLPMTTASWSSRSP
                     LRTPSRAWPARDPTLMEGHRSPTALLWDPHPGSHSSATSPPGTTERKRLAPNEYRQRY
                     TSL"
     gene            complement(<317815..>319104)
                     /locus_tag="LMJF_14_0800"
                     /db_xref="GeneID:5650283"
     mRNA            complement(<317815..>319104)
                     /locus_tag="LMJF_14_0800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687629.1"
                     /db_xref="GeneID:5650283"
     CDS             complement(317815..319104)
                     /locus_tag="LMJF_14_0800"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687681.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650283"
                     /db_xref="UniProtKB/TrEMBL:Q4QFQ3"
                     /translation="MDLDAFLSKNNKKSSKKVAKKSADEAALGGFGLETVPRVSTAAA
                     KPITVANTGGSDASAAAGTASPLPAPEKTVAAPVVAVNLNFAGTTRSAKTWDAVKASQ
                     DSKRQEEVQAAAARKAKEEAEAAERKAAAGGDDDEVQLPESSPKETKVAKFVARGHRN
                     ATGAIGGGEGGAAAAASGRFAPHTQGLSLENLPTLEETFGNARKPSQSTASQSQSQQQ
                     PMSLPSQEQNGESAPAATPQESSSTPTSATAVAGSNKYVPPSKSSSTMESSTTLPSSP
                     MPTRGSAGGSSAAAYRPPSGSSGVYKPPSMGAYRPPNASAGEAYKPPAPSAPSSGAGA
                     YKPPTPGGASAGAYRPPASTGEAYKPPSSGGAGVYKPPSAGNSNAGAFKPSTAAGFSA
                     DTYKPPVAGSGSSAGAYKPPSAGGSAGVYKPPSKREA"
     gene            complement(<321571..>325518)
                     /locus_tag="LMJF_14_0810"
                     /db_xref="GeneID:5650284"
     mRNA            complement(<321571..>325518)
                     /locus_tag="LMJF_14_0810"
                     /product="putative kinesin"
                     /transcript_id="XM_001687630.1"
                     /db_xref="GeneID:5650284"
     CDS             complement(321571..325518)
                     /locus_tag="LMJF_14_0810"
                     /EC_number="3.6.4.4"
                     /codon_start=1
                     /product="putative kinesin"
                     /protein_id="XP_001687682.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650284"
                     /db_xref="GOA:Q4QFQ2"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q4QFQ2"
                     /translation="MKDVGGASSPLYDNDWDGIRSSSVGKLLRQDGLPLLSNARSVTT
                     ASKRAGSVKPDMATGFRIVVAARIRPFTELEVHQWRQERRVAAEEREDAAAGRNGSTR
                     SASRQPFGSEHKSSNATSLISTTHAGATPSQELRGVPPDVSQASPNVDGVPLPVVEVE
                     SNGRTIVLLNPKRPSLDTNATAPARNAFTYDYVYSSFTPRVELDSRLTGGLAFSSTAV
                     PRAAGGEPYIIDETTENAFPSRASWPQFSEHTPEQERQAEAEQVAIYEQLAIPLVDAA
                     LQGYNTCMFAYGQTGSGKTYTMMGTAQHPGLIPRLCQLLLSQVAMRNAEAHDGCAVSP
                     STRAAAVVLQLSYMEIYNEQVRDLLKQRPKNAILRYRSRFDHKDMESDEFRTLKVRHH
                     PSQGIYVEGLTTVPVSTWAECEAFLHHGNALRTQYSTAINAKSSRSHAIFQFQVTQRE
                     GTGGRVRGREVALETCSKINLVDLAGSERNTQSKTTGKHLAEANSINASLSTLRRVLD
                     GLVNNCGSCNPQALAGGGKVKKGAVIPYRESLLTYVLSDNLGGNSLTVMCANVSPSAS
                     NISETESTLRYATLARGVVNHARLNEAPTALIIREMREQIKAMQEELRKAPNPAHVAE
                     LTEGILLSEQLLREMRGREKKYELRLQSSEAQQEELRKAVASHQAGEAYWRAEAQRQQ
                     EELESLRSALVAITASSSAADAIGDKKARSTGRASKPCHVTPPDRSLRLPQLHQGTAA
                     NGARAAPAPPFSADGRYLDGEAVSATRSPLTAKKKQSAKKHMGLICGDGGIRRDTAVA
                     YAVAADFYSPGARKHKLSVARGTPLSLIDLREQKCRPGAVLPHLRGGSSASAPCKARR
                     ENSGLPPEGASQPLSRRSLSSERSQRFPHPPSQHPQRSRYSNRAPIRRPPSKQNKGDL
                     SKLTTSTTEEEAPEIPLTVGGRSGLSALHNGGGGGVARDSELDEVPSFYQTVTYLTAE
                     GAALEGSSSVATSSCALSLKEGGEDDQVVRAADSSAGRQRPGQQRKPRGLDVLLLQAD
                     VLELQQQRADTPQSSRCNPRKAPEIEGEAATPTSSRRPTNSPGMSEACQAQAVRGRRR
                     SPVDVESGPNKKRTKASQGTDHKYSSSSGAVGEDCRLSPSPSLPAPQQQQASNGGGSS
                     VRGAATVDDRKTMHRQPAAVLPAGEESGEECRYVRISDDDDLKRAFEGESDGDVAPTA
                     SHPRTFSGDDDAGLESGCMSVFEGLTDMIPADSSRGCLGHRLPYATVAAAAESAVASA
                     AAAVAPSPEHALSLLVGRKLKQNGGAQRHAGGSPPSCAHHYSAVGALSPQSYW"
     gene            complement(<326790..>328523)
                     /locus_tag="LMJF_14_0820"
                     /db_xref="GeneID:5650285"
     mRNA            complement(<326790..>328523)
                     /locus_tag="LMJF_14_0820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687631.1"
                     /db_xref="GeneID:5650285"
     CDS             complement(326790..328523)
                     /locus_tag="LMJF_14_0820"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687683.1"
                     /db_xref="GeneID:5650285"
                     /db_xref="InterPro:IPR025254"
                     /db_xref="UniProtKB/TrEMBL:Q4QFQ1"
                     /translation="MDREGSYSSHSTRCASGSVGNQRWSASNRSSGTAVGATGEDFNS
                     LIVAFYTRVYPSADVFADDAAEFDLEDISEAVTELANEVSALQEETHVLGSHVQTLQQ
                     RRPGGGATVSIPNISESAGIQLDAADNSGSGALSPVDTTVFLLGGDYELSMGTSRTSG
                     GGAADTVGSTSGTGRRGRSFRRRSLADVDAFMRVDDKAVLLRQETARLRTQEEKAAKE
                     AEGVHEMLVATVEEAIRRRQELRLEMLQFEREVLRNGGAEDDTAEVSAHRRNPLGDAK
                     KLTVSSAAVATTADELLRYLERRHSTQVSYLDKLEVQCQAAEQDIARAQQLVRQRRAA
                     GEAFQAVDMEQLRIEHKQFSERMEAKNKELAELKGTSTRTVQQLNHLMGQLNELASEQ
                     TRLKREAKSRSEYLSRCGKEIATATAEAVQAESKHMTLKAQQEAVKVPKIEEYMAQKA
                     EEVELQKAVKNLERKVQIAEGQAAVVRQQSRRLQAQRASAIKYANEKHLSRNSTTSRA
                     TASAGATASSRPAAGSARGLLMQRRQQREQEQQPPSLPEASTVEQDGSAAAPAADQPA
                     AAATTATVSSM"
     gene            complement(<329977..>332949)
                     /locus_tag="LMJF_14_0830"
                     /db_xref="GeneID:5650286"
     mRNA            complement(<329977..>332949)
                     /locus_tag="LMJF_14_0830"
                     /product="putative protein kinase"
                     /transcript_id="XM_001687632.2"
                     /db_xref="GeneID:5650286"
     CDS             complement(329977..332949)
                     /locus_tag="LMJF_14_0830"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001687684.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650286"
                     /db_xref="GOA:Q4QFQ0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4QFQ0"
                     /translation="MSYQQLQGAASSSSGGSGAGGRQLSAQQRHAQQSALAASSLLPP
                     PLRSDGRAAAAAATGSASLVASSPRISTAPGHVDTSASGAGFRHPGSASGGAAYDQPG
                     SAHLPVRHHHHHAQPSRQQKIQLPSSSSLARSAGVSGPSTTVSSSLGSAQYASPLSTV
                     GASMPTDPPTSAAVASGAIPVGSNYAYWRGASGIGGPSDRRRRSGSGRSGGGGGSRRN
                     GSPGPRHHTSQAQHLQQRPRADASTAPSSEHPAASSVPETAAALVTSPPSTLPENCSA
                     SSSPSWPQPPLPPPSAASAGSAPLASSGVPVISSHASQPSRRGGNGGASSPRRSAAAA
                     PAIIAGGGGGGAAAGGSASSMPPPPSASGVATSATAGAASPSQKVQGTTSGGFSLASA
                     TSVRLMRPNGEERPTVALSQNIMSVYEAINTLFYQERQLLLTAPAKYAARKYEDAAGH
                     YLPYPGEEIAERYVVREVIGKGSFGTVLHCVDQKYHEAVAVKVIRSGPYFESQGWFEA
                     QVVAHLNNDPALQNLVVQLRKVFLWKGHMVLVFEPLSFSLYRLITLTKYNGVSLDLTR
                     KFAYQMIKVLLVLEQHQPPIIHCDLKPENVLLRDPSRSEVRVIDFGSACYQQQPQWNP
                     PPAQVVLPSTSPSSSSGPPWDSVAEGASGGVKPTAAADDDDSSGPQSPPKGPQQRPQA
                     TAGSTTASTDAALASGVAAPTAEEAGTVKKASDAAPAVAAAAGTATGDDRGGDIIMPK
                     YIQSRYYRSPEVILELGYTTAIDRWSLGCFLVEMHTGVPLFPGKNEGDMVAYFTSILG
                     PLPDYMIAASPKRKQLYYTCPSDPSTNSGGGESAHGVATVGIGPAEDAPPGLTPMSSA
                     PGHAMGSPFFLRTPRVEGEGAAAAAVAGSSSNSPPLSLEEILGVHKGGPRGCRAGQPG
                     HDEAAYEVFCDFIHKLLQYDPRKRVSCQQAIQHPFLEPIRALKSRSVAPPSAAPGTGG
                     GNTEAGSAPPPPLPGPPQ"
     gene            complement(<334967..>338725)
                     /locus_tag="LMJF_14_0840"
                     /db_xref="GeneID:5650287"
     mRNA            complement(<334967..>338725)
                     /locus_tag="LMJF_14_0840"
                     /product="putative DNA excision repair protein"
                     /transcript_id="XM_001687633.1"
                     /db_xref="GeneID:5650287"
     CDS             complement(334967..338725)
                     /locus_tag="LMJF_14_0840"
                     /codon_start=1
                     /product="putative DNA excision repair protein"
                     /protein_id="XP_001687685.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650287"
                     /db_xref="GOA:Q4QFP9"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QFP9"
                     /translation="MADDLASLQQRFGVFQDEEEMRMDVAARVVAQSSREALEDEERL
                     KKSWRELEKAEHAVGKLQLELSEAQLAAAQESSGLLGDAQRNKSSGPATPSPRRVSDI
                     RFQLNAAERELKRADAAVQKLQKEVDQRQAARLAEAKRLEQEDEAERAAADVTRVVRA
                     NSTTGRPVPLASSSSTIPPRANTSVNGGALAGGSLSASSPTVMTTTRVLYRAPTHLKG
                     ITQSDYSGGEVLPSLSRVQVTRADIRSKQRRYQDDSEMQRYVERVTKRQRLEAVAKEQ
                     RRLVALGTDGDAPSQSLSSSIEKLAETRVKAEGEQDGHAHQVKQEPGGDDVAGALTPA
                     AAAAAKARAATKEAEGGERTRRLPRAGVKVETEEEEGAHDVIDVDALMEADDDAAVAA
                     VVSRASTQLTGGYTQRSGKATPSTSLSSQQQQQQRERAGSASSTTVSASEEVVWEMEE
                     ATLLPGVRMDAAIYNRLLDYQQEGLLWLLTLHSRRTGGILGDEMGLGKTIQVAVMINA
                     LHHSGMLRGPVLIAAPMTVLRQWLAELHRWAPYVRSCVMHESSGSDTTRDSLLQSVQG
                     TPAVVITTYAAMRVHCGLLHRTGFQYVILDEGHKISNPEAGATLAAKSFTTPHRLILS
                     GSPIQNSLKELWCLFDFVRPGLLGTMSRFIDEFETPIAQSRNARASPLSLATAVECAK
                     ALQAHIAPYMLRRLKRQVNTSLPPKYERVLRVPLADKQLDQYLQVLSSPAVQRLFAQT
                     AMFGSRNGGLDRDGRDSTGSLHVAGLRANMASRRHSSGVRLESFRLMNQLRQICNHAD
                     IYAVQQGADEEDRMMLARRGAAAKLSAISATRPGQHRSFRSNNPVDLLGSGKLNALLM
                     MLKEWQSFGHRVLVFSQTRIMLDIIENMCEQQAYSYIRMDGATNSHYRQELMDRFNED
                     DSIFVALLTTRVGGIGVNLIGADRVVIYDPDWNPITDVQARERAWRIGQKREVCVYRL
                     ITSGSVEESILRRQLAKMYVTDKVLKDPELQRFFDVQDGFMESFLLGSEYANRVPVDK
                     RYLLAAHHLNSVSAGNRDRARGRDRHAALGEYGNAVPGVDDDDDTDTDMSEGNMGVAG
                     SKEEQPRKERDFGMLVPLKNEDGIDEVGADPDDTGGAEEDGSPVGIPGMGDRNKKTSK
                     GKEVWRETQMLQKLVDCQDVSVAGHDRVAHHLARKKAEDMMRRVSSSALTTEAMREQQ
                     RQYSLLQAIGEKKAKDAADREEKARYYREEIAAAAAAAAAASQKRRHE"
     gene            complement(<341599..>341946)
                     /gene="SMP-3"
                     /locus_tag="LMJF_14_0850"
                     /db_xref="GeneID:5650288"
     mRNA            complement(<341599..>341946)
                     /gene="SMP-3"
                     /locus_tag="LMJF_14_0850"
                     /product="putative small myristoylated protein-3"
                     /transcript_id="XM_001687634.1"
                     /db_xref="GeneID:5650288"
     CDS             complement(341599..341946)
                     /gene="SMP-3"
                     /locus_tag="LMJF_14_0850"
                     /codon_start=1
                     /product="putative small myristoylated protein-3"
                     /protein_id="XP_001687686.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650288"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR015232"
                     /db_xref="UniProtKB/TrEMBL:Q4QFP8"
                     /translation="MSEIKYENGQPGYSGNTVVKCFKDNGNGLLFRIVNDEERKWAFY
                     NDTTNYQMVVKVAFGKDSKIEAIGNTTMQKDEESGEFKCELEIAPTTTEMFIEGEPNG
                     FKISFEANPIAKA"
     gene            complement(343656..346251)
                     /locus_tag="LMJF_14_0870"
                     /pseudo
                     /db_xref="GeneID:12981174"
     CDS             complement(join(343656..344270,344272..346251))
                     /locus_tag="LMJF_14_0870"
                     /pseudo
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /db_xref="GeneID:12981174"
     gene            complement(<347516..>350779)
                     /locus_tag="LMJF_14_0880"
                     /db_xref="GeneID:5650290"
     mRNA            complement(<347516..>350779)
                     /locus_tag="LMJF_14_0880"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687635.1"
                     /db_xref="GeneID:5650290"
     CDS             complement(347516..350779)
                     /locus_tag="LMJF_14_0880"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687687.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650290"
                     /db_xref="UniProtKB/TrEMBL:Q4QFP7"
                     /translation="MERGSNDVAASLLSTELEGDAQLSERLRGGRPKAAAADAAADSL
                     PGRRRASRTQVQSLLEDQRRFALRDDVALPPLYSSSEGVSATDYRVGGVALSRLPDMF
                     GQGALPATALAPPTPMNAALSTSAVATALKDAVLCWGASSSSSATRGGAVGTCRSSVG
                     DSGAVSAPHIRRSWRLIEVTHRSAVPSTSPPYSPANWSVGQRWVRADHVAQVNALAHA
                     VCTEPVMQPARVQAAPLPTGLERSDTDCLYASGLRMCFDSTRSTASFPAFASAASSNV
                     LVRTEVEDRREESAVHGCGCSSLFAASGTLTSASPSSLAFFTFTESEYDAIVLPPPPS
                     TRFTYASSCYLVQLWARFGNPVVTVDRWRWPEGGNEEGGGKGERWVPSVEEVCAEYHR
                     VTAGVLQQRRQQLLDAVQSQQPHLLSESSPALSPTTRATRGGGRKGTEATVNEGSSAV
                     AGGASTTAASHHAHPFVASFDRYALLQRTATAAPAYDAGAAPALSQQALSTAKDRDGG
                     DSVSLLLSQLSPPPIQPSSHGSSATILANACGDSGSLTLDAPPSPPPAGSTATAQERL
                     TALATPNAWFAHDAEVHRRACLARLLRQEQQANVPYQQAANRYLALVAGAAVALQRAV
                     FAFYNRGDEADMPEAPVWEGVAAGDSTDRASLTEADAHLGTSSPSSRRLGRPPRSTFT
                     VQLQPLPRVDPAAWRATEVAVRKAGAEVLGSMSSAAPPSAADAASPSRRPSRSAAAVA
                     GSQKRPHSATAERVATTGKRKGRVAVAKSAPEGVAADALAQLNDGDDEVANSEASAAS
                     ETGSAFSDDEQGLEGNVAGEEGDRGVKMGFTEEQRQPHSTQPSPPKLSSSRPRRSVGA
                     GTAHSQASQLPVDATYAALQAYITDVLPFRCARLRGVVQAGWLLPAPPALPHTLTNPI
                     EEEEVCTVDAQVRGNTSAEIRPTFAFPSSSSAPQQEQAPVTGDTVAAQSLNSALLAPI
                     LTEEEYQQLRKVNTAGVCNRVVSHTDEAVLLSLPSAVPRLHREVEQELERYLYEDTSA
                     LMEVNPIAQSLVDAIRVAYTQNKLLQRFATRLEHVLEGLKKVSEECEEEAQAVPRVL"
     gene            complement(<351868..>353853)
                     /locus_tag="LMJF_14_0890"
                     /db_xref="GeneID:5650291"
     mRNA            complement(<351868..>353853)
                     /locus_tag="LMJF_14_0890"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687636.1"
                     /db_xref="GeneID:5650291"
     CDS             complement(351868..353853)
                     /locus_tag="LMJF_14_0890"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687688.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650291"
                     /db_xref="UniProtKB/TrEMBL:Q4QFP6"
                     /translation="MLLTKEEVQAITLNAKSVHKYADQAFFPAEINEAGKRIGDQPFL
                     NFFVRYHHRHAPEQYSWSRLRRVLLLEDVMTAHKPDTAPVVTSPTIEWRGKIFWICFA
                     VEPVQPRSSSSAAPNETVKEEIVTLPQLSNTVPREDEVLAFCAASANQRPTEVYADGV
                     LGEAPVAPPVLLDSGEVASAAQLVAQDRLPHLEGVESVNQAPPPAAALNPRAFVPTPR
                     QVELLRQYKTQHLAQHQWTEDEIEESKVLRQRYCSMGVATAPVRTVTYMQHHHVEGRK
                     QQQQPRHALGTSSSAGAATRGLNASQAAELDLAEEPASSMAAESGDVFAATHTQRSTL
                     SAVAPSSPSGATSATDTPLSPFLPRSVLRAQQQQHASASLALNQHAPAEDPSSILILG
                     DGASASYSQLSVSQTPPPEMQAQASLHPGSLTALSQHLSQLREAEESFYQYISEDSRS
                     AYLNRLADITKRNSETNTRNRRRGIANERRLERKGNLLESCGLWITDDKERASKAEDY
                     VKAQAGDSSSTRKNDESTTVASAVAGGGAAGDGADTAKSAEDVFVERFKAYYSAQRIT
                     FADCADSDLFADGNDADIGPLLHAAAVVFDASPESDKADSPSSTGAVTEAMRLGRRPV
                     RRLLPNRLRTEESTPALVQAQLVHRSTVRMAKRAREE"
     gene            complement(<357200..>359764)
                     /locus_tag="LMJF_14_0900"
                     /db_xref="GeneID:5650292"
     mRNA            complement(<357200..>359764)
                     /locus_tag="LMJF_14_0900"
                     /product="protein phosphatase 2C-like protein"
                     /transcript_id="XM_001687637.1"
                     /db_xref="GeneID:5650292"
     CDS             complement(357200..359764)
                     /locus_tag="LMJF_14_0900"
                     /EC_number="3.1.3.16"
                     /codon_start=1
                     /product="protein phosphatase 2C-like protein"
                     /protein_id="XP_001687689.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650292"
                     /db_xref="GOA:Q4QFP5"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:Q4QFP5"
                     /translation="MATASKQQQHLGSSESHATPQLVPAPPPVARGGDSYVNENTRLV
                     VSDPLPYSSRQQQRDGNRGSNVNDYTSDRREVMGAARGRDEVRYTLDLNGRRCSDSAP
                     YSGAGTGRPRASSLPRTHEDVKEILPQLRPLREVRHGGDLNRLRSPPPRHSADHHGAA
                     TGYALDSLRTMAPNGTVFADDREREKQREVLSAPPASSTVIPSSYSPRPVADQVRLLG
                     RHQNRGSVHRSNAMATQAAGNPDTRMLRSSPFSSGSDDEGLAPAGGPSAPETAAAAAA
                     AAGAGNGRTAPIETRRNVKGGAAAAVAAAIAQRGITGLGGTISKPVYDKCGATAKKSP
                     YGAGAERPERIRHEARSEAVDADELFGSTQVLCSLRSGAERSDGNTAGARPPPPAVPV
                     TAPSSRMRNCDHSGARCAENELPVYKFNVVLSSGKTATVPISLIAGSGCVQGMRPTME
                     DAHFAELNATHVRGQPVSLLAVLDGHCGRRVADLGAKWLPHYVLHHAALGENNALALV
                     ESILQTDREIFHTLQAKSHGHHQQRAGNSSGRRRRDVDEEVFDEMVSGTNGGSTLIAA
                     AVCGRMLYVACLGDARAVLYDGHTTIAMSEDHKPGNTDESRRIAKCGGFVQFGRVCGI
                     LAVSRALGDFEFKFQPSSSPNATGEEKLSTNFPFGALGENDSSGPAAPSPSSHNRRFI
                     SNRDLMVSNIADVRQLHLTDASAFLLLACDGLWDVLSNEEATEFVRDFLCYTPDVCDP
                     HIFSGTKSRPSPDVVQRVLNNCCQKLAEFAVDRGSMDNVSVMVLFFHDVVDTVARFSG
                     RVPSSANAGEATSSAASQPHALHGTGRSHPRKSVQSVFELTNKQLKVRNGRIVAQR"
     gene            complement(364853..364961)
                     /gene="LM14Cs1C2.1"
                     /locus_tag="LMJF_14_snoRNA0001"
                     /old_locus_tag="LMJF_14_snoRNA0004"
                     /db_xref="GeneID:12981166"
     ncRNA           complement(364853..364961)
                     /ncRNA_class="snoRNA"
                     /gene="LM14Cs1C2.1"
                     /locus_tag="LMJF_14_snoRNA0001"
                     /old_locus_tag="LMJF_14_snoRNA0004"
                     /transcript_id="XR_002460098.1"
                     /db_xref="GeneID:12981166"
     ncRNA           complement(364855..364961)
                     /ncRNA_class="snoRNA"
                     /gene="LM14Cs1C2.1"
                     /locus_tag="LMJF_14_snoRNA0001"
                     /old_locus_tag="LMJF_14_snoRNA0004"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460099.1"
                     /db_xref="GeneID:12981166"
     gene            complement(365151..365262)
                     /gene="LM14Cs1C1.1"
                     /locus_tag="LMJF_14_snoRNA0005"
                     /db_xref="GeneID:12981173"
     ncRNA           complement(365151..365262)
                     /ncRNA_class="snoRNA"
                     /gene="LM14Cs1C1.1"
                     /locus_tag="LMJF_14_snoRNA0005"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460100.1"
                     /db_xref="GeneID:12981173"
     gene            complement(<367392..>369212)
                     /locus_tag="LMJF_14_0910"
                     /db_xref="GeneID:5650294"
     mRNA            complement(<367392..>369212)
                     /locus_tag="LMJF_14_0910"
                     /product="putative glutathione synthetase"
                     /transcript_id="XM_001687638.1"
                     /db_xref="GeneID:5650294"
     CDS             complement(367392..369212)
                     /locus_tag="LMJF_14_0910"
                     /EC_number="6.3.2.3"
                     /codon_start=1
                     /product="putative glutathione synthetase"
                     /protein_id="XP_001687690.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650294"
                     /db_xref="GOA:Q4QFP4"
                     /db_xref="InterPro:IPR004887"
                     /db_xref="InterPro:IPR005615"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR014042"
                     /db_xref="InterPro:IPR014709"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="UniProtKB/TrEMBL:Q4QFP4"
                     /translation="MPATTKKTATTVTGAAVSNDVLEGLPSEEELAAKCLELGLAIHQ
                     PDTYEITHPALSLRPFPMKADVLRQLYDRQLLWNEAINRTSRNFEFLRDSMKSTAESD
                     RSFTGRLLAILEKVYMTTPVGAKAPVYQPFMLGILRTDYMSSVDPESGSHLSSTEVSA
                     AAAAGTARQWKNIEINTISCSFAGISPLVHKFHAYLHKFREAFMNVGDAAVVESTKAA
                     SLATPSVVAASPRQRESAYVTDEKHNSTVQVSAALAEAVAVWRNAVPYSSFLRQYHQR
                     TGVLLKPIVLAVVQENELNTADQYRLLLELLETHGVLSLRRTLAQLHETMRLEHATLC
                     GNERDRSTETEEVLSEQLLPPFAVVDEKYVVAVAYFRSTYVPKDLPTETAWQTREQIE
                     ESNAVKCPSVPYHLMTFKKMQQLMSNVSEVLAPVSFAGNQQKAAALAEHFAPQYSLNS
                     DEYARLAANRQRIDEGKVISDPEYWIADAVLHPEQYVLKPQLEGGGNLIAGEPMQRML
                     RDVTSDDPLYQKIRREYILMRKIDYPVATGVFFQKNSIHVEKNACSEVGIFGVILSSD
                     ANGYIMNQAAGTLVRTKPADAADGGVIAGVAALDSVQIIS"
     gene            complement(<370124..>374770)
                     /locus_tag="LMJF_14_0920"
                     /db_xref="GeneID:5650295"
     mRNA            complement(<370124..>374770)
                     /locus_tag="LMJF_14_0920"
                     /product="putative mitochondrial DNA polymerase I protein
                     C"
                     /transcript_id="XM_001687639.1"
                     /db_xref="GeneID:5650295"
     CDS             complement(370124..374770)
                     /locus_tag="LMJF_14_0920"
                     /codon_start=1
                     /product="putative mitochondrial DNA polymerase I protein
                     C"
                     /protein_id="XP_001687691.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650295"
                     /db_xref="GOA:Q4QFP3"
                     /db_xref="InterPro:IPR001098"
                     /db_xref="InterPro:IPR002298"
                     /db_xref="UniProtKB/TrEMBL:Q4QFP3"
                     /translation="MDDGDIAYDAAAGANLGEAEQVGRAAEVREETDYSAVDSEGVPP
                     PADTAAAGSTPAHTSALPCIGNLLDFESPLNLRLATLTRQHGKAFRAIAVYLPDTRVT
                     VNFDITFEDIASGARLVCKLNEIKSRYVEWISLFRASFVAIFVPTLQSPSVALLQNAI
                     GLSRPARPPPPAGSYHPRLNEDPDHLFFSYAKLREVISRKKKDKELNPQLLTVAVLNA
                     YAEEWKNFIAAPLSCAPQSFLLAAFNFQSRSGDMSAGAMLNKELLQAQLAAAADAIVL
                     YSSTSGNQATRRRTGAVAASLAATSSGLLRSDKDRWGLIFVSAPARTAAGTAAVPPMQ
                     DLLTGQFVQPLSLSERHLIYIIGTGSAAECFARFPLARKGKCAFSILLQDVESQLGLE
                     RPHRLNLTSMLTQALDSFSRITWMGLMKEENGEPHMPHPSSAFYRLQRRSVQREIMPS
                     FLEPVFAPGPRLMGGGAGGKPVDTMSRPIRGGAPNGAAGRGGASVRDLRATAQASRLL
                     EEHIQVIYNSHERLDREKALQEAMRSRVAYFMHVRSASVTAARRADNPFSARNGMVDV
                     SGQLWTSLNLMNPPAVRHWRAKIEDRTGEVKEFVDPEVVLPDTLPIGPPDAPDPKNRA
                     ENAILIGWDIKRILLFLRRSVRLRTFLYNGGKIWCAQYAQYLLKGFNNLHLATMERTL
                     LQYHDGPLKGSMQPLAKLKLIYEMQLEVAVSTRQMSSVQHRMDGLLASMEMELQGLQL
                     VPQSQVTYFANTLRLEHERLEKVLHHKIMDFTQSMDDDVRQRINFRSPQDISTIIYGG
                     GLCRHLGSRFIPVKPTRYPATSLFPHAVCHVTGTKAPEAYTQADALLGGNGGTGSGGP
                     SSGSAITLNDAQRSLQTIQQLCKRCTMDALIQQTAVVVVLCKVKIGGWMEQISLYCPA
                     VTDPEAREMNLRVAVDDIIPVAERPDVVTVTQLKERIAAYEPLKQLLAASSAASTGEA
                     KVPTTRKSGGKRTRQGGRAAGDGDIAADLRNILILTNCAHDKLESLVDSGVLEAIKKA
                     VFDGQVDGVGADGEPASLERVCFADVTKAFPPPPQGADSFESDFSELRSSNATTFSAR
                     CTWEAHAKELVSLGGVEGAVKSIVSQCASVVGTPRDAFRSSQPTPSSAPQGLHGQERA
                     STAGMLWMVTPAKLHPLLRRFLRGKSASSGADAMERVTMLLSPYKTIDLSFFSALQQL
                     RFTEKKLQLFEEGCLFRAVLPECHDRVHGELCHCVTATGRLSSQSPNLQNIPKEEDLR
                     RLIVSRFSAQGMMIEADYSQLEVVVLAALCRDPRMMQELRDNIDFHCLRVSLMTKEPY
                     EDVVRKAKVEKDPQYIQLRQQAKVFSFQRQYGAGVSTISTTTGLTEQEVDRLIVAEEH
                     HYKELSKYYSLVTRCVEAGADRLLRLRTLDTSLWNANIRRVVMLTEPMYYFVVPTGSK
                     FDFTRDRKSVPRLKNYPVQGLAGEIVQIMCGAIVREFYRKRNYGEKAFLVNTVHDCVW
                     VDAHKCVADEVCADLARIMGHTQEAIAALWPDMKLDVPFKAEIHSGPSLGELSV"
     gene            complement(<377768..>380353)
                     /locus_tag="LMJF_14_0930"
                     /db_xref="GeneID:5650296"
     mRNA            complement(<377768..>380353)
                     /locus_tag="LMJF_14_0930"
                     /product="putative immunodominant antigen"
                     /transcript_id="XM_001687640.1"
                     /db_xref="GeneID:5650296"
     CDS             complement(377768..380353)
                     /locus_tag="LMJF_14_0930"
                     /codon_start=1
                     /product="putative immunodominant antigen"
                     /protein_id="XP_001687692.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650296"
                     /db_xref="UniProtKB/TrEMBL:Q4QFP2"
                     /translation="MASVSNLTTAPAATGKSVLKTMVAIFKEEADIPRVLGESEAFIA
                     YTLKNRRAIRLICRANNERGAFRLHESPVHDLRFVNFHSNVAASASSSDFYVWVAVFE
                     RGGTGHGASDKAATTEGRLTVKPYFKLVDKVVINTFHFFINPANNMPDLLVLYGKTAA
                     VLESSKLISEYSTSMLEAKLSAASRELRQLPQETSLKSMCTTFSGSWLAFTSEATKVM
                     ACTLRNTTTPAWSGCEGDEIVQLSFVGSNAAAAGDSAAAPAADSSTALLAVSSKTKVC
                     VWKLTGVAEPALLRIFTFGSIVTMLTSRNAMSIFNDNGKLARVQVRGDDDFDTTVYDM
                     GGAVRPTSVCYHESTRFATVLVDAVKELDLYQLATNTASPSVSSPTSAPVKETTAGAA
                     APVPRSNSTPFVDPSIISTGIPFRPAASSYAAAPVPASVSSSAPVGSASPPANATSST
                     ATNANPITAMAAYNSARSALQNATLPQSLDGLVASAVYQGDEALRRAIDGLLNVVKNV
                     TQILLLTPDQLTRDHQQLVSLALEAQMTELQQTASASAAAAAPAVPAAAATNSRHSEA
                     FNSYALAKLLAPVASEIATGVTRGVRDTLRTELDAAVNAAFNLSIRVNQKEVLRRRLE
                     EALQETPRTLGENAAKWIDAYVERELSESLARMNASMSALEEENRKLQAALTQIMNSG
                     AVQEVEAMRAELAALRAAIRSGEAIGNNGAAAGAGAAATPSPQTVIETAEKYMKEGRI
                     SQGLSYVVMAQNARCCVQLLDRLSEDDVARVVSDAETAEATWVKLITQMCEQEATETA
                     EELEKVASFLFDVLSEHDEVIAKKTAKAQQVRSDVRHLIARARGKIESSDARRVLKDL
                     EKSIQ"
     gene            complement(<383038..>385662)
                     /locus_tag="LMJF_14_0940"
                     /db_xref="GeneID:5650297"
     mRNA            complement(<383038..>385662)
                     /locus_tag="LMJF_14_0940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687641.1"
                     /db_xref="GeneID:5650297"
     CDS             complement(383038..385662)
                     /locus_tag="LMJF_14_0940"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687693.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650297"
                     /db_xref="UniProtKB/TrEMBL:Q4QFP1"
                     /translation="MLLVSASSFRGTQHGAHRHHSAHHQSSALYGAGTTTPDTSNLYQ
                     SLGSINLTVSANSNNPYVGVRMTPEATLLQPQSVAHGRSAEAGPRTAVLEINRHLSFY
                     DAQPLDSSLSRESTKHETRFREAQQPWMASTLPMQVVPVYAHGSRHSNQQSSPVAAAL
                     GEANRNPSGATRAASEGYASMTNRPPGLMPTVINQVERTYLEPRSPVLTQQQQQEPHS
                     LPSYNGTPHEGWVRDYSPHSAVQQQRAPPQQRSLHTSPSYAAAMPAAGSTTISIRGTS
                     ANDASRTRSAACDTTRQFSPLPTIGFAVSPVPLVEMEPALDDYSSSSLTKSIADDDLQ
                     RQQATILAPSPHRLNTAVSPARPRCATQSPLATPPFYGDACACALDSTQTGLPSDTVP
                     QSAPVSCGTAAAPLYSRQHISNDAGACLAGAEKVQGNSDVHLPPQHSYGGASPAKGVP
                     TQTLAEAGASQGRPLPWVQLMPAAATNDKSGAVQPPKECHPLSDAPAYRAQGENDVDD
                     TDEDGKGGGDDEDGSLTAPDAAQRTKKRVRRNRKPKALEDLPPVTSMRYLPPPPPPPP
                     ALPTQPGPTGAAANDVSSSSAFDRYYAVLLRWYTRLLADEADFVEIATATSFDAGTAV
                     AAMSAVARQARDGSYAEDDKLSSAGPLQHLDSGPISLPMSSISPSLMSKPSPAYFGSS
                     GGGNGSNAEVHVRCPRIEQYMDACDIPAELRLFPTPNTTGTQATGAAPAALPQSVKDV
                     PSAVRWARDLEMWWFCYVFPHAAHTRHQSPAARPQMQPASMSPRGLTIPHTGSGGVLQ
                     NYPYGWSTTMPQPMMMMNSIPEVYGAHDSAAMGSGHPTIANRVCSPVGEHMPMQHQMP
                     PPPPPMPSGYSKGLHSIY"
     gene            complement(<388233..>388739)
                     /locus_tag="LMJF_14_0950"
                     /db_xref="GeneID:5650298"
     mRNA            complement(<388233..>388739)
                     /locus_tag="LMJF_14_0950"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687642.1"
                     /db_xref="GeneID:5650298"
     CDS             complement(388233..388739)
                     /locus_tag="LMJF_14_0950"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687694.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650298"
                     /db_xref="GOA:Q4QFP0"
                     /db_xref="InterPro:IPR000114"
                     /db_xref="InterPro:IPR016180"
                     /db_xref="UniProtKB/TrEMBL:Q4QFP0"
                     /translation="MQSSALRPSSLLRAYHYVHPKTGRPIRQYRKYGDPRFINNEVAL
                     IKGLFALITTDFGMVTQSQLENARLAILRRMPRGSFALTMHTDYEEFPVVQKSPESRM
                     GAGKSNIHHFAYKFTTGVPLFEITALSSRRLNQAEAEGIFLAGRSFIPLQTAVVPRGR
                     VDEYHVFK"
     gene            complement(<390070..>393417)
                     /gene="3'TUTASE"
                     /locus_tag="LMJF_14_0960"
                     /db_xref="GeneID:5650299"
     mRNA            complement(<390070..>393417)
                     /gene="3'TUTASE"
                     /locus_tag="LMJF_14_0960"
                     /product="RNA editing 3' terminal uridylyl transferase 1"
                     /transcript_id="XM_001687643.1"
                     /db_xref="GeneID:5650299"
     CDS             complement(390070..393417)
                     /gene="3'TUTASE"
                     /locus_tag="LMJF_14_0960"
                     /codon_start=1
                     /product="RNA editing 3' terminal uridylyl transferase 1"
                     /protein_id="XP_001687695.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650299"
                     /db_xref="GOA:Q4QFN9"
                     /db_xref="InterPro:IPR002058"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q4QFN9"
                     /translation="MSKYSLLFNQAAKDGTDASSSSGGSTSSSAQASTTNASSPGPLD
                     SAVPSPATATPPRRRLIHRRRGCVGAAEASSLSLPEPPQQPHQEGHENVMSDSVHHGS
                     SSGITESGSNVLATPGSGSVTSAAPDIAFKVPSPPVASASPSLEGTAALESDGDVVID
                     DMIKDQEGNSDGSTGATSAAAAGHVLRSDGDSPLTSGGPDPLPPAASCSSASQHIPPR
                     LFTCDMCLHYVSTSYEALEQHALEQHGDALADYTRLRSVAEKLVPVWGEVLQRKASVV
                     QQWGERIFAVAVQRDAGAEKMAEAHRARAQLELVVQRWHPRAKVFIFGSAVAFGVWDG
                     ISDIDFTVVDVEELEAGTWPPSEKNAVRSITELLRRAGFSFINLEPISHARVPIIKHH
                     ASLPIRLTDEQRHRLHEEARQSAAAVDLAAAESLPSSSPSSAQETPAEKDHTQLEAEL
                     IIARSVRYSFNLPAGPPDSAILEASVRLAVGSAAVQQVWWNRTRDMCCMTFDTTTNAV
                     NASTCPLHFTSAGMRARVQPLHEECRPELYGMDFDLSFRAFGIRNSHLLRRYLLSHPC
                     ARPGALVLKDWSKTSGVNNSVNGYLTSYAINIMWIYYLVHRGVIPYVCPTRDIPASLR
                     RNVDADPQYAAMVDPAWTPEERAAMEAQAGELLLGFFYYYAFEFDWANHVVSLNRPGV
                     TTKAALGWDVEDVAQASGSVPHFGVTGWQYQHNLAGAEGQHGDAHGGTAPAASQTRPS
                     VGHDGMLASNASMSARRSRATTRYSFCIEDPYEENLNLGRHMGVTKTLRVHTELYRGL
                     LSLLKDDLQHCCVFAASVNSSGSTGSNAATVSSAAEPATAAAKTSAEPTELPVRVLYK
                     LMAVSTRELAMARRRHSAAVTAGAEFPGVWLSDLEAAFLAQAPTEWKLATQVWNKHQL
                     LHRLGLKLHAREYVLPRREVGVRRLAAKAPPGVVLASTPEPTFNAEEVAAAAAEGERA
                     PSSTEHAPVSSAEVTQMNQAFLGALPVRRLPEDLLLAMTKGYSCLTPSWVAWTKPWAA
                     LSAWWTDRLHSPSTTPQSEGPLASGASEQGGVIPSLPPGAPRHISAMPEKSAGAMHQT
                     RTKLRRHVVAETASVSAGRRALRMLFR"
     gene            complement(<395440..>396303)
                     /locus_tag="LMJF_14_0970"
                     /db_xref="GeneID:5650300"
     mRNA            complement(<395440..>396303)
                     /locus_tag="LMJF_14_0970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687644.1"
                     /db_xref="GeneID:5650300"
     CDS             complement(395440..396303)
                     /locus_tag="LMJF_14_0970"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687696.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650300"
                     /db_xref="GOA:Q4QFN8"
                     /db_xref="InterPro:IPR006083"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QFN8"
                     /translation="MSALHDKLVSSEELACAVQRIVSVYERQQQNLRHTNPMVREACV
                     PRVLVAVAGRPGSGKSTIAALLADAVREALSDQPDPMAPFRKVDINDAEMNSNASDDC
                     AGAGSGRGVEVYVMPMDGYHLYRKELLAMPNAQEAVRRRGAEWTFNPSKLRDDLVSIR
                     TPNERGLYDDVFVPSFDHAVGDPHERDIRIPGSAGVIIVEGNYVLYRGTPEWAAVNDM
                     FDVKLFLACDRDVCMARLCQRHMKAWGISRKEAMVRASGSDTINGDLIDTTILHADVV
                     MHSINASESKL"
     gene            complement(<401742..>403682)
                     /locus_tag="LMJF_14_0980"
                     /db_xref="GeneID:5650301"
     mRNA            complement(<401742..>403682)
                     /locus_tag="LMJF_14_0980"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687645.1"
                     /db_xref="GeneID:5650301"
     CDS             complement(401742..403682)
                     /locus_tag="LMJF_14_0980"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687697.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650301"
                     /db_xref="GOA:Q4QFN7"
                     /db_xref="InterPro:IPR006153"
                     /db_xref="UniProtKB/TrEMBL:Q4QFN7"
                     /translation="MPLAHEIHHLNEEDLVYIADVTHIMANRDLYSLLPYTGSNWFLP
                     SIRECGEGEKHWEMRWCWKEGLIVAIGGRRLSIRALNIFIRVCFVALIWFLLWNMLPC
                     WLVEPGGYVWDPLVLVIVSAIVGGLICRILQLPPLVGVLWVGIMWNNIPTLKYLTHGI
                     VKEVFDISSKLGLTVILARAGYKLAIKDIIPHWKQTALLATMPFVFEGVSHSLIANKI
                     FDYNDNYNWAFLQGMLCSIVSPAVVVPGSLYLQDMGYGCGVGPLSLMLSAVGIEIVIG
                     VWCANFIIGLIFYDQKLAVAIVLGPVQFLGGIIIGIGLGILFFYVVELIKQEAHRLPN
                     GKYTRAHLNSCMDFAFGIFLFECYAMVFFGYKMNLAGGGCVMCVFFSATVAHMWSRTR
                     TMEHEDHKKYVATWLALCWDQVMMPILFATMGAKINVKAIFNQTFFPRAVICMVCSTA
                     VRFTVTFLIQIGSDMPWKEKLLVCVGYLGKASAQASMGPIAANLVASMIAALPPGKKH
                     SLDTMAEYANNVQQISAMYVMFMAVVASLGLVRGGKLVLKGDQTVGKSRDKRASGSSS
                     SGAAVTGDIIVAEMDTTVAENASQHAHFPDGASADQRQPSVSSSPAKDHGALLPRTGQ
                     IEDDRVTRNSFDRRREHYSSIA"
     gene            complement(<405655..>406785)
                     /locus_tag="LMJF_14_0990"
                     /db_xref="GeneID:5650302"
     mRNA            complement(<405655..>406785)
                     /locus_tag="LMJF_14_0990"
                     /product="ADP/ATP mitochondrial carrier-like protein"
                     /transcript_id="XM_001687646.1"
                     /db_xref="GeneID:5650302"
     CDS             complement(405655..406785)
                     /locus_tag="LMJF_14_0990"
                     /codon_start=1
                     /product="ADP/ATP mitochondrial carrier-like protein"
                     /protein_id="XP_001687698.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.0990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.0990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650302"
                     /db_xref="GOA:Q4QFN6"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q4QFN6"
                     /translation="MSAHAASPPAAHQEQQHQAPQAGRAGRDTPYGQYGGGQEFQLTA
                     TDMAVDMLIRAVFDLFQRSMAAPIDRVMVLTAVEGELVRQGRLPAGGFRGVGQLYSRL
                     WRKEGLGGFLRGVMADAVLTLPSGFVDSFATNAVFVCLQRLIPARMADQMSTSVIVAL
                     SMAATSAAVWVATPYNAIRKTVMTNYMADIVAPAGDATRALCAGGEAATAKSGGTGRA
                     DADEAEPVSPLQEEAYRYTTATETARQIYRRKGWSGFYRGAAVEPLTVCTYRGLYLIA
                     SVMLSERVQMTYPYAVARGLAIVADVLTQPLEVVSRRLVLTASDEKDERRYAGVMDCA
                     RTIVREEGVTALWSGLRFRLMVSVASVAIRTVFVMVTDAADV"
     gene            complement(<408925..>410235)
                     /locus_tag="LMJF_14_1000"
                     /db_xref="GeneID:5650303"
     mRNA            complement(<408925..>410235)
                     /locus_tag="LMJF_14_1000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687647.1"
                     /db_xref="GeneID:5650303"
     CDS             complement(408925..410235)
                     /locus_tag="LMJF_14_1000"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687699.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650303"
                     /db_xref="GOA:Q4QFN5"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q4QFN5"
                     /translation="MSAAAADYPLRRGGDVEDDVDDEERRRLTESSIKAFLEEEGVPV
                     RSSVTVEDITSALVALANSVATASACLAVKVALLRLDCLTAVEGELRKDATRASSSKV
                     RVTAEKSPSPRMTRASAFGWLRHLHQEGKGVCGVLRGGKAELGFVLASFVEEALLFAA
                     MRSLMDRLGPLLPSENGRAGGAAALWWAGLSRTVAPTFVMSLLSWPLRAVRTTIRVNY
                     MADTSLPVCEPSLQPAQQQGEQQQRRQHRYTSATEVWGCVLHRMGVRSLLLNGLDVDF
                     ASRALSLGLAWTVVKPASRWMQRWAMMSASTAGAASAPLALVRLGQHRLFALGVLLAV
                     AGSVNALQRPFVVLRQRMALLPVADAESVCNGDDDQTKTPPTARRGCRYANGWDCAVQ
                     VWRQEGVSGLLAGLPLCLITSSVVPLLRTFAGYPTAPSFSGAVV"
     gene            complement(<410619..>413705)
                     /locus_tag="LMJF_14_1010"
                     /db_xref="GeneID:5650304"
     mRNA            complement(<410619..>413705)
                     /locus_tag="LMJF_14_1010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687648.1"
                     /db_xref="GeneID:5650304"
     CDS             complement(410619..413705)
                     /locus_tag="LMJF_14_1010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687700.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650304"
                     /db_xref="UniProtKB/TrEMBL:Q4QFN4"
                     /translation="MSSALQFRRRLLPSSQAKVFVLQRSDMQRKDVVIMALRTLRRWV
                     SSLPPPAAPPSPLAPAGHLSTDSESDSGRTPATSHSGVHSINAHVVTQFFAPVESGSW
                     RAQGRFGHRRRRRHGAATSGKSSTECIEAATSRSASGVDAALAVNDPACMRAEPPCAS
                     PLLHTSARDAHSAMSPVQQRLCQLIGAGAWREALEVLRCHEQQNPTATHHAQASRQAS
                     SASGLHLHRASAPAAAEDADDYAVIPFMFVSLQEVSVWLLLWCGHGTAAWHVWRRIMQ
                     AVSMPSSPRLALLLALFTYVVERDTMRTRDMLLLLEMMNSSATTPPSEVKIGQMCEEN
                     PAPPLRVWRHLFWQWLWCCNECTDPSKSPSQAHRHCLASFLEGAVGELTKFAFWSSAT
                     PAGQHMGAMTESVALLLLALRDVYSTSDEWQRLLKEELTTVCDGKRKKMSSNSCRSAS
                     AVWWEGSQEHPPLLSPSVCALMSEVVEFLLVGSSSTADDVRRDDGERADEQGHMQLRT
                     IFSNAARNLKRLRGHCSSAVPENGGDALEAFRMWHERIVENEGLGGTWEALRLAMRSP
                     PAQSCPFRLGQPTTPDDAAGISLKWLLQRIDDATAQGDWTTALRLCLNYSFPEGRSCR
                     EDTDSSGVETQDLVLEAVKGPSRCHPSTSTPLPADPFSFFHRLGKGLVACEVARPSGA
                     SWQGALALWNFARQSSHHRAACASPSDIAVVAVTRSELLHIGPRPPGPAPPLLSLSRA
                     LGRIFFLLASAGRWAEALGCFHETPDVYLDGFVVSQVAYALRDCPSQSRAVLDLWAAW
                     RCRVGDAVDPTEMMTYRLLNAMLHTSVKATSPVASLSSPSYQSPAMVAAKVATAVLIA
                     AADTSPAAPSTLATDARHAAVTPGTAVPLDWSRRRCTIRGVVADRWVGSWADALRVAL
                     ASCDVSLLVQTVLRCAPAAHSPKLYSDVRRILQEKGVVLSPAERATLLALWGEGRRSR
                     LSCDSGVGAGKGTSPAGEAVPSNGEGGGARQHVLETEAFLDELLGLDLASRKEAKD"
     gene            complement(<415156..>416100)
                     /locus_tag="LMJF_14_1020"
                     /db_xref="GeneID:5650305"
     mRNA            complement(<415156..>416100)
                     /locus_tag="LMJF_14_1020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687649.1"
                     /db_xref="GeneID:5650305"
     CDS             complement(415156..416100)
                     /locus_tag="LMJF_14_1020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687701.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650305"
                     /db_xref="UniProtKB/TrEMBL:Q4QFN3"
                     /translation="MTEGRLETIHNLRPKNWDNRRHWTNWHHLYDCEQDHITRESAPF
                     HDLRAGGQFQYEYAGGGPYAAPIEPQHVNDRSAGDRMDFALGRGTDMGGMGYLPLDTD
                     PGRPVKPNNVPRQTALFTRKDPLKRGLFSEYPYMPEGDGDGTGPSPRTGVMKAGGPCD
                     YLGGAAEHIPDPYNDKPNRGRIWHFRTGPVKHDYPKWMPQGEPERKPRKTYGPFRAGK
                     PDHLHIGGDVEWIPDPYDKGPIRNNRHPFRTWHTRTKWSMPVHAPWSTGLATSEARKG
                     AELDLTENSLPSLKTYRRANHTQTIGAEAALSSMPPRM"
     gene            complement(<416807..>418324)
                     /locus_tag="LMJF_14_1030"
                     /db_xref="GeneID:5650306"
     mRNA            complement(<416807..>418324)
                     /locus_tag="LMJF_14_1030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687650.1"
                     /db_xref="GeneID:5650306"
     CDS             complement(416807..418324)
                     /locus_tag="LMJF_14_1030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687702.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650306"
                     /db_xref="UniProtKB/TrEMBL:Q4QFN2"
                     /translation="MIGLKSMAGVRDVVRGGSWPARLLDMFTSRAAQESFEFEAVVTD
                     ACAAANVPVPSEADLPHARWWKKLCRACQDKAGTTKHGSQLLRSRLTNALTQRLAVEE
                     VYRLNGGEIAKEPAVENPIVIMGLPRSNGHMAAHVLARSGLFLTPRQCDTLSPSLLLD
                     VERRDAFRKKFRGFSYLHPDFLCVRVPQADQVDDDLTLHLMTPQSYAWGLLHGLDEYL
                     LECLEEDQLPVYSEVRRVMELLQWYRKCGHFSEPVTREFNPIDNAMELQAYGTKNVLL
                     RPQWLLYSPFAILSPDAVNTAFPKMKAIWVHRALSQCLPSLCSALCLHNTLYTGKPPS
                     DSQLASMGEKVLGIFGSGTAYAIEYYGKFDQRRMAHWSNRDVKRHATRVATKTLDYFS
                     VELDRYRRMQMISGQTEYVSVSRPLHDAQMPYFCLHDGIIGDVFQDYIYQFAEFAFEK
                     KFGITVKEYTPLAAPADAMAMRGIAHGSSEPRSAPALGAGQPMVGHFQQERRGFR"
     gene            complement(<421254..>421796)
                     /locus_tag="LMJF_14_1040"
                     /db_xref="GeneID:5650307"
     mRNA            complement(<421254..>421796)
                     /locus_tag="LMJF_14_1040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687651.1"
                     /db_xref="GeneID:5650307"
     CDS             complement(421254..421796)
                     /locus_tag="LMJF_14_1040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687703.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650307"
                     /db_xref="InterPro:IPR003807"
                     /db_xref="UniProtKB/TrEMBL:Q4QFN1"
                     /translation="MDTANRGLSYLCCVGGSLKPWAEGQDEGDDKYESLQGPGGRNLT
                     GSVNDKRICVPQKIDPKTFFANERTFLKWLSISVMIGLMSLTLLNFGDSTNNGAELAG
                     LVLLPVSIVFMVYSLFIFRDRANKIYMREPMRYDDTRGPTLLVLVLGSALALATLFSL
                     QRQYTQTVVSSFSESARFSQ"
     gene            complement(<422433..>423056)
                     /locus_tag="LMJF_14_1045"
                     /db_xref="GeneID:12981167"
     mRNA            complement(<422433..>423056)
                     /locus_tag="LMJF_14_1045"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721740.1"
                     /db_xref="GeneID:12981167"
     CDS             complement(422433..423056)
                     /locus_tag="LMJF_14_1045"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721788.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1045"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1045"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981167"
                     /db_xref="UniProtKB/TrEMBL:E9ACR4"
                     /translation="MELHLLPETDSFSQVFLRPTFAVPFSVMTSLTLVTNYFMEKSTV
                     ENSSAPAVLVTPHLCVNVFSFTLFVASITFSKSTQITRAIALGQSPPMKLFVLRSLPW
                     PLSVVCGGQGDRKLVPFVLYSLIFPGTLVVASLHLISLGVNGLENALCWQLPLQRYLA
                     WTTLWRFVVATAVFTTNYLAAHNPTQSVLIPSTDTYRQPSNVGRKPE"
     gene            complement(<425205..>426017)
                     /locus_tag="LMJF_14_1050"
                     /db_xref="GeneID:5650308"
     mRNA            complement(<425205..>426017)
                     /locus_tag="LMJF_14_1050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687652.1"
                     /db_xref="GeneID:5650308"
     CDS             complement(425205..426017)
                     /locus_tag="LMJF_14_1050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687704.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650308"
                     /db_xref="InterPro:IPR013718"
                     /db_xref="UniProtKB/TrEMBL:Q4QFN0"
                     /translation="MCAALSPAHFQLRVKILSEAAKHVPETGFTNAALAASLKSIGVE
                     DITDRTLSQIFNRGFPIALVEHIVKSTNLHVQRELESVFSKDAIIKSIDSNVDAFVQN
                     RLLLPTEKNVVEKAILSKLELLIPLAEHWPSAVALEYLPANLPYTVMNLAEFVDTTVY
                     YMERATTLGELLDPARRILRSKAMASRIRSGEVDSNGASPTSEFLKSFLKGISLSSGP
                     YAGPSALNLGWYCKRAQVAIVYGAVTTSLLGDVSQNAADTRSLTKAAVETVF"
     gene            <428203..>441009
                     /locus_tag="LMJF_14_1060"
                     /db_xref="GeneID:5650309"
     mRNA            <428203..>441009
                     /locus_tag="LMJF_14_1060"
                     /product="putative dynein heavy chain"
                     /transcript_id="XM_001687653.1"
                     /db_xref="GeneID:5650309"
     CDS             428203..441009
                     /locus_tag="LMJF_14_1060"
                     /codon_start=1
                     /product="putative dynein heavy chain"
                     /protein_id="XP_001687705.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650309"
                     /db_xref="GOA:Q4QFM9"
                     /db_xref="InterPro:IPR004273"
                     /db_xref="InterPro:IPR013602"
                     /db_xref="InterPro:IPR024317"
                     /db_xref="InterPro:IPR024743"
                     /db_xref="InterPro:IPR026983"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QFM9"
                     /translation="MMSTKVIQELKELPLNTVEDAQKFFSIVDDVKEQGVALPPITHM
                     FFARVDSGLHFEPYHIRTICRDNRPMNYYVVTKGHVIHVDRRNGEYKVVATLEQWLLE
                     AKCFNRICKIAFFRNYIRHKALLRLLESARRTKLERIRAILSKRLLLATPTFQKDLIA
                     LRRKAFDFQWTPATEGFKKVLSLQISGEKGNIAGFSTDEFVEMQDDYGKLLQRKFASL
                     LLDILSVVVERVENVTQLLSTMRVIEKYPGATGCVNKDVTAKELHKRQMEQKRLVVDY
                     EKLPSYIRLVHHFQLESTFQQACSTFFDLEGAVRRRAAILRWRFRVECIVEGRKELSL
                     FPSKEHVTKTAEAVMDKCIDLLSGAPTCVGSEALKPFTTMIQTATVRSALLGDALISV
                     YKKEVLQFIEADYDEAKSKLSSYEPLVTVSQFLAEWQDVSMNWDSTLSHENSLLVSIT
                     ESEIRGYATRAYKAQSEIMKLSNRTYGTVVVECDKTLQKLVAQLKGVLVDIEAALGQL
                     IKLNFRYLKAECDFWVGKLSLPDIALAQFINWYLGLQDSGSIFDEFSNHVVDIQNLHR
                     LLCELREKSNAGVINDEVDYSSVLRAPFQCAVTEARKYYLSNSSRIKEMLLAEHTRII
                     ASVTSTTKRLASEYSNENANEIGAPVTQKLEDVRDELVQANSEARQLDMYARVLEMQT
                     FNWSEIAVAEDELQKYVELWNVHKEATDLRHRLEAKTVEEIDGQELKDTIVSLFQRAF
                     KAQKNTPGCTANYLVKSLAVEKANVPMYVELCNPALKEAHWLQLFQHTSIQLIPSAKR
                     TLRSLEAAGLMTNEHSAAVREVVSSAVGVYELEQQLKKLQDYWANHLFVVVPYGGRSN
                     AFVVDAVDATLEELEEQQIVVQTCLTSKYLAPVQTEMKEWEAKLSLIHSVLMEWVGVQ
                     KAWMYLEFIFTSDDIKRQLPDESLLFSSADRFFGSLMKRCSEDPHMAPLCLEGNGDTL
                     KKLQKCTYQLECIQKKIDEYLETKRVAFPRFYFLSNDELLSILSDSRNPLAVQPHLQK
                     CFDNIKALVFADDKTIVAMRSSEGEEVLFTHPVKVIGNVESWLNDVERAMRATLFDCL
                     AACLRAYTTEHRTKWFFEHPAQCVTTVDQIMWTREVEEVITATGSGDSSAWSSYQDRF
                     GEQLLQTVELVKLSLTALQRTVVSNLIVVDVHCRDVCAELAADSASAAPHPCSSLLDF
                     GWQKQLRFYYGPPTSAHGSGGVAEMADCFVRHGAAELPYGYEYLGNQPRLVITPLTER
                     AFLTCTAALHMQKGAAPQGPAGTGKTESVKDLGKALARTVVVFNCSDGLDYRMMSQMF
                     AGLAQAGAWACFDEFNRIELEVLSVVAQQMLDITTAITQRQTFMKFEGHHIKLHTNFG
                     VFITMNPGYAGRTELPDNLKALFRPVCMMIPNYALIAEIMFYAEGYGKAQSLAAKMIR
                     LYSLASQQLSKQDHYDFGMRAVKSILVLAGRLKRADPDSDEELLLVRAIREANLPKFL
                     VDDRHLFMALLHDFFPTIVEVAPASVSEVILSEAKCFLTEELVHTSLSSPEAQMRLQP
                     TEGLLFKTQQLFDTLMTRHGLMLVGHTMTGKTTVRDTLASVLTRLGRVLDTTPVPGAA
                     GGDSGNGNPGAKGGLAGTRRHTLAASMRALDARCQSYFTTTHATVCNPKAISMTELYG
                     DVNPLTREWQDGVFSAIVRDLVKQSAAQHGRAATRHWVIFDGPVDAVWVENLNTVLDD
                     SKMLCLVNGERIRIPDTISLLFEVQDLRVASPATVSRCGMVYVDEECVDGGWSPLLHS
                     LSQAAAQELRAQWHHDRFLQLCGSLVPPLLQVVREECTEYIATCNAQLTLNLFYLMKA
                     AVQHLQGVIDEDRQEQQKQLRDDAAALVLDSGVSRPSIDSTFRRFSRRRSSRVTRTAV
                     LVRGDAIFDALFLQSCAWGLGGNLTETTRARFAAAMLPLVRKGALNFPADAEAEGCGV
                     FDYGVDYEIGDWRRWSEMVPEFHYNASVPYFDLLVPTEQTAALQYLLRSATTTHHHML
                     LNGLTGTGKSSTVNSFLLQTLHTEDAASSTAAFRFTLSAQTSAQALQNTIEMKLTRRK
                     GDREFGAPSGKTMMIAVIDDCNVPQLEEYGAAPPVELLRQMITQGGFYDRKRLFFKEV
                     VQTMLIACCGEPGGGKNEMTPRFTSKLLCFCAPQLTETSMRSIFSAILKGFFYARGFA
                     TEVAALADAVVDSTLEAYRRIAVECLPTPDKTHCTFNLRDVSKVFQGILQIKPAHCAS
                     PQALIDLWSHEASRVFHDRLIDDTDRGWWWRCCAEVIEKHFCGDVTAANADAADTDAA
                     QPVPSPLPAPDPAQLATIFYGAWVNRDYQRIGQDTSLQVVAQQHLAEYNTQSTTPMNL
                     VFFDQAVQHLSRICRIVSQPRGHALLVGVGGSGRSSLCRLAAFMMNMDVQTVHIARNY
                     GIEEFRDEVRKVLLDSGARGKEVVFVISDSQLVHSEMLEDINNLLNTGEVPGMMGLED
                     METVVRCCREASLASGRPDTRASVYEYFVSQSRERFHLCLCMSPMSGVFRDRLRMFPA
                     LVNCTTIDWFSEWPQEALRAVAQSTLSSAARDGAAGPGTDQLSALMVLLQSTVKDAAE
                     RLYAQHRRRTHVTPTSYLAVLTLYNTMGRRLRRDLQASANRYRNGLKKLDTAKSTIAQ
                     LQQQIREMQPGLAAAAKQVEEQKQTLAVEQLEANQMKEAQSKEEATALQLMNEAESIR
                     RECEEGLQQALPALEAAKQALETLSAKDIQEIKTFTTPPSNVEKTMNAVLVLLGEKDG
                     WASAKACLGKLDFISRLTGYPRDSITPACIRKLAVFVQDPDFVPDIIEKTSLPCRSMC
                     MWVHAMYKYYFVAKEIAPKRARLAGAEEKVEVARKELQAKQVALQKVLDHISDLQAAA
                     AAAQEKADHFQRQIETAMARLVRADQLISGLASERVRWKEALAKLETQLGCVEGTAAL
                     AAGCVGYLGPFPLDYREVLVERWRSECTALHIPFDATYSLEGFETEATVQQWALQSLP
                     RDTYSIQNATILHRTTQCCYMIDPQGQANAFVRKLERSRSSGAAGLLQLKLNSPNFMR
                     QIENAVQKGQAVLLEDVGETLDAALDPILLKQVRRVAGRDVVTLGDREVTYDDRFHLY
                     ITTKLANPVLTPELQVKLTVIDFTVTREGLEEQLLADIVGSERASLQQRGDRCVISIA
                     ANREEIAALEAQVLQQLSDATGDVLDNAELIQALQTSKVTSEKIGVELAAVEETNKTI
                     NATRDVYRPLAVRGSLLYGAITQMAKVDPMYDYSLPFFKNLVVSVLASTRRQRPQLQQ
                     PHRPSSIPASSMMLGNGSLHEREAQNCHVSLAPTDSSHGLPGASAEEEEEAAAAMSEA
                     EVEARVVMLVEEVTWMSYRVLCRGLFGPHKLLFSFVLATTLLRSTGQITKEEWELFLC
                     GGAGRALPPAFAAAGGEGSDGATVQRPGYVSSGTWVDFGAICGLEAFAEVYESFIASL
                     ADTSDLGDADLSGDRPLPWTAWFTETYGAEVLTRLPASLAHLSLWHRVLAVKILRPNK
                     FHYMAAQLVADTLGQRYTIAPPFDLEEAFLDSTKMTPIIFILSPGADPTSLFLSFAEE
                     RGFSGRKHMLSLGQDQDVRATQMIREGQREGAWVYLQNCHVYASWMPQLQALVESMNP
                     SEIHADFRLWLTSNPSPSFPPLVLQAGLKLTQEPPMGLRGKVLSTLRSTVVADVWAAT
                     ASAADVGNADSNDASVSASSPAVLRGGHPSIELQRLVWTLAFYHGTVMERRRYRPLGW
                     NISYDWGMADFEAGLATLQTALDRCKDGGAGLPTEELCYMLGTIDFGGRVTDEWDTLC
                     LQVLTRRFFDTDAPGTTLQQKSPQDAITPPPFPKDGVSYAALLQLAEAAFTVGRESRK
                     DGDGEDESGESPARFGLHDNATLSVEQQLSLGLVDALVLMNASGAVTGATSAQRRSAS
                     GDHGEEDAKASGDEAMENPVAAVARNLLAQLPPLLPRQEAVLGSMTSPNHSTTTTTAV
                     SAVADPAPLQTLLSHETDLYNCLLSTMQSSLAELIRALKGEVVVTSRLELMMQRLAFN
                     QVPEVWAQVGYLTLKPLGSFMEDLLRRVHFMRRWGEAGPPPSFWLSGVFFPQGFVTAL
                     LQARSRALQVPIDSLQLRFRALAPSEAAEVSALTASHEAGTGSKAPTLVGAYVNGLYL
                     EGCGWDAARGGLVEAAPGALTVELPIIHFEPVMGSESVAKGPSASAAEAAAAYVCPLY
                     KVRTRAGTLSTTGVSTNYVTSLTLPSLDGVPGDHWTLRGVAALCALDN"
     gene            <444358..>447084
                     /locus_tag="LMJF_14_1070"
                     /db_xref="GeneID:5650310"
     mRNA            <444358..>447084
                     /locus_tag="LMJF_14_1070"
                     /product="putative protein kinase"
                     /transcript_id="XM_001687654.1"
                     /db_xref="GeneID:5650310"
     CDS             444358..447084
                     /locus_tag="LMJF_14_1070"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001687706.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650310"
                     /db_xref="GOA:Q4QFM8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4QFM8"
                     /translation="MLEATNAARRRTSSIEQRNSYEALMHAIENRVNGDTVNTTSIES
                     KDATASTCGYAAAPTTATTAPKHVDPMATNGVSQSEMLSAHLTEQLTNIPAALSPGSC
                     VRQQSQQLPPAQRQKYGKEEVATAAAAETDADVRNTQEPAVLSQQQQQQQQCQRADVK
                     HHADVAEVGSEDDDDDGGAAHGDDERALPLAALHSQPPITRRHAPTAVLEADGDEDDD
                     DGTAYDGVKTQVLFKPVNRAAYREVVASTWKPEGLTRRINTAGSGLQQNRSSNSSSSA
                     SEYKDSPHHPNSADDDDEAIATMATRNKTVRAAARTAPSMKVFRVPSFPYGGGVTEQQ
                     ARILQRQFDECIHNGEHLSSNAAGPALITKRGFDSGNYAEVSAATAQMDTTSFQPTSP
                     YEFVVEVERDVRFDAVKAREERRHRFRQLVREKRAPATMGTFNLRVIMDPFKTGFEEE
                     KNFPIVPGTVIAGRYEIIQMLGKATFSRAVRCYDLQDPIYNEDEESDDGEYEDDDVDD
                     DDANSAAASPADGAEDVACVGKGGVTTASCRVSDTATTASAIKQQVKPVNTATKSRLK
                     PKRKILGYGQVCLKIINNTKDFFDQSLDEIRLLTLLNRQRDPDDAHIVRLIDAFYYKE
                     HVMLVTELLRDTLYDYGKYNREEEKEFYFTLPRLRRLTRQIVEALTYVHSLNLIHTDL
                     KPENIMFVSYSRCIVKVIDFGSSCFLSDHLSSYIQSRSYRAPEVVLGCDYDGRIDVWS
                     LGAILVEMVTGDVLFTSDTVPEMLARIVYVCGTPFPRRMLWEGRHTSDYINKFGCIYE
                     YGGGADGQHGLHEKGDTDDGEEPYCLYTPVPTMAPHTCASSRKSRAAAAAPPPPRTTT
                     APYSVLREKLAAAKMVDEEFIAFVEACLMLDHKKRPTSAELLEHPFIRDVVL"
     gene            <449397..>450590
                     /locus_tag="LMJF_14_1080"
                     /db_xref="GeneID:5650311"
     mRNA            <449397..>450590
                     /locus_tag="LMJF_14_1080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687655.1"
                     /db_xref="GeneID:5650311"
     CDS             449397..450590
                     /locus_tag="LMJF_14_1080"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687707.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650311"
                     /db_xref="UniProtKB/TrEMBL:Q4QFM7"
                     /translation="MQRRVCGEWRWVTLSPDLLPLLLMVVMLFIFPRSDASGSCLRGR
                     DTHGPRLSHDAHRTGRAVALFYGSSEINRCVVQSRATAVPGVLMVRAATAESSAGDSD
                     EEAGGTDTWRTIAMKRTLNYDSGLKPFMTPWREVRRALRDVGCFSTLALPRLTLPTDT
                     ASPRVGDASPESSTALPPLCRKPLVLMSGRGRDCASCSSFASDVLEHYRAEWEYIRAH
                     VTLVDAGDPMTEELVRNPYPLWYDPVETGPWMTLTKVSEVWRAEGDAVAAASGASSTF
                     RAPSHNVTQTLQQSDAEDYILFNMGLRRKAAFLLQSPTVQATHHWSRLVKRAFAGQSE
                     YVLRIVFAYPHNGSVMRDIVNEEVTVGGSQADYLHFFNKAQPFFQCVKKAVRVMDWLQ
                     RYGDY"
     gene            <451537..>452229
                     /locus_tag="LMJF_14_1090"
                     /db_xref="GeneID:5650312"
     mRNA            <451537..>452229
                     /locus_tag="LMJF_14_1090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687656.1"
                     /db_xref="GeneID:5650312"
     CDS             451537..452229
                     /locus_tag="LMJF_14_1090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687708.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650312"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="InterPro:IPR016817"
                     /db_xref="UniProtKB/TrEMBL:Q4QFM6"
                     /translation="MSVESIMRDLVSNYLSYAVVVGSSILKVPQIVKVWQNHKADGIS
                     LLSILIELFSYIISTSWGVVQGLPFRDCGENIFITLQLVVLLLLAAKLQKSTRRASLA
                     LATELLVLYMFASGQVPCTIHEYVLSGQVFFNMFSRVPQIYANYRSRCRGQLSFLTFF
                     LAFCGGVVRVLTTSLNVSWDKGKAVLLVQFGVAATLNAVILAQMLYYGIADRRSKRAE
                     WSHAKAKSLKSQ"
     gene            <456730..>458166
                     /locus_tag="LMJF_14_1095"
                     /db_xref="GeneID:5650313"
     mRNA            <456730..>458166
                     /locus_tag="LMJF_14_1095"
                     /product="hypothetical protein"
                     /transcript_id="XM_001687657.1"
                     /db_xref="GeneID:5650313"
     CDS             456730..458166
                     /locus_tag="LMJF_14_1095"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001687709.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1095"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1095"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650313"
                     /db_xref="UniProtKB/TrEMBL:Q4QFM5"
                     /translation="MASACPATAAAPAKGAVDAVPAVVMRLMADQHCAYCGALLSTQE
                     QLEWLDVTLRCTQSGPARQLVFKAALMTHWHCGPDTLTVYESASGGGGGGSDDEQAVA
                     ASSATNYLIAAAVADVTAIVHRWVLQEAEVLEESAAAALFNHGDDLARRAVLLGDVGR
                     LLANVSRAFNSVPGGPSAVEALFAAARAAVTSAGLRLERGAQLSSTSSLFSAAATAAA
                     LTSAGMPAPCDDSVVGVAALSRSALLPELQSCTDVERRLARLHGWLELLCTCPTELVA
                     DEQYVVVWLCVLMRHVEEMHGYAREGSAQLSEARRQAGEATHQADSAIVSCRVGAVSD
                     GGGDDGWRCQWSLETEEAAVRRVAQSLSSQLWSVLPASSLLPPMLLNWLLARGGARTW
                     GDAVRTLRASADADGGLKAEHAGRRFSLLLLPLNRVVSVKHVVRVLHTLRAVEERCAA
                     SATPAAAAYRYSGHRDLIHLYRSAPAAA"
     gene            <460358..>468655
                     /locus_tag="LMJF_14_1100"
                     /db_xref="GeneID:5650314"
     mRNA            <460358..>468655
                     /locus_tag="LMJF_14_1100"
                     /product="putative kinesin K39"
                     /transcript_id="XM_001687658.1"
                     /db_xref="GeneID:5650314"
     CDS             460358..468655
                     /locus_tag="LMJF_14_1100"
                     /codon_start=1
                     /product="putative kinesin K39"
                     /protein_id="XP_001687710.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650314"
                     /db_xref="GOA:Q4QFM4"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q4QFM4"
                     /translation="MHPSTVRREAERVKVSVRVRPINERENNAPKGAKVTIAAKQAAA
                     VVTVKALGVSNNSGAADSTGTARRIAQDFQFDHVFWSVETPDACGATPATQADVFRTI
                     GYPLVQHAFDGFNSCLFAYGQTGSGKTYTMMGADVSALGGEGSGVTPRICLEIFARKA
                     SVEAQGHSRWIVELGYVEVYNERVSDLLGKRKKGVKGGSEEVHVDVREHPSRGVFLEG
                     QRLVEVGSLDDVVRLIEVGNGVRHTAATKMNDRSSRSHAIIMLLLREERTMTTKSGET
                     IRTAGKSSRMNLVDLAGSERVTQSQVEGQQFKEATHINLSLTTLGRVIDVLADMATKG
                     AKAQYSVAPFRDSKLTFILKDSLGGNSKTFMIATVSPSALNYEETLSTLRYASRARDI
                     VNVAQVNEDPRARRIRELEEQMEDMRQAMAGGDPAYVSELKKKLALLESEAQKRAADL
                     QALEREREHNQVQERLLRATEVEKIELESRAAALQEEMAATRRQADKMQALSLRLKEE
                     QARKERELLKEMAKKDAALSKFRRRKDAEIASEREKLESTVAQLEREQREREVALGAL
                     QTHQRKLQEALESSERTAAERDKLLEQLTELQSERTQLSQVVSDRERLTRDLHRIQYE
                     YGETELARDAALCAAQEMEARYHAAVFHLQTLLELATEWEDALRERALAERDEAAAAE
                     LDAAAFTSEQARERTSELLTSLEQQLRESEARAAELAAQLEATAAARASVEQDGEKTK
                     GALEQQLRESEARAAELAAQLEATAAARASVEQDGEKTKGALEQQLRESEARAAELAA
                     QLEATAAARASVEQDGEKTKGALEQQLRESEARAAELAAQLEATAAARASVEQDREKT
                     KGALEQQLRESEARAAELAAQLEATAAARASVEQDREKTKGALEQQLRESEARAAELA
                     AQLEATAAARASVEQDREKTKGALEQQLRESEARAAELAAQLEATAAARASVEQDREK
                     TKGALEQQLRESEARAAELAAQLEATAAARASVEQDREKTKGALEQQLRESEARAAEL
                     AAQLEATAAARASVEQDREKTKGALEQQLRESEARAAELAAQLEATAAARASVEQDRE
                     KTKGALEQQLRESEARAAELAAQLEATAAARASVEQDREKTKGALEQQLRESEARAAE
                     LAAQLEATAAARASVEQDREKTKGALEQQLRESEARAAELAAQLEATAAARASVEQDR
                     EKTKGALEQQLRESEARAAELARRLEATAAAKGLVEQDRESTKATLEERLRIVEARAA
                     ELATELEATAAAKSSIEQDRESKRAALEERLRIAEVRSAELASQLEATAAAKALVEQD
                     RERTRASLEARVAELASKLEATAAAKGLVEEDRESTRATLEERLRVAEVRAAELSSQL
                     QAAAAARASVEQDREQMRRALEARVAEVSTKLEATAAARASVEQDRESTKATLEERLR
                     VAEVRAAELSSQLQAAAAAKTAVEQDRERTRAALEARAAELASKLEATAAAKGLVEQD
                     RESTKATLEERLRIVEARAAELATELEATAAAKSSIEQDRESKRAALEERLRIAEVRS
                     AELASQLEATAAAKALVEQDRERTRASLEARVAELASKLEATAAAKTVVEQDRERTRA
                     AIEEQLRLAEVRAAELASELEATAAAKALVEQDRERTRASLEARVAELASKLEATAAA
                     KTSAEQDRESTKATLEERLRGAEVRAAELASQLEATAAAKTSAEQERATTRAALEARA
                     AELASKLEATAAAKSAVEQDRERTRATLEERLRGAEMRAAELARKLEATAAAKMSVEQ
                     NRESTRAALEERLRAAEVRAAELSSKLEATAAAKAAVEQDHERTWTNFEKQLRESEAR
                     AAKLTGQLEATAAAKAFMQQDRDRIKTAFEEQLRCSEARAKELAAQLEATAAAKTSVE
                     EDRERMRAALEQQLRESEARAAELAVQLEAIAAAKTSVEEDRERMRAALEERLRGAEL
                     RAAELAGVLEATAAAKTAVEEDLEKIKGALEQQLRESEARAADLKTRLKATAAAKTAV
                     EQDGEKIKGALEQQLRESETRAAELAAQLEATAAAKTSVEEDRERMRAALEQQLRESE
                     ARAAELAVQLEATAAAKTSVEEDRERMRAALEERLRGAELRAAELAGVLEATAAAKTA
                     VEEDLEKIKGALEQQLRESEARAADLKTRLKATAAAKTAVEQDREKTKGALEQQLRES
                     EASAAELTARLKATAAAKTAVEQDRDKIKGTLKQQLRESEARAADLKTRLKATAAAKT
                     AVEQDREKIKDALEQQLRESETRAAELKTRLKATAAAKTVVEQDREKIKGALEQQLRE
                     SETRAAELKTRLKATAAAKTVVEQDREKTKGALEQQLRESEARAAELAAQLEATAAAK
                     TAVEEDREKTKGALEQQLRESEARAAELAAQLEATAAAKTSVEEDRERMRAALEERLR
                     GAELRAAELAGVLEATAAAKTAVEEDLEKIKGALEQQLRESEASAAELAGVLEATSAA
                     KTAVEEDLEKIKGALEQQLRESEARAAELAAQLEATAAAKTSIELDREKIKGALKQQL
                     RESEARAAELKTRLKATAAAKTAVEQDREKIKGALEQQLRESETRAAELKTRLKATAA
                     AKTVVEQDREKIKGALEQQLRESETRAAELAAQLEATAAAKTAVEEDLEKTKGALEQQ
                     LRESEARAAELAAQLEATAAAKTSVEEDRENVKVAFEEELCDAKAKLAGMEVALKEAK
                     LEFEGRVGELEGECEKLRNDKLRYAKKVQSLEYQTRIDEARLKARRDAVHRKE"
     gene            <470783..>474472
                     /locus_tag="LMJF_14_1110"
                     /db_xref="GeneID:5650315"
     mRNA            <470783..>474472
                     /locus_tag="LMJF_14_1110"
                     /product="putative kinesin K39"
                     /transcript_id="XM_001687659.1"
                     /db_xref="GeneID:5650315"
     CDS             470783..474472
                     /locus_tag="LMJF_14_1110"
                     /codon_start=1
                     /product="putative kinesin K39"
                     /protein_id="XP_001687711.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650315"
                     /db_xref="GOA:Q4QFM3"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q4QFM3"
                     /translation="MDTVGGTVRLLSSSSTALSSIHDVRGSVRSSLASSHPSNGAVFQ
                     FDHVFWSVETPDACGATPATQADVFRTIGYPLVQHAFDGFNSCLFAYGQTGSGKTYTM
                     MGADVSALGGEGSGVTPRICLEIFARKASVEAQGHSRWIVELGYVEVYNERVSDLLGK
                     RKKGVKGGSEEVHVDVREHPSRGVFLEGQRLVEVGSLDDVVRLIEVGNGVRHTAATKM
                     NDRSSRSHAIIMLLLREERTMTTKSGETIRTAGKSSRMNLVDLAGSERVAQSQVEGQQ
                     FKEATHINLSLTTLGRVIDVLADMAKKGAKAQYSVAPFRDSKLTFILKDSLGGNSKTF
                     MIATVSPSALNYEETLSTLRYASRARDIVNVAQVNEDPRARRIRELEEQMEDMRQAMA
                     GGDPAYVSELKKKLALLESEAQKRAADLQALEREREHNQVQERLLRATEVEKIELESR
                     AAALQEEMAATRRQADKMQALNLRLKEEQERKERELLKEMAKKDAAVAEQHRLVAEKE
                     RILQQMVNDLERERMSHECVMASLQAHQERLMEALEDKQQSDAQRLALTAEKQQLQVE
                     WMEQQQQQSSYIARLIQQLKRTEYEFVNREQIHALLTQETDARYSLLELYAQLYQEIH
                     RQESKQKNILHNALVQQLQKAITLHETRAGQAQGEASTLTQRLHDLEHAYQTSTTALT
                     STTEKLQSSHKTLESTHRQLEGEHAELTRTHKQLEKAHAELEKSHAALTESSAALEQQ
                     VTEWKTRASSLDAERGDVSERLVRLEGEHAELTRTHKQLEKAHAELEKSHAALTESSA
                     ALEQQVTEWKTRASSLDAERGDVSERLVRLEGEHAELTRTHKQLEKAHAKLEKSHAAL
                     TESSAALEQQVTEWKTRASSLDAERGDVSERLVRLEGEHAELTRTHKQLEKAHAKLEK
                     SHAALTESSAALEQQVTEWKTRASSLDAERGDVSERLVRLEGEHAELTRTHKQLEKAH
                     AKLEKSHAALTESSAALEQQVTEWKTRASSLDAERGDVSERLVRLEGEHAELTRTHKQ
                     LEKAHAKLEKSHAALTESSAALEQQVTEWKTRASSLDAERGDVSERLVRLEGEHAELT
                     RTHKQLEKAHAVVTELTAVSEEKLSCALKVCESLKSSVGNASDQVSVAGMEVERLREE
                     VLMAESRAHEWECRCGVLRVRLEFYREACRGGLWTPSVVDIFKHLDVNSSRASEGKSA
                     AATSTRYPTTARLAQLLRSGNFSVV"
     gene            <477428..>486358
                     /locus_tag="LMJF_14_1120"
                     /db_xref="GeneID:5650316"
     mRNA            <477428..>486358
                     /locus_tag="LMJF_14_1120"
                     /product="putative kinesin K39"
                     /transcript_id="XM_001687660.1"
                     /db_xref="GeneID:5650316"
     CDS             477428..486358
                     /locus_tag="LMJF_14_1120"
                     /codon_start=1
                     /product="putative kinesin K39"
                     /protein_id="XP_001687712.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650316"
                     /db_xref="GOA:Q4QFM2"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q4QFM2"
                     /translation="MCNRSRKEISGEEARIFQFDHVFWSVETPDACGATPATQADVFR
                     TIGYPLVQHAFDGFNSCLFAYGQTGSGKTYTMMGADVSALGGEGSGVTPRICLEIFAR
                     KASVEAQGHSRWIVELGYVEVYNERVSDLLGKRKKGVKGGSEEVHVDVREHPSRGVFL
                     EGQRLVEVGSLDDVVRLIEVGNGVRHTAATKMNDRSSRSHAIIMLLLREERTMTTKSG
                     ETIRTAGKSSRMNLVDLAGSERVAQSQVEGQQFKEATHINLSLTTLGRVIDVLADMAK
                     KGAKAQYSVAPFRDSKLTFILKDSLGGNSKTFMIATVSPSALNYEETLSTLRYASRAR
                     DIVNVAQVNEDPRARRIRELEEQMEDMRQAMAGGDPAYVSELEEKLALLESEAQKRAA
                     DLQALEREREKNEIRDLMLKATEAERLELLERADALEQEVADSRAQAERMELENKRML
                     ALQREKEALLRAREASLEKHCQEMRRRECSMAHHRDEWQVTIEEERWQQKTVLVQLME
                     ADARNFHMGSFLEAYVSEVRQCWCATLNSALLQCRQGADASKARVDRLTAISCELQSQ
                     LADLKNELREAHKALAEAQAKAAQLSTDATAAATQYTTQLTDANKQLHQLRQDLEDAA
                     RENNTLRTQLDETTKNLDTEHAAMTESKQSADELRRQVDSAAAAAAQLQAENRASDAA
                     LKVATDENAMLTGRLTQLLDEQKLLCESLQRQQEAAAELARFDERWSFPDLHDATTTS
                     THMKEFPHQEWSIVVQNKSQELHRVFRDEAALACRVRPRHITNLHFELGSLRATFTVQ
                     HSQTISAKDIEHRLNNYQFRAMQELYDQRHKPPDGLDALALENARLQTDRDKDRRDII
                     EAHAEKERLQSELEEKGSEAEAAKADNEALRGELEEAHAEKERLQGELEEKGSEAEAA
                     KADNEALRGELEEAHAEKERLQSELEEKGSEAEAAKADNEALRGELEEAHAEKERLQG
                     ELEEKGSEAEAAQADNETLRGELEEAHAEKERLQGELEEKGSEAEAAKADNETLRGEL
                     EEAHAEKERLQSELEEKGSEAEAAKADNETLRGELEEAHAEKERLQSELEEKGSEAEA
                     AKADNEALRGELEEAHAEKERLQSELEEKGSEAEAAKADNEALRGELEEAHAEKERLQ
                     GELEEKGSEAEAAKADNEALRGELEEAHAEKERLQGELEEKGSEAEAAQADNETLRGE
                     LEEAHAEKERLQSELEEKGSEAEAAQADNEALRGELEEAHAEKERLQGELEEKGSEAE
                     AAKADNETLRGELEEAHAEKERLQGELEEKGSEAEAAKADNETLRGELEEAHAEKERL
                     QSELEEKGSEAEAAKADNETLRGELEEAHAEKERLQSELEEKGSEAEAAQADNETLRG
                     ELEEAHAEKERLQSELEEAHAEKERLQSELEEAHAEKERLQSELEEKGSEAEAAKADN
                     ETLRGELEEAHAEKERLQSELEEKGSEAEAAKADNEALRGELEEAHAEKERLQSELEE
                     KGSEAEAAQADNETLRGELEEAHAEKERLQSELEEAHAEKERLQGELEEAHAEKERLQ
                     SELEEKGSEAEAAQADNETLRGELEEAHAEKERLQSELEEAHAEKERLQGELEEKGSE
                     AEAAKADNETLRGELEEAHAEKERLQGELEEKGSEAEAAKADNETLRGELEEAHAEKE
                     RLQSELEEKGSEAEAAQADNETLRGELEEAHAEKERLQSELEEKGSEAEAAQADNEAL
                     RGELEEAHAEKERLQSELEEKGSEAEAAQADNEALRGELEEAHAEKERLQSELEEKGS
                     EAEAAQADNETLRGELREAHAEKERLQSELEEKGSEAEAAQADNETLRGELEEAHAEK
                     ERLQGELEEKGSEAEAAKADNETLRGELEEAHAEKERLQSELEEKGSEAEAAKADNEA
                     LRGELEEAHAEKERLQSELEEKGSEAEAAQADNETLRGELEEAHAEKERLQSELEEAH
                     AEKERLQGELEEAHAEKERLQSELEEKGSEAEAAQADNETLRGELEEAHAEKERLQSE
                     LEEKGSEAEAAKADNETLRGELEEAHAEKERLQSELEEKGSEAEAAQADNETLRGELE
                     EAHAEKERLQSELEEKGSEAEAAQADNETLRGELEEAHAEKERLQGELEEKGSEAEAA
                     KADNETLRGELEEAHAEKERLQSELEEKGSEAEAAKADNEALRGELEEAHAEKERLQS
                     ELEEKGSEAEAAQADNETLRGELEEAHAEKERLQSELEEAHAEKERLQGELEEAHAEK
                     ERLQSELEEKGSEAEAAQADNETLRGELEEAHAEKERLQSELEEKGSEAEAAQADNEA
                     LRGELEEAHAEKERLQSELEEKGSEAEAAQADNEALRGELEEAHAEKERLQSELEEKG
                     SEAEAAKADNEALRGELEEAHAEKERLQSELEEKGSEAEAAQADNEALRGELEEAHAE
                     KERLQGELEEKGSEAEAAQADNERCAASWRRRTRRRSVCRASWRRRTRRRSVCRASWR
                     RRARRRRPPRRTTRRCAASWRRRTRRRSVCRASWRRRARRRRPPRRTTRRCAASWRRR
                     TRRRSVCRASWRRRARRRRPPRRTTRRCAASWRRRTRRRSVCRASWRRRARRRRPPRR
                     TTRRCAASWRRRTRRRSVCRASWRRRARRRRPPRRTTRLCAASWRRRTRRRSVCRASW
                     RRRARRRRPPRRTTRRCAASWRRRTRRRSVCRASWRRRARRRRPPRRTTRRCAASWRR
                     RTRRRSVCRASWRRRARRRRPPRRTTRRCAASWRRRTRRRSVCRASWRRRARRRRPPR
                     RTTRRCAASWRRRTRRRSVCRASWRRRARRRRPPRRTTRRCAASWRRRTRRRSVCRAS
                     WRRRARRRRPPRRTTRRCAASWRRRTRRRSVCRASWRRRARRRRPPRRTTRRCAASWR
                     RRTRRRSVCRASWRRRARRRRPPRRTTRLCAASWRRRTRRRSVCRASWRRRARRRRPP
                     RRTTRRCAASWRRRTRRRSGFFKRCQGRRVIV"
     gene            <489029..>491818
                     /locus_tag="LMJF_14_1130"
                     /db_xref="GeneID:5650317"
     mRNA            <489029..>491818
                     /locus_tag="LMJF_14_1130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687661.1"
                     /db_xref="GeneID:5650317"
     CDS             489029..491818
                     /locus_tag="LMJF_14_1130"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687713.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650317"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4QFM1"
                     /translation="MDLAEKRKQLEALRAARQAKQQVVEQYISGRSSNPDGSPTSSTS
                     LSRSALALALPASAAAGDSAAAAGTSTSPRSALPLSLRSRSGGGRLSVSSTRGSAATA
                     KAAAPSAASSPVTPTTPTAQKARPTTPSKQSAPSQTQAAAADGGVAPRSIHFVSMNKD
                     STAAHAAMAGFSAASPNARPVVGSLCGSALPTVASRAAAAPPTEEGLAAYGGWGFLRK
                     CMRVPARDATGATVTQPVCIFNPSVLLGDVAGSVESSRRRVILDSTSCLVPYDGAAAG
                     QRLSDGAMMTLPTVWSVCVAAAYGSCDSPAVTSGGNGGELSVNTRCHGNTDPAGPDNR
                     TGASALDPLFMLSTGGTSVGMSQQRASAAARPATGAAAAAAAARVRASMDFGYPWGSA
                     SAAPSAVPGATTESALKVAKESPGLVLAWLLVPLPANTMPRKEGSFAGAAAAPGGGFV
                     SCVSGDITTMPEHVVIVLPLVCDSEVTTLLAHPLQPSTLLGGTRCGRIVQWSIGQAWA
                     QIEPRRLLERALATTGTTTTLLLPPQRPAHSSFPSPQAHQAPVLRMAVHGDASCHHLY
                     SISQEGKVCTWTASQPLHPAASCLSYLGIRPMGCIGVTAQFVERAGTDAMTKVFIGTT
                     SGALLVGANRDAKSIELQYYGPPRALPTSSTVIRTLDITATSVSTASFRDGAAATAST
                     CLTASLAHPAGADAFAAAEESGHHHHHHHHLTAVSSPSPATAAVARRVQAAALQPHRG
                     RIVSMAVQTATHGLRGRDCVVSAATDGSCVAWFDRSVIPLEGFSSAVTSVCWSPTKQG
                     VLAAGDASGLVTVWAVSTSIITPVVTVSLREAGHRARGNASSDGVLWVVPGTSDAAAG
                     AGSGTAGGGTFGFGGDDDEADVFDGEEVGASLGEADVVGTAISSVFFSRDGQWLFAST
                     ARGYVHTLHLGTSLV"
     gene            <494233..>495663
                     /locus_tag="LMJF_14_1140"
                     /db_xref="GeneID:5650318"
     mRNA            <494233..>495663
                     /locus_tag="LMJF_14_1140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687662.1"
                     /db_xref="GeneID:5650318"
     CDS             494233..495663
                     /locus_tag="LMJF_14_1140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687714.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650318"
                     /db_xref="GOA:Q4QFM0"
                     /db_xref="InterPro:IPR002059"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:Q4QFM0"
                     /translation="MGLSCALTSGLSLRCFSNTPARLSCGAGILHCSKLCLSGFGDPA
                     QGRLHNANHGAVRLHGTVTAFKHRRGYGFVLAEGVAASAPPLKHTYVALDTHAAAARN
                     NGVPPAREEACNELHKSFFFTRSALMGGFYVTEGERVSFAVVAVPPGKGINRRVAGDS
                     PSTRKDDGDHAALGGAETAEFLLGSPEGELEEDSSAATSDTQSQLHRIAVSLRYYDAK
                     TGKETPISPLTLYGKIVEWDAAAGVGVIAELDTRRQYHEDAPRFPFSLESVDLALGTE
                     LRSGRYVRFCLEPATHAQGGGGEDTAAAVTPTSGAEAAADVDEDVELVAQRVIIDSSM
                     ERRKGVFGRPLVLADAAPGTMTSESRFSGVVREVKADHFGFIQDDLSGESIFFHLSNA
                     SSRVKAGDRVTYLLREVEYGKHTGKKACFDVLIDQTVTSRARDAASDCGASAGAGNAG
                     GHHRKHAAERRSKTARDEDDLDFELL"
     gene            <497421..>498503
                     /locus_tag="LMJF_14_1150"
                     /db_xref="GeneID:5650319"
     mRNA            <497421..>498503
                     /locus_tag="LMJF_14_1150"
                     /product="tub family protein-like protein"
                     /transcript_id="XM_001687663.1"
                     /db_xref="GeneID:5650319"
     CDS             497421..498503
                     /locus_tag="LMJF_14_1150"
                     /codon_start=1
                     /product="tub family protein-like protein"
                     /protein_id="XP_001687715.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650319"
                     /db_xref="InterPro:IPR000007"
                     /db_xref="InterPro:IPR025659"
                     /db_xref="UniProtKB/TrEMBL:Q4QFL9"
                     /translation="MPTRKEGSDSASMYSMAQSVLPMDPRERIYYRPRHRLLQCYLER
                     RKRKGLGIASLLPGRHQSFQFFLEHTGDFVLAAVPRSFKTRTMVEDTSSGVGGQFYPV
                     SQGGANIVFTINQQQLDSDTRAFVGKLSRRGKGMEMVLFSEGSKDARKEILAVLLHNL
                     ADTNRSSFTVLLPAIDPESGYIKPLEGGEVEFLRDGRGSSHAGIDEAMVNSSDDDVDA
                     AYSTMSRATPNFAAVCDSPGASGAPAPSRSETAGRQKKWFLHGVLAREYRRNPGSPNI
                     IVLKSKEPQWDGVLRGYKLDFHGRSTKASEKNFQLVAVSDPGKVVMLFGKQDDDRFAL
                     DFRYPLCGLQAAAIATTILTARKAIL"
     gene            <500823..>501863
                     /locus_tag="LMJF_14_1155"
                     /db_xref="GeneID:12981168"
     mRNA            <500823..>501863
                     /locus_tag="LMJF_14_1155"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721741.1"
                     /db_xref="GeneID:12981168"
     CDS             500823..501863
                     /locus_tag="LMJF_14_1155"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721789.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1155"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1155"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981168"
                     /db_xref="UniProtKB/TrEMBL:E9ACR5"
                     /translation="MRRLRGSAHLTRHWTRRAEPHCSGVICGSRSITSTPTASSSTSS
                     GTDAGAAGAARLARAAEIRRKELLFRWLRRLVVPAFSIYGLFLLRPTEGHFLRYVAER
                     RHLDASFNAWFPPVTVGSPTEPGSKVEPAKRAPTATNTSSPTGGAGANGGASSMAPGV
                     IPTVFRSERDREWAAQRFNYKKGSDDEERVARKRLLFARDRVHLPDDTVVETIRSPTE
                     QLEELRALREHPPMHLLSEQLNSIAEESHRYAAALAAAAAAQPADPKDVASPASLRSD
                     AAATSSLDGVALPPLPGAAAVVSSPPQVEIQFEDRSLFATAAILFRDRDDRVVRAMRF
                     IGACGMVWKEVA"
     gene            <502845..>504134
                     /gene="ENOL"
                     /locus_tag="LMJF_14_1160"
                     /db_xref="GeneID:5650320"
     mRNA            <502845..>504134
                     /gene="ENOL"
                     /locus_tag="LMJF_14_1160"
                     /product="enolase"
                     /transcript_id="XM_001687664.1"
                     /db_xref="GeneID:5650320"
     CDS             502845..504134
                     /gene="ENOL"
                     /locus_tag="LMJF_14_1160"
                     /EC_number="4.2.1.11"
                     /codon_start=1
                     /product="enolase"
                     /protein_id="XP_001687716.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650320"
                     /db_xref="GOA:Q4QFL8"
                     /db_xref="InterPro:IPR000941"
                     /db_xref="InterPro:IPR020809"
                     /db_xref="InterPro:IPR020810"
                     /db_xref="InterPro:IPR020811"
                     /db_xref="InterPro:IPR029017"
                     /db_xref="InterPro:IPR029065"
                     /db_xref="UniProtKB/TrEMBL:Q4QFL8"
                     /translation="MPIRKVYAREVLDSRGNPTVEVELMTEAGVFRSAVPSGASTGVH
                     EACELRDGDKARYCGAGCTQAVKNVNEILAPALVGKEESDQAGLDKMMCELDGTKNKS
                     KLGANAILGCSMAISKAAAAKAGVPLYRYIASLAGTKDIRLPVPCFNVINGGKHAGNI
                     LPFQEFMIAPTKATSFREALRMGSEVYHALKVIIKSKYGQDAVNVGDEGGFAPPIKHI
                     DEPLPILMEAIEKAGHKGKFAICMDCAASEAYDAERKMYNLTFKNPEPTYVSAAELQA
                     TYERWVAEYPLVSIEDPFAEDNFDEFSAITKALAGKAQIVGDDLTVTNVKRVTMAIEK
                     SACNSLLLKINQIGTISESIAAAKLCMENGWSVMVSHRSGETEDTYIADLSVGLGTGQ
                     IKTGAPCRGERTAKLNQLLRIEEEIGSTATYGYPGWA"
     gene            <506745..>509045
                     /locus_tag="LMJF_14_1170"
                     /db_xref="GeneID:5650321"
     mRNA            <506745..>509045
                     /locus_tag="LMJF_14_1170"
                     /product="putative ras-like small GTPases"
                     /transcript_id="XM_001687665.1"
                     /db_xref="GeneID:5650321"
     CDS             506745..509045
                     /locus_tag="LMJF_14_1170"
                     /codon_start=1
                     /product="putative ras-like small GTPases"
                     /protein_id="XP_001687717.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650321"
                     /db_xref="GOA:Q4QFL7"
                     /db_xref="InterPro:IPR000306"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017455"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QFL7"
                     /translation="MSGNGAVQSPALAKPVLDLSQVRCIPFDQWVPDAQVVNCMAPDC
                     SNSFSLFNRKHHCRMCGHVFCSSCCNNLVYIPAAVVNKANSSTEGAAAAGSYSAMTNT
                     SLSSVVTPEPQQFNRACASDGSALPNGMRRGPQAPAAQGLDVSSASSSALLPGPLPVC
                     SDGNGHPPSNALTAPSAVTALPSSMSPSTQAAVPCRVCASCSYEVQLVVSTRQENGEP
                     RRRSRGELKMIQRVLLVNVMSFLTLRDLANVSLVSADFYFMSRDNIIWYQYNMTRWVQ
                     EAKLPRLSSHNSRAAASRMQQQRGPSWCTYSSGSGPRSSLVDDMFSSAPVIQDATALS
                     ESEAAKRVISLHARYNYTQFLDFARRQEMAWCEGLSSFSLGARLLLSSPIRVALVGPC
                     GIGKTASAHAFLGEKPSQMVVRPTIGFERRAVRVRLARGLSAEAVLHIYDLSGADRYG
                     ELRRFVCRHCHAIGLCYDPSRKVTLVQAADIMMGLESALGPQPVVVCGLMRQPHHTSS
                     SGSVPLNYHRAGPARLPAVVSAVTAVGLSAPLVRRDQSSHAVPVGSAESAAEAAGGVA
                     GESMLAAPICGVANGCNTSPRASSSPAGTAVTLPGGMAENGAHESCDRLQADAAVSPM
                     PSPPQPPFAVASPQSRALEVSVEDAVGITVRGHSSIHCPLLHPTPLFEALVQSVLDLL
                     VEATVASTSTISEISAELTTHGSGSGPQSFPTCCPSSLSAGSAPANATRVASTRRRPH
                     ASRAIMEDLRNLTMQPCALDILLDRK"
     gene            <510492..>512594
                     /locus_tag="LMJF_14_1180"
                     /db_xref="GeneID:5650322"
     mRNA            <510492..>512594
                     /locus_tag="LMJF_14_1180"
                     /product="putative polynucleotide adenylyltransferase"
                     /transcript_id="XM_001687666.1"
                     /db_xref="GeneID:5650322"
     CDS             510492..512594
                     /locus_tag="LMJF_14_1180"
                     /EC_number="2.7.7.19"
                     /codon_start=1
                     /product="putative polynucleotide adenylyltransferase"
                     /protein_id="XP_001687718.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650322"
                     /db_xref="GOA:Q4QFL6"
                     /db_xref="InterPro:IPR007010"
                     /db_xref="InterPro:IPR007012"
                     /db_xref="InterPro:IPR011068"
                     /db_xref="InterPro:IPR014492"
                     /db_xref="UniProtKB/TrEMBL:Q4QFL6"
                     /translation="MTSTTVTDKDFLAKKIVSADGPKGGEVVHELSLSEWCITRIEPE
                     EESNRRRSVLERIVNVVRVWIRHTMITEFRMPEAAAAQVEGRIFATGSYRYNVHTSGS
                     DIDMVLIAPSRITREHFFNTLAPRLKSEPWVTDLHCIRESRVPIIAMVCDGIDIDLSF
                     GSIRQDRVPEVITDDLLQGLDEQSVLSCNAVRVAHNIMDLVPNKAVFRQTLRFVKAWG
                     KARSIYSNTFGFPSGIGWAILTAFVCQCYPNQNAAGMVTRFFRTYHTWFKPNPHETGT
                     ENRAIYLTESMRARTHLGRGWDPRESKSDAMALFPVLTPAVPYGNTCYNVTLTNLRQL
                     CDEFQRGHDLLSKDLGMSAAEAKAKFGPFGVWSRVLEPAPFFGKFQHYLQIKVSCSDA
                     EHYQAYADGVESRIRILWAGNASSRGHTLEDYRQLRLHLNPRRFEDPEEVQLRTRLTS
                     KATGAAAAASHTRGSVGSRASGQLGDGGSSLHGNLNVKDSSAPSGPTWFTAHYFIGMT
                     VDTKVSSAKIDLAPAIRTFHTVVRELRQYREGVTRLPAITVVDMARIPTFVKEAAGYI
                     EETAAAQEERSSSEAEEARNNSSTAARADAAKRDGTSAASTTTSKPSTAASAADGSAS
                     ETSRGLHDGGAGNGAASSIDSYARKRTRDQYGTDGHGTVAAKAETSTAAGSGSGAAGR
                     AQAEEDADDIEQALGLDF"
     gene            <513479..>515161
                     /locus_tag="LMJF_14_1190"
                     /db_xref="GeneID:5650323"
     mRNA            <513479..>515161
                     /locus_tag="LMJF_14_1190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687667.1"
                     /db_xref="GeneID:5650323"
     CDS             513479..515161
                     /locus_tag="LMJF_14_1190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687719.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650323"
                     /db_xref="GOA:Q4QFL5"
                     /db_xref="InterPro:IPR000631"
                     /db_xref="InterPro:IPR004443"
                     /db_xref="InterPro:IPR017953"
                     /db_xref="InterPro:IPR029056"
                     /translation="MLSRLSERCTIATGLEQVLRHYVWSAAWLRDAEPAAAASENIDL
                     SGLMERAGRAAYDVFANLYTSQKHWLILVGSGNNGGDGYVIARHAREAGKIVTVLRMP
                     HSKPLPTEAASAQHAWKAVGGTESTMSPGAPLQLPADVDLIVDGLLGTGICGPPREQY
                     ADVIRHINGLPVPRVAIDIPSGLNAETGEAAGACVKADHTATFICLKPGLLTGQAKDY
                     VGQLHYRSLGLEDWMTAPERMRVALCRRVALDDVYEYFGIRRSALAHKGSCGKAILVG
                     GDHGFGGAALMSAEACVTVGAGLTRVLTRPEYAAPLLTRCPEAMVTAVETDTGEQLKQ
                     QMLEAFEWASTLAVGPGLGTGAYGQAALTAALRHAELHQDKTLVLDADALNLLAGCLH
                     GREGGAAAGARKHLPVLPNSIITPHPGEAARLLDCRVADVEKDRLAAARRLAAILGGT
                     CLLKGPGTIVHCHSSAKTAIVDAGNAGMASGGMGDVLTGLLAGLAAQRMHDTFDTTCA
                     GALVHGVAADMVAAEDGRGTRGIRATELIHRVPLIVNASGPSPASRQRPSGQ"
     gene            <515881..>517479
                     /locus_tag="LMJF_14_1200"
                     /db_xref="GeneID:5650324"
     mRNA            <515881..>517479
                     /locus_tag="LMJF_14_1200"
                     /product="putative phosphatidylserine synthase"
                     /transcript_id="XM_001687668.1"
                     /db_xref="GeneID:5650324"
     CDS             515881..517479
                     /locus_tag="LMJF_14_1200"
                     /EC_number="2.7.8.8"
                     /codon_start=1
                     /product="putative phosphatidylserine synthase"
                     /protein_id="XP_001687720.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650324"
                     /db_xref="GOA:Q4QFL4"
                     /db_xref="InterPro:IPR004277"
                     /db_xref="UniProtKB/TrEMBL:Q4QFL4"
                     /translation="MRRGPDDRVAHAEDRRAACRAEGGPDGATPPSSLPEKRGANGYG
                     STNTRKEGGTRRLSQLNIQLTDHPLESVSSTHRADRLLKPASPWARELDFSDCAYTPH
                     TVFILLSILMSILFMLRYYDYPNMGVASKVKVGLSAAAFAFIGFGAVHLPDSLMVRPH
                     PAVWRAVLALGVLYMVFLTFMIFQDLETVQKMMGYYDASLLNKLPERTYAQDCRMSTE
                     EDPWFFVHTSFDVFLLAHSLGYVIKMLILRDWRMVTAVSLGFEVVEVTFQHVLPNFRE
                     CWWDHIVLDVLICNAGGMLIGMWLLRQLNAKQYKWIALKEIPTVTGKAKRLLGQLGPR
                     SFERYNWNIFQSPTRFFQVTGILLLILLQELNCFTMKAILHMAPTHHIVTCRLVLWAL
                     LATSCLRELYEYMTNPRIKRIGTTAWVVILGMGMETIWITKMAIEGQYFQDAVMPTHV
                     AVPWMVAIAAFGIWLVLYFGVLSLEQRNRRRGAAYLLVNLFFYAAVVCVLALFLMGLP
                     DLQIGRQAFESAMAPYERYIFFWR"
     gene            <518761..>519546
                     /locus_tag="LMJF_14_1210"
                     /db_xref="GeneID:5650325"
     mRNA            <518761..>519546
                     /locus_tag="LMJF_14_1210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687669.1"
                     /db_xref="GeneID:5650325"
     CDS             518761..519546
                     /locus_tag="LMJF_14_1210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687721.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650325"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q4QFL3"
                     /translation="MPALKPLLVFGLRGTLVERIHVRHVPEGMPAADFTVGLVKVWLR
                     PHMVEVLNELQEHCRLAIWSSTTARNTHPLVNAVFGSNMTLQAGAGATTAAPARQEAA
                     SASAVVAASASNGRSGRFGTKRRPTKAEAADEESASEAAINAPKPQRVHFEFVWTREH
                     TRVDDFRRLNAAVNDDSHATVKDLSQVFAQFPSIAQPQNTVLIDDTPSKAKMQADNYL
                     WLDTCSNLRIKDETSLYRLRDFVMRELVPAEDVRELLPRRIRM"
     gene            <520557..>523364
                     /locus_tag="LMJF_14_1220"
                     /db_xref="GeneID:5650326"
     mRNA            <520557..>523364
                     /locus_tag="LMJF_14_1220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687670.1"
                     /db_xref="GeneID:5650326"
     CDS             520557..523364
                     /locus_tag="LMJF_14_1220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687722.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650326"
                     /db_xref="UniProtKB/TrEMBL:Q4QFL2"
                     /translation="MSVETQDVEVEVDLSKLIDVGLTFLPLQLTIKDILQRLARLEKE
                     NAIQNDHIAQLTANVAELEAAAAAQAPATDRSGDKEDKDAEAEHAALWEEMSRLNELL
                     GELQDDAERGRHTIDEIYAARKHQSSAAAAMTGASSHASLSTVSKSAATPLAHSPASG
                     ASASGIAVPAHAARAGSSAPSQRQQDPIEASGSSVPMGDIILSKAHEALELVLEAPYS
                     AFCDSRDASQRVEADHAGGLRGSKSGGQATQDSSPTSAGGTARPRRAVSIVDGPHGPQ
                     DRSSVSFPPLRDSPVLQDAHTPASPPQKTWGSSAVWTAATGGEDAGEHREATAPIIEP
                     LPSAQQQLRRPSTYAEKRMTAGAARRTSARAAAGAGGASEAGSPATPPSVFDKLRRDG
                     EDIAYLNRVVAEILGEMKGLHDDFDLLRTNRQESDDATSRPGAVVDSDGLDGLLRRLA
                     RVEGNITDARQHTQHRDNQLQEELDDLKRQLRVARGLTDDGMDALRSVADLTERVLQL
                     EKRVRALESGQGMLQEQFANVLAVGDGTGGDGALEVNAIQFAALQGAVKGLEKQLAAL
                     LVEQEGQRDWTDDIQKLNEGVRSVEADVESAQGQLQRLQKEAYRLDEVKANRTELPDD
                     SLLEKAQHCSSIGAGDGAAMSDLASRISRAEANIERISESKADRSALHKLRDELNALR
                     QLAELLNAQNRDLGDAEGGRASAAMENMLRELQGELSALKEAHNTRFAGGGLSGEDAK
                     NLMDSIERLDHCKADATLVANKAERDYVENALERLMREVEQVLNATNAGLIDTLEKSL
                     GILRDMIDGKATKQDVANLQGWMSEANIGGGAGAPDGLTGFKGFRCLGCNRPMDNMRP
                     RTLPATMTPFMNRNPQNHPQDSVTRTIQQQHAPPRAGGGGGGQAAVAGVTASSLRSAG
                     SPEGSFHRSTNSEPLPPIEPM"
     gene            <525463..>527175
                     /locus_tag="LMJF_14_1230"
                     /db_xref="GeneID:5650327"
     mRNA            <525463..>527175
                     /locus_tag="LMJF_14_1230"
                     /product="hypothetical protein"
                     /transcript_id="XM_001687671.1"
                     /db_xref="GeneID:5650327"
     CDS             525463..527175
                     /locus_tag="LMJF_14_1230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001687723.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650327"
                     /db_xref="UniProtKB/TrEMBL:Q4QFL1"
                     /translation="MRLRIERAARMEQRHFAEKELSARVDELLQTLARRILVCAPTWA
                     AQASASSRNGSTDHVSGAAALSWGGWRDAELADVRSTMTEVQELVDLHVVRPREAAAA
                     THEGGADSMRGSSSVAAELSSDASAVPASSVRFYEVFVRELIERIFGSVTKTALSSVV
                     SPDGTHGVSGAAEDDTVIVHGAAPDDASSLFPAQSVLRLPAIVYIGWRCGYSLLTSIG
                     RMLSVADDDRAASWLDVTSAALRSLLDGARTHGFHPSAVAAPTAADALHHFVVRTEMQ
                     ARSLQCLWWWCSLVFKHGYTHGLLPSPPSAPSAATPLNTPESTRTSPSTTTATAVTAA
                     GGCGSASGTTMHASFADREDYRTLWYIGRAEAAEYLSSTVLPNVAHFLHAAVAKFVFS
                     AAASPPQYWPSHAAHLTGAVQAVRDVSVHLFPSPALPTSASPSATSPSSHFQLTAATA
                     SFLRHAVHDALLPVAERVLDNPALLQDCIAPTVEAASITPGTAAPTSAYDGWDSSCEE
                     EWEGMQVKDGASRCLSRTQPAVTAAAPAEASQNTLTYTLDTLERELGDFVRADSVVMT
                     LRRL"
     gene            <528535..>529443
                     /locus_tag="LMJF_14_1240"
                     /db_xref="GeneID:5650328"
     mRNA            <528535..>529443
                     /locus_tag="LMJF_14_1240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687672.1"
                     /db_xref="GeneID:5650328"
     CDS             528535..529443
                     /locus_tag="LMJF_14_1240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687724.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650328"
                     /db_xref="UniProtKB/TrEMBL:Q4QFL0"
                     /translation="MSQEEAESRFDFNEGTGVTLGALPCFTTVSTRGAAGKALEAALE
                     PLHRIAYGRAGNNGKRRAALAGFKGFPASMEAEVAEKIAKLTKDRLRDVIKALGINVH
                     ISLSHAEVAAGVTKFLMAPRNDGKFKGSSSAAAKSKKVSPVKRPAPAGPDDESEVKKS
                     RPEPPALSSAAAAPAASSVSAASAGPSDDAVLVEVYRRVLAMTPEDRAVLGVKALRTS
                     LEEHFKLAAGGLRHKKGIITTAASECVRALKEAEMRAAAAAVQSVSDALSTPSPTSAE
                     QTAAPVPSAPEMLDSTAPAPVASPAP"
     gene            <530323..>530940
                     /locus_tag="LMJF_14_1250"
                     /db_xref="GeneID:5650329"
     mRNA            <530323..>530940
                     /locus_tag="LMJF_14_1250"
                     /product="hypothetical protein"
                     /transcript_id="XM_001687673.1"
                     /db_xref="GeneID:5650329"
     CDS             530323..530940
                     /locus_tag="LMJF_14_1250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001687725.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650329"
                     /db_xref="UniProtKB/TrEMBL:Q4QFK9"
                     /translation="MTSCETNSSRRPAPLALGVVVSVALLLLGLCGVPAQAATVTDLK
                     NAIKNELYRIDIGMTDFYSSLSVSPTVQQQYCTAAITSRAAGLSLTMESLSSPYGVLA
                     TEYGFLIYKDTFVFGPSIKLIGASAWPNGTLTTDIQSGRHILVPYLTNTVVFVTGVIE
                     NEDGRQNILPMMRLMMVDSYLCAHMHMNVANLYRKTFRTAFAELA"
     gene            <533078..>533536
                     /locus_tag="LMJF_14_1260"
                     /db_xref="GeneID:5650330"
     mRNA            <533078..>533536
                     /locus_tag="LMJF_14_1260"
                     /product="hypothetical protein"
                     /transcript_id="XM_001687674.1"
                     /db_xref="GeneID:5650330"
     CDS             533078..533536
                     /locus_tag="LMJF_14_1260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001687726.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650330"
                     /db_xref="UniProtKB/TrEMBL:Q4QFK8"
                     /translation="MESAGKGFGMLYRDMTAPPASYQWECVEDLSLQYSVAYASLTEP
                     YTVNVLTSMITVTRTESTPGVSYNLIGIACTYDGNCGDLKRGNLLTFSLRKDLIIIVT
                     GSVLSNGITNFLPVSYYVVQLASSCSSANIANVTRPFSVGASSVWMQLWQ"
     gene            <534803..>535261
                     /locus_tag="LMJF_14_1270"
                     /db_xref="GeneID:5650331"
     mRNA            <534803..>535261
                     /locus_tag="LMJF_14_1270"
                     /product="putative ubiquitin/ribosomal protein S27a"
                     /transcript_id="XM_001687675.1"
                     /db_xref="GeneID:5650331"
     CDS             534803..535261
                     /locus_tag="LMJF_14_1270"
                     /codon_start=1
                     /product="putative ubiquitin/ribosomal protein S27a"
                     /protein_id="XP_001687727.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650331"
                     /db_xref="GOA:Q4QFK7"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR002906"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="InterPro:IPR022617"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4QFK7"
                     /translation="MQIFIKDAAGRSVAVRVSAEDTVGFLKAQANVTQGNLFFAGMCL
                     AEEETLAAYGLSKESTVDVVIPVEGGKGKKKKKRIFTKPKKPTHRHKLEKMRALKYFK
                     VTENDDGSYKVERTRQDCPHPQCGAGVYMAQHKDRQYCGKCHLTYKAESK"
     gene            <536046..>537782
                     /locus_tag="LMJF_14_1280"
                     /db_xref="GeneID:5650332"
     mRNA            <536046..>537782
                     /locus_tag="LMJF_14_1280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687676.1"
                     /db_xref="GeneID:5650332"
     CDS             536046..537782
                     /locus_tag="LMJF_14_1280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687728.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650332"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR028939"
                     /db_xref="UniProtKB/TrEMBL:Q4QFK6"
                     /translation="MYTDYALLLNTVLSESGCTDASLQETAETVPLVYRTLAEHSYCL
                     LHALSVAKALLHEDDAAFAHLARAQAQRQKPAAETLSTPAPPVLSVSPSPIPPFAPSD
                     SLDMYLTIIGGGTCCELLLRLICSHGCAGGGRGAGILCGTTTRDPLVHPSHITVITRQ
                     PERLARYADLGVHCLARHHGRQAVERSDVVVLACPPAQLQEVARDLFTSAAKETATSA
                     GSSQNKTATTASSPSLPSSAAATPLLRSNAVLLFCMAGVQVRKVAQAFQHSSLDLIFT
                     PSLHTFSTHFPCAALSCDSHEPSTTVCCSVYSPTKGPPLPTKMSQAPEQCDKSLEEHS
                     IEEAGQCFTAAMAAYRSARLSEMHSSTSFLRPAVLQKAAKSAAAGPATARAATLSRVP
                     PLPGVTSYPAAAAPPRLTDFTAGRHPSTCPTLAEYLDLWRVVKAYVQATFAEEALKLS
                     RARGSAGGGPPRRRGNAETGDSYGGLVSVVLPDSTSKRHRQSEPGEVEAELLPALVLL
                     PAAQTRVLWDAWWGNSGRGGLLCRSDAAPPLPPSVTDVTGMWLCRVYTSAASLKASLD
                     DQLRHLLGDCTR"
     gene            <538740..>541145
                     /locus_tag="LMJF_14_1290"
                     /db_xref="GeneID:5650333"
     mRNA            <538740..>541145
                     /locus_tag="LMJF_14_1290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687677.1"
                     /db_xref="GeneID:5650333"
     CDS             538740..541145
                     /locus_tag="LMJF_14_1290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687729.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650333"
                     /db_xref="UniProtKB/TrEMBL:Q4QFK5"
                     /translation="MSSLIRCTDDLLHQKAVQSSHYERLERQLLDGERCRRAAVLALR
                     QRVADVKRRSKDVVDLRRENHQLADQLAQHALQLAALQCRNAESRKRESAAVERLQDG
                     IRSFTGHPARIALLVQALQAQKQLHGAGRRFSNELQMLWGLLCVRRRTLFFVAHSTRL
                     LSVQAALHVRLTSALRDRVTRCSEMREAAGRRTEIATAARVDHVMSDQQAAERLLLSV
                     KAEAGLLSVYAEALDGVCGAAGGEVAALSAVIDECDERLSAMRRTLQEKEAAVAEAKR
                     SLAAQQTAHAEASTLQEMQLVRAAEELSAAVADEESANSHAAELQRSVQLAEQDTEPL
                     ARRVYALAFLLLLCEQEQLRLSRQCAAQAEERAKAELELAQLRTWHEERLERLRASRA
                     AAANRAARDALFLKEAHGRKATLDLERDEWRLLYAQLVRDACRARAEASAAAAAAPVV
                     KRARRASVAGGRETVERVLSARPPRRKRVRAEGKSHVSAAVASRRQWAALEAVDALNL
                     ASSQRSSVGCRTTTPAYEETAVAELTSQQHRSGTAHVMVNIHATPLPPSTASSTLRPS
                     YRLTSVKPATVAKKPIRAPPAVPESLNPVSDKKRKADVGVTAAAGAVQHTPTTAAAHA
                     SAISPFTSAVGEESSDSSFSLVRNRKSAASEADSRSDISDVRLHSPSPSPRCPPGRHA
                     AAVPPVAAAHPLPRPVPRQGCGEAALATAQHVSGSALASALTACTPRSAAIGGNGERT
                     TAHPPSVPSHFTGNFAALPGVRGGTRLPHASKAVRLPRRRAPLLAAAAADLGEDLFAD
                     MFL"
     gene            <543882..>545765
                     /locus_tag="LMJF_14_1300"
                     /db_xref="GeneID:5650334"
     mRNA            <543882..>545765
                     /locus_tag="LMJF_14_1300"
                     /product="putative protein kinase"
                     /transcript_id="XM_001687678.1"
                     /db_xref="GeneID:5650334"
     CDS             543882..545765
                     /locus_tag="LMJF_14_1300"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001687730.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650334"
                     /db_xref="GOA:Q4QFK4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4QFK4"
                     /translation="MALPPATLQSPAVPDGQQHLGCSGGSGHLSVAALDQSRTPLYSA
                     ERRASLCDESGALAAVSLSADASRPTAANFVKGELIGKGSYGAVYRGMQRSNNRIIAM
                     KEIRLPGVVEQQLRQSEKLAATAASPAGVSSPVLPASNSVKGESALAKEVAAIKRELT
                     LLKQLNHPNIVRYLNDEVVDGTLRIYMDYVSGGSVTAALKSYGSFEEPQAAALCFQLL
                     QGLVYMHRRGIIHRDLKGDNLLLETSSQLKIADLGTAKSIFSSATMTTSIVGTAYFMA
                     PEVLQPSGAAVGTAADIWSVGCCLIEMMTGKPPLSDLPNQFTVMMAIGGSATVPLDKY
                     IPADNTWSDEVLDFISQCLRANPAQRPTAVDLLQHSWFAKFLNVMHAPSMSTPATLDS
                     MLTPTAPPIERPFTLSPQRQMVSPICSPNLTAALTPGYAGPQYSSGQPESSASSHTSR
                     ERKGKRDKRVSARRHARYSTSGATSATSRRSQESSQASTPQYSSGTRTRDGSAQSASL
                     PRSHSHPGRQQGPSSKRRAHAHIVGHGLPRDDSRQSFSSEQAMPQHTCTPGSGGAGDG
                     SGENKTKTAFLPAITHNGSVAPSPCGYSLDVSRCSRSLKNSGSSREPTKACLYTTDTE
                     NKS"
     STS             546214..546867
                     /standard_name="AU049322"
                     /db_xref="UniSTS:145770"
     gene            <548839..>549930
                     /locus_tag="LMJF_14_1310"
                     /db_xref="GeneID:5650335"
     mRNA            <548839..>549930
                     /locus_tag="LMJF_14_1310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687679.1"
                     /db_xref="GeneID:5650335"
     CDS             548839..549930
                     /locus_tag="LMJF_14_1310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687731.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650335"
                     /db_xref="UniProtKB/TrEMBL:Q4QFK3"
                     /translation="MYNPALPNHYRGVVFAAYVRRRQREEAAAAQQQRQPNALASALS
                     ASSLAAPSMASVTAPLLGLSAEELHQHRIKESAALGIQRAVMMEKEALEVEHKKRKLE
                     GSDARSRISSRLDKLKALAAKSKAVTGVSASLDAGDAILQAGGPSSPTSSQRTSSSSF
                     DAEAAPSAPLVFQRSSLAAGGYVMAAADPSLPGMLLRTKTRSAVQGKPSSTLLLRFLH
                     DSPVLGWKEAAIAEASTLSSAESSLCAPVLSQVQQLCRRFGFVRSMAAHVYAEDVVTA
                     ALARARSQTSAETQVPSAEAVRREQLRVWVRFDSVTEAFKAAESLAKEVSPATPAGRP
                     VFAVAFYPTGLYDSGALELREEDLLSPSA"
     gene            <551547..>552944
                     /gene="SHMT-S"
                     /locus_tag="LMJF_14_1320"
                     /db_xref="GeneID:5650336"
     mRNA            <551547..>552944
                     /gene="SHMT-S"
                     /locus_tag="LMJF_14_1320"
                     /product="serine hydroxymethyltranferase (SHMT-S)"
                     /transcript_id="XM_001687680.1"
                     /db_xref="GeneID:5650336"
     CDS             551547..552944
                     /gene="SHMT-S"
                     /locus_tag="LMJF_14_1320"
                     /EC_number="2.1.2.1"
                     /codon_start=1
                     /product="serine hydroxymethyltranferase (SHMT-S)"
                     /protein_id="XP_001687732.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650336"
                     /db_xref="GOA:Q4QFK2"
                     /db_xref="InterPro:IPR001085"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR019798"
                     /db_xref="UniProtKB/TrEMBL:Q4QFK2"
                     /translation="MASLIPTLTEQDPELANMIELEMGRQFRGLEMIASENLTSKAVL
                     ECLGSALTNKYAEGEPGNRYYGGTVFVDMVENLAKKRALAAFGLDPGEWGVNVQPYSG
                     SPANFAVYTALLEPHSRIMGLDLPSGGHLTHGFYTPKKKVSATSIYFESFPYHVKEDG
                     LIDYDALESVALVFRPKMIITGASAYARDFDYERFRHVCDEVGSLLFMDMAHTAGLIA
                     GGVLKSPFPYADVVTTTTHKSLRGPRAGMIFYRKKDRQGKPTDHESRINQAVFPGCQG
                     GPHEHQIAAIATQMREVCSQEWKAYARQVQSNARALAAALSSKGHVFVSGGTDNHLLL
                     WNVRVHGLTGSKVEKLLDAVSISVNKNTIPGDKSAMTPGGIRVGTLALTSRGMVEADM
                     STVAEFLDRAIVLAKQIQAAMNAVKLSDFVEALQTHAGAAALRKDVEAFATTFAMPSF
                     DVERIKYKDGLPEEQ"
     gene            <555542..>557236
                     /locus_tag="LMJF_14_1330"
                     /db_xref="GeneID:5650337"
     mRNA            <555542..>557236
                     /locus_tag="LMJF_14_1330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687681.1"
                     /db_xref="GeneID:5650337"
     CDS             555542..557236
                     /locus_tag="LMJF_14_1330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687733.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650337"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q4QFK1"
                     /translation="MMVRSSSSSCCCWCYSRAVHTALVCSLLVVLCIGGPSAVCGVEA
                     DDDTIRRLLAAGDKALGQGRAHYGEALSKYTAVLARWPKNERALYSRAELYSMMRERA
                     AALDDLNALLTVNKDHPQGLALRMSLNTQLGNLVDAHRDGKHLVRVYKALNKPDKSQQ
                     TSEKVHRLERYTVRWTALSDLWSQPVGAYTAATNDAVLMRKYRECVDLLARIIHEFSM
                     ESVELRLRRAACALAADDNIAATQELKYVTQRSPQNLDAIALNAQALRRLGALDQSMS
                     ELRRCLNLDPEYAPCANLHKLIRQQQRMTKNIEKRLQEKKFEAVVQLIAETRAAEPHA
                     PYEEQLAAWHCEALVSLRSTDEGIRVCQALVDRYDGANNPTVFDAHIRLAELHLLDDN
                     IAAAEAALQKAREIRQHDGKVEEMRLKIEKLKRTGPRKDYYKILGLKKTASAQEIRRA
                     YRKLAKSSHPDQLRSKDMTDREREKQEKMFRDVNEAKEVLLDEEKRARYDSGEDVNQP
                     AGQRGEPFFGSHFAGGFPGGFPGGFPGGFPGGFPGGFHQQRDGGVHQQFFFFNREN"
     gene            <559415..>560701
                     /locus_tag="LMJF_14_1340"
                     /db_xref="GeneID:5650338"
     mRNA            <559415..>560701
                     /locus_tag="LMJF_14_1340"
                     /product="delta-4 fatty acid desaturase"
                     /transcript_id="XM_001687682.1"
                     /db_xref="GeneID:5650338"
     CDS             559415..560701
                     /locus_tag="LMJF_14_1340"
                     /codon_start=1
                     /product="delta-4 fatty acid desaturase"
                     /protein_id="XP_001687734.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650338"
                     /db_xref="GOA:Q4QFK0"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR005804"
                     /db_xref="InterPro:IPR012171"
                     /db_xref="UniProtKB/TrEMBL:Q4QFK0"
                     /translation="MNQCCHSHLSTLEPMPDLKKDVLSIDGIYYDTEKLALMHPGGAM
                     VVRLCNGRECTAIFLSYHRRRFPHALYEKYQVPKDQVHPDSLIEQRQQPSYDSYLQLC
                     KRIQPIIAPTKGFAPWYFYLKAATWLAVMLGLDLYSLFYRRAYFLTVIQSLSMAMVGL
                     NVQHDANHGALSCDWRVNRILGLSQDLLGGSSISWIVNHDYVHHVYTNEPGRDADLEI
                     PLLRLHSGIPVRLAHCLQQFYIFFLEAVFGPVHVLFNIIFLAKGPSEKQRLIKTQWVV
                     SLCMLSIIPYRLLCNFLHATSFCDGLMSCVLQYAFGGFYLAYFFLLSHNFDGAKKVGT
                     SDGQDFVACQVETSCNFGGWWWGQINGGLNFQIEHHLFPRVHHGYYAYLAPIVREFCE
                     ERGFTYTHYQTIKENMMSTFRHMEQYGRGREKRKSA"
     gene            <562073..>563941
                     /locus_tag="LMJF_14_1350"
                     /db_xref="GeneID:5650339"
     mRNA            <562073..>563941
                     /locus_tag="LMJF_14_1350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687683.1"
                     /db_xref="GeneID:5650339"
     CDS             562073..563941
                     /locus_tag="LMJF_14_1350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687735.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650339"
                     /db_xref="UniProtKB/TrEMBL:Q4QFJ9"
                     /translation="MLAPSSQKPAGASPRALAQEDGSGVGVTASSTASPVPPRSSKAP
                     VPVASQFAVNDMEAVELDPAALWAALDLPAPESMPSQHTSRRVILVGRPLSGKRTLCR
                     RLCFAAEAQHAGSDDAADGGHERDAVTADNDRQPLYHPKSDDDEDAALFPNQHIGGCD
                     MPGAYSSGGALQRCTGVGPQDRANPLSHGSGVCYDYVVQRVPTRVVHDGGAAGGDSVS
                     ATQRASAGFLMTPLGGTVRRTTEFFCCDNAGALSMALPTLDHVESALVLMVVDASDVS
                     TIRQQLDYCYSTLESYVANLLRTHAPNHDEVRRMQLAAAQQEYWLAEEQKLRIVRTNL
                     ASGSSSSGTAGATTAASSPFSTKECMPDVLFKDPAANMDKVNSTTFRVPASAGTVCTM
                     RSVIVCTKIENLDRASRALGLTESGTAENEALLDRLGIPVGLRLAMRNSRQSLLGLVS
                     QLVRQYAIYHRAALASVCSRVSMTTAGAEGEYANSALVNPFYKGLWAYIAYVLYSGKD
                     PNASVPSDVLRVCSARMHPHALLPCGLDSVDLLNHFVTSSNAELPEGPSLTSPEDTAD
                     SVIRTTSENVITPDGVFSLHQRYIQQAQADLTSSAPVWGSLEEVTQGGEGMVWDSM"
     gene            565036..565857
                     /locus_tag="LMJF_14_1355"
                     /pseudo
                     /db_xref="GeneID:12981170"
     CDS             565036..565857
                     /locus_tag="LMJF_14_1355"
                     /pseudo
                     /codon_start=1
                     /product="pteridine transporter"
                     /db_xref="GeneID:12981170"
     gene            <566673..>568253
                     /gene="INO1"
                     /locus_tag="LMJF_14_1360"
                     /db_xref="GeneID:5650340"
     mRNA            <566673..>568253
                     /gene="INO1"
                     /locus_tag="LMJF_14_1360"
                     /product="inositol-3-phosphate synthase"
                     /transcript_id="XM_001687684.1"
                     /db_xref="GeneID:5650340"
     CDS             566673..568253
                     /gene="INO1"
                     /locus_tag="LMJF_14_1360"
                     /EC_number="5.5.1.4"
                     /codon_start=1
                     /product="inositol-3-phosphate synthase"
                     /protein_id="XP_001687736.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650340"
                     /db_xref="GOA:Q4QFJ8"
                     /db_xref="InterPro:IPR002587"
                     /db_xref="InterPro:IPR013021"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q4QFJ8"
                     /translation="MPAVHVKSDKVKYTPEVIESLYDYATTRVRRNTDGTVSVEPTKC
                     QLLFRTARQVPRVGVMLVGWCGNNGTTVTAGILANKLGLKWRTRHGMQSANYFGSITQ
                     SSTINLGMTRDMDEVFVPLKDLVPMVSPDNLVIGGWDCNNMNLGDAMRRAAVLDVQVQ
                     DALYDHMKKLCPLPAIFDIDFVAANQKDRANNVLDTCDRWEAVEQVRKDIRDFKSANE
                     LEKVIVLWTANTERFSEHRDGVHDTAENLLAAVKRNESELAPSTLYAMAAVLEKCSFI
                     NGAPQNTLCPGLVEMAREAKVFVGGDDFKSGQTKMKSALVEFFVGAGIKPECIASYNH
                     LGNNDGYNLSSHKQFCSKEITKSNVVDDMIKSNQVLFPEGARKPDHCIVIKYIPYVGD
                     SKRALDEYTFSIFMGGQQTVVLHNTCEDSLLAAPLIIDLIVLTELMERVTISASDDTQ
                     TPPPASFEHMETVLSILSYLLKAPAVPEGTPVVNALNRQRAAIENVLRAMIGLPPDSN
                     MLLECRVPFIREEHINGK"
     gene            <571266..>573314
                     /locus_tag="LMJF_14_1370"
                     /db_xref="GeneID:5650341"
     mRNA            <571266..>573314
                     /locus_tag="LMJF_14_1370"
                     /product="putative tyrosyl-tRNA synthetase"
                     /transcript_id="XM_001687685.1"
                     /db_xref="GeneID:5650341"
     CDS             571266..573314
                     /locus_tag="LMJF_14_1370"
                     /EC_number="6.1.1.1"
                     /codon_start=1
                     /product="putative tyrosyl-tRNA synthetase"
                     /protein_id="XP_001687737.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650341"
                     /db_xref="GOA:Q4QFJ7"
                     /db_xref="InterPro:IPR002305"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="PDB:3P0H"
                     /db_xref="PDB:3P0I"
                     /db_xref="PDB:3P0J"
                     /db_xref="UniProtKB/TrEMBL:Q4QFJ7"
                     /translation="MNTDERYKLLRSVGEECIQESELRNLIEKKPLIRCYDGFEPSGR
                     MHIAQGIFKAVNVNKCTAAGCEFVFWVADWFALMNDKVGGELEKIRIVGRYLIEVWKA
                     AGMDMDKVLFLWSSEEITSHADTYWRMVLDIGRQNTIARIKKCCTIMGKTEGTLTAAQ
                     VLYPLMQCCDIFFLKADICQLGLDQRKVNMLAREYCDLIGRKLKPVILSHHMLAGLKQ
                     GQAKMSKSDPDSAIFMEDTEEDVARKIRQAYCPRVKQSASAITDDGAPVATDDRNPVL
                     DYFQCVVYARPGAAATIDGTTYATYEDLEQAFVSDEVSEDALKSCLIDEVNALLEPVR
                     QHFASNEEAHELLEAVKSYRKDGATLPLAETALPAAPAKPHACMWMPALLKVPLDVAE
                     GMIKVTKDFIAAHPEGTVTLVLPDWSAVASDEITGVEKDISAALQVNCALLKAYGLPS
                     SVKIVTENEVILGNCDDFWVSVIGIARKNLLSHVEELYGGEVRNAGQVIAALMRVATA
                     LMLSVSHVISTSLDGHINAFAREYTKERIDCVQTLEGRIPALHRPGAAPAVLGADDVL
                     YLDDNDMDIRRKIKKAYSAPNEEANPVISVAQHLLAQHGALSIERGEANGGNVSYNTP
                     EALVADCGSGALHPADLKAAVLQLLLDRSAQARALLNGELKKNMTVLRNAEKKMAKKR
                     "
     gene            <574472..>575425
                     /locus_tag="LMJF_14_1380"
                     /db_xref="GeneID:5650342"
     mRNA            <574472..>575425
                     /locus_tag="LMJF_14_1380"
                     /product="hypothetical protein"
                     /transcript_id="XM_001687686.1"
                     /db_xref="GeneID:5650342"
     CDS             574472..575425
                     /locus_tag="LMJF_14_1380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001687738.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650342"
                     /db_xref="UniProtKB/TrEMBL:Q4QFJ6"
                     /translation="MESQADVLRQLRAHGLAMLVKDFQTLCSSLSLHNIRVEEFTFLC
                     AAVLQCDLQPRDCEVVFAFLRAERASGGGISVSHLLERLRTLFEPLEVVCALQLKCLL
                     ETRQLDYCNVSLNELQRAEAGLRSLLVDHPLDIEVGAQWEHLEDELQRLHVRFSVPVP
                     TFRLLVRRSARALRSAVRALGWDGKIQRRLWQEEGEEPRDDGVQEPLRAFDAGGLSTC
                     TVDEICNEGGVQDRSAAVFSAVAKLYHHRLALGAQSLVAAERLGPALGANVRAASRVP
                     SLTLPNSAADPTHPRFKADLYAVSPDALSCTAARREAYAAS"
     gene            <576276..>576941
                     /locus_tag="LMJF_14_1390"
                     /db_xref="GeneID:5650343"
     mRNA            <576276..>576941
                     /locus_tag="LMJF_14_1390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687687.1"
                     /db_xref="GeneID:5650343"
     CDS             576276..576941
                     /locus_tag="LMJF_14_1390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687739.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650343"
                     /db_xref="GOA:Q4QFJ5"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR015720"
                     /db_xref="UniProtKB/TrEMBL:Q4QFJ5"
                     /translation="MHFFVVCAYLAALCTVAAVLPATALRVKPTITALTFDVGKEEVC
                     LYSMGKDFYEGVTMHYHVMEGENDFDVFIRDVDGHVIYASYAGEHGAEDRVYFTTHAN
                     KEHAYCIDNRDYSGELKVIKMEVGLTSLKRWKNRIDPLRKLMTRTDGFVMGMHDDQIL
                     LRMKEQGIREWVEKIFTMLTVRLVAEAFVMAVIALLNVLSITYLFRRASLQRPLTGST
                     ARR"
     gene            <577752..>578198
                     /locus_tag="LMJF_14_1395"
                     /db_xref="GeneID:5650344"
     mRNA            <577752..>578198
                     /locus_tag="LMJF_14_1395"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687688.1"
                     /db_xref="GeneID:5650344"
     CDS             577752..578198
                     /locus_tag="LMJF_14_1395"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687740.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1395"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1395"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650344"
                     /db_xref="UniProtKB/TrEMBL:Q4QFJ4"
                     /translation="MFRRVTLPIGSSASLSTLRMAARAGSHKPTTHDWSKILPQHMTA
                     EARAALQAQSHRTVSAVVPGKMFMRHWIVAEQSTVSVVNRVISGMIAVFTMIWAAGYA
                     TLGYNGHNSAHVAGWIFIAYWLVMHTHMMWLAPTMLGLALLELALN"
     gene            <583165..>586254
                     /gene="SCGL"
                     /locus_tag="LMJF_14_1400"
                     /db_xref="GeneID:5650345"
     mRNA            <583165..>586254
                     /gene="SCGL"
                     /locus_tag="LMJF_14_1400"
                     /product="putative phosphoglycan beta 1,3
                     galactosyltransferase"
                     /transcript_id="XM_001687689.1"
                     /db_xref="GeneID:5650345"
     CDS             583165..586254
                     /gene="SCGL"
                     /locus_tag="LMJF_14_1400"
                     /codon_start=1
                     /product="putative phosphoglycan beta 1,3
                     galactosyltransferase"
                     /protein_id="XP_001687741.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650345"
                     /db_xref="GOA:Q4QFJ3"
                     /db_xref="InterPro:IPR002659"
                     /db_xref="UniProtKB/TrEMBL:Q4QFJ3"
                     /translation="MMDNCVDGGTGGDGSSHLRRSTTAEPRYGVCRRGDGDDDDYDKG
                     RSVSVLSRLLMTLGGFSWSAPTQEGGGGRAPTTTAAATTHRRRRGMVTARTLLSDGAR
                     ICFTFLFCCCCCPFTKKLLGETTRRRNSVIVATENTAENAMLVIRRTWERHRGLLVTF
                     ASAYVFLLWWVGLPLAQTAVVSLLESEELFIARLQYVGLPDALHPPTHPMAVLLQQLA
                     VPPALMSLRRVSVLPRNGGRGGAAEANPDASEGMSKSVRQQLFDRYRTRSAALAMEGL
                     RLSYTQRHPRLFFIRSSRTLTASQVPSWTLHVVEDGCAECLQGQGYAEAVKGMAVELD
                     QTSPRTAEDDSVSRAAPSQVQGAVFATSNAPLGRIGPMLLAMASVTDDVEVAAELRKW
                     RWLAPVRASEVRKDSPRAPRGSFKCASSKPYLAVLGIPSTDQPARVALREAQRQTWFT
                     YHEVARTETGFEGALLPLYIFGAVEWPAPTRQPTGAPVTPSARDDGEGTVRGGGKAAG
                     KPARLDAAYVSIDTQRLSTDPSLLLPRIDELTAAVELRTATLAAAAGATIAADQDAPL
                     LEMPTVTQRRRRMTLRPSWRNERSTDSPCDAIVDQTVRMTAASATPPSVPLLQVAQHL
                     SLPVAPLVAAPARFVCYASSALWQEALERRDSLWIDMLTDRRPATGKTVGGEGKWGLR
                     VEVGMSQKLILWLMYAYCTFPEVPFIMKGDDDTYIKVPQYLSDIRYLQRGRKTRVPPP
                     HDVDTEHATVENAQLVKSTEECVYWGSMRRWNGEVYFSAGMLLLLHRRLVQTVVEVRT
                     EFNNDVLYLAAADYSAAYAHSYYASMMDHEDVMLGKLLMERRFRADRLCPFRRHWYVW
                     EDLQRFHDLHRGRVRNVTWASVALHRCRPADAHYLHYFFAQEHRYSGSGVAAERSAEG
                     GQEGDAIPRNERAERAARQAAQSWVADRLRPVLQASGNVAERAARKFDAAALTTAEEG
                     AGWSSLPDVLWALQRDCSVHTPPYLSTRDGVAIDDVEYVPFSDGVLVLNGWKARILL"
     gene            <589403..>591070
                     /locus_tag="LMJF_14_1410"
                     /db_xref="GeneID:5650346"
     mRNA            <589403..>591070
                     /locus_tag="LMJF_14_1410"
                     /product="putative protein kinase"
                     /transcript_id="XM_001687690.1"
                     /db_xref="GeneID:5650346"
     CDS             589403..591070
                     /locus_tag="LMJF_14_1410"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001687742.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650346"
                     /db_xref="GOA:Q4QFJ2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4QFJ2"
                     /translation="MDKYTKVKNIGKGNMGTCTLARNNEDGKYYVIKQVDLTRMSKKD
                     RQQSLNEARVLSSLRHPNIINYVDSFLARKSDNLCIVMEYAESGDVCTRLKKHYGVNV
                     PERQVVDWLIQLVLSLDYVHQRKILHRDVKTQNIFLTHENLIKLGDFGIARTLANTYD
                     QAQTFVGTPYYLSPELILEQPYDHRSDVWALGVVLYEMLTLKHPFNAKDMKGLLQRIL
                     AVHYDPLPTMYSAELRDIVARMLVRDPAGRIKLDEILQIPIVRERIRQWLKEPDVVPQ
                     HYVRSLCKHHLLPDFQDEATAMPSTRSAARAAAAMAHEEWRTTSEATSAQTDGDVCAR
                     KDTDTRPHVTLGGPFSIPSTAARTAAAVCTSSADEESSDGVRPSIPPLKPYSNLPQLG
                     MASPQLYTPQLPQMHPRVQSNNRASSPSRLFRSPFSTPSVARSAALPISRQQGDPVSQ
                     SSPAPLPLQRPIARAKAPTRPYARPYVAQPHLSPSPGYLFAANPRKNPIDARRQQSSR
                     PSGPYLNPLFAAPRQMAPAYRSLVPPLPPPPDIKAMLQRAAAERARR"
     gene            <592774..>594786
                     /locus_tag="LMJF_14_1420"
                     /db_xref="GeneID:5650347"
     mRNA            <592774..>594786
                     /locus_tag="LMJF_14_1420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687691.1"
                     /db_xref="GeneID:5650347"
     CDS             592774..594786
                     /locus_tag="LMJF_14_1420"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687743.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650347"
                     /db_xref="UniProtKB/TrEMBL:Q4QFJ1"
                     /translation="MDGVEWGEAEEDLTHYLREEPPRVSALPVSIRYRTFAPPAQDTR
                     VRAGRSVRDFYLYRRRRLDSTIDAELTACGLSVVQPLQRVLTDSFAIAQRQQATYQWL
                     AQRHTADEILHRFAVDRKLNAVPCLAAVNRSLSVLGREGGADAVLDVLEDVLLDTAII
                     PLSTLLGAIKALPSHPVRAARVALTFKGSLGSQTVPPSVWGNLGAALAQASLQMPKPL
                     EDHFMELFERVLAMVSASTGRLSESLVVAFGQCLLASSKPCSAAMHLVREELLSGRSR
                     DGFTGAPLHLGAFLSDLLVGLCRDDDQRRKPRHCSADTDTLTFACDVIKYAFAVRVQL
                     APRVFDDVLALCERRKEYYRMCILFVSMCVLSTPSLVSLLRVVEVVTQIPDLRAPLQR
                     LLPFNCTGFFLWCLQRYPGLYQSPVESQSQQKATRRVCALLGCLAVEESNAEKLPALL
                     KVLTHDKGVGSIMAARAVSAAVRRFRELRCPASKAVLAALQAQHEAVLAAVLEMPSRP
                     TSPAASVPPANVTVELHRLLPSESVYCTVLSVAALATLASRPAAEQAFVRMMESYQRK
                     CGAVALLPFECVCDSFGLPDGAVRMLRTWHREHTWLTVLPLGLSLQLDGVTACEVCCA
                     AFAATQQVHKKVILICGSETEAVAAKETNVEPLIVMEALVRRLLCQ"
     gene            <595596..>600863
                     /locus_tag="LMJF_14_1430"
                     /db_xref="GeneID:5650348"
     mRNA            <595596..>600863
                     /locus_tag="LMJF_14_1430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687692.1"
                     /db_xref="GeneID:5650348"
     CDS             595596..600863
                     /locus_tag="LMJF_14_1430"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687744.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650348"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011044"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4QFJ0"
                     /translation="MASPAAADAENRAKPLHTYPESVPPSSKILAHCGFDSRHFNAVA
                     YLGDNTLLTSGGKFVLFVHVDTGAVESQDGPQDGAVGAVAVHPGGTSYVVGERCPANP
                     LLRAYGWPSRAPSKTFAGGAEVGYSTLAFNVDGSRLASVASAPDYTLAIWDWENTSLL
                     LRSKCFNSDVYSVAFSRFDDALLVTGGAGHIKFWMMADTFTGKKLQGSLGKFGRHEIS
                     DVAAFVILADGKVLSGSDGGDLLLWEGDLIACTFARAFAVDEPGAKGLGQAPHDIQPC
                     HDGAIHFVSLQGRYVVTAGDDGYMRYWDLHELEVAEGTGLPPYYAPNCLHEVCVSAAF
                     RIRSVTLDEEHQQWVILDEFGTIATLPYPLRNGKLDTTGRAGQVRLRLNGVPLTCAAV
                     SPVEHVVLTGGMDGVVRCIDYVCCAERCRMEWPRHPRKDPVPVADIKVLVPRSTAQSM
                     LAVAGFGDGTVRLLEIGQGSCSIRVAGQWKAHADGLCALAVNEDASQVASISPSGHVF
                     FFSVETAPCTLDPVGYCVGPLTNPTSAAWDTQAVGGHGGCLLGFEGGQLLSIHAPAPG
                     SVDHDEGYEFPCAYDLVAIRQRQLPPPKTEVEELELVDDTAAAALEEEDVGPWPIAFV
                     VQLPGDGFAIGMGKEELAYVYQGTIRYANRLELPPLPPTGVEPPDYVEDPALNVCYRD
                     CVPRRAFVSPNGALVVCADRNRLLLREAASRPQVFLLGAAHDSTGGAVTGAFLSPNGS
                     MVVSIGTDGLVVTQLRDGYAAPPASPPLISDATAVEPALGMVSAAAAAAAAVVAVAEE
                     VVGAAEAPALSVQEQKEADDAARAAAEREAKLQRFLNKLEKVRDAYAELVHVNEQLPP
                     GQRLNRDEMQLDASLQDALDAEKQRRVREAEKEYILPTAREDVKTAKLKNCFLDNLLY
                     DRFELAAIEEGFSVASLRLFDPHESIAKLDAAARQLAESDGESDVEKEEDGGSDSEQD
                     GAGADAPATGPAVAADSQAAGVDAAAAAHERPDDLVGMATIGASVKQQLDKMDTRRRE
                     RQERRDGYARLLDCKPNPAIDDAALKQQIAMDLKNRGDCTFRTDAAYRGEHRYRPTAV
                     AKLQRMIHLMEDIVHMKTSFNEELLKLREEKRHALARLNWMRQDYGKVLFQLGLCASP
                     EMPHLSLTVEEEPETLYTMDHDKLEAYNKQKAEERAKAEAMKAHRGFGADLAGAQAPE
                     RSRDSSTVTVGAVPGTMITSQKRSKGSHFSSYLGRGSRQSAMGSLAMRERMDADLKGK
                     LHNVALTPEEKEEREMQRAVLERDMRRLKDAMAAVRAEFNDKLESLRLRRAALDVDLC
                     LMTRCLTLFHREYQLLLIFRSQDKKLRAVLTAVKQERESVQRAIASQHTDVASSEDRI
                     RHLTAQLKSTNQAAEAYIDEHCPSDKLTYIKRVYYRQLKRRRRPEDGDDDDDDITSDD
                     DEDEDDGIGEEVRPPNCSVEAWEGMLKCRESRLDLTEASDAAKAEVANIRKQLEQSEQ
                     RLQELAEHVKQCRAEVQVLEEKKRRELNMLYTAVPLRLSQVRCLEEDARLPSHLPEQP
                     VVVISAEQMSALRQRIFDLADQKIERRDEVARLTAELQPLKEARAASNRVFEEWQNKV
                     NEVMLLRFGQYVDLEMLETCGSSWAIEAKKEELHHLELKWARSVKKVENHIAELRTRL
                     QDKVFENTNLLQNLGDLETERQRVDSVLSQATSKTVQQYCGTTVASKQERAVLRELIA
                     AQQEEIDALTAEILMLKRKGGHVYSQAMI"
     gene            <602809..>605601
                     /locus_tag="LMJF_14_1440"
                     /db_xref="GeneID:5650349"
     mRNA            <602809..>605601
                     /locus_tag="LMJF_14_1440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687693.1"
                     /db_xref="GeneID:5650349"
     CDS             602809..605601
                     /locus_tag="LMJF_14_1440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687745.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650349"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="UniProtKB/TrEMBL:Q4QFI9"
                     /translation="MYAQMPEIYLCPCCSEFSKREERERLLREARDAKEAERRRLMQL
                     DVFEERARPLPSGDVRRKAYRRIMEDDELVETAPSVPPPPKTIDDLRRAKKDQKVPKL
                     IVTVHCGRHVSAEHDDRISVIVRCGAFEGQTEKVLRGKEVMVAWEELFEFPYINHNEP
                     LEVLVVNDALPEKNDRLIGGVVIPCSALQDRSHGDQEPLPIMPEGSMQTGYGSCQEGP
                     LGTIVASWYLRGADDKMDEEAIEQQTLSVPLGCTFVVHHLFQFTDYGAEPYTGGVLCV
                     LRDTDDNCSESVLYKPGTQPEPSLSPYYGKDGYYYLPGNPSQVMQLNTERKLGHILVC
                     VPKKEESSSEEEELLVIGAVPLEFERLYNKGNAVLLIESKSKEDALWGEIEVEWVNKP
                     LDDLDPHPSLLAVQKESLFFTVVRGFNLVRRDGEPVAEGYVSVASGELEGVTVEAPAV
                     QGSDGNNVINWNQEVRFVEVDPAQKVVEVQVYEKDRLISVGQCELDDDDEGVVIVQMF
                     HAANINEEAGEVVGSYKRLHAPLPVGEDIYRKRTAAEEAAYRGADEEDEEQEEAHRAA
                     EMDESNVHEDEEEEENEEEEPQATRATPMADRDMSINEDLYEKEVDEAAPHETPQWQR
                     SQREEQRPDEEEEEAPEQQEYLEEAQSEKELQEDAEQEPQLEPEVEEELQPEEAEDAE
                     HQVEEALEEVSEPEEGEEGLQRPAAASEEVWQPEEEEHHGELHRHEYEPEEAHQSEVG
                     EFEAEHYCAASRSAGTPTSEAEAAAEAEAEAEAEAEVEAEAEVEAEAEAEAGVEAEAV
                     AAAVAETEAVAVAEAAAVAAAVAEAEAEAKAEAEAEAEAEAAYDATAGGRQRRRPSWV
                     SPATKRSGYKQPWYPSGAPETDQHIPFSKTKLSKKNIESIRQLETCKSRIEEESVRRS
                     STPRRSSTRGLSPSSQ"
     gene            <608047..>610104
                     /locus_tag="LMJF_14_1450"
                     /db_xref="GeneID:5650350"
     mRNA            <608047..>610104
                     /locus_tag="LMJF_14_1450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687694.1"
                     /db_xref="GeneID:5650350"
     CDS             608047..610104
                     /locus_tag="LMJF_14_1450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687746.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650350"
                     /db_xref="GOA:Q4QFI8"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021841"
                     /db_xref="InterPro:IPR026825"
                     /db_xref="UniProtKB/TrEMBL:Q4QFI8"
                     /translation="MTDPLALQATRKALIEGKADARTRAAQAITSRTSQLYKDVPTPE
                     AEEVIVLELRGVEEQLLRSTAAVYRRAGLLCVRAVCAGLPPQPLGSDLLMHLLDPVLR
                     SMGDADPIVRIAAIEACYELVRHHGAEAFGARFTDLFTALSIAVSDRDKRVFLLAEEV
                     SCTLKESVSRSGASAVDMNTFASFVSDTLGNYISTSGPLVIDVAAAVSQWILQWLRFV
                     LELPGCHFATSMASLLRVLLAASVSNDTNVFHILRECRHSVSQRYSADTAADVCEVVG
                     ALCTCVHDTTSARTRVFCLEWLSELVHLGIHDDIFQLNLSRVLQATLPALSSVDGSTH
                     AAAVTTNQEVQHAIVSVGDGVSAGVIDVLLRSILELLDSGAGEETLIGGLEWLLVLHH
                     LAPATSENLLSNVLGRITMLLDVAPENVALRGTEVACVLTNNSHFSELVQLVLHRLLH
                     HNQDGQLLRRFPDVVRRLHTLRSGLEQDDFREGVLVHFARALSCMTDLRFVSKVVLSL
                     QAMLATFPELDDVRTLLRRGLTNTNAAAMFSTLLPCWRYNAVALLSLGLLCRHFVFTR
                     HICEHLGEGEMSVATYVQLDHLVQQLESSTFTFLRVSLLHPTACPALVQTLYVLLLLL
                     PQSSPHYAMLSRRLQPVTVLVQLDKVAAEPLAAAEQVEVSAADWEQYISAQEALLQYE
                     QAL"
     gene            <610835..>611257
                     /locus_tag="LMJF_14_1460"
                     /db_xref="GeneID:5650351"
     mRNA            <610835..>611257
                     /locus_tag="LMJF_14_1460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687695.1"
                     /db_xref="GeneID:5650351"
     CDS             610835..611257
                     /locus_tag="LMJF_14_1460"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687747.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650351"
                     /db_xref="GOA:Q4QFI7"
                     /db_xref="InterPro:IPR005336"
                     /db_xref="UniProtKB/TrEMBL:Q4QFI7"
                     /translation="MSSTVTGQAIPKLFPKAFHSWVGTGRIFNFLAPYEQNRVIAYLN
                     SIYNTAPLFKWSLSIVPLYGIVSGYPPVEKIDFNSSAALCATGMVWFVYALLIQPQNS
                     GSRSLALVNICLATVNGYNCYRSAQHKRRQAVNANRIE"
     gene            <612671..>614125
                     /locus_tag="LMJF_14_1470"
                     /db_xref="GeneID:5650352"
     mRNA            <612671..>614125
                     /locus_tag="LMJF_14_1470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687696.1"
                     /db_xref="GeneID:5650352"
     CDS             612671..614125
                     /locus_tag="LMJF_14_1470"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687748.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650352"
                     /db_xref="UniProtKB/TrEMBL:Q4QFI6"
                     /translation="MFSKGYCVLLRPYQHVAFAKRSSAGGVNLNKGALTKRERGDSFT
                     EPEVYRSKTNLTAMLKTRRKERGLLKEEKQRTMMDHLNLDTRTAEALHAGRRLPQTPA
                     EIQAVRSSDDALVEDSHGSQDYSTTMRNLMRREVDRRDHMADKFGQPPTSREFYQLFR
                     KLRSADSEEEAVEQHQRRLVEEHGVYPSSRIDSFMMDDDSYFPDWVHALPYSIRDRVK
                     YGSLGLTEDDEALRVRLARLPRDARLREWKRLKAAKEYSAATEETLTLAELRDARQGK
                     RRFHWLQRKRQKRAAALRRMAMRKPDGYELWPSSVKDFSQRIAFIAQHVENGLQTGGE
                     WPLNEDALTKAKIKRRQSEAERTFLMSPDEKKMATSAGGSSMHGGMKELLDSLDEPEK
                     RYTKLSRKTYANRVNAIVHGDQDEHGRQYRRLHNLATRRQRRYDSLAEMALEKELRKE
                     PLVNVSGLNHTDDEHWSRHEKSWVEGMPSTRYGS"
     gene            <614886..>615821
                     /locus_tag="LMJF_14_1480"
                     /db_xref="GeneID:5650353"
     mRNA            <614886..>615821
                     /locus_tag="LMJF_14_1480"
                     /product="putative glutathione-S-transferase/glutaredoxin"
                     /transcript_id="XM_001687697.1"
                     /db_xref="GeneID:5650353"
     CDS             614886..615821
                     /locus_tag="LMJF_14_1480"
                     /codon_start=1
                     /product="putative glutathione-S-transferase/glutaredoxin"
                     /protein_id="XP_001687749.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650353"
                     /db_xref="GOA:Q4QFI5"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q4QFI5"
                     /translation="MFGRGTFSRKVLVGTTVAGFVGVGAGYTMYQRRLRDNRSVTAEA
                     FNAMQDATKLDEAFKKLCDPKEHPLIQFYRYTTCPWCGTVKAFLDYNKIPHECVEVEP
                     MFKTELAESLYKKVPQLRFESEAGARSYLVDSQIIVDTLSEKMGLGGQLKDEDVNKWR
                     TWARSSLVRFVTLEFNHSLPAAWAGYSYIDSCDTIPYANKLFLKVIGAPVMYLVAMMV
                     TKPRLVKAGLMKPDDDPKQRLHDEVNRFTAEALVDPKSKKPRTFHGGRKPDLVDLDTY
                     GVLQSVRNHRIYNEMVTETQIGPWLEAMDRLMGKV"
     gene            <617185..>619722
                     /locus_tag="LMJF_14_1490"
                     /db_xref="GeneID:5650354"
     mRNA            <617185..>619722
                     /locus_tag="LMJF_14_1490"
                     /product="putative inositol 5'-phosphatase"
                     /transcript_id="XM_001687698.1"
                     /db_xref="GeneID:5650354"
     CDS             617185..619722
                     /locus_tag="LMJF_14_1490"
                     /codon_start=1
                     /product="putative inositol 5'-phosphatase"
                     /protein_id="XP_001687750.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.14.1490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.14.1490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650354"
                     /db_xref="GOA:Q4QFI4"
                     /db_xref="InterPro:IPR002013"
                     /db_xref="UniProtKB/TrEMBL:Q4QFI4"
                     /translation="MQANSPTARPAGSQGRHRCAIAVKNNVQYLFVVMPKPKPPPEVE
                     LEPLMFFDALPPTTPTAPDPRQTEDMYMPKRDSVEDAIAIPLEVNGSGQLQRSLAFPA
                     TDFASLAEVQQQGGPFTSFQEYPALFGCLTIDRVYVLVATAVTAAVPLPFAGVIYSVT
                     GTAWVPFDIPGVAPVRVSPTDRVRLREFQEYAFCKGYYYSDDVNVMLPFPFTKPANCA
                     PPDMSCDWSYHLREPFSACSLTAACSVLVRGFAGERVCTLKDGTELHLVLLGRQSNVN
                     PGPRYLSRGLNTANGAGNDHYYEYILWKHHGPDTVTFTRHSFLRGTIPVHWTTQMTMS
                     LSEPTMIFSSDKAEVLRGSATYFAHMFQELKHVMLLDTNGQAATNPQVRCINLLRLHP
                     KSGEDVLARHFLDAVRASDVVIKQSFPGGSLDLVHVDWLNLVKEYGIDVATSTFWEAS
                     MEFLATASTAADSMMTVGMIHGNGEVVRLITQSRFVRLNCADSLDRTNLACFLTCLQL
                     SVAMLITQRIPHGSFQDSPPVPRLDASEEVAQEGGYAAAFAPMSGAKQTVPKPFMNTW
                     NEARDPQRIPPLMVRALAELFVNNGDCVAMLYTNSAAMHGNILRGVCGMRLQGHNAVI
                     ATQRKFENVFEDRKKLRGIEVLLGRNRGDHFPSISPAFLLRPVPYTQWACALVVLGVP
                     DNVTTREVDAAVRRAWDTRVMPQLAVCQLPPIESRALVFTVTLSAASTTHERDDLAQS
                     LQQSTLGGVPPEEALEDAKPENGTPPPRTERLAIIEFDPDLCIVVDVARLLRQQGYLP
                     LGSNNCVLAPYAYPVQTASDSKTMSGAVKNVGTSLKRGLTSLMRGLN"
CONTIG      join(FR796410.1:1..622644)
//
DBGET integrated database retrieval system