GenomeNet

Database: RefSeq
Entry: NC_007258
LinkDB: NC_007258
Original site: NC_007258 
LOCUS       NC_007258             684829 bp    DNA     linear   CON 18-JUN-2017
DEFINITION  Leishmania major strain Friedlin complete genome, chromosome 17.
ACCESSION   NC_007258 CT005256
VERSION     NC_007258.2
DBLINK      BioProject: PRJNA15564
            BioSample: SAMEA3138173
            Assembly: GCF_000002725.2
KEYWORDS    RefSeq; complete genome.
SOURCE      Leishmania major strain Friedlin
  ORGANISM  Leishmania major strain Friedlin
            Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae;
            Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Rogers,M.B., Hilley,J.D., Dickens,N.J., Wilkes,J., Bates,P.A.,
            Depledge,D.P., Harris,D., Her,Y., Herzyk,P., Imamura,H., Otto,T.D.,
            Sanders,M., Seeger,K., Dujardin,J.C., Berriman,M., Smith,D.F.,
            Hertz-Fowler,C. and Mottram,J.C.
  TITLE     Chromosome and gene copy number variation allow major structural
            change between species and strains of Leishmania
  JOURNAL   Genome Res. 21 (12), 2129-2142 (2011)
   PUBMED   22038252
REFERENCE   2
  AUTHORS   Ivens,A.C., Peacock,C.S., Worthey,E.A., Murphy,L., Aggarwal,G.,
            Berriman,M., Sisk,E., Rajandream,M.A., Adlem,E., Aert,R.,
            Anupama,A., Apostolou,Z., Attipoe,P., Bason,N., Bauser,C., Beck,A.,
            Beverley,S.M., Bianchettin,G., Borzym,K., Bothe,G., Bruschi,C.V.,
            Collins,M., Cadag,E., Ciarloni,L., Clayton,C., Coulson,R.M.,
            Cronin,A., Cruz,A.K., Davies,R.M., De Gaudenzi,J., Dobson,D.E.,
            Duesterhoeft,A., Fazelina,G., Fosker,N., Frasch,A.C., Fraser,A.,
            Fuchs,M., Gabel,C., Goble,A., Goffeau,A., Harris,D.,
            Hertz-Fowler,C., Hilbert,H., Horn,D., Huang,Y., Klages,S.,
            Knights,A., Kube,M., Larke,N., Litvin,L., Lord,A., Louie,T.,
            Marra,M., Masuy,D., Matthews,K., Michaeli,S., Mottram,J.C.,
            Muller-Auer,S., Munden,H., Nelson,S., Norbertczak,H., Oliver,K.,
            O'neil,S., Pentony,M., Pohl,T.M., Price,C., Purnelle,B.,
            Quail,M.A., Rabbinowitsch,E., Reinhardt,R., Rieger,M., Rinta,J.,
            Robben,J., Robertson,L., Ruiz,J.C., Rutter,S., Saunders,D.,
            Schafer,M., Schein,J., Schwartz,D.C., Seeger,K., Seyler,A.,
            Sharp,S., Shin,H., Sivam,D., Squares,R., Squares,S., Tosato,V.,
            Vogt,C., Volckaert,G., Wambutt,R., Warren,T., Wedler,H.,
            Woodward,J., Zhou,S., Zimmermann,W., Smith,D.F., Blackwell,J.M.,
            Stuart,K.D., Barrell,B. and Myler,P.J.
  TITLE     The genome of the kinetoplastid parasite, Leishmania major
  JOURNAL   Science 309 (5733), 436-442 (2005)
   PUBMED   16020728
REFERENCE   3  (bases 1 to 684829)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 684829)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire, CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR796413.
            On Jun 1, 2012 this sequence version replaced NC_007258.1.
            Data release policy www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..684829
                     /organism="Leishmania major strain Friedlin"
                     /mol_type="genomic DNA"
                     /strain="Friedlin"
                     /db_xref="taxon:347515"
                     /chromosome="17"
     gene            complement(<9661..>11985)
                     /locus_tag="LMJF_17_0010"
                     /db_xref="GeneID:5650881"
     mRNA            complement(<9661..>11985)
                     /locus_tag="LMJF_17_0010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682198.1"
                     /db_xref="GeneID:5650881"
     CDS             complement(9661..11985)
                     /locus_tag="LMJF_17_0010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682250.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650881"
                     /db_xref="UniProtKB/TrEMBL:Q4QEJ8"
                     /translation="MDRAATSDARARSSLSKAQEHLKNNDVKEAIDALSSHLRFNQVT
                     PIGFECLELLADLCLTQEKLEPVKLIEVLRRCRSGLRGSQHMEESVQRIVDSVMIRIR
                     QMCAKAKERAEAMQVNATEGDRMLAALNGISLAALAEKRHIIPCHAALRRLIRHFCGN
                     NTIGFAKKLTFIYNKTVRQFLYMCKEFNAPACVLDISSAVSRAVSHMALDHLHDHDDA
                     ASRNAVQELLKERAAFLTSTSAVTETVETLCCLLNDICSLRQYGGAFDVLSCLKRVCD
                     KVQRNEEFVDVVSGAYETMSDIFWTCSVYNYHAYCLSVAASMKRQEKRGPLAARAVLA
                     SLCVADGDMELDPFGRYREKNARIDELFESPITTKTSLIANLKTKGVHTLASPDIVKI
                     AANLEDPNFSDFTGLHKSVTALTAANSDLARYGNELHKMILRYQLEVLSGTCNYVEVL
                     SLAAYNGNLTAAEYVNNIEPVILGDDSVSVDIDTRTNTLSFRDSSKAKMLSYFNKIVA
                     NVDTVPASSLATTSGRYSDFTHVAASSSKREVMPLAADLDAARARSTSIYALQKACMN
                     SKAERIEEAKKSEDKKRERAVAERREQEEAKKEETQKAYIRKLYAEYNERQRQERGKE
                     VLRKLRIKYPGFKVDESIVYRSAAGFEDELTRLLAAFKRRGVDNDRKEILQANLYERA
                     LRALEIPKRKDYEAQNAERTRAERAAARENYLAEHRREYDRRQNEKAVLSKFLHDADE
                     FERTWRKRANIDKPSKRDEQQRLLEEEMRRLGGE"
     gene            complement(<14273..>14938)
                     /locus_tag="LMJF_17_0020"
                     /db_xref="GeneID:5650725"
     mRNA            complement(<14273..>14938)
                     /locus_tag="LMJF_17_0020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682199.1"
                     /db_xref="GeneID:5650725"
     CDS             complement(14273..14938)
                     /locus_tag="LMJF_17_0020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682251.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650725"
                     /db_xref="InterPro:IPR021910"
                     /db_xref="UniProtKB/TrEMBL:Q4QEJ7"
                     /translation="MWAGENSGILFITTVLSHVALLPTIHFFYRRKYIFELCCASFGF
                     LASFMYHTTESFGTSIFLTEVAWHRLDNVGVISILGIWYVYLCCFQNPYVDISCKCFC
                     IFFTLVVQQKNPWDVRFTVSPILFFTLFPVVKHCLFEQRLPLFSARHLGCGVFLFFFA
                     AIFFFLGLNKHADRYRMYHGAWHFFGGLSSFFLWEMVKTPGCTGSYGIQRRDCPLRGD
                     TMV"
     gene            complement(<15699..>16376)
                     /locus_tag="LMJF_17_0025"
                     /db_xref="GeneID:5650726"
     mRNA            complement(<15699..>16376)
                     /locus_tag="LMJF_17_0025"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682200.1"
                     /db_xref="GeneID:5650726"
     CDS             complement(15699..16376)
                     /locus_tag="LMJF_17_0025"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682252.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0025"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0025"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650726"
                     /db_xref="InterPro:IPR021910"
                     /db_xref="UniProtKB/TrEMBL:Q4QEJ6"
                     /translation="MAHRPEDSKYALFFTCVLSHLPMVAVVAFLVRRDLRFEGVVGAY
                     SVTVSLMYHTCECFETSLFMSQGRWHRLDNIGAIVSVGCSCIQLACFENRILLEYLQY
                     IILFIVIILQEAAPWDVRYTIVPIAVCIALPIVSHLLNPRRRQGFVLPRVLNGLVALV
                     LGGVFFAMGLDESNDPVRIYHGFFHICITITIFFFFYALRPSAERKRRSLHLPSCDDA
                     VAVMVNL"
     gene            complement(<18084..>18722)
                     /locus_tag="LMJF_17_0030"
                     /db_xref="GeneID:5650727"
     mRNA            complement(<18084..>18722)
                     /locus_tag="LMJF_17_0030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682201.1"
                     /db_xref="GeneID:5650727"
     CDS             complement(18084..18722)
                     /locus_tag="LMJF_17_0030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682253.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650727"
                     /db_xref="GOA:Q4QEJ5"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q4QEJ5"
                     /translation="MYFVSPVPSHAPLSQSEEAITRGSVMQGNLHTKAAAAASVASVP
                     AGSHDASCANLSDYLNEDSVVGDLETYDVGEYHLTTCPICLEHFTLDNPAILLKCEHG
                     FHLQCLESWRQRSSMCPMCFAPVVGDQGRLMSSCDVRTRRRMQRKPPAAPHRAAERNA
                     LITPTASQRIPQSNCEVEHASEQDEEIEVIEVTSGKGSVHWVWSWLRKCCAF"
     gene            complement(<19557..>20345)
                     /locus_tag="LMJF_17_0040"
                     /db_xref="GeneID:5650728"
     mRNA            complement(<19557..>20345)
                     /locus_tag="LMJF_17_0040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682202.1"
                     /db_xref="GeneID:5650728"
     CDS             complement(19557..20345)
                     /locus_tag="LMJF_17_0040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682254.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650728"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:Q4QEJ4"
                     /translation="MRRWTASAAPAAVQRQSCLLALRCATTGVQHSYKPGCFVLALRS
                     LFVTLTPTSLKRRIAIRMQTGMERTEELERELQWLQKHGSPLQVMGLPNHAELAEVRA
                     RYRSLVLETHPDTAKNTTGESEYAILQTAYKMCVNPASLWHQNGASPALHRQLLRVSK
                     KKLRRIDRVHVFATFSYAVMLAIGVFFSTVVVSNGLEAALKFFDPEFYHFMVQQEKEE
                     DRKRAAGEVVDTDPKRLAPTAVRRLLFPGQFIHEGDESEARRGE"
     gene            complement(<21108..>21818)
                     /locus_tag="LMJF_17_0050"
                     /db_xref="GeneID:5650729"
     mRNA            complement(<21108..>21818)
                     /locus_tag="LMJF_17_0050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682203.1"
                     /db_xref="GeneID:5650729"
     CDS             complement(21108..21818)
                     /locus_tag="LMJF_17_0050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682255.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650729"
                     /db_xref="UniProtKB/TrEMBL:Q4QEJ3"
                     /translation="MGQAFMEDQGNSLVVWGSTGRRLQFSMQDLKMPASLRDTPHFHF
                     YEKQWDAVASFWFNRVLKESALQHLSVEAIVELIRQDISKRWERRREEQSIYKKRKRL
                     LQRSGPAGTPSASVLLTNVTTLDGYQAATEMEQRDLVTALVERVEDVANDKVESWQVL
                     VDDASEQRPAKAARVEGTAATSGEHPENDADGASDFDDRVAVVLKLSSKEKAATTIAH
                     LHGSRFDDRRVLCRFWSE"
     gene            complement(<23387..>25048)
                     /locus_tag="LMJF_17_0060"
                     /db_xref="GeneID:5650730"
     mRNA            complement(<23387..>25048)
                     /locus_tag="LMJF_17_0060"
                     /product="putative mitogen-activated protein kinase kinase
                     3"
                     /transcript_id="XM_001682204.1"
                     /db_xref="GeneID:5650730"
     CDS             complement(23387..25048)
                     /locus_tag="LMJF_17_0060"
                     /codon_start=1
                     /product="putative mitogen-activated protein kinase kinase
                     3"
                     /protein_id="XP_001682256.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650730"
                     /db_xref="GOA:Q4QEJ2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:Q4QEJ2"
                     /translation="MDFYALQDSLLRNAKSGGSSDTGDVESRYVLMEKIGSGSYGDVW
                     SATRRTGAKDIYAVKRIDKRQAGTKGLRSVMGEVETMSLLSHPNIVKLEETYQDEACL
                     SIVMEYLPGGSLQHRIDRQSVSELETRRFITQLLMAVEYIHEKGIVHRDLKPSNCLLS
                     QNDLVVKISDFGLSVFAGSKQCLTTCCGTLHFMAPEILLEKNYGKPVDMWAMGVMAHV
                     MFLGCYPFQARTEAALTKEICRGYRPREEGAGGLRCPPLLLDFISQLLLYDPHRRMSA
                     KDALKHPWIKEGLEANRRTSLYPSQAPSATAMKPSARWRAAVLAVMGVQRLLYLQKIQ
                     RLVRLGYDGFPILRDYRYLVTGKYVPASTSVECSHMFHARPMALLELISMIDTCPFLK
                     HVDLSWNNIHSLSVIQSLLKVVTRHPSLQSIDLSHNPIPAVAGRSIVRLIRNPLSQVT
                     CINVGDTGISADTIGQINSFLKEKLTPAALSYSVSTGDMQSRLTQGSGDDALMTSSLT
                     MVSSLQQKRSIGSGPPKQPAKKESRGVRLPPISRPPVARRHGKMP"
     gene            complement(<26164..>26727)
                     /gene="ARL-1"
                     /locus_tag="LMJF_17_0070"
                     /db_xref="GeneID:5650731"
     mRNA            complement(<26164..>26727)
                     /gene="ARL-1"
                     /locus_tag="LMJF_17_0070"
                     /product="ADP-ribosylation factor-like protein 1"
                     /transcript_id="XM_001682205.1"
                     /db_xref="GeneID:5650731"
     CDS             complement(26164..26727)
                     /gene="ARL-1"
                     /locus_tag="LMJF_17_0070"
                     /codon_start=1
                     /product="ADP-ribosylation factor-like protein 1"
                     /protein_id="XP_001682257.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650731"
                     /db_xref="GOA:Q4QEJ1"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PDB:2X77"
                     /db_xref="UniProtKB/TrEMBL:Q4QEJ1"
                     /translation="MGAWLASLKQTLGLLPADRKIRVLMLGLDNAGKTSILYRLHLGD
                     VVTTVPTVGVNLETLQYKNISFEVWDLGGQTGVRPYWRCYFSDTDAVIYVVDSTDRDR
                     MGVAKHELYALLDEDELRKSLLLIFANKQDLPDAASEAEIAEQLGVSSIMNRTWTIVK
                     SSSKTGDGLVEGMDWLVERLREQGLGA"
     gene            complement(<28653..>30002)
                     /locus_tag="LMJF_17_0080"
                     /db_xref="GeneID:5650721"
     mRNA            complement(<28653..>30002)
                     /locus_tag="LMJF_17_0080"
                     /product="elongation factor 1-alpha"
                     /transcript_id="XM_001682206.1"
                     /db_xref="GeneID:5650721"
     CDS             complement(28653..30002)
                     /locus_tag="LMJF_17_0080"
                     /codon_start=1
                     /product="elongation factor 1-alpha"
                     /protein_id="XP_001682258.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0080"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0081"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0083"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0084"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0085"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0086"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0081"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0083"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0084"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0085"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0086"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650721"
                     /db_xref="GOA:Q4QEI9"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004160"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR004539"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QEI9"
                     /translation="MGKDKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEK
                     EAAEIGKASFKYAWVLDKLKAERERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNM
                     ITGTSQADAAILMIDSTHGGFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKTV
                     TYAQSRYDEISKEVGAYLKRVGYNPEKVRFIPISGWQGDNMIEKSDNMPWYKGPTLLD
                     ALDMLEPPVRPVDKPLRLPLQDVYKIGGIGTVPVGRVETGIMKPGDVVTFAPANVTTE
                     VKSIEMHHEQLAEAQPGDNVGFNVKNVSVKDIRRGNVCGNSKNDPPKEAADFTAQVIV
                     LNHPGQISNGYAPVLDCHTSHIACRFAEIESKIDRRSGKELEKNPKAIKSGDAAIVKM
                     VPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKGVNKKEGSGGKVTKAAAKASKK"
     gene            complement(<30849..>32198)
                     /locus_tag="LMJF_17_0081"
                     /db_xref="GeneID:5650722"
     mRNA            complement(<30849..>32198)
                     /locus_tag="LMJF_17_0081"
                     /product="elongation factor 1-alpha"
                     /transcript_id="XM_001682207.1"
                     /db_xref="GeneID:5650722"
     CDS             complement(30849..32198)
                     /locus_tag="LMJF_17_0081"
                     /codon_start=1
                     /product="elongation factor 1-alpha"
                     /protein_id="XP_001682259.1"
                     /db_xref="GeneID:5650722"
                     /db_xref="GOA:Q4QEI9"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004160"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR004539"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QEI9"
                     /translation="MGKDKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEK
                     EAAEIGKASFKYAWVLDKLKAERERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNM
                     ITGTSQADAAILMIDSTHGGFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKTV
                     TYAQSRYDEISKEVGAYLKRVGYNPEKVRFIPISGWQGDNMIEKSDNMPWYKGPTLLD
                     ALDMLEPPVRPVDKPLRLPLQDVYKIGGIGTVPVGRVETGIMKPGDVVTFAPANVTTE
                     VKSIEMHHEQLAEAQPGDNVGFNVKNVSVKDIRRGNVCGNSKNDPPKEAADFTAQVIV
                     LNHPGQISNGYAPVLDCHTSHIACRFAEIESKIDRRSGKELEKNPKAIKSGDAAIVKM
                     VPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKGVNKKEGSGGKVTKAAAKASKK"
     gene            complement(<33058..>34407)
                     /locus_tag="LMJF_17_0082"
                     /db_xref="GeneID:5650723"
     mRNA            complement(<33058..>34407)
                     /locus_tag="LMJF_17_0082"
                     /product="elongation factor 1-alpha"
                     /transcript_id="XM_001682208.1"
                     /db_xref="GeneID:5650723"
     CDS             complement(33058..34407)
                     /locus_tag="LMJF_17_0082"
                     /codon_start=1
                     /product="elongation factor 1-alpha"
                     /protein_id="XP_001682260.1"
                     /db_xref="GeneID:5650723"
                     /db_xref="GOA:Q4QEI8"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004160"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR004539"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QEI8"
                     /translation="MGKDKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEK
                     EAAEIGKASFKYAWVLDKLKAERERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNM
                     ITGTSQADAAILMIDSTHGGFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKTV
                     TYAQSRYDEISKEVGAYLKRVGYNPEKVRFIPISGWQGDNMIEKSDNMPWYKGPTLLD
                     ALGMLEPPVRPVDKPLRLPLQDVYKIGGIGTVPVGRVETGIMKPGDVVTFAPANVTTE
                     VKSIEMHHEQLAEAQPGDNVGFNVKNVSVKDIRRGNVCGNSKNDPPKEAADFTAQVIV
                     LNHPGQISNGYAPVLDCHTSHIACRFAEIESKIDRRSGKELEKNPKAIKSGDAAIVKM
                     VPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKGVNKKEGSGGKVTKAAAKASKK"
     gene            complement(<35254..>36603)
                     /locus_tag="LMJF_17_0083"
                     /db_xref="GeneID:5650724"
     mRNA            complement(<35254..>36603)
                     /locus_tag="LMJF_17_0083"
                     /product="elongation factor 1-alpha"
                     /transcript_id="XM_001682209.1"
                     /db_xref="GeneID:5650724"
     CDS             complement(35254..36603)
                     /locus_tag="LMJF_17_0083"
                     /codon_start=1
                     /product="elongation factor 1-alpha"
                     /protein_id="XP_001682261.1"
                     /db_xref="GeneID:5650724"
                     /db_xref="GOA:Q4QEI9"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004160"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR004539"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QEI9"
                     /translation="MGKDKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEK
                     EAAEIGKASFKYAWVLDKLKAERERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNM
                     ITGTSQADAAILMIDSTHGGFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKTV
                     TYAQSRYDEISKEVGAYLKRVGYNPEKVRFIPISGWQGDNMIEKSDNMPWYKGPTLLD
                     ALDMLEPPVRPVDKPLRLPLQDVYKIGGIGTVPVGRVETGIMKPGDVVTFAPANVTTE
                     VKSIEMHHEQLAEAQPGDNVGFNVKNVSVKDIRRGNVCGNSKNDPPKEAADFTAQVIV
                     LNHPGQISNGYAPVLDCHTSHIACRFAEIESKIDRRSGKELEKNPKAIKSGDAAIVKM
                     VPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKGVNKKEGSGGKVTKAAAKASKK"
     gene            complement(<37450..>38799)
                     /locus_tag="LMJF_17_0084"
                     /db_xref="GeneID:5650732"
     mRNA            complement(<37450..>38799)
                     /locus_tag="LMJF_17_0084"
                     /product="elongation factor 1-alpha"
                     /transcript_id="XM_001682210.1"
                     /db_xref="GeneID:5650732"
     CDS             complement(37450..38799)
                     /locus_tag="LMJF_17_0084"
                     /codon_start=1
                     /product="elongation factor 1-alpha"
                     /protein_id="XP_001682262.1"
                     /db_xref="GeneID:5650732"
                     /db_xref="GOA:Q4QEI9"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004160"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR004539"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QEI9"
                     /translation="MGKDKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEK
                     EAAEIGKASFKYAWVLDKLKAERERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNM
                     ITGTSQADAAILMIDSTHGGFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKTV
                     TYAQSRYDEISKEVGAYLKRVGYNPEKVRFIPISGWQGDNMIEKSDNMPWYKGPTLLD
                     ALDMLEPPVRPVDKPLRLPLQDVYKIGGIGTVPVGRVETGIMKPGDVVTFAPANVTTE
                     VKSIEMHHEQLAEAQPGDNVGFNVKNVSVKDIRRGNVCGNSKNDPPKEAADFTAQVIV
                     LNHPGQISNGYAPVLDCHTSHIACRFAEIESKIDRRSGKELEKNPKAIKSGDAAIVKM
                     VPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKGVNKKEGSGGKVTKAAAKASKK"
     gene            complement(<39658..>41007)
                     /locus_tag="LMJF_17_0085"
                     /db_xref="GeneID:5650733"
     mRNA            complement(<39658..>41007)
                     /locus_tag="LMJF_17_0085"
                     /product="elongation factor 1-alpha"
                     /transcript_id="XM_001682211.1"
                     /db_xref="GeneID:5650733"
     CDS             complement(39658..41007)
                     /locus_tag="LMJF_17_0085"
                     /codon_start=1
                     /product="elongation factor 1-alpha"
                     /protein_id="XP_001682263.1"
                     /db_xref="GeneID:5650733"
                     /db_xref="GOA:Q4QEI9"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004160"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR004539"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QEI9"
                     /translation="MGKDKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEK
                     EAAEIGKASFKYAWVLDKLKAERERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNM
                     ITGTSQADAAILMIDSTHGGFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKTV
                     TYAQSRYDEISKEVGAYLKRVGYNPEKVRFIPISGWQGDNMIEKSDNMPWYKGPTLLD
                     ALDMLEPPVRPVDKPLRLPLQDVYKIGGIGTVPVGRVETGIMKPGDVVTFAPANVTTE
                     VKSIEMHHEQLAEAQPGDNVGFNVKNVSVKDIRRGNVCGNSKNDPPKEAADFTAQVIV
                     LNHPGQISNGYAPVLDCHTSHIACRFAEIESKIDRRSGKELEKNPKAIKSGDAAIVKM
                     VPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKGVNKKEGSGGKVTKAAAKASKK"
     gene            complement(<41867..>43216)
                     /locus_tag="LMJF_17_0086"
                     /db_xref="GeneID:5650734"
     mRNA            complement(<41867..>43216)
                     /locus_tag="LMJF_17_0086"
                     /product="elongation factor 1-alpha"
                     /transcript_id="XM_001682212.1"
                     /db_xref="GeneID:5650734"
     CDS             complement(41867..43216)
                     /locus_tag="LMJF_17_0086"
                     /codon_start=1
                     /product="elongation factor 1-alpha"
                     /protein_id="XP_001682264.1"
                     /db_xref="GeneID:5650734"
                     /db_xref="GOA:Q4QEI9"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004160"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR004539"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QEI9"
                     /translation="MGKDKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEK
                     EAAEIGKASFKYAWVLDKLKAERERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNM
                     ITGTSQADAAILMIDSTHGGFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKTV
                     TYAQSRYDEISKEVGAYLKRVGYNPEKVRFIPISGWQGDNMIEKSDNMPWYKGPTLLD
                     ALDMLEPPVRPVDKPLRLPLQDVYKIGGIGTVPVGRVETGIMKPGDVVTFAPANVTTE
                     VKSIEMHHEQLAEAQPGDNVGFNVKNVSVKDIRRGNVCGNSKNDPPKEAADFTAQVIV
                     LNHPGQISNGYAPVLDCHTSHIACRFAEIESKIDRRSGKELEKNPKAIKSGDAAIVKM
                     VPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKGVNKKEGSGGKVTKAAAKASKK"
     gene            complement(<47957..>52090)
                     /gene="RAC-A"
                     /locus_tag="LMJF_17_0200"
                     /db_xref="GeneID:5650735"
     mRNA            complement(<47957..>52090)
                     /gene="RAC-A"
                     /locus_tag="LMJF_17_0200"
                     /product="receptor-type adenylate cyclase a"
                     /transcript_id="XM_001682213.1"
                     /db_xref="GeneID:5650735"
     CDS             complement(47957..52090)
                     /gene="RAC-A"
                     /locus_tag="LMJF_17_0200"
                     /EC_number="4.6.1.1"
                     /codon_start=1
                     /product="receptor-type adenylate cyclase a"
                     /protein_id="XP_001682265.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650735"
                     /db_xref="GOA:Q4QEI3"
                     /db_xref="InterPro:IPR001054"
                     /db_xref="InterPro:IPR028082"
                     /db_xref="InterPro:IPR029787"
                     /db_xref="UniProtKB/TrEMBL:Q4QEI3"
                     /translation="MQIRPSLGGCLRHGGAGDHAARQMSRLRATKLLVSTAVACVLLC
                     SAPWVLAEITNNAEQEPVYILNAMYSTEAYTDDDAKALWTGMDMAFYSSQYKAAGGRP
                     IKILHPDPDQDNLYDIAEVILHSLARQEKLLAVLGPYLDGRLTAALGNAEVVQSGLVL
                     IAPFTGSSGVRTWSDSVYFTRAEPMVELKVVVKHIINKLRFRRIAFMRLTGMHFGREE
                     MMYVQDTLASLLRDPAVIYSVPYSEISVAVDEAAFDAMADTHPQVIILWAAPVPQVIH
                     FLEKVMTDPRTSSAYIMSCSMIQRVVFDVYKRLLSAGSIKPQDGRILASATTSPVSSS
                     MKYMEAFKTQMADYIEHSGSFDYYPVDDNAEALGQKARPEAPRSRKYTIDEFFQEHPS
                     IAKLMALGWLSGTLVQQTLQQTDWIVNRSTYKAGLFNQNRFVIGGDYVLGDYGGPCEP
                     LAQFLGASCYCNQGGHSAMLTALRNASWYTVFDSSFQYPQSECNSSKSQIVVAVNVLT
                     LLHEGYPKLIDAGMQLNEVLPHAFDSTLCKGYQVGSTFLRVETAKAQLLFDTEVSNYS
                     VDIVAGPILQGLDVGEMFVLNPLQNLPQLRTERRNYVYLMPTLEQQLYVMYATIDALR
                     NTMHVLEDTAVVLRGYSAEEVVGISEILFKTAGTFNLPDPSIAAISLTDSLHDLLSPT
                     AINIVMGMQDGDSVHFANFLAKHIDAMVVVCFDELTMYYEELRATFSVQQASVQGRLM
                     SFSSLPLWTDTSTEAEDRWPILQRFHNIFPDPINHTPSLLRDVVIAGFIQALVSTTTV
                     VETKLLTNAVYINGGVTTYGFTLGTFEWGCTTTTKGESCVYKNFGASSIEILSIQRML
                     DPTVPQLSPPITPAMEYRPRQRLHALTPAQRNGLIAGCVVGVVVLITTCTLILYCCMD
                     SRNNDAAPKDGDEPVTLLFTDIESSTALWAALPQLMADAIAAHHRVIRQLLKKYGGYE
                     VKTIGDSFMIACRSAHSAVSLACEIQTKLLKHDWGTEALDSAYHKFELARVDTLDDYV
                     PPTARLSEEEYAALWRGLRVRMGIHTGLTDIRYDEVTKGYDYYGDTPNMAARTEAVAN
                     GGQVLATEATWWALSNDERAGTAHTVMGPQGLRGVPFAVEMFQLNAVPGRRHAALRTE
                     IEAMLPEDTATETASSAAGALLSSVGTMSDPAAGIAFVLTSCFAPYPAAQRVRELQPL
                     LSKWGVGAPPRSRLVSEEDYCQGLMNRLAVRIATVSQARLQLTREDAADGGLKRASSE
                     ALNPLAREGDCAAGGVRPRVTGSSAASLPVGIGSAMREWHVRSRLMNDTGRPSVTHVS
                     QQRASQLTSHTEAQDAVFRLSALSVPESTVESSGADDEEIVIVRVSRNPHYARHAFE"
     gene            complement(<60047..>64291)
                     /locus_tag="LMJF_17_0190"
                     /db_xref="GeneID:5650736"
     mRNA            complement(<60047..>64291)
                     /locus_tag="LMJF_17_0190"
                     /product="putative receptor-type adenylate cyclase"
                     /transcript_id="XM_001682214.1"
                     /db_xref="GeneID:5650736"
     CDS             complement(60047..64291)
                     /locus_tag="LMJF_17_0190"
                     /EC_number="4.6.1.1"
                     /codon_start=1
                     /product="putative receptor-type adenylate cyclase"
                     /protein_id="XP_001682266.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650736"
                     /db_xref="GOA:Q4QEI2"
                     /db_xref="InterPro:IPR001054"
                     /db_xref="InterPro:IPR028082"
                     /db_xref="InterPro:IPR029787"
                     /db_xref="UniProtKB/TrEMBL:Q4QEI2"
                     /translation="MACWTVVATTCWGTGCVGVSDRVSYRGHKRTLEALRVSAWRRGL
                     RLVAVSVLAVVAAALCAALPVWAADGSGKDPAKNPVYLLNATYSLDPSTTKDAKALWL
                     GIDSALHASGYRTASGRPVEIVNPDPAVNKSDIIAVVQRALEKYPTLLGVIGPFMDPL
                     TSTVVKSDAFNGTDLMFLAPFTGSDAVRVWNNDVYFTRGDPWTEMTILLTYMLKTIRP
                     RRTAFMYLTGAQFGDSEYKMVVSLLSSFSLDLPAVYTAPYSMTNTAVKKKTFDAMADT
                     RPQVIIVWGIPGEQVVKFLQAVLTDPRTSSAYIMTCFPLQQIVYRVYYDLAMAGKLTP
                     VDGQIMSSATSLPISHTEVEHVRLFRTEMVDYMQKTGRVDASLWADEAKAVQKYGPGE
                     HEASSSDSAAYMHSFYHEHPSTGQLMIAGWLSGKLIDQTLQEPLWTIDRKTYKAGLFD
                     QTRYVIGKDIVLGDYGGPCTSIAEYLGAVCYCNQGGRASILQGLFKAAWVLLPDAIFN
                     YEQSACYLNKIVLSKPLNVVTLNFSDLPKLRKAAEDMVKVIPRAISEERLGFSAFNPA
                     MLNVTQLTAQGALDWEFLNYSVDLVTGPMLRSIDLSGLLVISPVFNRPNVLVAKENYL
                     FLMPTLEQEMYVMYSELSSVRSLTSIGDVVNLVLHEYRNSNVKSITAVAMKTAATFNV
                     PDPTVEAVSSRTSVESSLAPDRINFVLGITDQDVDGIASFLSKNPLAIVVISFVDLAH
                     EYDRLTAAFAKLPDTVQARVITFTNLPLWSDTSPSALESYPLLKLLNAIFPNSADHTP
                     SLLRDLLSIVFIQAVAYGDGGFAKPTSLQESIYKKGVINAYSVTLGRFTWNCTATTNG
                     ESCVYKNFGASNIAMLSVQRMLDPTVPQLSSPGTPAMEYRPRKKLDKLTSSERNGLIA
                     GLVMFTVILLAAVPMILCWCMDNRNNDAAPKDGDEPVTLLFTDIESSTALWAALPQLM
                     ADAIAAHHRVIRQLLKKYGGYEVKTIGDSFMIACRSAHSAVSLACEIQTKLLKHDWGT
                     EALDSAYREFELARVDTLDDYVPPTARLSEEEYAALWRGLRVRVGIHTGLTDIRYDEV
                     TKGYDYYGDTSNMAARTEAVANGGQVVATEATWWALSNDERAGTAHTAMGPQGLRGVP
                     FAVEMFQLNAVPGRRHAALRTEIEAMLPEGTATETASSAAGALLSSAGTINGPAAGIA
                     FVLTSCFAPYPAAQRVRELQPLLSKWGVGAPPRSRLVSEEDYCQGLMNRLAVRIATVS
                     QARQRMGSNEAGVSGDIQNLISSGLLNPLLGEGSFISDGARARHSGVIAVPPTAEPSA
                     MRESRVLRRSTLNGLTFSRGPSSKKASLSVNTAGFLDDVVPFTAQGSRRPSEEHNSRS
                     ASVSCEVVVVRMPMKLGCRRRPSLLEPLAEDEAEEA"
     gene            complement(68880..72858)
                     /gene="RAC-B1"
                     /locus_tag="LMJF_17_0180"
                     /pseudo
                     /db_xref="GeneID:12981435"
     misc_feature    complement(68880..72858)
                     /gene="RAC-B1"
                     /locus_tag="LMJF_17_0180"
                     /pseudo
                     /db_xref="GeneID:12981435"
                     /db_xref="PSEUDO:CBZ05821.1"
     gene            complement(<75012..>78806)
                     /gene="RAC-B2"
                     /locus_tag="LMJF_17_0230"
                     /db_xref="GeneID:5650738"
     mRNA            complement(<75012..>78806)
                     /gene="RAC-B2"
                     /locus_tag="LMJF_17_0230"
                     /product="receptor-type adenylate cyclase b"
                     /transcript_id="XM_001682215.1"
                     /db_xref="GeneID:5650738"
     CDS             complement(75012..78806)
                     /gene="RAC-B2"
                     /locus_tag="LMJF_17_0230"
                     /EC_number="4.6.1.1"
                     /codon_start=1
                     /product="receptor-type adenylate cyclase b"
                     /protein_id="XP_001682267.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650738"
                     /db_xref="GOA:Q4QEI1"
                     /db_xref="InterPro:IPR001054"
                     /db_xref="InterPro:IPR028082"
                     /db_xref="InterPro:IPR029787"
                     /db_xref="UniProtKB/TrEMBL:Q4QEI1"
                     /translation="MCADATHPRRACWCGAGGVAGCVRQQHAYRCSRLLAGVLLIVGA
                     LTLAVSTAPTAWAAGANVSPDEPVYLLNAMYSLSDYSWKHAKALWLGIDSALHAVGYT
                     AASGRPIKIIEPGPTDDRSDIVAVVMKALKDYPTLLGVIGPYSDTRLGALMSSPEIQN
                     SGLMFLGPFTGSSAMRVWNENLYFMRAEPRLEIMAMAKHIANTFRARRTAFTYVTGEW
                     FGSFEHKSLVELMASLSLDPPAVYSAPYSTSTAVNMTAFDAMADTHPQVIIVWGIPAG
                     QVVELLQAVLTDPRTSSAYIMPSFALQQMTFQVYYDLAMAGKLTPVDGQIISSATSFP
                     LTEPASVHLKVFRAQMGEYMVKTGRVDPSLWADEAKAVQKYGPWEHEASSDSAAYVNN
                     FFNEHPCVTQLMIAGWISGSLIAQTLAEENRVVNRMAYRQYMFSQQRYIVGEDFVLGD
                     YGGPCNGVAEFLGAVCYCNQGGHSAVLSRLDKAVWTVITESGVSFTQKSCYSDSTTLP
                     RPLNFLTLIFVGHPLLAQVGLNVNTSIPALFAYLKYSASPVNGIALNVTDTTPQALHD
                     AVTTNYTTDVVVGMTVKGMNVDEYLVLSPLHPRPHLVEPLRNYVYLMPTLEQQMFVLY
                     AKLSAVRDVTSIDSGVHVVLHDYASDEVANITAMLRKSAATFDYDNPSVTAVPSTKTV
                     GSALARGRINVVLAVTAADVAGIVDFLVEEKTSIVVVVFDDLVIQYSTLVTALKSKPA
                     SVQARVITFTNLPLWSDTSESAHAASRLLTVFHGALPDPSQHTPGSLSAVIAGSFSAS
                     MRRLADSVHSTSLTDMVYRESSVTTTGVPFGKFHWGCTTTPTDRLCVYQNYGAQGIVM
                     LSVQRMLDPTVPQLSSPMTPTMEYRPRKKLDKLTSSERNGLIAGLVMFTVILLAVVGL
                     ALYCCMDSRNNDAAPKDGDEPVTLLFTDIESSTALWAALPQLMADAIAAHHRVIRQLL
                     KKYGGYEVKTIGDSFMIACRSAHSAVSLACEIQTKLLKHDWGTEALDSAYREFELARV
                     DTLDDYVPPTARLSEEEYAALWRGLRVRVGIHTGLTDIRYDEVTKGYDYYGDTPNMAA
                     RTEAVANGGQVVATEATWWALSNDERAGTAHTAMGPQGLRGVPFAVEMFQLNAVPGRR
                     HAALRTEIEAMLPEGTATETASSAAGALLSSAGTINGPAAGIAFVLTSCFAPYPAAQR
                     VRELQPLLSKWGVGAPPRSRLVSEEDYCQGLMNRLAVRIATVSQARQRMGSNEAGVSG
                     DI"
     gene            complement(<80549..>84535)
                     /gene="RAC-B3"
                     /locus_tag="LMJF_17_0235"
                     /db_xref="GeneID:5650739"
     mRNA            complement(<80549..>84535)
                     /gene="RAC-B3"
                     /locus_tag="LMJF_17_0235"
                     /product="receptor-type adenylate cyclase b"
                     /transcript_id="XM_001682216.1"
                     /db_xref="GeneID:5650739"
     CDS             complement(80549..84535)
                     /gene="RAC-B3"
                     /locus_tag="LMJF_17_0235"
                     /EC_number="4.6.1.1"
                     /codon_start=1
                     /product="receptor-type adenylate cyclase b"
                     /protein_id="XP_001682268.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0235"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0235"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650739"
                     /db_xref="GOA:Q4QEI0"
                     /db_xref="InterPro:IPR001054"
                     /db_xref="InterPro:IPR028082"
                     /db_xref="InterPro:IPR029787"
                     /db_xref="UniProtKB/TrEMBL:Q4QEI0"
                     /translation="MCADATHPRRACWCGAGGVAGCVRQQHAYRCSRLLAGVLLIVGA
                     LTLAVSTAPTAWAAGANVSPDEPVYLLNAMYSLSDYSWKHAKALWLGIDSALHAVGYT
                     AASGRPIKIIEPGPTDDRSDIVAVVMKALKDYPTLLGVIGPYSDTRLGALMSSPEIQN
                     SGLMFLGPFTGSSAMRVWNENLYFMRAEPRLEIMAMAKHIANTFRARRTAFTYVTGEW
                     FGSFEHKSLVELMASLSLDPPAVYSAPYSTSTAVNMTAFDAMADTHPQVIIVWGIPAG
                     QVVELLQAVLTDPRTSSAYIMPSFALQQMTFQVYYDLAMAGKLTPVDGQIISSATSFP
                     LTEPASVHLKVFRAQMGEYMVKTGRVDPSLWADEAKAVQKYGPWEHEASSDSAAYVNN
                     FFNEHPCVTQLMIAGWISGSLIAQTLAEENRVVNRMAYRQYMFSQQRYIVGEDFVLGD
                     YGGPCNGVAEFLGAVCYCNQGGHSAVLSRLDKAVWTVITESGVSFTQKSCYSDSTTLP
                     RPLNFLTLIFVGHPLLAQVGLNVNTSIPALFAYLKYSASPVNGIALNVTDTTPQALHD
                     AVTTNYTTDVVVGMTVKGMNVDEYLVLSPLHPRPHLVEPLRNYMYLMPTLEQQMFVLY
                     AKLSAVRDVTPIDSGVHVVLHDYASDEVANITAMLRKSAATFDYDNPSVTAVPSTKTV
                     GSALARGRINVVLAVTAADVAGIVDFLVEEKTSIVVVVFDDLVIQYSTLVTALKSKPA
                     SVQARVITFTNLPLWSDTSESAHAASRLLTVFHGALPDPSQHTPGFLSAVIAGSFSAS
                     MRRLADSVRSTSLTDMVYREGSVTTTGVPFGKFQWGCTTTPTDRLCVYQNYGAQGIVM
                     LSVQRMLDPTVPQLSSPMTPTMEYRPRKKLDKLTSSERNGLIAGLVMFTVILLAVVGL
                     ALYCCMDSRNNDAAPKDGDEPVTLLFTDIESSTALWAALPQLMADAIAAHHRVIRQLL
                     KKYGGYEVKTIGDSFMIACRSAHSAVSLACEIQTKLLKHDWGTEALDSAYREFELARV
                     DTLDDYVPPTARLSEEEYAALWRGLRVRVGIHTGLTDIRYDEVTKGYDYYGDTPNMAA
                     RTEAVANGGQVVATEATWWALSNDERAGTAHTAMGPQGLRGVPFAVEMFQLNAVPGRR
                     HAALRTEIEAMLPEGTATETASSAAGALLSSAGTINGPAAGIAFVLTSCFAPYPAAQR
                     VRELQPLLSKWGVGAPPRSRLVSEEDYCQGLMNRLAVRIATVSQARQRMGSNEAGVSG
                     DIQNLISSGLLNPLLGEGSFISDGARARHSGVIAVPPTAEPSAMRGWRVLRKIPERPT
                     ACNVRDKQ"
     gene            complement(<86278..>90264)
                     /gene="RAC-B4"
                     /locus_tag="LMJF_17_0237"
                     /db_xref="GeneID:5650740"
     mRNA            complement(<86278..>90264)
                     /gene="RAC-B4"
                     /locus_tag="LMJF_17_0237"
                     /product="receptor-type adenylate cyclase b"
                     /transcript_id="XM_001682217.1"
                     /db_xref="GeneID:5650740"
     CDS             complement(86278..90264)
                     /gene="RAC-B4"
                     /locus_tag="LMJF_17_0237"
                     /EC_number="4.6.1.1"
                     /codon_start=1
                     /product="receptor-type adenylate cyclase b"
                     /protein_id="XP_001682269.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0237"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0237"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650740"
                     /db_xref="GOA:Q4QEH9"
                     /db_xref="InterPro:IPR001054"
                     /db_xref="InterPro:IPR028082"
                     /db_xref="InterPro:IPR029787"
                     /db_xref="UniProtKB/TrEMBL:Q4QEH9"
                     /translation="MCADATHPRRACWCGAGGVAGCVRQQHAYRCSRLLAGVLLIVGA
                     LTLAVSTAPTAWAAGANVSPDEPVYLLNAMYSLSDYSWKHAKALWLGIDSALHAVGYT
                     AASGRPIKIIEPGPTDDRSDIVAVVMKALKDYPTLLGVIGPYSDTRLGALMSSPEIQN
                     SGLMFLGPFTGSSATRVWNENLYFMRAEPRLEIMAMAKHIANTFRARRTAFMYVTGEW
                     FGSFEHKSLVELMASLSLDLPAVYSAPYSTSTAVNMTAFDAMADTRPQVIIVWGIPAG
                     QVVELLQAVLTDPRTTSAYIMPSFALQQMTFQVYYDLAMAGKLTPVDGQIISSATSFP
                     LTEPASVHLKVFRAQMGEYMVKTGRVDPSLWADEAKAVQKYGPWEHEASSDSAAYVNN
                     FFNEHPCVTQLMIAGWISGSLIAQTLAEENRVVNRMAYRQYMFSQQRYIVGEDFVLGD
                     YGGPCNGVAEFLGAVCYCNQGGHSAVLSRLDKAVWTVITESGVSFTQKSCYSDSTTLP
                     RPLNFLTLIFVGHPLLAQVGLNVNTSIPALFAYLKYSASPVNGIALNVTDTTPQALHD
                     AVTTNYTTDVVVGMTVKGMNVDEYLVLSPLHPRPHLVEPLRNYMYLMPTLEQQMFVLY
                     AKLSAVRDVTSIDSGVHVVLHDYASDEVANITAMLRKSAATFDYDNPSVTAVPSTKTV
                     GSALARGRINVVLAVTAADVAGIVDFLVEEKTSIVVVVFDDLVIQYSTLVTALKSKPA
                     SVQARVITFTNLPLWSDTSESAHAASRLLTVFHGALPDPSQHTPGSLSAVIAGSFSAS
                     MRRLADSVRSTSLTDMVYREGSVTTTGVPFGKFQWGCTTTPTDRLCVYQNYGAQGIVM
                     LSVQRMLDPTVPQLSSPMTPTMEYRPRKKLDKLTSSERNGLIAGLVMFTVILLAVVGL
                     ALYCCMDSRNNDAAPKDGDEPVTLLFTDIESSTALWAALPQLMADAIAAHHRVIRQLL
                     KKYGGYEVKTIGDSFMIACRSAHSAVSLACEIQTKLLKHDWGTEALDSAYREFELARV
                     DTLDDYVPPTARLSEEEYAALWRGLRVRVGIHTGLTDIRYDEVTKGYDYYGDTPNMAA
                     RTEAVANGGQVVATEATWWALSNDERAGTAHTAMGPQGLRGVPFAVEMFQLNAVPGRR
                     HAALRTEIEAMLPEGTATETASSAAGALLSSAGTINGPAAGIAFVLTSCFAPYPAAQR
                     VRELQPLLSKWGVGAPPRSRLVSEEDYCQGLMNRLAVRIATVSQARQRMGSNEAGVSG
                     DIQNLISSGLLNPLLGEGSFISDGARARHSGVIAVPPTAEPSAMRGWRVLRKIPERPT
                     ACNVRDKQ"
     gene            complement(<93196..>95118)
                     /locus_tag="LMJF_17_0100"
                     /db_xref="GeneID:5650741"
     mRNA            complement(<93196..>95118)
                     /locus_tag="LMJF_17_0100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682218.1"
                     /db_xref="GeneID:5650741"
     CDS             complement(93196..95118)
                     /locus_tag="LMJF_17_0100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682270.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650741"
                     /db_xref="UniProtKB/TrEMBL:Q4QEH8"
                     /translation="MVRYPIIASAPGDSSTQTSLPYGIGPSAAAKQSTYLPALLAAAQ
                     QTSPIAAKSGQSTFPSVPYYGILSRFEVRMDVSVERDARAPAWSISDAAGASAGMLLR
                     NPTTATARMAHIQRRLYDVAERFGSVYHLSNGATLSESVMAPLLPHQGGASSAASFHS
                     QLTYGAYVQALHDAFRRFRALRQACVTMEKGASGAGAATIGDGMTTHHTFYVRLLGHP
                     SWKDLNALLCVEKGRLLVCLISSSRITQKHLTAVCADAGVSLAWLGGAALVAEPLQLI
                     PGDVNPVWAVWDALVNLPLLSPSSINREGNEERLTSGADGAADTLDNASAGAREVLRR
                     VTQTGSALSGFHISLISSMAFQGATRFHQVGRIAEEAPVFAQEERPSSSSLSATAAAR
                     QPTRQAIVARRYIWRLIPSPTSCLAVAPTSSSASALSCCAVLPFFISKLLQCLVEECG
                     LIAFAVHCGGPAELTTHLGAPSGSTGSTASGAVGVRLVHSSAPSLLTLQQGPSSSSCL
                     AFSRLSGAVWVDAETRESLSLGGLAAALGEPDKDAVGDEEDTEMEFEVVSIRYERHSE
                     LKTMEKEPNKVRVCATAASVESGGSCPVKRARFDAAGIDEEDHDDAFVRPAQWGSSFA
                     FTVSVKRLITVDDIDA"
     gene            complement(<96074..>97654)
                     /locus_tag="LMJF_17_0110"
                     /db_xref="GeneID:5650742"
     mRNA            complement(<96074..>97654)
                     /locus_tag="LMJF_17_0110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682219.1"
                     /db_xref="GeneID:5650742"
     CDS             complement(96074..97654)
                     /locus_tag="LMJF_17_0110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682271.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650742"
                     /db_xref="UniProtKB/TrEMBL:Q4QEH7"
                     /translation="MMSGSAENGSDGSRRASSGMTGSGSGNGGSSRGSDDDGDRTGAR
                     RRGSSQRVLLPDGGSHGHATSTHTNPRSREPSLTVAGRSSSLPDTPLKRGSAAAASGV
                     KSFSRPAAARFVAAGNTPPLSAESATPVAAAAHDVRDTVEYRAAWDLELWKAVQADRF
                     RKELEKQRSVAFADLERLVKRREREARVALQQRTTAVALREEAVQAVETRLAEQQQHV
                     SDMEKDVRRMRQQLLDAQQRVEDEVRAQVRLANDTIAHRARLLEERVKAAEAQARRAD
                     ERQRLAQQEYLSLYEAFSRYRTQQLASPGSASGGTTATAMGGPASSSFSVEQLRTQWE
                     TEHQLQLDRQAQRHASDMAAAQQRCRELEEQNRRLTAALARRREQLRRHAESASPPPL
                     PTSVSQRPPSHAGREDREGPSGSGTAASSSSTPSSNVGAATTALLQPAHKETLRDVVE
                     RTSRELHRLETERSSLVEGSSGALRETDTVIVRIDARIRELREHLSAVASWRDAGWRD
                     RVDGTERRERARLETGPL"
     gene            complement(<99513..>100466)
                     /locus_tag="LMJF_17_0120"
                     /db_xref="GeneID:5650743"
     mRNA            complement(<99513..>100466)
                     /locus_tag="LMJF_17_0120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682220.1"
                     /db_xref="GeneID:5650743"
     CDS             complement(99513..100466)
                     /locus_tag="LMJF_17_0120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682272.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650743"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q4QEH6"
                     /translation="MSGAEPHLSLQSLTPVDLKQLSRQQKIMLLQDYRSSGARNANKM
                     LFLATDLLAGGSSGLSSSELYDVYEQVLIASLECGRIENATMYLNLLESRFGKKSVRV
                     SHLRGLCLEAQGKIPEAKKLYEQVLKDMPTNDFCVQRLSAIYKSNGHYKEAIRVLEED
                     LVYTDEDDKQHTYVEVHRGDALPTYRELSNLHYLLGNTDKAIFYAEECLLFDNESYFA
                     HVRLGELYYMKRDLPRCVIEYSQSLLFNSQQNNSRAAYGLWQVANEMLRQHQSGVKKI
                     EDEAVLMQTQDLRTYAAETLRRMYAGTAMLSALDAYLQREA"
     gene            complement(<102174..>104780)
                     /locus_tag="LMJF_17_0130"
                     /db_xref="GeneID:5650744"
     mRNA            complement(<102174..>104780)
                     /locus_tag="LMJF_17_0130"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682221.1"
                     /db_xref="GeneID:5650744"
     CDS             complement(102174..104780)
                     /locus_tag="LMJF_17_0130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682273.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650744"
                     /db_xref="UniProtKB/TrEMBL:Q4QEH5"
                     /translation="MRALLPPRSVLDAPLFVVVAVMLLLHGAPARGYDGDAVTAPPSA
                     STAFTEHPFTLPAAASLLDVLAGSFCITTGEGEEGSCTPSVSRLPTHPVLILFTESSA
                     GHSSTLAALRAKVRQIATDVPSSVLRVHEYVIPTSATERRLIELLLIGASHLPTLALF
                     HGSVAKVQVAPGSIISASPFQAPVLYSTTPLASASYFELRSWALSELPARYVDPVTFH
                     LIPSLQFVFSPAEVHDTLRLVRDAVEASESRSVLPAFVSMVYVRLTRHGSEEVLAALS
                     SIATQAGNAVLTLVTESAEVAAAWGLRAEHTFTMAPWSSTVAAYLNGSTSAGFVAAVP
                     DLSPPQSTGTVTELAEVTADSAAWRAACAASVRAENAQLQNWRQAMNAFKTTSPLRRI
                     DSAVHLLHELKALQNALKIVFVLRESDDMWFHHHLEVAAALARRLQSTTVLYNTTTLV
                     KGSKARSRVERSWTPTMRCDVFWLDAEQLPAVADGLHVSQVPSVLILVPLQSRFGEGG
                     AGDRADAAAAAGDDDQAAAGASEETGLRRRDPFIGIHTINRYDLLKAAYMDDAQMVVE
                     PVSGKEALPLFPSDSDALLRFLASGSFIGAMQYTMSSAQFSTLRAKVTEVPDAVQAAT
                     ASGGIPNRHYLQLDHRYYPLRAAEEPMEGPAYVRQILNGSSPLPVLGSDDSDTEVGRQ
                     QGGGRSGAHPRGTTSASPDEADERLRQLRAREEAAALKRKAVWEANLAKRRREKADRL
                     RRKAAEDAAERERQQAAFQREVNAALKAEQAGAGGGAGGTSASQPEGLLVRRPTLDDV
                     SEGLVGEGRRGHPLRHPFGEEVDSQDAAQILRRRRRHREYREWLADRQRMVNRCVTVT
                     EKGKLSLMTRWE"
     gene            complement(<106813..>108084)
                     /locus_tag="LMJF_17_0140"
                     /db_xref="GeneID:5650745"
     mRNA            complement(<106813..>108084)
                     /locus_tag="LMJF_17_0140"
                     /product="putative peptidase t"
                     /transcript_id="XM_001682222.1"
                     /db_xref="GeneID:5650745"
     CDS             complement(106813..108084)
                     /locus_tag="LMJF_17_0140"
                     /EC_number="3.4.11.14"
                     /codon_start=1
                     /product="putative peptidase t"
                     /protein_id="XP_001682274.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650745"
                     /db_xref="GOA:Q4QEH4"
                     /db_xref="InterPro:IPR001261"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR010161"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="UniProtKB/TrEMBL:Q4QEH4"
                     /translation="MSLAPIEHRLEQRFRRYSAITTQSDPRNLGKCIPSTPGQQVLAE
                     LLAKELQAMELQNVVCDKYATVTAVKPGNVPGAPRIGFICHLDTFDCGLCPHVKAQKI
                     RYTGGDVCLNEEKNIWMRLREHAELSKYVGQDILFSDGTSVLGADDKAAIASVIEMVA
                     NLDSSKEKHGDIVICFVPDEEIGLVGAKHLDVKARFNVNFAYTLDCCELGEMMYECFN
                     AASATIKFTGVSVHPMSAKGVMVNPLLMAVDFISQFNREETPECTELREGYWWFAKMD
                     ADTTQARLEAMVREHDLAKYTARKAYMLDVAKKVQAKYPTGKVEIEIEDVYANIANSL
                     KGDFTAIDLLLEAMRKASVKPNIIPMRGGTDGAALSVKGLLTPNFFTGAHNFHSCFEF
                     LPIPSFVKAYEVCRNIVLLGAEKSEKTPSLL"
     gene            complement(<109677..>111797)
                     /locus_tag="LMJF_17_0150"
                     /db_xref="GeneID:5650746"
     mRNA            complement(<109677..>111797)
                     /locus_tag="LMJF_17_0150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682223.1"
                     /db_xref="GeneID:5650746"
     CDS             complement(109677..111797)
                     /locus_tag="LMJF_17_0150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682275.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650746"
                     /db_xref="UniProtKB/TrEMBL:Q4QEH3"
                     /translation="MDVIPLVAQEIVARYHKQAGDRPMGSAVTVDLAALLTRLWLLKE
                     RARFDDAGDVAASVLHIEALADDVLDYLLHRCSLPSLSTLSLQVRCDTLRTSREEQQH
                     KAEVKKEAIRVQLEGALMSMEPGMVSAEQVWSSLAVCFVHHYSGLGSLASAAAKAGSG
                     SSGTSHSETLSAVSAALPRAQVTAFLRQDRVERAGQLRQLRRIAWGLRLYQKETGRTA
                     GVDLMSLSTTVDTPLAELEAKAEEAVAELEPRVRLTRALLVSPTCPLGAAAHQQLKEE
                     YHHLLLVQHVLRHVQCGLQQLRECMNSRVMQPYTSLLAALRQLMPVSKAAAAAQASSS
                     AITAASPAAAATARGAAAPKKVVFPKFMELADAYEAGMRCAGELALWSTLLRVATESA
                     AGYDSTLPRTAAEEALALAEAAPAPPVTSASALAAEVGALLDSDATRQRLPPGVHVRY
                     RTDLPLHTVDPTVARIYPESLCAMRGYCPVQLLAGCPTAGLLIPGQVPSEPSSPTLSK
                     TSLGCMEVSGSVRRVALARPLYFIFADAAAMRAFAADPWRYVEGCLHVFHAADPCLTL
                     VMGRAAELPRELYLEGARVVERLRSDLANAQHEQENRQSCGTQTGQIDSYIDHNYFWN
                     EWDLRRHALKLANLMQMRTHSSQTAALHFRREAATQADPRKDSEAQTLHNAATQPPHV
                     AQYLKGLRGTYTSAIEQVRKVIEH"
     gene            complement(<113303..>116521)
                     /locus_tag="LMJF_17_0160"
                     /db_xref="GeneID:5650747"
     mRNA            complement(<113303..>116521)
                     /locus_tag="LMJF_17_0160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682224.1"
                     /db_xref="GeneID:5650747"
     CDS             complement(113303..116521)
                     /locus_tag="LMJF_17_0160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682276.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650747"
                     /db_xref="GOA:Q4QEH2"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q4QEH2"
                     /translation="MAALLPSTAPRRMPYQVADRIHVYGRVRPPASPDAPLWVTVDSR
                     TTTLHCGSAEEVLPMTEAVSKRRSPTTAHVPQSSSFTLDGVMGDIRGGAAQAFLDSTA
                     RSCVEDSLLKGTSATILCCGEKGTGKTTTMFGDVAVPGLCQRILASLFAVVGAQSEPS
                     TPTFRSGVTMTAPSTHDLASLSSSGAEEEEARRGCRTRFLVKLSCLALRGEHVVDLLA
                     EAAHDAPSSGASASASPRAAPPPLPASSSLSLSARPNITMDSRGRVVVRNVSTVTCCS
                     AADAIALIHQSRCAPSSAASPRSPGHVVVIVDVTCEEGEEASASHHIVRTAKLHLVDL
                     AAAEQARHRSQRPQPPPSSTSPSMPAAESVVTSHGGRSEDSAIRHSLAVLQQVITGLS
                     SSSTAVDDAPPTRPPYQQSKLSMLLKGHLGGGCRTLVIAHVRSEEAHRQETLATLQLA
                     RRLLCVPEHPTSRVVEDPVVRARQLQRQVATLQAELRLQMELNQRAASSATALAAAAA
                     PVDAPAASNAKGAKKCFGDASATDAPARSSKSCTRRASDRCTSPSQTPAGAASSCHPL
                     LGRAASSSATPVSDALTTGVMNFVAGRIAVLPVSTVQEMNTCFELLRQCVAERDIQLR
                     AALTDLRTAEATTAAAFTALAASSARSSVSERYSGRSVCGGGAGRRRICSIRGTASLA
                     RDTPVSEGKRRLSTDSTLSTSIMQLPRCNPSRTTLLHEPSPTVPATAGVKAGKGYGSA
                     PSAAGLSRGETKDTAPLSPLPGLSVFPSTGPNTAAAAANAPLAAAAAAWSANEGIKSP
                     ENEVTFVPTCNEAASFKPLAPSSSLQCARVVSSAPVSLIRPFSASKSTASASRQASAA
                     RKPSTPWGRAPTDSLGPFSSTEVNSTMQVWRSHSAADSALQASPGESSAFHIYTTQTA
                     EGVQQVRQVRHDEEALASLRLRLLAEVTGDNGHSDTALADECRYYEGQLTRRREALLR
                     NFESWYRARVPAEDDTTAAANALQEPAANSKALTLGTMRRRLRRPATAGSAGSGGGGG
                     DAGVLSGVAINGVGGNGAYEVWGGVGPVLRPAASFSSATQKE"
     gene            complement(<120694..>122679)
                     /locus_tag="LMJF_17_0170"
                     /db_xref="GeneID:5650748"
     mRNA            complement(<120694..>122679)
                     /locus_tag="LMJF_17_0170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682225.1"
                     /db_xref="GeneID:5650748"
     CDS             complement(120694..122679)
                     /locus_tag="LMJF_17_0170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682277.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650748"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q4QEH1"
                     /translation="MHEGGTCSNKDSSRPSTRASATAHGDKPENAVGTDKPDRTIPSE
                     GDCMPKFKRGKTWRLHCSSSESVKAALTSNAADAANPLAPMSSVHSSNAASSLADAPL
                     CLLPQLATSSAAGASPSAATRPPRGAGYPSGTARSSSIVSVSTAPHDMQLARQRLEPQ
                     HLKLPSMGSADMHATRESLLSDISDTLSTESTPTHSLQDCHSANCGSTMNAFLRKAEA
                     LEAKYQQAPLSIEEDLFVYDDIVISKDEARAKQWRLAGRKPQPANIEPSSDSGTSRTL
                     KKFFSFNDFDVCVDEVDFMPLSPATVEAAATLARDAVLETPKHGLKHITVTNTTVKAP
                     NTVAHFLAQSRSKEPRVNRPLRSFQVNVLLGHATRVKCIALSPAETDFASCSNEDASI
                     TLNNFGVGSEVGIFTGHHDTIISATFSPDGKYLATASKDEMMILWDVTTTKILLTFAH
                     PKVVICCCFGPDSKHLVSGCQDRVCRLWDTKRGREWMNYTEHEGIIIAIAFSPDGNYV
                     CSASADRSLRVWSATTAKTRFRLLGHVGIILSCSYTSDGRHIISNDESLLRVWSAEDG
                     SCKLSLSPVDVAGTLQLNHRAPKLGWTLSSAAPGSFTRFVLVACNNRFVYVIDIDTGR
                     EVASTFCKAPVYCLTAGSHEKMAFGDSFGNIYILRLM"
     gene            complement(<125529..>128957)
                     /locus_tag="LMJF_17_0240"
                     /db_xref="GeneID:5650749"
     mRNA            complement(<125529..>128957)
                     /locus_tag="LMJF_17_0240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682226.1"
                     /db_xref="GeneID:5650749"
     CDS             complement(125529..128957)
                     /locus_tag="LMJF_17_0240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682278.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650749"
                     /db_xref="InterPro:IPR000210"
                     /db_xref="InterPro:IPR000408"
                     /db_xref="InterPro:IPR009091"
                     /db_xref="InterPro:IPR011333"
                     /db_xref="UniProtKB/TrEMBL:Q4QEH0"
                     /translation="MRHTASSGGFYRFAATASSPFPQLPARWLRQPDASSSPWPLQPH
                     DQRQQQTATTRSPTQACDSTLTAAVASRHARPAPASPSPRADGDIAAAATGTAGSGRS
                     CASPPPRRSHTATEERLSALSAALPRPFYFQPVRTTESVCVATTASSSEWVLLNVGGR
                     LITTTVGTLMADPDSVLASLCACLVPSPGRGDIVAGKKSGAHRSAPITTQEASGRCGA
                     VAHATPPGEEAPEGGVRCDPLGRDNRTHSANLADGRDADGLRNRAAESGGGDAQTLPT
                     EAAPDAEVPPAAVDGPQHAPQHDNDSVQRDGDRSSLFSELYTCHHPLHHSIASAAPTS
                     AAPPPALQHVSHQHSLRSVMRESLPDYVAAHTPPAVSMPVGASVGEGGDGEAVSPQQT
                     ASAIPLDTDGANAILLDLDADYFLPILNYLRHGAAMIPHYLSMAGVLAMAEYLNVMGL
                     VRLLRGPPKPRRVMLFSWGSGGNGELGTHATRDEPTPTMAQVTPFGVRVCEIALGANY
                     SCALSDTGSIYTFGNGEWGQLGLGGSGCVVRGGSNSTGGGGGGGNGTGQDGVDVPVEL
                     LIPRRIPLFEQLPAVHVAAGYAFAMAIVEGHHVYFWGNNNHGQSGRGRAHFDLPTKKV
                     DAPVLVDTLEGKRIIQLSCGSFFALALSDDGFLYSWGLVDCVGLGTPEEVERRYRDVL
                     GESLSNERRAVVLTPQLVTVKGRRRVTPGGAAVTAPERIVRIRAGQWHSGAINEHGEL
                     FTWGVGYQGRLGHGSKAPAYVPTLVRGALEGHRVVDVACGSFHTVALTAAGAVFCWGD
                     NASGQCGTTAGSPDAFTAPYRVVGLEYVAGGVARSIACGRQHTVVVMEGPQPWCPQPC
                     CRADAAESGYHSHAQVYCFGEATRTANATGSTASAVAAAAVSGATRGTVSSSHIGVSV
                     AAMNASTLPTSPGHGPYMTGGAAGGYQPALAPGGAAAAFPTRSPLPCMGGHHHPHYQL
                     VPGLQNVDVQGVVSGLHHTFAYVEELCGDALRVAGGFGETLPTATRGWEHRPSYAPYP
                     PPLLPPQAAAESHVSHSAFTWGPRGCSSGGTTISWVRSFVPPTPASQRPPSAYRDPWA
                     DAPVESSTDSVGGRIVPLTRTRTLHPTSWSSDGAPTPFTGAASSQQHHSLGEPP"
     gene            complement(<133086..>134165)
                     /gene="CYSB"
                     /locus_tag="LMJF_17_0250"
                     /db_xref="GeneID:5650750"
     mRNA            complement(<133086..>134165)
                     /gene="CYSB"
                     /locus_tag="LMJF_17_0250"
                     /product="cystathionine beta-synthase"
                     /transcript_id="XM_001682227.1"
                     /db_xref="GeneID:5650750"
     CDS             complement(133086..134165)
                     /gene="CYSB"
                     /locus_tag="LMJF_17_0250"
                     /EC_number="4.2.1.22"
                     /codon_start=1
                     /product="cystathionine beta-synthase"
                     /protein_id="XP_001682279.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650750"
                     /db_xref="GOA:Q4QEG9"
                     /db_xref="InterPro:IPR001216"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="UniProtKB/TrEMBL:Q4QEG9"
                     /translation="MASANPRNQILANALEAVGNTPCIRLNRVPQKHGIRCEVVAKCE
                     FFNPGGSVKDRIGKQMVLDAEKNGTLKPGSVIVEATSGNTGIGLSMAAAIRGYHMVIT
                     MPKKMSHEKETTLQSLGAEVIRTETSLPYDHPDSLIGVARRLRDEKGYVLLDQYTNPS
                     NPGAHYEFTGQEIYDQCGSKVDMVVICAGTGGTITGVAKKLKELIPGVIVVGVDPVGS
                     IIADPEHPGEPVMYHVEGIGYDFVPDVCERKYVDRWVKTRDQESFDLALELHREEGLL
                     VGGSSGSAMAGVLEAAKDLRPDQRCVVLMADGIRNYMGKFADVNWMIEHGFRQGEVTR
                     PTYDTLKKELEEVKAKLAKYESGTQ"
     gene            complement(<136352..>138709)
                     /locus_tag="LMJF_17_0260"
                     /db_xref="GeneID:5650751"
     mRNA            complement(<136352..>138709)
                     /locus_tag="LMJF_17_0260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682228.1"
                     /db_xref="GeneID:5650751"
     CDS             complement(136352..138709)
                     /locus_tag="LMJF_17_0260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682280.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650751"
                     /db_xref="UniProtKB/TrEMBL:Q4QEG8"
                     /translation="MAAIQSVLAEHNIKDARFILELPSTAAAASTVATAGDADAPGTR
                     GAGNASVVAAPIDSSAPSTEGGVANTTLLMGMQTTPAAVPTPPPEHQRPPPRARSPSA
                     RQRSPASYHSESLLGHALPAPSTSHSGSPPLNDSISSLGATARPAPGAAAGDASGTHV
                     TPGAAAEDGSATTIPAQPPAQPHPPPPKRDVDAITSDGAAAVLTGEVAAEICRVSNQL
                     AQDIAAAEAQMSRKEILQKFVGRSVILEDRRQREAQQLAQASKLSWNGIPHPAVPFKA
                     DAASVHTTASSQPRCGIPTASTKPPAQKLSADATIPCGTVASAFSAAVLPPPPPEPRQ
                     PQRRSIVRLTPPSRTPVHSGGNGAPGSVLPDSSSLPSLVSAKKSAVPGKTPVFSILNK
                     DGSRLLDQGGAAMTLRTSLPGALAKTGGASVAPAGAATNGGDATEASRSSSNSNSNNT
                     SISHIRQSRPSSVSLLADDRAPPSPVHEPLLGVAAEEEANRQCSILMQTQPRSPTPEP
                     QPVESAINRDDGEVLRKMLSEQSKENTRRALQLQNQSRLSHTTQMATTSVMGKNQPSA
                     SGTFSTASTPRSPSRPSTSAAAASSQPSLRAMLQEQQQLQDASRRSMEEHNRLMQAAR
                     AARTPASALSNAFETSKTPAVALATPPAHATTAATGAAAAAPVTVKEDDAAHWKAGIA
                     TSARASPPRHNANGTFTPSTSSIQVVKFTLPHEEEARQAAVQQLCRSPSGTQHLDSKD
                     RYRALLAAQQNEFAAQEAKTQDYKVLLNRAVEFNRFQQQQRTKPS"
     gene            complement(<139594..>140415)
                     /locus_tag="LMJF_17_0270"
                     /db_xref="GeneID:5650752"
     mRNA            complement(<139594..>140415)
                     /locus_tag="LMJF_17_0270"
                     /product="putative NADH-ubiquinone
                     oxidoreductase,mitochondrial"
                     /transcript_id="XM_001682229.1"
                     /db_xref="GeneID:5650752"
     CDS             complement(139594..140415)
                     /locus_tag="LMJF_17_0270"
                     /EC_number="1.6.99.3"
                     /EC_number="1.6.5.3"
                     /codon_start=1
                     /product="putative NADH-ubiquinone
                     oxidoreductase,mitochondrial"
                     /protein_id="XP_001682281.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650752"
                     /db_xref="GOA:Q4QEG7"
                     /db_xref="InterPro:IPR002023"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q4QEG7"
                     /translation="MRCVPAASASATAVAPTTSYPSTSAALLANTRAIHGEVRHQNTD
                     YDNTRIPWDFTTSSYEKIHNEILPKFPRGRRISATIPLLHLAQQQQGGYIPVTAMYKI
                     AKICEVPPMHVFETVTFYSMFNRHPVGKYHIQFCRTTPCMLCGADELMERTMHYLNVR
                     MHGTTSDGLITIGEMECLGACVNAPMLVVSDYSNPPNFSYDYMEDLTWESIKTLVENL
                     RGGKPFKIGSQRLDRRYAEPAGGRTSLLFKEPPGPYCRDFDAEPDKKADAASPKK"
     gene            complement(<144026..>144559)
                     /locus_tag="LMJF_17_0280"
                     /db_xref="GeneID:5650753"
     mRNA            complement(<144026..>144559)
                     /locus_tag="LMJF_17_0280"
                     /product="putative histone H2A"
                     /transcript_id="XM_001682230.1"
                     /db_xref="GeneID:5650753"
     CDS             complement(144026..144559)
                     /locus_tag="LMJF_17_0280"
                     /codon_start=1
                     /product="putative histone H2A"
                     /protein_id="XP_001682282.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650753"
                     /db_xref="GOA:Q4QEG6"
                     /db_xref="InterPro:IPR002119"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:Q4QEG6"
                     /translation="MSYTGEESTGMPPQPPMMGPGSATADQTSIVSGGKLGGKGKGKG
                     KGKGKRGGKTGGKAGRRDRMSRAARAELNFPVGRIHSRLKDGLYRKQRCGASAAIYCA
                     ALLEYLTTEVIELSGAAAKAQKTERIKPRHLLLAIRGDEELNQVVKATISRGGVVPNV
                     HKALEKKSKKKSAKRAA"
     gene            complement(<145654..>147831)
                     /locus_tag="LMJF_17_0290"
                     /db_xref="GeneID:5650754"
     mRNA            complement(<145654..>147831)
                     /locus_tag="LMJF_17_0290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682231.1"
                     /db_xref="GeneID:5650754"
     CDS             complement(145654..147831)
                     /locus_tag="LMJF_17_0290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682283.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650754"
                     /db_xref="GOA:Q4QEG5"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="UniProtKB/TrEMBL:Q4QEG5"
                     /translation="MGMSVTMINAIPLLRSMHANCVCPVCFEVFKKPVCFPCGHILCR
                     ACATRCIAARPRCPLCNQAVPNMRHCAPLPQLSLLCVLTREVGLRASGLQLRSSVQNA
                     ATPLSHRNHDSSMKRHRGATADDAVEETQGEHQAPRPRRSSLSPPPEQRPFLSLREPR
                     ASHRVANAVAATEGSTANHAQHTSLPELLRAAAGETQRLQSESPPPPLLMVGEGDDVL
                     LGEAPHRSIIAQVTTSLPSAIAHRVGDSGALGRGQDQPPTPTPPPALSPSPAPFSTPL
                     QLMCNHITDHADQLDSTPLLSPLPFTAFAVVEAASVTAAASVTHRSAQASSRVLATEH
                     ASNAKKASSWSLWRRGRGVIHCTLTPPAARLLARQSVVADGAGRGKTEAASKTASSSS
                     AASADTAASLWHRFGCCALCGLDVVQRAAVRQRLQHLLRSPTAHCDPAELAMQTEESL
                     SLLLGPLWGVCCEVQEHSTNIAQSQVSTCEGEYTTTELDAVQGSYCCPCRGEVTAHHV
                     TGVAHHNCLAWAGLLDFFTNTSLEDLPAAAAAGVYFVPSMTASLHMTVPLQDPLGVLA
                     ARTSGRVARWQLLAATLCHMHQRDADEESELGKRVQTSGESGAEGPLMTPRCALCEDG
                     APLLASNSPSFPFGAGLRVCEGTERGESSCGQQYHYPCALLAGASACIIFGLEDECNV
                     LDASASTPVRDRSAGGKRRGVERPVEVWCGVCHERHEVCRRRV"
     gene            complement(<148891..>149502)
                     /locus_tag="LMJF_17_0300"
                     /db_xref="GeneID:5650755"
     mRNA            complement(<148891..>149502)
                     /locus_tag="LMJF_17_0300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682232.1"
                     /db_xref="GeneID:5650755"
     CDS             complement(148891..149502)
                     /locus_tag="LMJF_17_0300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682284.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650755"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:Q4QEG4"
                     /translation="MRALGLAVEAGDGTGDKGECDSALLTSSLSCDPSRSMEVEVETR
                     QGYVYTGKLVHIDGHYNVMLNEALVQRARSFDVERAVLREKLQREARLIASSLQGVVA
                     EDADVMQSTSELMPRPRYIGATYIRSNNIFLMRFVDASGGTGTTAASAASSNSALGQL
                     KSGFSAMAASIKAHLQREKTRNRAARRKRLEAKKSAGGGGGGR"
     gene            complement(<150898..>155022)
                     /locus_tag="LMJF_17_0310"
                     /db_xref="GeneID:5650756"
     mRNA            complement(<150898..>155022)
                     /locus_tag="LMJF_17_0310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682233.1"
                     /db_xref="GeneID:5650756"
     CDS             complement(150898..155022)
                     /locus_tag="LMJF_17_0310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682285.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650756"
                     /db_xref="UniProtKB/TrEMBL:Q4QEG3"
                     /translation="MCNAATPRATLRAGLAAIGLKPRPNAIHTSSSLRSTSPAESPVA
                     ATPHRTVPCLVLFSPQGPRPLEGLKTVTLERPGNVAAAVPRGGYLRARGASLNRQSAG
                     GPPSLSASAAVASSRAARQRNAKHAAVSAAARASHQSSSGIRCVYDRDTRSQLLHIIP
                     GTEVDFSSCMRLPALAATPTPASGMVATPLLFAATAVHTIVVVQFCVAAPTLSTAARH
                     QAGASRPQLPGSPIPPPGSFYIELVLRTGTSSDSTRGRGSTNGGGSSSSSGGYRLRFT
                     NTGHAVQRHTHHTKIPLQCVRTAQWVQLFVDLEALLQSCKAAGAVVAGGTHCRLQQLR
                     IGSGGSAASTGGVYVRRIIAGHGLPLPHPAMDHLVTADGVPGTMPLMPTPIGGAQEIV
                     RDADREGHSDRRGSGTLQQRSSGSGSCWVPPEALRLPAEAGESLCVFVRTGDEHVLSE
                     VPALLTPAEEPSREGEAHTRDSDNSVEATQVRWKANNCASDVGRGAVEWARDATQDTA
                     RRRAAQAVTAAASKPLTLPLSATLPPHQLPRRQPKPDQQQSPALLNSYRHQPESETAA
                     ARVCKRQPEPSKVLHHTALELLRMRDQQQSQPQPAHQFTGSGAAAHAQTSAAPLSPFF
                     PSSTSPWSSPVDAASLSASDDAEMFVVREVSAAEQLAPATPPQYPANQLMTGKPPLRC
                     TPSQPPVANKATHHALNAGHTGEWVVQQVGEDVVIEDAGQEGFSAPATVGATGLLFST
                     TSSATTTTATTSETSVLSVVSYSSAVELMDAMSERVRRIQMVLTGVEEEAAAAASIFA
                     QPLGRRPPSRHVTPPPAEQGARPAVSTVTPTVPPLLAPPPPLTGAAATHSSPPPPPAP
                     GPTAPAELMEAVLGGTPRDAVAATAAVPSLPPASPAAAMATQTCDSIARVAVAECAAT
                     TSAAPNDANAILELWSSAERPLSLPASYQRPATAAAKRTPLAERLRAHQASLSSSSSA
                     ASFSLVDGGDNDGVGDAPSAAIPPPTSAATSWTFHSVSLTLQTPSMLRIPATSGAVGE
                     ALPRAGGASSSYTAGAEKGEGAPLLRQAPRPLSESQTPAAEVVAAVMPQSKSSSGQVT
                     KAVVWRRPVPVPGHSPSVGDATQRALQDEVRLTGTPLPGRIRAAGAESGGAGRLATWS
                     ARQNTGPTSSGMHTPLSAAVASKLGVAPQQESRQGFIEGAELCVGAQALPPPPSGRSF
                     STVSSFQMWLPSSSMPTLSASRGRYPSTITPFSGGGDRHCDPFSDSSSGAGGGPRPPR
                     LGIAAAYPSAHPPMPHPSVVRMPQSAAAATLPTCNAGAAVGPSPLAQQQTLGFPAAAW
                     TGDPPQHAPVSHHEAPQNDVPLSAKLGNREGRYMYDGVLQCYLDLETNAYVDKT"
     gene            complement(<156540..>157529)
                     /locus_tag="LMJF_17_0320"
                     /db_xref="GeneID:5650757"
     mRNA            complement(<156540..>157529)
                     /locus_tag="LMJF_17_0320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682234.1"
                     /db_xref="GeneID:5650757"
     CDS             complement(156540..157529)
                     /locus_tag="LMJF_17_0320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682286.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650757"
                     /db_xref="UniProtKB/TrEMBL:Q4QEG2"
                     /translation="MMGGRRGPPLVAPPRVLFAYTQTATDTPMSRRQPPQAAAMGAGD
                     KGRRHATSPTKAGASRFNVVFRRSSGSRQQRAKREGALSVAHDVSYLYDKDNRACVLQ
                     CKAVGQAPNKIFTCMQRAHRGADWVVGTELHLCGFDILVEEVMELHCIPYEEAVNAVG
                     NSSKAGAGAGGDRITFCGNSARTASAASSAQTLPTAASVGPGRGRTIHARPRFVLLPR
                     PSPLHGVTATPPRATHDNAPSSPTPLEDEEVPSIYAPQKWPTLKTDSVSVGTALTAHH
                     PTDPPPTAPRDERGVDDSVYPDSCPPHERRQRRRRRSVASLARELERCYPEYF"
     gene            complement(<158039..>162994)
                     /locus_tag="LMJF_17_0330"
                     /db_xref="GeneID:5650758"
     mRNA            complement(<158039..>162994)
                     /locus_tag="LMJF_17_0330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682235.1"
                     /db_xref="GeneID:5650758"
     CDS             complement(158039..162994)
                     /locus_tag="LMJF_17_0330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682287.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650758"
                     /db_xref="UniProtKB/TrEMBL:Q4QEG1"
                     /translation="MVAEASAASREEAELGAIIDALAIAPSSTEWARITRVLDSDLFV
                     SFVALLTALNAHALVRVVRAQPARAGPATLRAPFALKTRPQFRATVAAELASIADAET
                     VSRSQSDKIAAGNVPLRRGSAVDPQAQTLQCRQHAHHYDVGVTGDRAPSARDAIKLAL
                     FKSLDVLQDYAVDEWREAGREGALLLNELACGGCCTSEMDVRVLNWALRYGSVSLGSS
                     CTAVAADVVLRFRCVAGSDSISVTTTPVERAPKESHTRPSCVPLGSVKESGFVVASSA
                     PSGEAAGLVVSDEICLPFPISAVTIRRPFVDEDACRSRPALKELRWPRQCMTGATLLL
                     LAAAKASLYRSATSTCSALMLDSNAVLEGVSTASVRCKSPVASAFEWPRAPFFSTFCD
                     SAALQRGLFSHGESWGVESNTAQDTTDLLAQNQWHCPDVVAMIAFMRAALRLPLRSYP
                     KITFEQTALHDPARRMQELAQGLYGDVDVLTRVHVCWETPRDCFVACAVSDPVLHHRN
                     AIQSGSEASSRAWLSCADTGYPRGPLLLLVAAVCSLYDQVVSRVATAAAECYPMVPVK
                     NSFARGGLDFLLFSWFEASPQVRCFTIGTTPPSYAQQPRSEATPLLDGSTHHELGPSM
                     TRAMLFYDVLGQRVLFAETHATNAVDAVARMDFLSVEQNFPRQDLYAPPSMVAQRPFR
                     SVSRQCRWQRFRQLLERSLQRSIAAADVTGADHLARTNQCAGHQTHDRTVVAAAVRAC
                     IGACASEAGALWTVLQVVAKVAATRAGAGAEGGGINGERGVYARQLLSARLLEDSGPT
                     AEPFAGEAGSEADRGWWTGGHDVTWNCRPLGKEAAPPRAGVMEAQLCMGASLGAAAMT
                     DGKQAAVASVEVIILRCRVDAVRSSASEVTEAEWLCEKRVTEPPSLCCFGTVTLTTAQ
                     AVSGIFPALALLCRRALEYIYSEARYAPLVSILPPMSDVLAWCAAAAPMFAGTGSGYL
                     PYEPRFYAAPKLLGELLQGAAGKYRCSYSIPPPRDRVTSAASGTDWGEGCAEVERERG
                     EAAQPSTIFYTSKPIHVDTAANEYATRGQHGSRLAKPPAVACTLYLESLMGNGASPSA
                     PAVSPMCPAPVAIPFVLGHGVGRTKREAWRSAAWQAVRLQFPAVLAQLEAYRDVSELL
                     QRPAQLNQLVRSSGLDRNSVWGGVAPVVYKLNFDCSVLFPSSVRNAATEVAASASVQA
                     VRRSQCGVTAVRTDGSKLCVVPGCTATAASSGEAYTTAVAIVLRAVRGAAQEAAAHMT
                     GATMGTTASRTAWAALSPSSPGSVSGAACSPDLGPYAAWRDTTHNGKSIWHAYAGALS
                     AYLDSDVVVHLVAAEDASVDELGSLSRGVGSGRRLSRRVMLSRVQVRMRDGRSGAATA
                     AGNVPLGFADQQPWASRRITSFGAFSVAAGSGAVDASVGGGADGILLECTAASLFARR
                     WSPLGTGASGTRVGAVAAAAPPLTEHPSRLLQEITRWLSDITQQCGLPLKVREELRGL
                     LCARACDLARIQDSYRSTPAERVEALLMRWVGRRAQVRIRRINSSVVAYPSLANQMVW
                     VAEALVEIQAERRCPGSRSSSHAGLSLDGNALPLLEQDGELKSCAGTRERLDRPWVAA
                     RAVGATGNEAAWQLYRHVCNALRDLVATEPSPRSVEKQRRQ"
     gene            complement(<164063..>164497)
                     /locus_tag="LMJF_17_0340"
                     /db_xref="GeneID:5650759"
     mRNA            complement(<164063..>164497)
                     /locus_tag="LMJF_17_0340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682236.1"
                     /db_xref="GeneID:5650759"
     CDS             complement(164063..164497)
                     /locus_tag="LMJF_17_0340"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682288.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650759"
                     /db_xref="UniProtKB/TrEMBL:Q4QEG0"
                     /translation="MPRTIKCILCAVALVAAFAAALAITMTVREKVPNGLYCGNYASG
                     LVVGNLTVQYEKRLFDLAFKGLGMNLKCENEAFSYDPKSHTLMVTSAKDPSDCLGAVI
                     TASGLNLSVTYKPIADVIILDVGVAKIDCKKCSALTYVQPAL"
     gene            complement(<166529..>168316)
                     /locus_tag="LMJF_17_0350"
                     /db_xref="GeneID:5650760"
     mRNA            complement(<166529..>168316)
                     /locus_tag="LMJF_17_0350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682237.1"
                     /db_xref="GeneID:5650760"
     CDS             complement(166529..168316)
                     /locus_tag="LMJF_17_0350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682289.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650760"
                     /db_xref="GOA:Q4QEF9"
                     /db_xref="InterPro:IPR001269"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018517"
                     /db_xref="UniProtKB/TrEMBL:Q4QEF9"
                     /translation="MSEPRQPEVAPALPVASEHTVTCGIAASLSEKPALVAMPAPEPT
                     ARLPITREKGVCPVKAQYLRPAPARVSLDAEGRTRGMNKGAAREHSGFVQGTQRPAWE
                     GEGNFFLGPTLQQIKRVVREAKQRQPKQQQQGREHQQSPESKEGAASADAITTEPSEK
                     TTAATAAEASELLPVIGQKRERSSSAEEAPMTEAPTPDATTKLSSNEPTARPTQTEES
                     LREVIARQSSSRGLFAEKLVLAPLTTVGNLPFRRICKSFGADVTLSEMAVVFNLNRLQ
                     KSEWSLLRRHESEDIFGIQLAVSRPQEAATFAQALEASGFSYDFLDINCGCPVEKIVK
                     SGCGCGLWQRTERLRDVVESLAIYQSRPVAIKCRIGLDEDIPTLHQQIHRYSAWGAAA
                     VTVHGRSRKQRYTKFANWDYVDQCAQLTSLPVIGNGDIMSLEDVLEHRERQPHIASHM
                     IGRGALIKPWLFEEIKTGQVKDISSSERLDMLKKFCAHGMAHWGADERGVMTTRRFLC
                     EWLSFLHRYVPVGLLERLPQRINERPPFYEGRDELETLMSSDSVKDWVRISELLLGPV
                     ERQFRFTPKHKSNSYTSATELDGSMSVEG"
     gene            complement(<169123..>169671)
                     /locus_tag="LMJF_17_0360"
                     /db_xref="GeneID:5650761"
     mRNA            complement(<169123..>169671)
                     /locus_tag="LMJF_17_0360"
                     /product="cytidine deaminase-like protein"
                     /transcript_id="XM_001682238.1"
                     /db_xref="GeneID:5650761"
     CDS             complement(169123..169671)
                     /locus_tag="LMJF_17_0360"
                     /codon_start=1
                     /product="cytidine deaminase-like protein"
                     /protein_id="XP_001682290.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650761"
                     /db_xref="GOA:Q4QEF8"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="UniProtKB/TrEMBL:Q4QEF8"
                     /translation="MPAVKWSSPVVRNELMSLTRLPAEMQRAAAAAVAAHKNAYSPYS
                     NFSVGAALLHDDGSVTAGCNYENCTLQSCCAERCAIVRANVEGHRRANAVAVYGRSYG
                     AATPTNPPPVDALCPPCGLCRQLLVEVADLSQNFEEFMVVLVALDAQRAKVVRLADLV
                     PAKFGPADIGMDVTQLGCHPSA"
     gene            complement(<171189..>173591)
                     /locus_tag="LMJF_17_0370"
                     /db_xref="GeneID:5650762"
     mRNA            complement(<171189..>173591)
                     /locus_tag="LMJF_17_0370"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682239.1"
                     /db_xref="GeneID:5650762"
     CDS             complement(171189..173591)
                     /locus_tag="LMJF_17_0370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682291.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650762"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:Q4QEF7"
                     /translation="MGQAASYAESSVQRALLRLKEEEQADEDELLCACGYRRASLASS
                     TEESAAVAARSSQDAEQSGPLPLSATHSANVQLPPPPEALGPLVSLTPEYYTLDELRH
                     VLQYLPDPLWVSLYRVSLLYMLDNDRDGRISSTDISFFMDWGIKTVGRDVLPDQLAEV
                     LQTYAALHCWHCCLHVGERIEAMKAAAAAQPQPGHGGNTGAGGAERTRRHHILPPGAV
                     GPSPLHPHHEQHHSQSVPSFMLLHFREAFLNAPAGGPVPLPGTMDITATKSSESTVSP
                     TQSSPSLASSTSVFCQPITDNVRHAAAAHFAEWMLRLVQHQERDRRHERQRFERRVRS
                     MTTAADMKLGGTARLRHSSYVGQQSLRLRLSATLLPTEAASVDASADGDDLVVSVSRN
                     NTPGQHRSMLCATLNADAGAMAASWDAEHEAPELEVVAPAPSPQLATSLPFSKSPTVT
                     SRSRPPYSHSTPATSLTCVKAPPQPSSPSSSVTPLSVPITFVGGNGSSKGTSSPLLSS
                     AIGTPLTSAGSFPDGRRRTAVGGALITDTSPLHQPSRQHPSAVAPTTRSKSLGGPPCA
                     ACLNMAVSPEDVTAGASASANGADAPEGDLNDSDFSNVNRCVSASSIASVAGAGGTAA
                     AATAPSGGSAASLLAHQVSVLLMDAEVFYAELEANGWCTIGAVEEVYLDFAVEESYCL
                     PFWSFCRLLNKASADDVQVALELSTDQAVAVLTSAVAVEEYRQAAAVRQLQRHSTMQR
                     DGGHGNGNHCYSSSRGDGWARNLQVIPLFVVSEYTLVAFIAAFIHAYWAMLGGMGVDP
                     VI"
     gene            complement(<174728..>175555)
                     /locus_tag="LMJF_17_0380"
                     /db_xref="GeneID:5650763"
     mRNA            complement(<174728..>175555)
                     /locus_tag="LMJF_17_0380"
                     /product="putative Qa-SNARE protein"
                     /transcript_id="XM_001682240.1"
                     /db_xref="GeneID:5650763"
     CDS             complement(174728..175555)
                     /locus_tag="LMJF_17_0380"
                     /codon_start=1
                     /product="putative Qa-SNARE protein"
                     /protein_id="XP_001682292.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650763"
                     /db_xref="UniProtKB/TrEMBL:Q4QEF6"
                     /translation="MADAVLYHKELLDLEQQVEALPLDVRAPHQPATAGVGSSSSSGT
                     GRGGGGNVNSSSARAATFAKAQDILRRLNRLLQQLRVEMRLLEGEERGVYETHASAHA
                     KKIASLREWVQQSKERAAQSTAASMAVATAASSSQGQRSTGVHWPPREGDNDEAEGGD
                     GPVMSNCAEARQAATRINEVQHSTLQSLGRSEKLLNETETLGHEAATTLRAQTEQIKQ
                     TTVELDEMRSELGRASTELKCFMRRMALDRLIICFVIVILVCIIITVVLAVLKHKRR"
     gene            complement(<179120..>182728)
                     /locus_tag="LMJF_17_0390"
                     /db_xref="GeneID:5650764"
     mRNA            complement(<179120..>182728)
                     /locus_tag="LMJF_17_0390"
                     /product="putative protein kinase"
                     /transcript_id="XM_001682241.1"
                     /db_xref="GeneID:5650764"
     CDS             complement(179120..182728)
                     /locus_tag="LMJF_17_0390"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001682293.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650764"
                     /db_xref="GOA:Q4QEF5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4QEF5"
                     /translation="MHNFRISLNHDVCDGGRLRPHRHRSSSSSSSSSNFSSGTSVTTS
                     EEADVNGVMQHLEAAAAAAAANSDGACSLTDCMCPGANNKELLSYKPDGVVSVYDNHE
                     EDLIDCDAGESGSRTGGLSRERTGTDLLSVKSAGASARRRKDEVDVAAKGIPLEVRRF
                     QCTKSILAFKEATKNDATPVPAKLVDFIVSLTSSKNGLCTEKEMCDWLVAQMCDRIET
                     GQVWAMGKTSNLLFALLWRGSRNFIESVRTSGASLFQVSHLADVIRQAPQGNISGDRL
                     PGSLQPIQHGSTRRKSARSRGKSASAVGSNRAVKPLTSCFLEQLKLKGVCSCGAASWL
                     SQGNEALPVQIDPTFDIPAAEICFFVTNTAYMEALCEYRFRHPTLDLVRGEILCDSDD
                     CTLSDSAGPASDFSSGLTTPAAWKELLDDTLELIKTVAAADPSILICPTGVAIATIRL
                     RNAVLLYEVACRALVRLVHSIFTSLRTLVNSVQTESGAPPTRTQTTRAEQSPTAITGS
                     GCSDSSRLADIGARVDLTLSPEAALGLVNMHYSAMHQFNCAVRIFKTYCESAQHVSAE
                     ISKRATAALKLIPEDDFAAFRETLKQLQENDCAKTADASHTAMQPLPHQAANSSGVLS
                     PSAAGATEGRATEMFSPLSTVAVDGASLPTPAPFSLESGAYSTSLPDAGVRDAVLMLY
                     EFNSAHEGEQPPMWSRQVDAVSALFDEKEAAILHRIFRDGLDGLGGQWRDLTNSALAA
                     AEKVLMTPCESTSPAPKRENSGVHGFPSSDGIAPESGGHHGSHGDATARNSAHALRSL
                     PSGLQLLQATGLASGDDKADFASPSSSSANNSSLSVAGAEKSAERSIEALLQEEDVVV
                     ICNEECSCNDTLKLTDRFQILMDVPLGQGSYGKVFRAWDEVAGCYLAAKELPLDSSKA
                     HSVAVREVLQEYTVLTELSHPNIVRVVAFMVMRETARIYMEWMPSGSLQDVLRHHPRG
                     VLRESVVCRYARDVVSGLAYLHSRGVIHRDVKPANMLLSSDGTVKLTDFGTSLVLSDN
                     NRTLKSDALAGTAAYMAPECVQGTYSSASDIWSFGCSVVQLITGHLPWYDVQTGSSPE
                     PIALLFKIGCLDDTTHLERPHDPLVSTVAAATIATETSTSFDATLSNSNTASMTGSFA
                     STFSKSFRAALPATTVTSQPEISQELIRMLNAIFVVDRKKRPSARELMHHPFFKLM"
     gene            complement(<186792..>189956)
                     /locus_tag="LMJF_17_0400"
                     /db_xref="GeneID:5650765"
     mRNA            complement(<186792..>189956)
                     /locus_tag="LMJF_17_0400"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682242.1"
                     /db_xref="GeneID:5650765"
     CDS             complement(186792..189956)
                     /locus_tag="LMJF_17_0400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682294.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650765"
                     /db_xref="GOA:Q4QEF4"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q4QEF4"
                     /translation="MNFAEAFRDAVGEIPYTGDELINALRAARALLASLPDDIHLEQK
                     KRFDRQNRRLSGEVIDIPVSESESSEEDKDGDDEECAEGSRRTGTGKGTAVDAGAISA
                     ADEVAAPSSQFSTPAALPPAAASEGANDGGAVQSIATTLPADQASHLAASHGSLRDGS
                     GFVSPASLHSGNPLLRSEATSSCDAPREPAKTHGQRRHRGTSSEQRHRASPRPWDNCD
                     ARHTPSASSTTASSLSCDVDDEKRERVRQLELYDQSPSKWLHQFICIGAKLFGEQMED
                     YFRAVHTLIYYMAVRRKRVEQRCQYLRNRAAQEGTEGVDARLSDAAARAFSYTSRVSC
                     EMAVTAVHEDGAAASASEEAMKNIESSDDNDEDDDGEVLEGFYISREVKRSIRVGLPD
                     NAFRLRDSIHNFFFSCYATVIIQGSVSVAQIKQAAVEVVRICRCVLTWPRYPLNLRAQ
                     WADDREDQLRQFLNKWLGEANGHLVTLMMAPPEAPAAVGRRAGAQSEADVDNSTTARS
                     SPSTVDAESIMADDGSSRHDGNDDSEDEDSEVAVGPNSVNVPQQKVFLGPQTRGEDAI
                     AMAYEFVRSPAPHSTPLARLVADTVPGKSVGTLLPCIEQPERRTFNDGFCRLAPSLSQ
                     KELELITELMQLPLTEMPVVNEDDKGNHDQRSLHEAEKAIVKHWASPTYDPRGGELTV
                     LINPTNAFRLQLSNPIIFSLGGVQCDMCCVTERRVSFQAVLDSGVRSEVVLEYEGCIG
                     YDVCVACSYYYYKSSEMRLLRAVHPNPHLRAPFAFGRFSKTRVHTIRASACEESEGDM
                     TVEVVMGVSPYGVMPVGWVLPVDRLAELSAACPMLAEETELTAAVHATLPVPPQDWKQ
                     HCTIANISSLLAETDGRCDTAAAMASRHALAAGVADDHLIDEADVCPICLQLLHSLLP
                     VLRTLCGHCFHVECIGSHYHYKPAVVDGEVNENNGCPVCRCSEYMPPLTDADAMVRTN
                     VYKLMLRVPADEVAKGRGARAREWGGGCAIAVGTILTDDGAYHNATNIASCEAFYGVM
                     PGFDFTRHDTAGARAMEAASPAVP"
     gene            complement(<196062..>199250)
                     /locus_tag="LMJF_17_0410"
                     /db_xref="GeneID:5650766"
     mRNA            complement(<196062..>199250)
                     /locus_tag="LMJF_17_0410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682243.1"
                     /db_xref="GeneID:5650766"
     CDS             complement(196062..199250)
                     /locus_tag="LMJF_17_0410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682295.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650766"
                     /db_xref="UniProtKB/TrEMBL:Q4QEF3"
                     /translation="MYALEISTTSPCRSAPYYSLVIRKPYILGQCAAADISLAYEGIS
                     DEHVSVTVLHEKEAAREVEAAARTVPADEHDSDVAANDALEEQHSGVSDAPAEAGGEG
                     CRLVVRVTALPTKGDAEVRLGETTLNSGDSAIAHDGDMLYLGDGICGTFRYRPLMVGM
                     ERSAYPEDYMNDLHRMFGQLGATLVDVPIPSHEAPAIPIGQLYCAAELNDSSNCLAAL
                     SYGYSIVQPTYVFEWFAAVAKNAAAPLSTLPAPSRFEVPVRCTTHPTSTTYLRPESDT
                     CPFSLFPIPSTAMTNRSRADLFADRVFFFFTDASAMRYWRAVECCGGAVYGPGDVEAA
                     KEAIHALVESQREAGAPASRLPENFYIIIDNTSEAVLLNSGLEAASPELMAFIEEACA
                     TSGATHLPVMADHSLFTALLSNKFYEEPVPLTAEPPTAAGVGYSTAHSDPGDASAMPS
                     LNLHTDDGEEGAGTTSAGAPRSGYASGGAASSRVRSASRVSERRASSLHRAIAHTLSW
                     SQMRSRSRQCARSPSASMPGKSDGGLFFANSGHLGRRRLVPFAVQGEPRAFIEYFDVL
                     RVRIYTFLVREEPKLDKAITVYHRNYFVDRDTMDYALEVKAQAVDFIERVEDLLAGNV
                     CHGSYTESLHRFWADCSEINTKAEHLLHCWDRSMSAAVLTRRILSRRASSTDSRRATS
                     SRSMTSRGAARAANSPALAACKAEPATSDANDGADDNQAAVAFVDAQHPNDSESACEH
                     QNEHARPEASQPLEAASHIHERPMAAQGAAAAMGRSGAAAESPATAPDAPSTSTSART
                     SHRRSSMTLLSHSRSGAAAAKPRSIPLAARPPWVSDWNDENSSQQQLQQKPQQQQKWA
                     EPRKPASHTPAPTSVPYPPLRVPLATLQPECAADSPTVVRPRSARRAGSAFACRPPSQ
                     QEPVQQTHREGISDGSTRPEETEDETGALTTTTQSPAEAPVMMNGTEEGDASQVPSAP
                     APAPERASAKKTRASTSRRPSGPMKPRNNSVSASKRNHSGSTPRRANGQGAAAHPAAN
                     GNGYHQRDASAVVADNGNGNTQQQRAHSIWKY"
     gene            complement(<200396..>202063)
                     /locus_tag="LMJF_17_0420"
                     /db_xref="GeneID:5650767"
     mRNA            complement(<200396..>202063)
                     /locus_tag="LMJF_17_0420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682244.1"
                     /db_xref="GeneID:5650767"
     CDS             complement(200396..202063)
                     /locus_tag="LMJF_17_0420"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682296.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650767"
                     /db_xref="GOA:Q4QEF2"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR019369"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4QEF2"
                     /translation="MLNCQGNPSLSGAASAAVGGASGASRSTFNAAHIKVEFNQYWYS
                     RNTVHHLVREVCHHATACAFLSTPSLFFALDERRGNETAEDEARMTQLRRCSRVFEYD
                     AQWASDPCYVHYDFHQPDQVPIQYMAAFDYVVADPPFITADVWAHYATTAKLLLKEGG
                     KLLFTTVLENHTMLENLLDRPLFIAAFYPLVEHLTYQYVCFLSYEPTCLAQPNTELPE
                     ADAKMVAAVRVANDLRSSEREFALQMAQRKREGEERLPTAAFERDNELAQNPEARQRA
                     EAERNAVNWDTIPIEKMEWGHIPEGLTMYPEGNVPPTAVQQRAVSGTSDDPAAAAPVT
                     AESFGLEYDACRRLRANLDAFKSSIDAMQRHMDAQMKLRHQRVKLSKELTALKEASKH
                     HDDTAEHDASAVTPAAAGFSASAIEAQVAEATNAIAMNERERAERLDEMELLARQIEK
                     GEAELAALALQQPSSASPATDMAAAGDADTNAAGASGQQSPSAATPYYAPYAAAMTEC
                     IQAYRSVEAKKVPLQELAADATRRFKFPVFARMKELLQRMKELKQQR"
     gene            complement(<204153..>208082)
                     /locus_tag="LMJF_17_0430"
                     /db_xref="GeneID:5650768"
     mRNA            complement(<204153..>208082)
                     /locus_tag="LMJF_17_0430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682245.1"
                     /db_xref="GeneID:5650768"
     CDS             complement(204153..208082)
                     /locus_tag="LMJF_17_0430"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682297.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650768"
                     /db_xref="UniProtKB/TrEMBL:Q4QEF1"
                     /translation="MMSRLPHFRSDSDFHRDEESSQSMSQVRARPAIRLDTSLSFIST
                     TSIRAGTASGPASPLLGALGGDSINDVCSSAAAVSSPTPFHMRDVNVEASGQYCLQSL
                     KASHSRAVSDSRSAHSSSRLYSQQQQQPSQHQHCPLSLSLSSCSPSVRTDYDAHSRPR
                     RGGQARCLASEAEGDKLEVLESEATVMIRPSDPRPYGTDADDEPGVRGQCVMSSTVSP
                     APRRAVTLPSNFEDGLSMPLSEGAEQHDEESSRGRGSKCAARADGCGGLNLDHGAQGD
                     DQEDDAESMSSATPPPRRAFMLSRRYSSADVESDAEPPRSAAEEAERRTPTRMPYVDF
                     AADAPRGSTILVVDNGDEDEESAFTDGRPTAAVIARANAHPPAVAHAPLAEGPAVSPT
                     LPDGRLVKGVVVEAEKDAQHRAPLTPLRATAAERESVSSHSRSLSSAGSSRMMSPLPR
                     PAPHVAQTTATSTRSSPAHVRGTVRAVCDDTGGATEQQQQRAGTKTVLANKAANAPVN
                     TTTTTATTAANTQPASSTLESELQATPMIPAQLDAAAALPAAADGGPASVTPLNSFMA
                     LNSISGPSLSATTTAMSSLWLVSGSTPTPLRRLRDRDREVSATLHTQEGEAEETSKGS
                     DTARTQTERALKLADEADASAVTAPEAGVELHGSTHRYSAPADTSAEVEQLIASAEGA
                     HHHCSSSAPRHTATDSAASPAVSAPSFSPEPARPQADAYCLSSPPLAAGSAASASVQL
                     NFLSAKDDAVTPVDLRPLPASEAATTQYRYSTATPPPFTTAGTLRRPSETAPSMSSPS
                     SAESARVSEEVKELVRRAQAEVCRTRESLFSALRDYRASFHFSETSPTAKNTLSATAP
                     TPAAQLTATVSTTACASLSVSPMLTRSLPLSTVTVAAAEPSTSPSAALKTASVLTTRT
                     SGEWRSAAIALRPQLRAAADAILRCLQGYDARDHGVLPMETVVRVTYFVITRRQMPPA
                     TWSLRTAEGALAATPMRASMVASGGGAATRSDSAHLPSHNAEGRRAVLLSGTPLGRQL
                     SSSEAGEPRHRVATASHKLFETPRQQRLSLDAHGTTTRVGGSGSLFLSSHLIGVTRPR
                     DCSKSDADADDEDKTAKPECCGRPATCISPSRTLEHVMMLQQRRAEEELYMQFYFTVL
                     EAFKQVFGERYAWRHLGATNASRHDCAINVAQPAQKRRRTSNAAPPECSDLCGHTHVT
                     ATEADAEQTQLEVVNEFNDVAGPLETLFPRLRQQYALLQRERRDSAAAAPKSIVASTD
                     SSLMVARTASESARTEAAAAAAGLARRPPPLDVLVYYRKFIESLREL"
     gene            complement(<210039..>215843)
                     /locus_tag="LMJF_17_0440"
                     /db_xref="GeneID:5650769"
     mRNA            complement(<210039..>215843)
                     /locus_tag="LMJF_17_0440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682246.1"
                     /db_xref="GeneID:5650769"
     CDS             complement(210039..215843)
                     /locus_tag="LMJF_17_0440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682298.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650769"
                     /db_xref="UniProtKB/TrEMBL:Q4QEF0"
                     /translation="MAAAAAAAGVTGSSYPTAAPVPAAGGALTTCSAAQLAEEYQKLL
                     DVVGTPNYETIQRLFSGDATPPASTIPMIQVSFELFEAVQNRFAATKQVLERTKADLL
                     TRNQHYSLLHQDMLRLKDEYAVLQKRNKEAEERNTQLHQQRAKLEVTVEQLGREVGQG
                     RTALDTLRGKLLHREEELQLSQSRVAESLVTLSQKEAVIGTLRRELGKCGHIRYGPAA
                     GQRDGLREGEGDGLQDGGDGANSHAYTADMLGRIAADVEGRSQEARMKLNMADLEGRL
                     SRLSEEKDSVLAQHSQYRQHVQLALQTYEAEAMLREDTLARHACVYTPYFVGAQEELY
                     AKLVNLQTGEDLATDQRGDDDEMGVAARAEAPPPLQSFGALTFEIRRTIDRLSRTHID
                     DASRQQQELSLCVDAQCVLLQASAKLVGFLSAMEEEVLRRRLTLPEVREEWHKARVPE
                     FAQGIAQSLQEGASRFGRGLVGLLQQENSFVEELQQARALQQQQQRVSIAGKDISAAA
                     AAASAAGGKGQRLQRTSLPGGTPLRHRSDSALASRLGGDGSYSSMQRSGEAEWRKGSL
                     MGAGTARVPPASASTGDGHGGSKAEGEQVTASTTANRSSVTSGAQRPLTSAESSLVGP
                     ADGAAGHAAAPTSRRTKIGGSFDTSEAHEGSATGAADMIASPESQWQSTPNAQTRGGT
                     TDGKDAAASAGQSMQYTPTSLATPPAVIPATTSNTDQRNGASNCAAVAEQVAGGLAAL
                     PLMPSVVVCPHCAHDVLVRASAGASLPMPGDGSDGGGARGLLSVPDTAARASLETSNN
                     TSSALASPAGVRAVLRTKSSEWDRAAPGSGAAETTDTQRDGTRLTSSSTAVTKSKNKK
                     KPGSTSGKTGASSKRPKKEPFTGSRGASSSPASSRTNSAGHSRTHGARTWSKRSMSVS
                     TSRVLTRDEQRIGMNSPSIYIASNTSQAVLHSCRSEDNDGATLSAAAGVSAAELALAL
                     SDCQDRLAHTTQELQDMQLANVALQAQLVAALAAAAATAPALGPSMPADLDNTAEPNS
                     SAGATGPVAGSAATQKAAGGHQATPNLPVSPGKKVHEHGKPTTTILQTASNSPHSGPG
                     AAEEAVRASGEVVEIDQVATSVDRKPHYRSGSASPTTQHQSMHAGAHRGGAANRDGVA
                     RASTAGAPSGGKDGLTDESGGAVPNHYTHSLPSTASSPASTSFPGLYSGTARPVAHTV
                     EVPGTTDSTLMLGIAAARASQSTTALQQSSSTAARAKRDPTANAEAMDGGAEQSRGGN
                     TAGGATSIHNSNTNAFRHERPSPLVSPPPQGHYAKRANGGLAAASATQSQHGNTSTLV
                     PVWGSACLPVLNRRPHALTGATASSTDATGSAALHRAIASAVSIPHKTQTLGLVITNS
                     RVTGAAAMQPEKVEPGGYTVSATKDKGGSHANSVGDHTVAFKLPSASPHSLTRRFRKC
                     ALPSLPPLSSSQVPLQQHLWCTHASSSKSGRLPTSSTRGSSPVPMSALPTAVEAGAEC
                     SHQTLATVAATTSAPASWRSVLGSNIVSSSLPSVSPSTMPQQSVSAWTSSPISPAVAT
                     SIAATINIGSDGSAQLSTNPTYPPAAATALNKHQQRKIAYQQLRLCFSQGASPLYSGR
                     GGAQQPSAAVGAGSYVQVAGWPRGGTWYAKRNTGTRGRLRQVMARLVRGTWVRGHLYE
                     APIFASPASVPLSDTKTAFCLIVGGHGVHSHFSSPCTASGHPAARTWQDASAQSLPCA
                     SGAPIPQALTYLATPAETQRQWSSKRFGRSNHGPFALPASSAADTTARRSCQRKLRTW
                     QQQKRWHIRQSRDAAAAGKLGRVSCASATERVAGSAEGLNMQQLPLTLAQRRAAHLSQ
                     FQFAAPSATAIQPVLSTRQLAASDFVSSFVHTRKQRRNACPALHLAKRDPMQRAVKRT
                     VYTVSAASSRSSLSDVLTSTLPEEVLTPLLPSYH"
     gene            complement(<218199..>222950)
                     /locus_tag="LMJF_17_0450"
                     /db_xref="GeneID:5650770"
     mRNA            complement(<218199..>222950)
                     /locus_tag="LMJF_17_0450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682247.1"
                     /db_xref="GeneID:5650770"
     CDS             complement(218199..222950)
                     /locus_tag="LMJF_17_0450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682299.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650770"
                     /db_xref="UniProtKB/TrEMBL:Q4QEE9"
                     /translation="MFADYSDAVGDADAPSLIYLSEPLPFSVKQLGLSHAASPLNAAA
                     ATPAAAPSASPSFRVRAMHLDDVAEDVILVCEDSITLCVPLTWSAAAAAPASLERSSK
                     SEKDKIEAAHGYAACLAQDAASTTAMHHRNCSPHARGALLCLPSRHAPPAPHSSTHTA
                     SAEAAAACLRMANPSQVWTAPLSASCCTTGSTSGLCLPRRLPMPHEELRRSASVLMAV
                     PLPPPAALSSPASSTGRSETPGLTSGPLAVSGYGTLTAPPPVMAVYIMECPVLHEGVD
                     CIAASAVPLARPLAKVVCSPNTLRFREAWYPMQFFCWCDRSRAPAAASATTTAAAYVD
                     HHLLCVSSIAVDLVQVRCRVSPALASQPPQPPQASTKPSPLLLFGGGGTQEDGHIPLA
                     SPVNAATVASMTSSSSMASSATTGGVCDGAALVSISVLQRYVTRSDWCTYDARSRVLL
                     SLNHARPSVVKPIKVYVGRRASSVDREPRAKSSRATDASSVRLELRTLTELTLPESPC
                     ATLHMHCGAGHGTAAGAAAVSLSELPLPLLRCPHVSHQLSSVLGVLTIYGQSFVYHVS
                     SGRSTIGGQQDPVMDLYMHVPSREHGCQPLSGVSQTGRALSSGVACAGASASAAEAAH
                     SDSLLSRLTAAASFAAASAPPPKLCSGVFVHAARLSLTAVISCASHDSQASVQDPRSG
                     AVGAHVLAAPLPQLPGSVPFCVQVVDNLIVIHSPDTARSAVYDLADCGSSSVSRMSAA
                     TASRNARKSMPARSYVWKAVTSGTLGAGVRARKPAAASAHYSSEPAPSLGAGGGATSG
                     SQGMASSGFGRSQLSRPHHHSGSSITGDVDDASASTSCTPLLLSPTTSHPPAATSSVA
                     QAAAAAESLAAEHQRQRDRSRRRKVTWQHRAPSAGFTSMLSVLSSAMLAMTALDPTTD
                     AAAASPAVPLMYPLYCCGAVAAVEGCEEGDAGGGGGAPRDSEPVVYSDYQWLAGLRLP
                     LVMKASDGTLRVCRVDAARVAAWRLLVGSSHESDRAGQDPCPPQQEQGLDVNTWNGEA
                     AAGFVRTYVSFLCRRHQVFSARSANGRSTSSVHALVGLLAELTVQAVGLEGDDGDGNG
                     AGVSQTGPAEYSKVDALRHFLWMATASTPDVGGEQLYTLWTCMLENLTLETAFSARCV
                     AVERERSLALAGGVGGADAARAASSEASGELLISSAELQQLILQKVFDPTWAAIQSSL
                     LCHPQQQQQQQQPQRRRQLEGLLCDYVRLLHSAAIPVEPPLQHLLLEMVLSDVGDIPA
                     SPFMSSRSPSVCSAARRVQELLRQGVLERNEATARWLLDWWGASQEVRASMRRIDTAD
                     TSARRFNAGEPSAKCRAEPSGAVASAPTSPAAATPTAQQCDDVSFSPFCPAEDAEETE
                     ILFGEAVRLLEAHGFLLEVAEAYSCRSHFTAAAAVLQRVPEQSKLAEVPVVAPSPVLS
                     HHRRTRVLSWDSLVLSVLDGAWRCVCCAEEALFSNAGGALVASQHQVTALDFASNPLK
                     SWRTRSLERQVQAAHRVYITVARRLLVKPTASALPPSSASKAAHPSQGSLAATTSPDV
                     DGRFHVHAIHYERLLRQMEQGWHELKQRGGA"
     gene            complement(<224421..>225071)
                     /locus_tag="LMJF_17_0460"
                     /db_xref="GeneID:5650771"
     mRNA            complement(<224421..>225071)
                     /locus_tag="LMJF_17_0460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682248.1"
                     /db_xref="GeneID:5650771"
     CDS             complement(224421..225071)
                     /locus_tag="LMJF_17_0460"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682300.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650771"
                     /db_xref="GOA:Q4QEE8"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR027137"
                     /db_xref="UniProtKB/TrEMBL:Q4QEE8"
                     /translation="MEEDLHREQRRRTYVHAATAEDANKEAVSTHVSGYNPWEVLGLK
                     PGASTQTIRLRYHELMKQVHPDMAADGAGDIPRLNQINKAYELITKSPTLDRRYRNLV
                     SDTQYFYYKFLPEWMARNVDEMPRYWSWVKWRTPSSFHIFLLLCGFYVLGRFYAAFPM
                     LTSIFFVSVALDVLLHTMLAPAALCMLFLYSIMAYRSYDMAWLTSPKGFLRRELGY"
     gene            complement(<226290..>236945)
                     /locus_tag="LMJF_17_0470"
                     /db_xref="GeneID:5650772"
     mRNA            complement(<226290..>236945)
                     /locus_tag="LMJF_17_0470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682249.2"
                     /db_xref="GeneID:5650772"
     CDS             complement(226290..236945)
                     /locus_tag="LMJF_17_0470"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682301.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650772"
                     /db_xref="UniProtKB/TrEMBL:Q4QEE7"
                     /translation="MCATDFTCPRSSVAWASGSFTVGELLTPHSLSLPVGLTLKLSLC
                     CQYRFDGTLLRSAELYDIFLQELLRASPFQVLSAAEKRELFPQALIFAVDTWGRRRVY
                     NTSYVLTDADVAEHNDGDGDVLVLTTGALSPAALLKLITSSPSLSAARRSGLGSNHKT
                     SAADPAIAARTGARAAPTRGKVEEEGSEPVDTALQAADTDMQLHITSRVLKCKCPHIL
                     TVMPPLHMQRDALPPINIVGLGSHCGVPTSSNNTDGADARQSTRPPFSASQHIRRVCG
                     ADGTVAFAVSFEVNPPVPPTSLVTWTVRSVVAKAEEAGSAAPRGDRSWTDGHHSGSNS
                     SGPSTSPTYSPLILRHSRLLPVPHYSASSTGGDIGPSAVSTPTDSCLLHSSASSPFFA
                     VEANVRYEVSVRISRQPLAPALLARGARASGGDQGQGESAVGFSAAETASWPSAATAS
                     AERVAHGHFVLRLPLNRTWALPSVHPAPHFGFRRSMRLTNRTMARTAVMAALDPYYSL
                     HSASPTPSLESAGSTSAEASGAGWFGGAGHRSVGGGSSDAVLGRRRPLAYYGYWENAP
                     LRDQPLPQHPTRVLANPYTKTSAPARKADATDGDGEAGSTSVPLFLGRNLVAYLVRDV
                     DDVCDPVVLERRELWAVQAHITTSGPTTACGEHQDVSALILRQLLLRMRVEPKLEVTV
                     PNTTWLADARRLAGAAREGSYRCEARSSPPATSMTAEDTGAASLALCVAVPDAQRDAS
                     EVHASVRMSHRGVYEVVWVARVAVREERLIRTANLDPLYTRVIPVTASAEATASGLFI
                     VEVYSRPLLVVRRLASYPRVVAVELPMHARRWVVSAPRALADPTSPLAASSTSPAAPQ
                     QRQSAPRGGGSSGADVLSDNAPTGYWRSRPPLRVLSVDEQLTAELDTNSVPNVQRMLP
                     NGTLEFVAQDTGEALSLTVVIDGAVRSLHYTSQCPDTHVEYQIYVIALPLPPIVPAFA
                     PIYMEEGCVLLVAPREVRKDEVAEWRVPPCMSARHPPYLVQRTISVEEQEETQIITTA
                     VDGGNPLALTTAAAASRPVTALMACGVEAYHHCDVVWSVRNLVATVEKTYSLRRCQRP
                     PDVVFHEKDRHQRISYPHAEVFALPSLTEVAHTRVNASVLVSLGAASASTDATEVVSH
                     HRRHRRVIPVAGFAADIGYSFNYTGQQNYFEMVLRPVKDAVAHQLWNTQHDYMAGDDG
                     AMVLRRRTGMRMRQEQEHTPMGGVGTEELGVDAATGDNETVEAEGAFSGEYHANKASE
                     SRKASTSPAERAAALAEQQARRRRRRQLDEQLDTKLEETYTLLHEAEARRLRVAGVGN
                     ASLFLMDYVVRSSPARLSAEVEAEKHEFVRRGMCVEKPGSAAVLAVNPRGLVREDERY
                     GTVLPPPPPPAVAVLPFCAPQYTFARYPELFSLYGYEFTWACPDAAVMTVEKHHPTYS
                     VLYHTPERYGRAAAAPPATASESLCQLTVANHVTHTEQRDWFLVKRVYPSPLPATALV
                     VLSHNAAGSLQVVPPPLSSATPKSRPSRTSSSAGTSSSSDTAQQQAAAAPPAIITMEK
                     LYTAPINTYPFARARHIVGKSAVLHVDAPSDPAMARWAVTSVVPAASTTVGSQLLMDN
                     VEFQPLPRHPAAVARGRGGSTALIKGLHTPGLYTITHSLPDPENPNVCPPVALTEMLD
                     VFHAQVVEKELYVCGDTAALQAVPIPREVAHEFVGQWEVVSLATDENTVWTADANFTG
                     ICFDRGTQAETLVHGLPFGVVTLRWAIYRLLPLSTDAAFPPPSLTASGKYVSGVGTSQ
                     RAASAASEVQHRVLVDHDTVEVFVLTENLPSRRLVTLADRATILTTSSTQNWRLEAGM
                     AGPGATAAVDGATQARMSVHSIHSYSNGEAAAFFSPSDGSTADGAAHAAFHTYFGLHP
                     RPGGGVLVLEQLPVGTLYLYYDLVPSRSIFGRMEGHTCTLKGHYEVERVSAYLTATTS
                     MDHECDGYTGKGRITLCLHTEGAPATESDGLKGNSRTPPRSPPQSKRQSQSSREDVQF
                     WQSQVRLIDPATLEDTVKRGAREVERLSGERCATPWWVSPTTRWFNPSYTSVNTASLP
                     GRCISFTVQAGRHLSPREVSQPLFVAVPRPSSPPTPTLAVASGMYADRAGDGSAAGGA
                     MHTTGVCPFHGNFISTRIIDGAPGAEAGVTAGTSAARGREKGSGHDGADAATSRFGLS
                     QLFQLGLPHTLGDAALAFASTLLGRDGSAGGDDGGDEGGVWGIRYLPVLQPATLRRAN
                     TTMRPMVGLRGVQDDVTYEVNISGRTATFGRSAQDSAEQASEATVLLRLDLSHPRQLG
                     GFIVSASAATELNATWRPAMATVSGEGAHDASQGEADTPSSSSRPAPATGSPQHSLLY
                     KCVEGTVRGADVLQYWTETNRPDGRVDRTAQEWLDYAFAVRNATVPCDVLFGSLDHLI
                     SEAHGDGSSAPASASPSASGDWYSKRARRGRQRIALPQGALPLHQQQQYISLAEMERQ
                     VERIRRQWKWTADGIDVTGLPADLQHALSHRRVTSTQLRAIEAARKARQEAEEAALAE
                     ETRQQQLHQRELQNAPSRMSPAERLENALRAYQGVAQGSEVAVLRMRLPRKGSFAVPY
                     DIFLRTALHKDVLCGTAIDPPPVITDPTSQPTVTNPHSLVPLGRVEVRDMAPVLSVHP
                     PVVKQCEVEGGMPVLTFELTGANFARAAFAADAVKLEEIPNPALAKAEHGAPNHPDVG
                     LTACIEQMQRGVKAAVEAGSRKRLYLQLRTCPTFKMLTLEEYNEHQDSEALLRRLQLP
                     RYLRVTVRDAIYPDGFLAPSSQTASSGASNASAWRWMPGRELPTSVTATSTDASFVVE
                     VRPTLARLHLRSSADMTPPGAAAEGRSGSGRRRHESGRWWGGGGSTAGSSKPDPATTA
                     AATEMAQLTGPSFDPTPSRPLLLCEADLRRYGFQLGIELIGDTWAPTVGEDGPSAGSY
                     ARAAADDGTIVFGDHQRQADLPRQRAPPNVALINSFSVVEHHSLDSSHHLYMKGGGVY
                     RSHFINYLFSELLSDPAVLQGHRFVYRYNDTFAGITIPPLSANPAAATSRRGHRDGGW
                     LSGRSRDAGAAEAEEYSDLHATQVRRSSSEHRPTRGGAGDATGTATGSGKATAAPFSS
                     AFPAVRQFCKVEEILFAVPGIATECSGCLLADTTFYVAGDLTGMWTASPRSGTASAAT
                     GTISALVSAASATTSGTPASEATMELFSWTGEAYTRPLILPWDSATRVPRRWQFDWLC
                     PAAAHRALEHLALQLTGSSDGAALSIVMDVILYRVRGVDGEALPAAQRPMVLLSSTPA
                     DLSDVLWQNHVHTRRVGASAGQTTLAAPLVLSVNQTAVDAAYTQLADDTLRRRRHAQT
                     TLEYHRDDYYAAGQLVVNASVFLKVCTNESSEVGDGAASCMVVSITDALLTVEAPRVA
                     MPPASWTRRLFGRGGEGIGAGSRARDAPRAAALSPVSPTVLLYHICMAFLVHELLPLL
                     GIVVVVAPPGTASALSDSLLEDQRRAHVAFTIMAFLSFLFVYAYGPTTAWLGLSMAVW
                     CLSLYYSRRAELVLVFIASVVYTHYLM"
     gene            complement(<244378..>245991)
                     /locus_tag="LMJF_17_0480"
                     /db_xref="GeneID:5650773"
     mRNA            complement(<244378..>245991)
                     /locus_tag="LMJF_17_0480"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682250.1"
                     /db_xref="GeneID:5650773"
     CDS             complement(244378..245991)
                     /locus_tag="LMJF_17_0480"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682302.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650773"
                     /db_xref="GOA:Q4QEE6"
                     /db_xref="InterPro:IPR003719"
                     /db_xref="UniProtKB/TrEMBL:Q4QEE6"
                     /translation="MRPKMEPRGVAVSTPMMVCDAFATDRFKGNPAAVCLVPTSVYCM
                     EWSAVSSLEASLGRGEPESPERKMTEKDRQAAAEKYSVERNIKMGRAFQQVAKEMNLS
                     ETAFVYRLPASRIRTIHEQIMHKCKEFENEYEEKVKHDNEERRRMSAAVTEDEEASGL
                     PAPDRQQVSAMHTIESSQSPTHSAKHLGNMAWPLSPGLLPSSSFSMANSGLSFLYTRA
                     SNSMMTSSETGRRPRRMHTQWFGLRWFTPIKEVPLCGHATFAAAHAIFEISRLVQSES
                     TRHLVSHIPMEFFVPSQTDVICFVTESGIISVRRKSDSIARASSFMLQSYTCSPDTYE
                     VHFPMTEALSIKKQVPQVLFRDVAAALGLAYGAECIEDIAYSKLTGYYVARLSTPHNV
                     LECRPDWEALRRAFSSTDFMDALKEQSAVMGPIKGLGVTAQNEGHIMVGPAANAHVVS
                     RFFAPWMGVDEDPVTGSLHTAILPYWLRFLQKGCFKVGDHMHFYQASKRGGSVTGIVI
                     GRKAERVALIGPVVTFMRGSCTFEVEEEH"
     gene            complement(<248373..>251093)
                     /locus_tag="LMJF_17_0490"
                     /db_xref="GeneID:5650774"
     mRNA            complement(<248373..>251093)
                     /locus_tag="LMJF_17_0490"
                     /product="putative protein kinase"
                     /transcript_id="XM_001682251.1"
                     /db_xref="GeneID:5650774"
     CDS             complement(248373..251093)
                     /locus_tag="LMJF_17_0490"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001682303.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650774"
                     /db_xref="GOA:Q4QEE5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4QEE5"
                     /translation="MPLHKTRINTDSQRSPPPAPANHIRTPVGSASSQSLAISPLSTK
                     LVEIPSPERKSNSGVVTGVSISDGGAIWDRRAQCRAPTGPPHSITAERRNEAGDGAVV
                     AKGGKASSSPSKATAGRVGSQGSDEGGDETSSGDEEGEEEDSDEEDDEGEEGGYYDGA
                     TSDQEEDDDVDTGDSTADDEEDEDDASTSASSSSSGSSTAPVEIGSRRSRRTKRSGKK
                     STQSSLKAATNTAVPSSASSAAQWRGGSGPAAQPIRTKVSREGDVNVKVIFADRSRHC
                     FRRYVKEVMTRFGFRKATDFDMYCIDQYGDRVDIDTEEDFEQLLDALTEAMGVVGRDS
                     LVGSPDTHASPPPPSLGLFPHLHGANQSTGSCGIPAAGDGLSISGHASERAMSFSASQ
                     NHTSSFYAAKSFSLSPRLDATIASSISAGSLVEDDGKSSVSVLRLYVRYSNAYYTEHR
                     REFEQQMNHSLLYTQGILNSGGSGAHPPPPPPPQLSLGSPSSKWRLQTDQLPSGHVSP
                     GAVGSPLARNMLTFTTCSVGSGGGDGGATSSHNEFNAVHGKSSDWAAASADSMSMQFN
                     ETLSSNLAKTLRLDEAEPLDWRRMSVLGKGSFGTVYEGITQDGKMLAVKVQELSLDDG
                     DDAEAVKAVKAEINLMSSLKHKNIVTYYGCQTRVLPTGNQQMEVFLELCHGGSLASLR
                     RKFVKAKEPFSISLVRSYTRQVLEGLAYLHAQNVVHRDIKSDNVLISAMGEAKLADFG
                     CSKRLGPATLQGMPGTLPPGAAPAAAAPSPQEAAAARAAMHQTVVGSPFFMAPEVLRE
                     DGSYTGAADIWSVGCLVLELLGREPWDITGKNIFQIMFRVSKEKGMPTGVPKKCPAIL
                     LDFFERCFQRDAKRRATAVELLAHEWLTCPDKALEEVPPSPLSQKESPAE"
     gene            complement(<253926..>258203)
                     /locus_tag="LMJF_17_0500"
                     /db_xref="GeneID:5650775"
     mRNA            complement(<253926..>258203)
                     /locus_tag="LMJF_17_0500"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682252.1"
                     /db_xref="GeneID:5650775"
     CDS             complement(253926..258203)
                     /locus_tag="LMJF_17_0500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682304.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650775"
                     /db_xref="UniProtKB/TrEMBL:Q4QEE4"
                     /translation="MPASETPLLGKEAASPPPRPPPRSCMSEGNHRHDKSSAGDSQRT
                     TTPDGRPATPERMLELHSADAVTPKRIASRSHQNDEALATFGHSEADRDADGGAEEAR
                     AATNFDHKATLAMAQLPNATNMTLSPSVLQPEATEGLVTMAAAKSPRGRDNCAGGDEL
                     WDRDPSNSLGVAKAAAEATRTATHADLDGAIQVETAAAADEKEEESEDEDEDGLFQET
                     VLFINNFHSLSSMRCTPAKTPQQPSQETIVGSAIQTPHMPRSLEVTPVKKLPTGREMP
                     GESDAAGHLNQAEAGAASSGSRRFPTADTTASACCTVCVSPATTVNTHVPAAPASPLP
                     TPQQWCCPDTCASTFAAAATTTAPTTPAASEYFFIDNHDGTAYLSDASLQLDGSYVLG
                     QTILLARSSATSEASPISAARRNAAGAESPVVRLQFDADLPQQRAKLTHRPLRSARLT
                     EVLSASMAAPFSPNSPVPHPIQSGAASPVSPSIARVLCRSAAPSRDNSSRPVASAAAC
                     RLLSSNFGDSFCFDQTLLVPLNESVDAGRSAVIADAFLVTDRSYRSSAPARWEACASP
                     TVVTPALSSAAVSFRTFQAGTERRERGVPRLSPSCPAASFSVSHASPVPDTPNAAEQL
                     ASQQARATREKRTLRSDQDVIYLIPSDAVTETITPDDITSQGWIPVQTVGVLPSAAAT
                     TATAAGDDGRSRSCIVGGGAESPLPKNPSTTTAAARMSSQGACADEFEREQSLSRCLY
                     DGHGGGALPIFSPASTLSASTLECINRRLTYSISRWASAHQHFDTASQSDADGVSGVN
                     LAGSMALPLPTPHCLAGHPNERHHSNTGGSIQREASSLCWGNEKAFSGSFSAFAAEQT
                     SDSRSPVPVPPKLSETPQREQSPSRCAAVSIPIAPLQQGRPVGAAGAEEDDTGDTAYV
                     DWSSLLTSMRYQRPSTVEAATSESHANEGSLSIPLTSSVSAILGTGALPPASGGRYAG
                     GAATGAVASHHAIQQAPQHLRAPHPRRMSATRFSYGTASSSVSVQAFGEHSQRMPTGA
                     VLPFSSAAGAAGNSSFRTTYCCNRPSTTSTETASLNPGFGGGDGPGSSSVSAAGLPLS
                     RGALPHHHPHHQHRYSQQRAGMIRIHSTGSLLAERFTAEAAAMSVSGTAPRLGAVSRN
                     NVLHRNSYASPHQQQYLRWTEATALAGAVPATVSGRRAAATAGFLVPDTSVFLPWAPL
                     TITPEGSVNLGGSEATGRRGVAAAMTGVPAPHVPMTLMPFTSSAETSTATTTNSTTCD
                     AVSTREVAHQFADDLTRGDTVLSPATLRTLNTAVAAAMEMTVNQLQASLYAASTATEP
                     EPVPLAPNADATTPAVPSSPHAFKQDDEAHKENYAVRSRISCNPASAAVAAGSAQRSR
                     SASGTRPLGCREGSATNIAVRLSSKARSPSNPAQPGGAPLLGQQLPQ"
     gene            complement(<260495..>263593)
                     /locus_tag="LMJF_17_0510"
                     /db_xref="GeneID:5650776"
     mRNA            complement(<260495..>263593)
                     /locus_tag="LMJF_17_0510"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682253.1"
                     /db_xref="GeneID:5650776"
     CDS             complement(260495..263593)
                     /locus_tag="LMJF_17_0510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682305.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650776"
                     /db_xref="UniProtKB/TrEMBL:Q4QEE3"
                     /translation="MQPLRSGALASPPLHPSLTSAAAAEQLDARLRPGNEPTSRIGLQ
                     CDRKRVTGVASSGDAGGGVDSDNALMPASVSSFCCPAAPSAHSGAEVGTHPVLSAEGS
                     IPLPPAAQPKEPFLPDHPPPQRHRRQWTPRRGSLCTGTPAGGNGGAVESAVTTVRDWV
                     RSAGCSPSKEPRSASISRRDSLASSFASALVPRDGLWELSRQWTTGADGDDGEERQRH
                     AELGARAAKAGSSSSGGSAVNSGRGWDGVESWSSSEAQLQRPEGFELAGAPTSPQRTP
                     SWRQLHSHPATTATITSSNSSVPASRGNGDGAAAPACSSAYTFSARSRSGHSTGTSSL
                     AGGSSASAATDCGTAATLLSGWGPNRRGGDSDDGSYGDQPSLSGVSSPSLVTPPPSRR
                     TSAPVTSTLQADTRMLSSSPALTARELAQLGEWRSVTEAQRSDFVSTAAPTALSPLLQ
                     RPAPERTGGGGPASWCLESLCCASFNTSLPNGVWSGRNSTAQTPLNWERGGAAVETGG
                     AYGSFCASPACWSTSELDAGGDGALLECRSGGWCSRLSSPMSVSIADMNGPACARQGM
                     PHRSSLTSPPTSPSFVHRVQGTAHGCGSDGDDGTMEDIEMRHTKRKCTESPRGSPSAT
                     PMSGSFAVSLADALAAAPTCTAMSHETHLWQQQQRRLRTVSPSVARPDEEPLPCDGAD
                     TYASTHYRDRSTFSPPSPIRTTAPSMVPVHPPPLLDTPISSSLLATGARGRPHDMSGG
                     SLHVTSVDAAAPVLETADSIAGVVVEVDAQHAASLSSCGSGGSGEEPEVDTFSLERAQ
                     AAMEDADAEAASALRARQHRLYLLSTSQFAQDFERYGGHVDPVQLELEAEAEREEEDE
                     QERRREGLARRSAALEGFPGASCEISAGPRGGRATRLRWEKDDGPRSRQNGIAANEEG
                     EVSSAPTAARIPHLPSPHPPRPSSSTVSYSTPSAHPAAPVASGRVCSEESLATPSRRG
                     ACVSATAAHVRWSEPEESEDGHSPGSVATTTGSRSRQDVSPPVRERSMAPAELQKERE
                     GY"
     gene            complement(<265590..>268127)
                     /locus_tag="LMJF_17_0520"
                     /db_xref="GeneID:5650777"
     mRNA            complement(<265590..>268127)
                     /locus_tag="LMJF_17_0520"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682254.1"
                     /db_xref="GeneID:5650777"
     CDS             complement(265590..268127)
                     /locus_tag="LMJF_17_0520"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682306.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650777"
                     /db_xref="UniProtKB/TrEMBL:Q4QEE2"
                     /translation="MNVASLPLRRDSDTATTGDGTSLAPPAACSLGLFAPAASTSPQL
                     TQLKSSRRDVEGGVLTRKTSATDELLQCDKVVILRPPPLDDALPSGTAHSTAAVAYVD
                     SSSLPPQHSLSSVAYTTHLAEQPSSASLQSVSDAHAAASRELGRGANINASGSVLTWT
                     LDDTDTTRTSFLQTAGSTQPPSLQASRSSSCQPVVLPVAQQASPSPSPSPATVAETKG
                     AANEPAPATQPRSVLTAEAQRNLQLASASRLSGSGGPVARRCHSALTSLARRSPCAEV
                     KATLRSVVAASGPMDATAGTPARPSYESGRDAGESPLGEASDGCRESRSGAIPTARLT
                     QPPQAVAAARQHSRSDSLLPSTPGRQQQLAVALMPSFTPPHDSTSPSLRTPAPQQTSP
                     CTSAPAVSAPVNVTVSAISDAPDDVPLPQHLDLFTVLPASNTASAGTAGGYSNFGDGD
                     AGGVLRPRLPMPNSANIRGIGTHANSENLCAAYSSVTTSGTETPTQTRTSRLNLGSWN
                     THHFASSSGWLSSSMKNTDGGSGGLVVGSRWNDGSCTSTPPPTNSELFRQIRQSTTHV
                     KSILRKSGSSTEIAYGATVLNDGDQANKNRSCVLLPSVHGGGVGGRAETTACTTPRIT
                     ASSGMAGGGNGRTSAMSSPIDEPALQMDFIVLRHTTSDADRVNGSAKPADASPSPTGS
                     RSRTHRGFPTGTWPQPNPDNINSVANSNVSGVLGTSVENGKGVFADGVHGSGNAGTGS
                     TPLSSAVQRSLAFPCQLSRSPSTPGHPSPHRTQQCRSSGMRHGGGANIGNTSNGETQV
                     LPPPSTATELPILFARDTVAAARCTSDEPPPEIILASPSPKRVRVVV"
     gene            complement(<271538..>274732)
                     /locus_tag="LMJF_17_0530"
                     /db_xref="GeneID:5650778"
     mRNA            complement(<271538..>274732)
                     /locus_tag="LMJF_17_0530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682255.1"
                     /db_xref="GeneID:5650778"
     CDS             complement(271538..274732)
                     /locus_tag="LMJF_17_0530"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682307.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650778"
                     /db_xref="UniProtKB/TrEMBL:Q4QEE1"
                     /translation="MAHLLDSVASPSSTSPSQTPTRSSSSLQSHKAAHPSSRQRHPPP
                     QQRWSSSAQVAAHPMRRANVEERVGGSPEWDRRTPTRQQQSHRSAQRGDPLPASRRVQ
                     QERATTTEEAAATYTSPISVDDEASSRFSATQLTEMRERYGSDWASPSEVLQLRTLFQ
                     DVMSRYVREVQALKGELAKAQEECTAYAREREKVLELQQVYQDGVAACGRAKEREAQW
                     VEERALLHVQMEKMMVENQRLQLYIAKKQQPHTHHMPPRGSATGSRERVRAAVQAVAT
                     ATAATSSASPSPSASWPPLPPTATATTTNTTAYLASPQPLDGPDTKIAASLPSAAGAA
                     VTGTVHTEATSPYTLPAPSSPEVLQHRAPQRGGGVAAETTLPPMPSPTSHQSSFARSA
                     SPMSAAGAAGAQPLHSTPPQRTFPTGTGDDAGADLPGGDGDHGDTLPQQQRGRSRRHP
                     RGGANHDEEPHNSSLMTPSASTSDDGRLGAGKAVRLPRQQRVRLDGGDDEVDNTIGEG
                     EFNPSYARGVTDLSSTSGGSSSPSPAADMRAMLAGCGLAQVHEQRSGGHSDGGGRRAA
                     EQWGGEPVAERSAAVAAAGELPATATATATTTTTPSLGSTAMMTASSSLSLQYLYQLP
                     RTPAEALQEEVQMLKELRRLGEENQVLKARLDYMQMTKEIFTNQCEQQHLRLAQAHDQ
                     SRHSAAQWELSSRQLESEVRQSEAKCAELQGALEDVLQRAKRQQELSQARLVELEASS
                     RAALVTTRDEAMGRVGALRSSLREIAASLATKSASETSPAAGHEVAQLREEAGQRERI
                     VENLRSELHALRAAHTELQDDHSALQAEAQMYRTRLEGDLASSRELLATARSGQQSAE
                     SRIDELEAEVERLRSAVVASDGCMHTMEERLRLATDELASQQEQLDEASTWQARALSA
                     ESELGTQRSYYEKEIAVYKTAACAMQDRHHAEVEGLLKRYEKLQVRHEATKVRLAAAV
                     SRSGAAAVFAAAGGQAKRRHSRHAKSEDRGVPVISGNPTDAASHSPSAAVKTEASSSH
                     CATAAYDSLQALRTSGQVTEKLIRSLNRATSPYH"
     gene            complement(<276522..>280400)
                     /locus_tag="LMJF_17_0540"
                     /db_xref="GeneID:5650779"
     mRNA            complement(<276522..>280400)
                     /locus_tag="LMJF_17_0540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682256.1"
                     /db_xref="GeneID:5650779"
     CDS             complement(276522..280400)
                     /locus_tag="LMJF_17_0540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682308.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650779"
                     /db_xref="GOA:Q4QEE0"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QEE0"
                     /translation="MDFEEAWREAMGEEQPPLPPPQQARGGHDGGGGGDDAYDEFSDE
                     DLLRSVPCANDAAVAPVFGPVFSMAPVATAMTSAATAVPEFSSPRPAAASAVAAAMLS
                     LLPSSGSQRGALEFPPVGVASFLLRGDNGRVRWVTTTGGAAASAAQRSGVRKIPQTVG
                     HSHPREVVDVEAMEADDDVVAVHGDDEAATLCSSGAAMQPRDEDDEDDADDAAPSSMH
                     RRASDPAGFLRDGLSARAMLRDIYAEEAKRQQQRVKRQENTEWQSVQRAAAGRDRCEL
                     EVLGDRDEVLDDEEREQRQFIEPARHCRAATAGTPARPRPHHAPSNGELWVTKYSPKL
                     FHEVLSDETVNLRLLQWLKSWDAYVFPDDAPPAAKGAQASAAGATAAASPPAERIAVL
                     TGPPGVGKTTLVHVLAAHCGYEVIEVNASVERTASRLEALIKTAVAAAGPAPGGCVRR
                     LTASSGAAGSAAFAIDHLANLGVGKRHSGDASVAEVAAAAAPSSPHASSSLVQHLLRP
                     KCLVIDEMDGIANSSVAAYLIQQQLHRPVFCLCNDFYVPSLRPLRQHCSHVYHMPPIR
                     PQRLLSRLEEIAWREGATMFDSMALSELIKTSGGDVRSCLNAMQLISSAVHQQQQQRL
                     DAGTGASSSATAAPAVTTPSRHTVTELIRRMQGKDTRVALRDSWQLLFTRPERNKAVQ
                     LLKQECGIDYEAFVEAAAAQHNRNVVPVRRALERERAIGAPTGGGYAATRTAETKGGG
                     DASTRAAMEPVATGFRVDPGYLYAAQKLSRCPDSGSLMDGLQENYLNRAYTDYSFSRT
                     SATADSFSQQDVVVAAAFQHPELMGTAERLCHVSALTCYVHCSTAARGSRIEFPREQA
                     TLRRLQSELKHVTQQFREGCRPHASAFLGDDEVVSTDVVPMLLRCLFDRSLRLPAHSI
                     SSFSRLPPAEQRLLQASVARHVEYGLDYQRDRQHTPSSATAAAGAAGASLSPFGSLAA
                     ANVEDEVPWRLAPELDRLLAGVVRPVEHALAGSGGGDYRGYSFSSRSSHFGGSGAGPR
                     GGSGLRTSPSPLGAKSDAGSPGFATNSGGGGGGGGSRELSRRPSVASVMMPVRNEVRQ
                     ILSGEIRQHRIMQSMELLKRQSQQSTTDALERGVKRQRAHSIASAATASSNPVHKADS
                     TVKGDIREVEHATSAGGAEGVDAPVNKWPRADGTMAAPVTVTTITTVRRDFFGRPLPS
                     TGSAGAVSASTGSTARSGRRAVGDRRSASATAATSPSSLVSPSSGDAGKYRFPRPHSP
                     HRPTASACVRYVYQDGSTNAVKMPATFADF"
     STS             281954..283406
                     /standard_name="fc03a12.x1"
                     /db_xref="UniSTS:192096"
     gene            complement(<282163..>283059)
                     /locus_tag="LMJF_17_0550"
                     /db_xref="GeneID:5650780"
     mRNA            complement(<282163..>283059)
                     /locus_tag="LMJF_17_0550"
                     /product="putative RNA-binding protein"
                     /transcript_id="XM_001682257.1"
                     /db_xref="GeneID:5650780"
     CDS             complement(282163..283059)
                     /locus_tag="LMJF_17_0550"
                     /codon_start=1
                     /product="putative RNA-binding protein"
                     /protein_id="XP_001682309.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650780"
                     /db_xref="GOA:Q4QED9"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4QED9"
                     /translation="MMDGRLVQTSCRTTHFSAVEATLRDWPEVEAVGSFREKKNNKRD
                     ITTVFVTFRDEAAAKAARAKLDAIPGIAEAATALSASPEQEKGAASSSRSKRSRTKKG
                     NTGSDKKSLAAEFLNFESYEDQKQRKVHARRRSNGVPEVVGAETTRRGREGRGMSRGN
                     NNNSRGAGGNHRGMRGRGGAHLQPQQNFQQPQQYQQHQLHPPLPPPPPRLPPFEANVA
                     FIDNVPFGTTNRYLMEHFSAFGRILDVNRFELMVMICFDNPESVQQCIQHMNGSKIHD
                     NVITVSSGTIRIPGSVAIQMGV"
     gene            complement(<284080..>284745)
                     /locus_tag="LMJF_17_0560"
                     /db_xref="GeneID:5650781"
     mRNA            complement(<284080..>284745)
                     /locus_tag="LMJF_17_0560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682258.1"
                     /db_xref="GeneID:5650781"
     CDS             complement(284080..284745)
                     /locus_tag="LMJF_17_0560"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682310.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650781"
                     /db_xref="UniProtKB/TrEMBL:Q4QED8"
                     /translation="MHVSPLTAPRRAQSSLQKLLGDPNDPYLAALQQFDILRIADIVA
                     EGPVKSGVPVEFLRRAARRVDTDGFAAARAQLASPTPLTQRPARSSGEAVLQSLHAAG
                     IMHRNETEAVAAAELKSAQAAYDALPQEEKTALQMERVVSHLFDGLCAMSAAMRMQAE
                     EGAASVEERDATFSVYERILSAYRDGIITADRWSADFVPELEELQVIWQHLSDPRAMP
                     LEK"
     gene            complement(<285854..>289498)
                     /locus_tag="LMJF_17_0570"
                     /db_xref="GeneID:5650782"
     mRNA            complement(<285854..>289498)
                     /locus_tag="LMJF_17_0570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682259.1"
                     /db_xref="GeneID:5650782"
     CDS             complement(285854..289498)
                     /locus_tag="LMJF_17_0570"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682311.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650782"
                     /db_xref="UniProtKB/TrEMBL:Q4QED7"
                     /translation="MASYCEVCQGLYDIPHPHLRLQRSPLSPPPWKRGNRNPVCPSSL
                     PPERRGSGGIRGSRGLSWPRVASRQRETPHALRSPFLEARGSGRDCVGPYVCPRQQRR
                     SASMPAVPDSYTASASHAASHSSPSLGRRVSPGADGGVGCGDEQDVRHRCSTSLRPPM
                     PAFAAAGRRGSPFIERYCEDTYCSQRRADGNPPQLDYLRRGAGHVCTYMSPYDDGEGD
                     GERISLTPDGGDTAFTSSSFSPCAPADARHHRCASAGRPLHVCRASSLFPCDDLGRGG
                     ELGSRIPHHSSSSRSLENATRYASERDARPRSRRDTSADHPSRRISPAVDGGDRRGTH
                     MPSVHNDTGSGEPSSSKRLPLLPTAASMTPASSFAGLTLDAEQRAQASASFEAPLHFS
                     RHGDAAWQPAASAGPLPSRARDSLANLVAKIRAEVSKDVTSRATRAPSNDPLLSPADA
                     KPWATAEDKRQRHRCAAKPQEQGYAPGATSYAEQTSAAQATASSLLSSSAVSTGAEGT
                     AAFHVLAARRSFSAGDNRGSHAYRPSAAPPAASGQARSARSHRRRSSTAEYCHPSRPR
                     HSASLSLSACSTRSSSSSVHLRHTVRRAEAVLGRLRGRSHSNGGSRAPSPAAKTTTRG
                     FVGNSLADDAAAAGATTVHGRRNTSAHSSAHGKDCARLQSGRGRRRHSAPPLPSRPHT
                     TRVPSRRSSLSAPTDAFSTESPGAPQRVHPPDRAARKATRDVGQARDDASAAMETVAE
                     SRREQEMWRATQEHRIERLREGLSALCTAVRKDLQKVRDEVGRVRDEVGRVRAAGNGT
                     ADDTQKRMRGALATALRSNSPDERATHARRREVDFHPSSVVAAVTQCTPAEQRRLAML
                     LLPHFRPLLADLVQSEVQCQLRQHRDEQQEAQHELEQRLHTYVGEAVVSHQGRTRANE
                     TLGSEGIATAPFWATFSSADAFDAHLRSATRAVLLEEDDRRYSLANENERRHERRVQK
                     LKQGWQETLKTAQAEWKAEWKAILEKEANAWTCRAQASLQQQADMLQDIVKALTRDVT
                     HLQEQQEALSARLSTSLRHEREVRVQEQTQLTERVEQRVRQLLPREAESACVRFHALR
                     EQRLAAAASRGTLTELTTPGASRRSATPTTSAAAAAAAPSSAEELRLSIVQPAMEHMR
                     RLLVLHQEMIDATVEARCRRAEHTVEGNRHVWSQNVAELRSKLSALRADVRGALGELC
                     ENLNVASPAL"
     gene            complement(<290433..>291374)
                     /locus_tag="LMJF_17_0580"
                     /db_xref="GeneID:5650783"
     mRNA            complement(<290433..>291374)
                     /locus_tag="LMJF_17_0580"
                     /product="bis(5'-nucleosyl)-tetraphosphatase,
                     symmetrical-like protein"
                     /transcript_id="XM_001682260.1"
                     /db_xref="GeneID:5650783"
     CDS             complement(290433..291374)
                     /locus_tag="LMJF_17_0580"
                     /codon_start=1
                     /product="bis(5'-nucleosyl)-tetraphosphatase,
                     symmetrical-like protein"
                     /protein_id="XP_001682312.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650783"
                     /db_xref="GOA:Q4QED6"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q4QED6"
                     /translation="MCIPAVLKPGPLGESASPSAEDGAVEDVCVFVGDLVNKGPDSYG
                     VVRFLRDIGAIGVLGNHDAALLQLSEKLRADVPLTDKEASSSLYPLALHCPDDVFAFM
                     MSVPHILCFHAYRLIVVHAGIDPSIPLAAQSVEAVTRMRNLVKAKKYWRQPTNEATGQ
                     PAHVALSVSAAFATLERPKLGANWGVKWSELARKLHGSVAGEEASDRSSDRSRGRSRS
                     GGSGTGDGADDSGKKKPKKADEDVSKWRRRIHRDYTDFTVVYGHDAKRRLQVYPYAYG
                     LDSGCVYGGELTGLVWPSTLVSVPGWTDPSPPRKSKV"
     gene            complement(<292328..>297244)
                     /locus_tag="LMJF_17_0590"
                     /db_xref="GeneID:5650784"
     mRNA            complement(<292328..>297244)
                     /locus_tag="LMJF_17_0590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682261.1"
                     /db_xref="GeneID:5650784"
     CDS             complement(292328..297244)
                     /locus_tag="LMJF_17_0590"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682313.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650784"
                     /db_xref="UniProtKB/TrEMBL:Q4QED5"
                     /translation="MRDGERSAASPSLPSASALPATMEVVVQTPFISVEGLGADAVAA
                     ASDDAQQRPIRLQHHAHGPDSACLTYTDSCLTARLADVIAEELLQGHALQQHGGVGSH
                     RIRSASATTAAATAENREVLTFTMGPQGAANSSFLFGGTLGWPSRQRPLSPTVSPSSQ
                     AWSGLFAAVLNRLFAPANAPADTRVVAAMSVTEVRDAAPLRHPSVLQRPRSTVDLLSD
                     TVLRTEIDETEGLDDSVDYPSDIPAACYVRVESIHDAMAVLYAALSCSAGWRHTQPLA
                     GEAGHPEADASSSSPTAFAFLQPACEPLEERMCHVCVTLIVSCEPLRPLQHQEVQQPP
                     PWTTRRAMDNFRDEAGHKRGSSGPAALLSAASGVPAPVGIWKLWDVAGPSVSCGYRPL
                     KASSPKSAEGQGGRSAVGCTTAVLAAKRRAAPAPLPTPLLPWSSRYSLAALTHTCLAE
                     VGATLSTSAFSVSRGSVDSLIPALRHDTSTSLQIASSAVSSCSLVVPICAVVAEATAD
                     DVNSKVLAAAAGWAALGREHQQERQQHHEGRPRVRGLDNADAARRVLHEYAVLLKDFV
                     AERYGAVDGGGTASPPFAAARSPSASLMASRLPVNNDEEGGSARPEAAPAPRVSPMQA
                     SLSTRVAVDTSRAATPSECGVALCVGAAPMRSMSMNTVAVGTDVAVTVPLSINVTRDA
                     EDSTGFSPRPRVEADVRSKKLADNPQGVLHQARADTRAVGAVRNTPEAALSAAPPATS
                     PASVAATCATAATHAEEARLQRFHSLFESESFDVSEEAEATAAMEAARQDEAPSGLDT
                     SSVMAHNGHHKEQTPLPQHTPQVRDSGSPPSVLRTGRHPGSRARIREPSSLEGQRAPL
                     PSAPSHIGVDSAEHDSMADNDTTAASLCPPQALLYDTTMTSQGEGPCAAEVVASAACD
                     AASHACEDPTQTPAPSLPPPDVALATFLGPYCDAFVRLCGVMRADVRAWRAHEAATLD
                     QLSALAERHTRDIQEIATLQRRLATHFGTADALPGSSGASTPAAARGRRADVGALLCG
                     ALTGGDPDLAASRSAAFASTSTLIFEQLVRSEEKVAWLERQLVDWRRRAREASVLDTS
                     STNADAAPLIAGEGDGESALELSSSPPVVASRGSETVGSVLSGPREDPAAPHMREAEA
                     LLRRLLQRCTRAYAAAQQWGDRWHAQLVQEQAAKSVLQDRVMELEAELAGLRRQRSDT
                     AASSYLHRPPATTIDQASSGAHASAASRPPTDSPPSCFTASPSPPVAALGSHSPYCTL
                     DGVNAESSLLTAAPVSPIGSDVASSLPSSSVSRGLQRGREDIVDPATLWDRMNAQRLA
                     THGRNSAGDRAGTDSFGAVSTQLAVLLSRAVQGGDACAPSARADLHAGTAAASSTSVA
                     APASLFEIHVGASSTVSSRGPDSLFRRATARPSASAPFVFAGDAPEVAARASDRASDV
                     ESCELRQRRPTPSRPQHERRVEAAATPPSTTHRSARGNDEGTFGGEALHHHVSAGTVK
                     IGGGALVCAASHPPPSQCHTTSAGELEVYPSAALEALGRAATQLEAEAVRLCGAAHNA
                     SGTAPGSQCHVAAIERRQLYGGDEVAVRRDEDMRAVHPSSPSPLFQSMGQLRSATQAV
                     QREARDAAERERAYLSAILFSSTAAGSE"
     gene            complement(<300772..>303927)
                     /locus_tag="LMJF_17_0600"
                     /db_xref="GeneID:5650785"
     mRNA            complement(<300772..>303927)
                     /locus_tag="LMJF_17_0600"
                     /product="putative P-type ATPase"
                     /transcript_id="XM_001682262.1"
                     /db_xref="GeneID:5650785"
     CDS             complement(300772..303927)
                     /locus_tag="LMJF_17_0600"
                     /codon_start=1
                     /product="putative P-type ATPase"
                     /protein_id="XP_001682314.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650785"
                     /db_xref="GOA:Q4QED4"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR006068"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023298"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:Q4QED4"
                     /translation="MAQRRAWFSANELPEAEETSFMDMIWESLEDRMVQILIVSAVVS
                     LVLGLTVPDQDTGLVDYAHGWIEGTAILLSVTIVTLVSSINNYQKEQKFKELSKATPP
                     VKVQVVRSGTTLDITDKELLSGDLLNVAAGDVLTVDGLVLRSTSLKVDESAATGENDD
                     VAKSAHGDFVLRSGSNVTEGEGTILVMGVGVHSFAGHIAMHVREAKEETPLQHKLEEL
                     ANLIGYMGMVAAGLMFVLLSGKELLDTVVYRKHPFGYKKYLDNLMTAVTIVVVAVPEG
                     LPLSVTIALAYSMKQMFKENNLVRHLAACETMGGATTICTDKTGTITQNNMSVTDGVT
                     AYGVAYVVPRRPSTFAGEDEKGSSGTLAPLSPLLQASTSMNVSEALGGAQAAGVRRLL
                     MECIVMNTKATWVRVESLDAKQATVRLTGSKTEQALLNFVDALGEDPMQLRSERLSRL
                     NEEAMRTPSSPFSLVPWPTGLEGTSSNVVAAAATFTKDLRIYPFTSARKRMATALVLR
                     PEKLVRYYVKGASELILAACTHTYDAQGERVGLSHEVRMRLEEAIMAMARRQLRTLAI
                     AYTDYSLSADCSATPQGSSDSDEGGAAPSSPFLEDDTQLTGLTLVGIVGIRDPVRLEV
                     PGAVAQCRRAGVVVRMITGDNKATAVSIAKEVGIYGKVWSGPAEGEQGLALEGPQFRE
                     LAKSARKLNAILPRLQVISRASPMDKHILVSALMTRGEVVAVTGDGTNDAPALKGANV
                     GFSMNSGTEVAKLASDVVILDDNFSTIVTAMKWGRNVHDNICKFLQFQMTVNVAAVVV
                     SFTGALLDRNGDSPLKPVQLLWVNLIMDTLAALALATETPSDEVLLRPPKPKAAPLIT
                     RRMWLNIAGQSLYQILIQQYLLLGGANTLGLAVRDSEELHTLIFNVFVLMQLSNEFNA
                     RILDNSVGFWHNLGNAPMFITVVGTMFLIQIVSVQYGGTLMQCVPLPLASWVTSLALG
                     VVPLLLGFVLRRIGVVEREIPPPPPVVDTEEEAALQLALKQHVCPTLQDTARKVRMQL
                     RVLRAFRTNAQEQKASRTQSS"
     gene            complement(<306517..>308013)
                     /locus_tag="LMJF_17_0610"
                     /db_xref="GeneID:5650786"
     mRNA            complement(<306517..>308013)
                     /locus_tag="LMJF_17_0610"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682263.1"
                     /db_xref="GeneID:5650786"
     CDS             complement(306517..308013)
                     /locus_tag="LMJF_17_0610"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682315.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650786"
                     /db_xref="GOA:Q4QED3"
                     /db_xref="InterPro:IPR000582"
                     /db_xref="InterPro:IPR014352"
                     /db_xref="UniProtKB/TrEMBL:Q4QED3"
                     /translation="MLATFFGRRAEPEFKVVCDPESIVFPVDFDAPDYPYEQAFEEAD
                     AYVRKLPTRGVVPVSDVLRLQFYSLFKQATEGDINEDVKQPSMLRDWEGYWKVYGWRK
                     CRGMTRERARDLYTDLLDLQIRKHCSFVWGAPSGEDRWAAFYDGVRIIRNLPKGGYYL
                     PDSLRAHFYALYKQALVGNLSDFQKTPAAFSEKYKWLRSRPSKAGFDQMRYDEWAALK
                     GMSCEKAKRMYCKDIFKSAAMCGYVWAPPGTADHLKVIGDQTSAKTLKKRTDADEHAE
                     RIAGATHLTMEEAMDAVGVHLSMVERLTMHSFTKKEQTAAARTAEEAAGRKKREEKAE
                     VKRRGVAGSHVDLNKGMAFARPKAEESTEATVTEKTEETEAKEDAERRLEAQGTDKDP
                     QSVCNLCGSFAKDIASDAEAPEKVKESGAAAAAAKDCTAASTSPAPVPKLQASAKVAE
                     ASKILPSKSEPVLKKEPAVKGTSKGAKSSHQAKNGAKKGPAGKRTKAN"
     gene            complement(<309147..>309458)
                     /locus_tag="LMJF_17_0620"
                     /db_xref="GeneID:5650787"
     mRNA            complement(<309147..>309458)
                     /locus_tag="LMJF_17_0620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682264.1"
                     /db_xref="GeneID:5650787"
     CDS             complement(309147..309458)
                     /locus_tag="LMJF_17_0620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682316.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650787"
                     /db_xref="GOA:Q4QED2"
                     /db_xref="InterPro:IPR000582"
                     /db_xref="InterPro:IPR014352"
                     /db_xref="UniProtKB/TrEMBL:Q4QED2"
                     /translation="MSAADFEAAVAYVRSLPKDGPVQLDNAAKLQFYSLYKQATEGDV
                     TGSQPWAVQVEARAKWDAWNSCKGMKSEDAKAAYVRRLLTLLRSQGIQWKPGARVQSR
                     L"
     gene            complement(<312897..>314063)
                     /locus_tag="LMJF_17_0630"
                     /db_xref="GeneID:5650788"
     mRNA            complement(<312897..>314063)
                     /locus_tag="LMJF_17_0630"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682265.1"
                     /db_xref="GeneID:5650788"
     CDS             complement(312897..314063)
                     /locus_tag="LMJF_17_0630"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682317.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650788"
                     /db_xref="InterPro:IPR011042"
                     /db_xref="UniProtKB/TrEMBL:Q4QED1"
                     /translation="MASEDIIIFLDALENTVNLIRGDGSAKKTLFTTGCVCPDGIGLD
                     LSAYKDSRNPDDIVAWWGNMGAMKPCPGQSDGADWHDADGFLVRAPLFGGDAAVKWVE
                     TTAPQSLMRGTAAFQAPGHPPLITTMKQVALSGNGRAVFFCDREGHGVKKYNVDTKEV
                     VPLLSSDVLAALADGLTEEEAHASLVEPNSDEDKCRFCVGITLDEKHDQIFFTLKGPS
                     KGGKGRILAAPYYFQRRNLTSITAANTSTSEGVIDPKTVVTLLDDLPEPIDLLLDSEE
                     NYLYWTDRGDDAAGGNSLNRAPVTYDPCSGRPQLGERELLIGGFNEAIGLGWAANLAD
                     CMRLPDNKEILRQYMYVTDMRHLWRCDLKARTKEVVYKCGPRNVLTGVEVLRFL"
     gene            complement(<316021..>316311)
                     /locus_tag="LMJF_17_0780"
                     /db_xref="GeneID:5650789"
     mRNA            complement(<316021..>316311)
                     /locus_tag="LMJF_17_0780"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682266.1"
                     /db_xref="GeneID:5650789"
     CDS             complement(316021..316311)
                     /locus_tag="LMJF_17_0780"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682318.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650789"
                     /db_xref="GOA:Q4QED0"
                     /db_xref="InterPro:IPR000582"
                     /db_xref="InterPro:IPR014352"
                     /db_xref="UniProtKB/TrEMBL:Q4QED0"
                     /translation="MSAADFEAAVAYVRSLPKDGPVQLDNAAKLQFYSLYKQATEGDV
                     TGSQPWAVQVEARAKWDAWNSCKGMKSEDAKAAYVQRLIEVTSQKGHPWNPA"
     gene            complement(<320159..>321490)
                     /locus_tag="LMJF_17_0770"
                     /db_xref="GeneID:5650790"
     mRNA            complement(<320159..>321490)
                     /locus_tag="LMJF_17_0770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682267.1"
                     /db_xref="GeneID:5650790"
     CDS             complement(320159..321490)
                     /locus_tag="LMJF_17_0770"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682319.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650790"
                     /db_xref="UniProtKB/TrEMBL:Q4QEC9"
                     /translation="MQVRRADAARSSEFAEYSAAGGEQQPYSIATTARAARTVREFVG
                     NSVMLSVVRDRAAVMKSYIKNSNLRPASAATPQRERDWADPTAQSLVRRRCELSLGPT
                     VTCCASKEHRGRGLTQMELAARSARNMHTSRAVSKPVVPPPFELLSASRPVPELPAEL
                     KGAITSYYLSRLRQLSVAHQERIVHAIALEKDRRTVITCLKQQERAFAQPAARSPSSI
                     TRGLGKGRPQTGAAHPVPKNVPRSTVNAKSHRRVMGEDRASPWKRQGANAEERQAMDR
                     FCQRFAVEARAAFLDNAMDVCMARRTRFYLEQPPIASQLGVVLPEEQLTPLYIMAVGD
                     LLYNMTGWTHRDSGKFSRAVVAIVCRGIPTVISSAAAEKAAAGRERQHTTLAGIPSAL
                     QSFPSLGTDSLLADSHPTTAATATAGLKDMNKQRAGRLLGVPLSMPAEGTR"
     gene            complement(<322918..>323889)
                     /locus_tag="LMJF_17_0760"
                     /db_xref="GeneID:5650791"
     mRNA            complement(<322918..>323889)
                     /locus_tag="LMJF_17_0760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682268.1"
                     /db_xref="GeneID:5650791"
     CDS             complement(322918..323889)
                     /locus_tag="LMJF_17_0760"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682320.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650791"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q4QEC8"
                     /translation="MPTTVLYHGDQLGPRPLVILDHSVARLEQSATAVLDACQEAAKR
                     YEAMLSSLAWDHGAVFVPLQVSIGEINVMEQSCRHVCAVLDAMDVQWSHVLAHSYGAL
                     VAARMAASTAYPHRIGSLLLLDTPLVTEQLVRNTKQREEIAKAKKDVNVPPAELSFAI
                     ESLRSALETTLPYPAAVDKSLYEDHLFSSASVFREKGLVRDEHRYVPVRHLAQVHHPL
                     QLLVPVKQPITDVAIHREFFGLRRPAVIKTADNHEDLFSAKCADEVADVVRAWMQRFE
                     PDVVMKRRFEKAAKEMVQLMGSSASFGEKGGGNIEKSEKKEKRKGRQ"
     gene            complement(<326615..>329866)
                     /locus_tag="LMJF_17_0750"
                     /db_xref="GeneID:5650792"
     mRNA            complement(<326615..>329866)
                     /locus_tag="LMJF_17_0750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682269.1"
                     /db_xref="GeneID:5650792"
     CDS             complement(326615..329866)
                     /locus_tag="LMJF_17_0750"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682321.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650792"
                     /db_xref="GOA:Q4QEC7"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:Q4QEC7"
                     /translation="MLRGYNGDHFFEMDDAKGSPALMGEKDRPATEFDRQTRYRYPVL
                     WRGASSPSVPSIANESSSLRHQHQQLSPRLHLHSSPPVPSSAEEIARTASPELGTHRD
                     GKDNGEEAKGRRHYSRHAGVETSLAVESPPQDSAASSPETLSAQFAGFTAAQQQRFES
                     LQERGPPGHEIARWKMLELMRHWMSMPSTRAGLDAVIRDVLVDAGIAKAKEAWGGSDA
                     CTAASRDSASSLQLQQRGSTSQPVATCANPPSTKAPPKKVSPKNKLIATSVALESDGE
                     PPSSTTHGEEDKGKQEFTKEGPRPLGDEAPAPSIDQATPASTPTPHAVSIAFSSPALP
                     VRGTTLPPDEATPSATAARVRSTSARRRRRKSGKGAVSAQERRVPPADGSHSPTPQDV
                     KGDTDESAALPVASLTPEKHVAPLTPRSGVSLGAAASSERADAASDARVSPQRYTESP
                     SFHHSSSEEALPNSSHNSPSPRQRSRSNNNPRAAPSRRVATYEEIPRFYFPLGRPTTR
                     EMMISGPLSSKHENPHLKIADGVSMSAPMYDGGESSRVGANAGALVGTSKDSVLFPES
                     RRAQKVAPMSQLHALDDRQVAHYIQREFGRLPPLPRHSQRVWLLGGRLRSGSHNHNSL
                     PFAKQELLYRQQFIQCVQRLCSQCFGVPRYFAFLVLRLIQWEMHHGNADAAEHRSPPQ
                     TRHGNGRLGSSSSLMSHTANGGGSGATGLPSVFLITAQHMTYFYEAYLKNKDMVRRIF
                     DLLILSSHLPTSPVAAASLAAMSAAAEANDQAVSTPGPSFSVLPLRSFLLPKDFVAYI
                     NVLLAYHPGLAFLRQTPDFQTKYLDTVIYRIFYELDRFDRGCISFSELAASRLIDAFR
                     QVDSAEDINMVLLFFSYEHFYVLYCRFWELDEDRDMLLAPEDLMRYAPEDVMNPCIVQ
                     RVFAGVGRRRRCNVPHRIGYEDFVWFCLSEEDKSTPQAIRYWFRVLDLDGDGVLSVYE
                     LRQFYNATRDKIAQYVQEGLVTFEDVVCQVFDMMRCSEYRGLFLSDLMREPEAAAVAL
                     NLLTNVVKFLQFEQRDPFVAHEERLLGGSEQSAWDRFARLEYDRMALEADGED"
     gene            complement(<332093..>333151)
                     /locus_tag="LMJF_17_0740"
                     /db_xref="GeneID:5650793"
     mRNA            complement(<332093..>333151)
                     /locus_tag="LMJF_17_0740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682270.1"
                     /db_xref="GeneID:5650793"
     CDS             complement(332093..333151)
                     /locus_tag="LMJF_17_0740"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682322.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650793"
                     /db_xref="UniProtKB/TrEMBL:Q4QEC6"
                     /translation="MAFKTTTSENDEGKMPAVASMDAFSQVETDYGSALSDFSCFVKE
                     LITPVKLCTGKGVLDVFGVCFDDGTAVLEDYHTERKDTDQKWEPWRPTKDGGAFRGQR
                     QFTCTTLVKAMMGKPYTYIEYQRYALFKLSGVPTLAVQFSSQVPGVMFGDAFRVEALV
                     TFTQAGSGASAEVTMRAFGYVQFLKSVWVKGRILATAMNTELPDGCKKLAAMVAAKVA
                     GRSGGAPGSADVPASDETEIESDKCSPHLPPLRPQTTLQRRVMAHGTTALAGLVVVVC
                     LKSVWQTLVLTRVSASELCAAARGREADHLDVVCQTIVAEWNGVLSAARPALVAAYLL
                     LISIFCGVTFKAVALSEA"
     gene            complement(<333855..>335831)
                     /locus_tag="LMJF_17_0730"
                     /db_xref="GeneID:5650794"
     mRNA            complement(<333855..>335831)
                     /locus_tag="LMJF_17_0730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682271.1"
                     /db_xref="GeneID:5650794"
     CDS             complement(333855..335831)
                     /locus_tag="LMJF_17_0730"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682323.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650794"
                     /db_xref="InterPro:IPR004182"
                     /db_xref="UniProtKB/TrEMBL:Q4QEC5"
                     /translation="MYVTPLRICFTSSFIEEPVIILLENVLTLERKTSFVCDTIVVVT
                     KGRVEHDFTAFISTGVTQMYNLLKTLWSVREKYAADRATSLYPEPESDASSSAGLASS
                     PSTSRTSSAANRGGAETRDNQPHDSQPLSPIDHQRTNGNQDSDVCTERDRVTASLSAS
                     HVGTPAAVEKQITSGLSQERSALQNRKNRLPEASNDVRPVTIPEFRRFFPSLPQTETV
                     NDSFTCCYQFGASRLGKMWVTQNFILFVSPMMESRIEIRFCDVEKIEKEQKLVLLDGF
                     YVQLKSGVSMSFSNFKSRDAALNVIESAFQASKAQQKDTAEYSGVSGPLVFKTTTSEN
                     DEGKMPAVASMDAFSQVETDYGSALSDFSCFVKELITPVKLCTGKGVLDVFGVCFDDG
                     TAVLEDYHTERKDTDQKWEPWRPTKDGGAFRGQRQFTCTTLVKAMMGKPYTYIEYQRY
                     ALFKLSGVPTLAVQFSSQVPGVMFGDAFRVEALVTFTQAGSGASAEVTMRAFGYVQFL
                     KSVWVKGRILATVMNTELPDGSKTLANMICERLENHQSGCGPQPNAGDSEARKEGRDP
                     AAPSSPECKPYVPVLFKVWLLEGFIANVTVLALSAVCFSVSLFFCLTMSFFPIGTFTQ
                     GGVLQSLTSPITAVVTAVVCFVSFQIGITAFVFL"
     gene            complement(<336973..>338364)
                     /locus_tag="LMJF_17_0733"
                     /db_xref="GeneID:5650795"
     mRNA            complement(<336973..>338364)
                     /locus_tag="LMJF_17_0733"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682272.1"
                     /db_xref="GeneID:5650795"
     CDS             complement(336973..338364)
                     /locus_tag="LMJF_17_0733"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682324.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0733"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0733"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650795"
                     /db_xref="UniProtKB/TrEMBL:Q4QEC4"
                     /translation="MKVHKRTNYISNIISTVGKKSALKKMSDSAPGAEKVEKAVVESA
                     KAESAATDCITAIDVKEENTDSETGPVGTTLVQDASEETLETIPPAEEAVPTAASEEV
                     KEEHPVIVGAKADPIPAEASAEAPTAAPGKVTDELPDKEASTSGAVLTAESPKTETTS
                     PSTPRKPQKAAFNIDAKPFSPVSLSDPALQATLVGEANGLSIKIGQWNPQPFVPIAHL
                     SPTAPVNAGHIPYVSPALPPAPAVKKETTTGKDSLSAYAKPWSPHPEVTVTPVVAAEN
                     EVAIHPGSWSAMTVDGKEVITPSPMVPRKSSTNLFAHSFSIHPKGLKTVELELFNYAC
                     ARCTLRTLYGRLSSRQPDVTMRNVSVDVPPLCIAHLIEQITKAKVTALYLNESEGPHY
                     DIWLDKPNLSTQLVEFISGSLWATPMHHGYAVMGKNEEGKRYLRNYVERLRDSKPPGP
                     NVYDVALVEVKEH"
     gene            complement(343982..344053)
                     /locus_tag="LMJF_17_TRNAASP_01"
                     /db_xref="GeneID:12981439"
     tRNA            complement(343982..344053)
                     /locus_tag="LMJF_17_TRNAASP_01"
                     /product="tRNA-Asp"
                     /db_xref="GeneID:12981439"
     gene            344131..344214
                     /locus_tag="LMJF_17_TRNASER_01"
                     /db_xref="GeneID:12981449"
     tRNA            344131..344214
                     /locus_tag="LMJF_17_TRNASER_01"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:12981449"
     gene            344273..344345
                     /locus_tag="LMJF_17_TRNAALA_01"
                     /db_xref="GeneID:12981450"
     tRNA            344273..344345
                     /locus_tag="LMJF_17_TRNAALA_01"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:12981450"
     gene            complement(<345258..>347366)
                     /locus_tag="LMJF_17_0790"
                     /db_xref="GeneID:5650799"
     mRNA            complement(<345258..>347366)
                     /locus_tag="LMJF_17_0790"
                     /product="putative protein kinase"
                     /transcript_id="XM_001682273.1"
                     /db_xref="GeneID:5650799"
     CDS             complement(345258..347366)
                     /locus_tag="LMJF_17_0790"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001682325.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650799"
                     /db_xref="GOA:Q4QEC3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000959"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4QEC3"
                     /translation="MERLQRVGVRTGPTFAADAPASTSELPKPTFQPGSSIYEMDSSG
                     RLHRFQCGRVLGRGGFAKCYEVSDETGTYALKAVNRASLEKPKTLQKLHSEISIHRRM
                     KHKHVVEFLRTFRDRYYVYMLLEKCDHGTLMDLLKVRRFSVAETQYVMLQCLSALQYM
                     HSECVIHRDLKPGNIMLDRELNVKIGDFGLAAELQYDGERKRTICGTPNYIAPEIIDH
                     KSHGHSYEVDTWSLGVILYTLLVGQPPFQMEDVESTYKRIRQCRYDFPANVPDNARDL
                     ITQILQSSPAHRPTLMDIRQHSFFSSSPPPPLTPPASFASFGLPVPGPAAPATTTTAS
                     AAAATITTRSARRASAVDMHYPPPAPYGKELLGAPAQREVLRPINANVPPPPGAPTSP
                     RHLANLRQQQQPAPAPTLPGICAHARNETPRSAPGTAAVPLSGRCPASSPQQLRNDAN
                     ADEDEKQQLTALHDRLHQTLCGDAAADDAADNEAPPPPVWVTQCADFSSKYGMAYRLS
                     TGQTGAHFNDSTKIVWEPITDRVEYHARVKIEMPARDGSTGLFAKDERHVFSMHNYPP
                     ELEKKVTLTKYFKTYLGRVQSSPDKVPVVACSPFLPAAPPRCTDPHTSSDFVYVKRWL
                     RVDGALVFRLSNKTVQVCFEDGAEIILSSEWRVVTYTTPSGRRRTMPLNSVATEWEEA
                     AERLRNTKSVLYQVIRDHCL"
     gene            complement(<349673..>351346)
                     /locus_tag="LMJF_17_0640"
                     /db_xref="GeneID:5650800"
     mRNA            complement(<349673..>351346)
                     /locus_tag="LMJF_17_0640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682274.1"
                     /db_xref="GeneID:5650800"
     CDS             complement(349673..351346)
                     /locus_tag="LMJF_17_0640"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682326.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650800"
                     /db_xref="InterPro:IPR013863"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4QEC2"
                     /translation="MSASTTELFTNQGTLYQYAGEEGEHPYYKPLGDVDSFTISLLKH
                     KKTAGTAGSNNSCVEYLIAVAEDGEKVFEQPIGVDLQLSYSAPTASVHWPAIIDEELE
                     TVAFRFAAPAAHVAQVTAQLRMQQFVELYNRCTYSLLTGYDEVDPEDEWYQYLGAATT
                     HEVCNEDATEPVFEFDPSQLAKASTGAGNICAAESLQFNRVLVVKKSNEEASLELQAL
                     PQTERGFDRAAMEKLVVRGVDGTSTGTLLENGDVTMLLFGGCSAAVQQLDLARGTVVQ
                     EYKPADLPVQSVAYANHTAANSGSVYTCLGRNVAFNIDVRMDPRSCVVMEDGKQPTDY
                     ALPSLRKDFTCHATSQNGYLVIGDGSGNIRLYTGPPGARKPAGGYFPKTAKTLLDTKV
                     PIVDIDVTADGQYIVATSTSFLLFIETKYVDSNDKESTGFQTRMGARKPQPILLQPSP
                     EQTLRMGGASAVHFQSAKFDRFPGTKELCVTASCGDYLLTWSLRAIESSQQSGRAVVN
                     SAVAVGKTVLSTSANRASHVGFLTGNDVGVVPVHEAKKEVSRTWTWGTE"
     gene            complement(<352131..>355757)
                     /locus_tag="LMJF_17_0650"
                     /db_xref="GeneID:5650801"
     mRNA            complement(<352131..>355757)
                     /locus_tag="LMJF_17_0650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682275.1"
                     /db_xref="GeneID:5650801"
     CDS             complement(352131..355757)
                     /locus_tag="LMJF_17_0650"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682327.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650801"
                     /db_xref="UniProtKB/TrEMBL:Q4QEC1"
                     /translation="MDTASAAAPSPPPRLRDAVKAEPSTEDERGQQLQQLSRHQDVAS
                     SASALEFLALWRPSAVSSSRHAAALTSAKQVEEVKRAQLSSSPPPSSELAAPTHVYDP
                     RLGTLSIGSVVFAPYRVCSERPVRGGLSACVTGDTVSGSPVTAAAPHQLMPPPRPPYR
                     LHYALAEVTGIQVMAGTVTVSFLFTDPGIDDEAVSMYECVPCPPACLSRWLLEENSPS
                     PQHCSLLERVLHVTPPEGPLPVNDIYRALQAASPKLASAPGLSPLLVQRQRQRERCVA
                     RLRQLYCLSDDDDEQPHTTMAHNSRGVAQGASGEDMAAKPVALEPTAATAAPSSVAWR
                     FLSTATTEKVALTVGSAGTTTLAASAATMFARYVAPTSVHAFFSGIFQEVNACMEHHC
                     SRHRRHSLTDPTTEPLSSLGRRLRRGVAAANAASPPPLVLVIFDSYATLRRFHVFMSV
                     RGHVVQLLDGTHVGRALPSPRTSHAFGAQCKIWLCMLRDDTGEESVEEEAKKEDGFSI
                     TRASAGEESVEVAQAVALMEAQLRCLLAAAPPVDALVSFKEHVTQQQVTKSRRSATLH
                     QHVTAEAVLQRLMPHLGADRLECVLQDVPAPPPRPTPVGNNAAASSSGTTQPPPSTAP
                     ATTVVKVSGAVFGDNKILVPCSPEQLTLLSTVLTSTPVAVSRKTGDGGAAEGGGETAG
                     QRKCSPTKKANRKRPRVTETADSSSATAVARAQALTPALLERIALGSFTDAAAATLFD
                     VFADATAVVMRAPGPSSEDLPATAGDAHRGSSDGSGAAEVLSSIEDLYEKWCVDPSRF
                     GEAFPVFAAVYALVADVFASVSRFRADRPRSASEWDAGIGDDGPRRLSSEPLESAPSL
                     EQATEMKASAVTQRRLPTPSPPNELPRGRLGALLGALPRIALVLPRGNPTQHPNLSTQ
                     QYLRTLRAFFSPWAVHEVTSPAASVAISCAAPVLWHQRGGLLLLFCDEATTQLGALQD
                     EADVVIACGKAAAAWVAANSATKASSGDSCNVAAAGPLLFAVISEAEVVAPTDQLTHL
                     WLPITLASPTCMGGGHAPADVSTSADGLERCSEWPAMSKEETSRTELEEMWKLLVAMV
                     SADGSVNVSARPSSPLLRQDQQQHGQTLRSTGAAARRLHQVEVLPRTLRQAVVLWRHL
                     QAAEPAMCGWQRQRCASPSELDSEGPWGTLQAVVKEMALGCVTATPVRMTDVTLLRGS
                     DDSA"
     gene            complement(<356498..>360352)
                     /locus_tag="LMJF_17_0660"
                     /db_xref="GeneID:5650802"
     mRNA            complement(<356498..>360352)
                     /locus_tag="LMJF_17_0660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682276.1"
                     /db_xref="GeneID:5650802"
     CDS             complement(356498..360352)
                     /locus_tag="LMJF_17_0660"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682328.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650802"
                     /db_xref="GOA:Q4QEC0"
                     /db_xref="InterPro:IPR011186"
                     /db_xref="UniProtKB/TrEMBL:Q4QEC0"
                     /translation="MHQEHIQRLTSHDAAVLRASHEFPTFTDAFARVAQVGLPELEAK
                     VGRIPSYSVNGASHGVAVSLCLPALAWDITRTCVLPVTDEVRRRTEAEAVGDVAISGA
                     AGGTAKRNYAALRPGGLELFGRLAAICADVSVSVCLEVVESAAAQGDGGVAACLSDES
                     PLCLLVRPLVPETRWHCGQQIPLAEKHVRGHPHTSRNPSCRNGGVCSSSRDCLLDISG
                     RTREQRNLMRLVTVCRVRGLFYNLPVRQAPYVGLVGTCSYGVLIGSSSGGDDAAWKTA
                     SERDRGGLFRRRTLWACKSASAMRARREEQQHLVAVMFQTAVCALLAPLYLTARPLDA
                     SGGRDASLARCSFPTQGPSAFSAKLIVEYDFCGDADAARRAPAETLPLRPLSLCTPLR
                     CASAPRTGCDNSGMHPDSVAAAGLRVNRHGLYSGALRVRQASREVDIGGRAGRRLTRG
                     EATARRLCHAFGIQMPDPSSASSPSATRAEARARRFWSSSAAAASCEGGAWTPEETAA
                     EGVLTEVVVRPGHFAVLFSTPPPLGVSAFPARQAPSAAGSLSFSPLPEHHMTFLMILV
                     RDGQAHPPEDDGCRGRSIPPSSALCLTPCRVLEPTHWAYGIVTTNAHRHLHGAHPLPG
                     GPISAAAVPVFVFVDSAYVPARISEARQRARHGDTAQQSFVQLYDEALRRLTSSLRGC
                     ESQDAPLEGDEKVLPAQTTPPHTTTPDVQQQPSSVVHHVLAKQEAAEVQSRVRYLCQR
                     VLEAAGVPGTQSYVPALPSKRRSSSTASSEGVVGRTGALHHVQLNPSSLLWLSATGRG
                     VNPTATAPRRTPVTLDRNLHRITREEEEEQAALRSRPPLETAPSSREASATAHHSPAV
                     QASNTEEGLTRMRHLLDTGRGSVLRRLPRACAAPCPWMPERGVNRGDESSGFDAAEGA
                     TATVLADAIPPITTAFSAGVSVLQWARKFLIIASPTIPQPASKPRCGPAAVLPRGPVC
                     RSQPHALQWWVADQHAVHERVRLEFFLCFADTYVCHPELQRGAGRAASECLIAGSGTV
                     SECVPCNSLSLSTHARKALERRCRVAQLLWSHAVTGAACSPSASSAAASFSVSLPAEW
                     RLRVTVVEAHLRQWGWRFHHEPVAAVHRGEMQCSRAVACASGVRVGQPAYSRTRPTLA
                     TAIVAWPCLKVEGVVRHVTSMQALRQTVEELEAVGAAATAAFDNAFVPPESALTDPVS
                     LCCRGLGPSRVPRSSPPCPLLIPSVFLDFFISRSCRGAIMFGDVLRPTAARSMVAALE
                     CVEQYYVCSHGRPSFTHLTPAH"
     gene            complement(<361792..>366837)
                     /locus_tag="LMJF_17_0670"
                     /db_xref="GeneID:5650803"
     mRNA            complement(<361792..>366837)
                     /locus_tag="LMJF_17_0670"
                     /product="putative protein kinase"
                     /transcript_id="XM_001682277.1"
                     /db_xref="GeneID:5650803"
     CDS             complement(361792..366837)
                     /locus_tag="LMJF_17_0670"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001682329.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650803"
                     /db_xref="GOA:Q4QEB9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4QEB9"
                     /translation="MLGMCSDENVANSQLSTLLGSPTQRSESSPALERVGSSQSSLFS
                     TPMTRRLQGFMTKESPDYRALPAPHTSPPPLAFSTADLASVNSDKRMWNVYRRQDGWV
                     RSPKADCCAPTSRQLHPGGHYSAPVASLAPPPVPQQGKISPHEPTRAVSDRTASRSIG
                     RERGGYTHSMARFPSVSPAATPFRDLDQHLPSESALFPTSSSEGGPHRCTVSPAKPLS
                     QMRESKSRNTGRSPSSHAKGGARHFSSSVERTSVSKELSALDHDVVCASSEATTSSRR
                     RGRRRYSASTSPLHDGDYIGDALTASADQRMFLQIKRQPQLWPSDSIGRRFSNAAIGS
                     TARRGVRRSSSSHTADQGGRSDSSMPLSAVMGVIPREDFAHRLRGDSMQSLSSLPQLH
                     QQPLQQLPASSSAPPLPQTRTLMASIMRDHAPCSLLKPLELTPAAMERSPERRESAEV
                     LVDSCCYTPSIFVVEQQQQQQQQQGPLLSTSLMDRPAEHSSASVQERGSFGHRVSLCS
                     RHRRSVANDSISTAGSSSNVSRRCSCSFAPPAPAHANVESSMSLKVPALSPPPWTPRE
                     ALYWMRNRLTLQEQEEMLGCDVVYYCGPPVQPRTACGVTDRATPPPSIHHTSEETVSV
                     SSPPKNKEEVVSFTAPSSSYFPITLGMHICFRYEVLEVLGIGTFSIVVRAVDHAASPL
                     SPERHCALKLIRRELLYQKAAQAEWAICEQLKECCAAMRPCSGSTFKEDASGGTADYR
                     AGASSVHRKPSASLPPALPWLSMADQRTLLFGSVLTPRSRFEYRGYHVIVFPLLGFSV
                     RDVVELRRESREAKADHAVSASSSLLPASTPPSQAGDQAAVALPTEVVGSVLAQLAHA
                     LHFMHHCAHVLHGDIKPENIVFVDRSVSGRSSSSINGHLAECGGAASQQPPPRPPSQQ
                     PLLQAPLPHSGDAAALPTPPNMHPFHRLCLSFPSSSLSNTAAPAPPVTHSGTGPRRSH
                     ATEYLEGHSSADVGDRGSPSSSTSTYSSSLPCLTAPHPPPRNTEIADGPDRGATIMSC
                     GYRVQHLGSEVASSSQQRPSGGDLLDQCITDGASASLAGRSLCMTGSRTGILTPSPHS
                     TSTGAGFVEGSVGYGAACTTLSEAPRCSSGSSREVSPSYTTRSGQDSGGGDEVSSIVT
                     PSALTRLTYALPHAMAASTAVTTSSRIALIDLGHAHHILPGTTATAFPLQSPSYRCPE
                     MSLRLPYTTAIDMWSVGCVLYELHTGHALFPDVCDDATMLRSAVRVLGMPDAAFLTTV
                     KACWRQYKQHKASTVRAAARAQGNVTSSDTGSQKVQLHLRQAHSQEPRLAVDGEDVNP
                     NEETVIVERCWREFIQVLNDAAGHQREHERRLKGQQESSTPPVMENSQRSPREAGLPL
                     PNGSGCTTTWETEEQLALLKVMFPGGQVHESDQCFSLPSKCDWHRYAWVDFLLGCLYW
                     DAGERLTATEAQAHPYLAPNFSPEVTAHDTAASSGMDRKDAVDDTTMSASGISAASSA
                     AVVGRVVAPTIRPTHCSGLHYLRRHPLTARLLDSAGETTSRPSSPHGSHSTASDDTAP
                     LLAPLLMSPSAIVLFDLPSSSRTAPSARMWEEHQQHLSHCYDSALDIHSMLQTPAKRL
                     TLSPYHNSDHRRNRLDGTESYPLRVVFSESDQGTESSVVVSAESSVRGNLAGTQKPRN
                     DNQTAAVMVLPLN"
     gene            complement(<369580..>370914)
                     /locus_tag="LMJF_17_0680"
                     /db_xref="GeneID:5650804"
     mRNA            complement(<369580..>370914)
                     /locus_tag="LMJF_17_0680"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682278.1"
                     /db_xref="GeneID:5650804"
     CDS             complement(369580..370914)
                     /locus_tag="LMJF_17_0680"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682330.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650804"
                     /db_xref="UniProtKB/TrEMBL:Q4QEB8"
                     /translation="MLSTTPVHRAGLLSTLIANGALHAAHLASVQTPAGALILSGCVF
                     RCLAMPFTIYGDQCLHRVACALPELHDAHKEYLDIVDHPRAIAWERRVAAQKLKNDRD
                     RIFRGFRTSNVKMTAPYAVGSALSLYCLGVPAQQIGTFFVQDAGMAIVSPLAVSCMAG
                     GQLSLASTATTSAATLFTVDPTLALAAGLTCFNVLRHLSQRVGFNDRLDGWIKKTKQA
                     VCLGLGLVAASSLLAGPLTYALALPALHFFPPYLAPVWFGMSATTALKTILVNGTAPG
                     QAMFRLPSYPPQHGTYGGESTAAGHEYRLAFTGVDVEETRSVWQTQKRILDYECDVRL
                     HRFLKQIGLFSDVDELEYEADKLKRKRAVARERRLAHTVADEDVSSKTQAPIRRRAMH
                     DSSGEALQEADEYSSTSHREMVAVQMEHAQLEELRGRQARRAAREAAWKQRH"
     gene            complement(<371620..>373134)
                     /locus_tag="LMJF_17_0690"
                     /db_xref="GeneID:5650805"
     mRNA            complement(<371620..>373134)
                     /locus_tag="LMJF_17_0690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682279.1"
                     /db_xref="GeneID:5650805"
     CDS             complement(371620..373134)
                     /locus_tag="LMJF_17_0690"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682331.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650805"
                     /db_xref="InterPro:IPR003018"
                     /db_xref="UniProtKB/TrEMBL:Q4QEB7"
                     /translation="MPAALLREAREVVQEAKESFTKPWRVQDQQREDTLLHLLNLRRS
                     KLAAVAQLVAELRQVDRQLLHVTEAKGLDVANWRYQQRELYRKMEKLHRGATALASCF
                     ALASPSSTASGATDLAVGKSQAAATACPSLSHTQCVAQKELAKVRETLQIQLAQLEEE
                     ERASAQRLETWHRLLSEVPWGGNASGDFSCTADTTGGEKDGTQHARPSAAAPSAAAAG
                     MIHTPAHDPPPQPCGYYSELWRASEAAAGVPLQQEQQQTPSLSAAPGTNTAVADRGSP
                     HPSDAEVVLLQHALHNINGALRQRLLRAAAASLASSSSSRSPTTSHHTSGGEEAAAAS
                     VTISGLPPLPDVTPLRSMQDFMKSPSGSSSAVLPCAQQSEAHPSERLPGSANAATAAY
                     ASQSGKGQQQEMSPLPRCTEATALGAPAEAVTAGAALDAAEEAQRRVWWQSLQAREQA
                     MKDSLNQLLQSVTTTSSPPSRERGSVDSADDAGRPAGSAIFSSISAHQRSLESR"
     gene            complement(<374243..>375688)
                     /locus_tag="LMJF_17_0700"
                     /db_xref="GeneID:5650806"
     mRNA            complement(<374243..>375688)
                     /locus_tag="LMJF_17_0700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682280.1"
                     /db_xref="GeneID:5650806"
     CDS             complement(374243..375688)
                     /locus_tag="LMJF_17_0700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682332.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650806"
                     /db_xref="InterPro:IPR019410"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4QEB6"
                     /translation="MLAWRVKEVESPYGDVATLHWAVPDADDDAEADALNFTALQVEL
                     ESAEDQLGAVLWNSNSAALRHLHTHVFNPLSSSSSAAALAPPAIPLAGKNIVELGAGV
                     GCLGIALAMAGARVFITDLKELLPLMEHNVRLNEKRVQARSRGVGRCTAFQWKWGPTV
                     STMVHKQLQKEMAAVTIADQQRRQQSPRGTATLSTKFALSHSVDRVVSSMVSSLLAPS
                     ASLAKCEEALRSVAAVSSSTTAVATDTRLKTPFHYVILCDALYGNPKDWPALLYTLTE
                     LMATNPDECEVVNFCEQRVNDVEGAFLKLLDAENGKKFVPIENRQRDGDAMWTEVLDC
                     ATRCCKSSSTSAAEQHKQREEAASSLLSYVLVQRRGAYQWVYKTKVLQDAQSELNMVI
                     RVTRIRWTCAEVMKGEKAKLRHSGSVGHRVTTSSAIFGVPEPPRRRRSRDDGIGENDS
                     ATATDAQAPSESVAPNVNKKKKCRHGDAHHR"
     gene            complement(<376453..>378885)
                     /locus_tag="LMJF_17_0710"
                     /db_xref="GeneID:5650807"
     mRNA            complement(<376453..>378885)
                     /locus_tag="LMJF_17_0710"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682281.1"
                     /db_xref="GeneID:5650807"
     CDS             complement(376453..378885)
                     /locus_tag="LMJF_17_0710"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682333.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650807"
                     /db_xref="GOA:Q4QEB5"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017930"
                     /db_xref="UniProtKB/TrEMBL:Q4QEB5"
                     /translation="MSRLHFKGGAWTNAEDEVMKAALAQYGLRDWERVASMLTKKTAT
                     QCRERWENYLDPRLNIHEAWSLEEEEKLVELQALFPHKWRLISEQLTRRTPNHYIRPA
                     WLCEQRYLELKDEQEYYLKQQQQQLKDAPGGAAGEKQSLESFMAERRRRRIARKTHEE
                     RASRADTVSGERCEREMIDMATSRLANQDQKKGLRKERQQQLAEAAFLAKLESNREGI
                     ESGTLSLRQTRKMRKALEEDRQKPGLVDEIEEADEAEEASIEARDSGEDDDNDEQFEA
                     IDMYEDQKQAGLVKKQRVLMKDLTEQQRHIQQRQMSSAADAGGDEEATASSIGSSRAR
                     AALTGVNQDLLKQLTSASTSASPSLLESNAFGTRAITAAGKPVTGANSIAAAAAAEAK
                     EELKSTLHHLFATLPSAARVPPGSALTSSSADMLPPPPLPSLKRPREALKPVSVTGEE
                     DRDASYPREVAQQRAPGLPSHPAGSSSSSGAEAKGGGNGVPADLFSTLDIPAPRKMPK
                     TDAAATAAVDRSNGASRSDEACAPIHANTDPSAAVANSTSAADTQYGITFTEGEAEMY
                     MQDAHRWVSVECERATAAAATSKTPEDEQPTPAEIRAAQSLVEQELCSADRTATDGAS
                     MTSGGGTKEATQLQHSSSMAAAVRAHTSVGGPQAYGAHVNVQQALHQLSQRVAAQVQE
                     ANAILQPLRQEWEQVMSTAMLSPLDRHALYGYVRDDGQLKGSTAVGNSVEDDEGEGLP
                     PPSIAAYVCERIVGQLQRARLALRFTKELRDREVLKMRRDLDEVEHDLQQLQSRERTL
                     QDMYRHQRAQQL"
     gene            complement(<379700..>382096)
                     /locus_tag="LMJF_17_0720"
                     /db_xref="GeneID:5650808"
     mRNA            complement(<379700..>382096)
                     /locus_tag="LMJF_17_0720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682282.1"
                     /db_xref="GeneID:5650808"
     CDS             complement(379700..382096)
                     /locus_tag="LMJF_17_0720"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682334.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650808"
                     /db_xref="UniProtKB/TrEMBL:Q4QEB4"
                     /translation="MPPPTPPAPSPRTVYDIVKSHIQLPINRDYNALKRVLRDWLAYS
                     THTPLQEKPTFTAELVITITRMPPETLSTIAQGAGGISGAAVGKAHSARGGRRWWPLW
                     GTREDRNSAGDPTLAAKVAGAASSSAPAIPPYVYRKVVPLHVWTAVLPWEMQRGLSFS
                     DLRLPQNMSSSRGAESDSTASSDKTAADPRAPSDIPVRPPQQRQQGAAVYAEEEDPYG
                     VVTPPIAFGEGNSASAAAAALARAPLCAATTATAAAAPTSSLSITPVSPAMLFLTDIR
                     STKAHGIGFWSGAIRQAVDVLFVGPTLPRSVGDASASFRQLRQQEGFALVMENKISSE
                     VLHRFFPLQEIRSPSSSAASASSATFRVHSFGHLDPLPPSLHPSRLGVDDWREEYRGL
                     SFTVAPDAPYNTPEEAPRYVFEVPRHTLRPAVAAALKESRSAHQELLHARDAQGRTLG
                     KAATPIHDCDATGSKLCRQADDDVSIDLVVNLSPQLRADLFSKAQLCVEYVSLLEEAV
                     AHYARMLNTDTAAAAEVPLDERLPSHADAGAGAGAGSGRRMKVWLSEHEFRWMTPEEL
                     KQASEAEAATEQQAQTNSSIHADQEGVFQESREEAAAVTQTKYNDVAVVGAAAEATLR
                     DTAASAVAAQSARPGAVSAARSISLQSPILRCEEEGCPSYLAPSFVGRHEAPALQSSV
                     VVLSADKLARYPRTHSHMQELPPVDYELYELCMRLGVGQQSVLYHYHERILHEWRREL
                     HRLRQQQKACGASEPPHVTAPSRLAKEDVQRMVGLVRDRSLQLPSDMVSLVEAVAAAM
                     "
     gene            complement(<384829..>386490)
                     /locus_tag="LMJF_17_0725"
                     /db_xref="GeneID:5650809"
     mRNA            complement(<384829..>386490)
                     /locus_tag="LMJF_17_0725"
                     /product="guanosine monophosphate reductase"
                     /transcript_id="XM_001682283.1"
                     /db_xref="GeneID:5650809"
     CDS             complement(384829..386490)
                     /locus_tag="LMJF_17_0725"
                     /EC_number="1.7.1.7"
                     /codon_start=1
                     /product="guanosine monophosphate reductase"
                     /protein_id="XP_001682335.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0725"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0725"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650809"
                     /db_xref="GOA:Q4QEB3"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR001093"
                     /db_xref="InterPro:IPR005990"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR015875"
                     /db_xref="UniProtKB/TrEMBL:Q4QEB3"
                     /translation="MSPPRHRTPSLLPSALPTPHPGSFSLRLRTSARTVFVVYIRIYT
                     HPINSSALPPLCLSWLEMAALGSLPTLPEGLTYDDVLLIPQRSPVRSRKAVNTSTRLS
                     RNIHLKIPIVASNMDTVCEDKTAVTMAREGGIGILHRFCSIEEQCAMVRKVKRAQSFL
                     IEDPRMILPSATKAEALEELNWSGRKGGVSCLMVVDDLTSRRLCGVLTKSDLTFATGS
                     ALVETLMTPVSRMVVSTNTAITLEEAREVMRTKRTKNIPLLGPKGELLYLITRSDILK
                     LTGNLNATLDSRGRLIVGAAIGVKKEDHERAAALVDAGADVLVVDIAHGHSDLCIDMV
                     KALKVNPLTNKVDIIAGNIATAEAAQDLIDAGADGLKIGVGPGSICITRLVAGSGVPQ
                     LSSVMDCARVAKKHGVPCIADGGIKTAGDICKAIAAGADTVMLGNMLAGTDEAPGRVL
                     VKDGKKVKIIRGMAGFGANISKAEREQRLDEDVFHDLVPEGVEGSVPCKGPLAPILKQ
                     LVGGLRSGISYCGSHSIADMQQRARFVRMSGAGLRESGSHDISKL"
     gene            complement(<387109..>388077)
                     /locus_tag="LMJF_17_0735"
                     /db_xref="GeneID:5650810"
     mRNA            complement(<387109..>388077)
                     /locus_tag="LMJF_17_0735"
                     /product="ysine decarboxylase-like protein"
                     /transcript_id="XM_001682284.1"
                     /db_xref="GeneID:5650810"
     CDS             complement(387109..388077)
                     /locus_tag="LMJF_17_0735"
                     /codon_start=1
                     /product="ysine decarboxylase-like protein"
                     /protein_id="XP_001682336.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0735"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0735"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650810"
                     /db_xref="InterPro:IPR005269"
                     /db_xref="InterPro:IPR007138"
                     /db_xref="InterPro:IPR011008"
                     /db_xref="UniProtKB/TrEMBL:Q4QEB2"
                     /translation="MVVAAVFTIKLRDSEAEQQFLDAFAPLQQHSVRNEPGTLTYELH
                     QVFEHGQPVPLQYLVLERYSSMRDFEEIHLKSAPLQNLFNVVAGIAVEEQKLTVYSNV
                     ASQPALDSRPQSWSEKDIDDPLLQKGVLVFAGARSGSRPAYTQEAKALAKYIVEEAKQ
                     PVLYGGGTVGVMGELAKEAHALNGKIISIIPNALSEREVSGAMIGDRIYTTATMSERK
                     SIMFAHANTVVALPGGVGTFDELLEVITLFQLNAYRPKIGIVNVEGFFDPFVALLRHL
                     IAEGFLEENVFDFLVIAPTAVEVMETLKSFVPPPSPASTLIWTSRP"
     gene            complement(<391065..>393881)
                     /locus_tag="LMJF_17_0800"
                     /db_xref="GeneID:5650811"
     mRNA            complement(<391065..>393881)
                     /locus_tag="LMJF_17_0800"
                     /product="putative OSM3-like kinesin"
                     /transcript_id="XM_001682285.1"
                     /db_xref="GeneID:5650811"
     CDS             complement(391065..393881)
                     /locus_tag="LMJF_17_0800"
                     /codon_start=1
                     /product="putative OSM3-like kinesin"
                     /protein_id="XP_001682337.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650811"
                     /db_xref="GOA:Q4QEB1"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q4QEB1"
                     /translation="MGKKDQAAAAENIKVLVRCRPFSEKENAMGHKSCVDLDMVQNTV
                     TVKSIIGEPDRWTFDAVINNSFSQEDIFTQFIMPLTESVLGGFNATVFAYGQSGSGKT
                     HTMTGVMGNSTLEGVIPRCVKHIFDSVQKMRDEAPSTTVSMYVSFMELYNGKVRDLLA
                     KQQVSLDIRENKDHTFFVKGAVVAQVKFPEDVIRHLEEGTDRRRVASTELNADSSRSH
                     SVFSLILECTETLEDGSTRAVSSKLNLVDLAGSERQGKTGASGDTLKEGCNINLSLSA
                     LGTVIDTIVKGGTHVPFRSSPLTMLLKDSLGGNSKTVMFANINPSERNVSETVSTLRF
                     ADRAKQIKNKPVVNMDSKDQKIAELTEIVKELREKLAKYESEGTAGLEEEVVQLQEKI
                     GQLEVQLDNATKSREADLVDYETAKATFAAERQTFNTRLLSMEDEISQLQNQLQISES
                     SGAAMQSQLNDVWTQCYNYFLTPTEKAAQTLEQLQVTRTLEEVLRNAKVKGGDESSLQ
                     EKIQSLTADLKASQAEHRATKKELKTSKAQLERHLAEVKEELAEWKRASVAPGSSIGG
                     GQVAATVGQQQDYTMQEEKLLAAIKLDDNGAAAIKLLREENETLRRQLMAAASAVPGS
                     TAAVAAPQQNSASISKNATADSAVPLELQSSTSAAAQNAAAISSLQAELEEAKAKVEH
                     VTASRESLYAELEAQRTELAKSESTVAQHDRQLAKVQQEYEAKLAAATRSEDEVTRLE
                     TRLHERSDQLEQVRTLLEKQKAIIIKNNEKAEYFQISLREKTEALVALEQQFREQLEN
                     KDAQMQQLINKRVAEFSEQRSAELNEKSLRQKKLKKKVHKLQEELNKWEERFDMKVCE
                     CEDLRKALEEKKVEQMRLLRRIELSDDEAEALEQKEQIQNALERAKQERRRKDDLFAM
                     GEVRSAKSVVRRSTTDPSDDAEYS"
     gene            complement(<395206..>396342)
                     /locus_tag="LMJF_17_0810"
                     /db_xref="GeneID:5650812"
     mRNA            complement(<395206..>396342)
                     /locus_tag="LMJF_17_0810"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682286.1"
                     /db_xref="GeneID:5650812"
     CDS             complement(395206..396342)
                     /locus_tag="LMJF_17_0810"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682338.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650812"
                     /db_xref="UniProtKB/TrEMBL:Q4QEB0"
                     /translation="MQQELLLLTRRVAQLESTADGLHGKLHEVHRAIGEVVLGQRNTD
                     LLVQQIERRHLAGPVGTEAATGNGRGEGVAQSTAPLPDTCASPSARHDGGASLAAATH
                     AATTVAPVALPSSAQLAEQVSTLRALLNQLTTNIFAADRLGAVIDRMAASGIDKDKVA
                     ASVLPSESLSSRASLLQRLQRRYALGTFTDAAGVTRLSSQVVRVHNVPLNMGAMEVRE
                     LCVQHVCTGKNADELVSCMVHRSTDSIPAVAAVAGHARHPVQEGADSPTDAALPRYLS
                     SKATSKTSASSLASADAAVLGDLPRGDTVAAIRPNTKTFEVVFTSAAAAVRALQVLNG
                     MYLRPTLHETPLPLVVEPVVSADVLAALKAWEDEAAAASQHLTR"
     gene            complement(<397590..>398213)
                     /locus_tag="LMJF_17_0815"
                     /db_xref="GeneID:5650813"
     mRNA            complement(<397590..>398213)
                     /locus_tag="LMJF_17_0815"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682287.1"
                     /db_xref="GeneID:5650813"
     CDS             complement(397590..398213)
                     /locus_tag="LMJF_17_0815"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682339.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0815"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0815"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650813"
                     /db_xref="GOA:Q4QEA9"
                     /db_xref="InterPro:IPR000467"
                     /db_xref="UniProtKB/TrEMBL:Q4QEA9"
                     /translation="MSALAKKMMEKYGWKEGEGLGKERSGIKSYVKVTRRDPHTATGL
                     GHAADPAQGGSLASTHAVELDAIYGQLHKETRKRQRQSSKARVDQGDTSEDEVDNGGE
                     LSDVSSTNSGASSSSSADSKSEGKAAVAARAAVKRQRRAPSSSPSNSGNDGDDRTDSK
                     RSKGEHIGDVTRMSDKELFQRCGGVRLGRAGRHRLFDGKLKRIQDSS"
     gene            complement(<402909..>404561)
                     /locus_tag="LMJF_17_0820"
                     /db_xref="GeneID:5650814"
     mRNA            complement(<402909..>404561)
                     /locus_tag="LMJF_17_0820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682288.1"
                     /db_xref="GeneID:5650814"
     CDS             complement(402909..404561)
                     /locus_tag="LMJF_17_0820"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682340.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650814"
                     /db_xref="UniProtKB/TrEMBL:Q4QEA8"
                     /translation="MSRLMTSPRPPAPPHATASSMAAVEEPTLHDAANAHAGIIPGIA
                     SEEGELDQFDIVLQQDAAASSGNAQVPFRNRSPSNAGTHSPSGATPPLAVGGYAASTG
                     SSGLVVSSAAHYSGGAGSNQRCSPSVLFQGAARRLPSVAGACQASAITQDRDQCARLI
                     HQMASACRGELHLHGYSSSAGGSTTSVASPGGDPRATSSPAAQQPSTASAAAVVSGLD
                     PHIFEEELSLLTGIILEANMAHNPQWQPQFAHRSNHPTSSNSNGGYVSPPHGMLRASP
                     RSGGGGAQSLATAPAAAAVTTAVSMLGASAGVAARTHSRGSPAGGVPGTHLASNYLTN
                     VMASNINNDGRSTIDTEVSDSLCRISHLGSGGGSNYHMYMMEHGVRPMNPCQGAAPLS
                     GATGGSARSISQLQQHQQAWTALMHESASNPGHLDRAAIASLTGQASRRPSGSAARST
                     SATVKHPRAVKPEVSSDGGRIRGPRSRTGKNVAPSNHSAFSECSGGETRSCRSTLTGA
                     HRVLSSSANATTNTSLSSSVFHQIQVDHGMSMNGGNGRTNNA"
     gene            complement(<407430..>409289)
                     /locus_tag="LMJF_17_0830"
                     /db_xref="GeneID:5650815"
     mRNA            complement(<407430..>409289)
                     /locus_tag="LMJF_17_0830"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682289.1"
                     /db_xref="GeneID:5650815"
     CDS             complement(407430..409289)
                     /locus_tag="LMJF_17_0830"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682341.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650815"
                     /db_xref="GOA:Q4QEA7"
                     /db_xref="InterPro:IPR007708"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q4QEA7"
                     /translation="MSLAHKIFATLKASGDSTFPSPAAPTSGQSETATTTSASPSGSW
                     NERFYHIAVQGCCHGELDRIYDSCSEHERQTGKRIDVLLCCGDFQAVRTARDMDSMAV
                     PDKYKVLGDFQKYYADVSGASTGHKAQILAPYLTIFVGGNHENSDLLAQESYGGFVAP
                     NVFYLGHSSVVTVDDCLTIAGLSGIFKDPDYDRPYPPRPYALNPMAKKSAYHVRRIEV
                     AKLHAYLRATQKIRSNSTIETTKTTSATSLAASPPMVDLFLSHDWPVGITSYGDEAQL
                     LRFKPYFTDDIRRHALGNPHTMRLLQEAKAPYWFAAHLHCYFEATVEHPSAGATETMA
                     AAAAASTKFVALDKCAKGHGCLTFIDLPRVRRGSVLAAPPSESHPHDTATVLGASRIR
                     RDPVWLEVLRASHQFVAANRTVEAGLGGGGFDVDEAVKEVVASCRSATRPSAAALLAP
                     TTETLLAALQLSPALPLQQIAPAAASPVSPTKGADGRTPPSATRRDETVWQNRNNTRG
                     TGGGLQPHHPRARTEATRTSSASTAAPKSSTPLWYTADTQPSQQPPTSALCIFEDMGP
                     TGCSSAPSSTSGMTTGHISPSFACTDGDGGAPPRESAATTLSWFEDTTQQQQP"
     gene            complement(<410194..>411765)
                     /locus_tag="LMJF_17_0840"
                     /db_xref="GeneID:5650816"
     mRNA            complement(<410194..>411765)
                     /locus_tag="LMJF_17_0840"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682290.1"
                     /db_xref="GeneID:5650816"
     CDS             complement(410194..411765)
                     /locus_tag="LMJF_17_0840"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682342.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650816"
                     /db_xref="UniProtKB/TrEMBL:Q4QEA6"
                     /translation="MRKRAVAEEKDAPPALPRRSGKTNFFQEPNPLSNGSEKKGDGDA
                     STTDLVGKKVNTKFDVSGQANFESRCDAKTGASNPFLQKLSKMESDSRLPSFPTYNAA
                     AEERRKKIEAKIKAERSKMLIFRDVGMDLDKPILSRDVFLVLKYFRYGMDFAVDNELE
                     RMLRYFNEHATNELKIIQDSKLMRGPPFLSRKRRSASRKRSSTSSSIKPAPSVGASAQ
                     GDLAERGGSTAALHQQGLQFQISSTFPHVRCAHMRQFCSPNAFSAATTSKLATLLSVS
                     HSSWPFASYFPSMTVQEARGSAGKSYNAKASELFTTMTPSMFRRPAVVIFSQLGQKFG
                     SQADIHWRRLAYATICPGLLPYISSPAQEAGTATSGATDAQSPYGVSRSGPTGKDGSD
                     ARAASSSRPMPIDVISLRSADVYKYRWVQRLYVSRFAKSLSQTTVSESGEQPSIDEIK
                     NALIASSTFVGSQLLEPFYATLGLRNYLLPHVMLVDHEGVIRWLSGGLPDADEKDVFP
                     SLLRQLESDYLKAPK"
     gene            complement(<412541..>412894)
                     /locus_tag="LMJF_17_0850"
                     /db_xref="GeneID:5650817"
     mRNA            complement(<412541..>412894)
                     /locus_tag="LMJF_17_0850"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682291.1"
                     /db_xref="GeneID:5650817"
     CDS             complement(412541..412894)
                     /locus_tag="LMJF_17_0850"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682343.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650817"
                     /db_xref="UniProtKB/TrEMBL:Q4QEA5"
                     /translation="MGRGFGRGAKSVAIVTHAQAGNAGKKTPKGLRGTRQRKRQKFLN
                     HNSEQAQLEESLGLTKPEKHAPKNLAQEIASIQFAHVVNKREKGLKHLRKQIMGAVKD
                     VRRLHADKARRKSKK"
     gene            complement(<413870..>414313)
                     /locus_tag="LMJF_17_0860"
                     /db_xref="GeneID:5650818"
     mRNA            complement(<413870..>414313)
                     /locus_tag="LMJF_17_0860"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682292.1"
                     /db_xref="GeneID:5650818"
     CDS             complement(413870..414313)
                     /locus_tag="LMJF_17_0860"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682344.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650818"
                     /db_xref="UniProtKB/TrEMBL:Q4QEA4"
                     /translation="MSFSTKFAMWWGSVTTKTEKLFNKEKERLVTHEYYDNPNPKSAR
                     PKSIHSIRGSMRASASAQSLQSSNGNAKPSRSFRQQEANESGNDADQMPVGSDPGYGS
                     VRQVPYTLNYNDMQQYPQGQQYTPDPQYMRQQHQGHPNQGYGQVY"
     gene            <415950..>417284
                     /gene="META2"
                     /locus_tag="LMJF_17_0870"
                     /db_xref="GeneID:5650819"
     mRNA            <415950..>417284
                     /gene="META2"
                     /locus_tag="LMJF_17_0870"
                     /product="META domain containing protein"
                     /transcript_id="XM_001682293.1"
                     /db_xref="GeneID:5650819"
     CDS             415950..417284
                     /gene="META2"
                     /locus_tag="LMJF_17_0870"
                     /codon_start=1
                     /product="META domain containing protein"
                     /protein_id="XP_001682345.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650819"
                     /db_xref="GOA:Q4QEA3"
                     /db_xref="InterPro:IPR005184"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR015232"
                     /db_xref="UniProtKB/TrEMBL:Q4QEA3"
                     /translation="MTTADDVCGAYTLSHCDGKVAPTKATLTIHRCGEILTAHVTVVN
                     DLRGTVQYENCHIVGSLHSTGNEASPAQESVEQALSKGFADGFNVVVEMNQVLLKNAN
                     SAFVFARLSKLSDLNGEHAIIAINDQPPNQEMTMIFTPDGNGGSFVAANIANSLRGNC
                     QIDAGLLRGDLATTQSEADESLMQVEKLISEGFQQGFHVCMNESGILLQSSEANIQLC
                     RIVSHSDLEGEYVLKSFNGAPVPTRNQPSIVFKSVNTNEVEISIVVANRIRGTAALNQ
                     NVLSSEEPLMSTRMMGTEEESQLENAFNVGFQYGLETISHGNELTLKNQDCKFVLVKA
                     AAPAAQHGGPTYKGTYCNKCFKTEGNGLLFRIVNEHEKKWAFYNDTEDLRIRVRATFG
                     ARSKIEALDNANMYKDDDGRYVVEVTVDPQATEMFIQGDVNGFRVLYDAQPI"
     gene            <419893..>421578
                     /locus_tag="LMJF_17_0880"
                     /db_xref="GeneID:5650820"
     mRNA            <419893..>421578
                     /locus_tag="LMJF_17_0880"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682294.1"
                     /db_xref="GeneID:5650820"
     CDS             419893..421578
                     /locus_tag="LMJF_17_0880"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682346.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650820"
                     /db_xref="UniProtKB/TrEMBL:Q4QEA2"
                     /translation="MAAPSSENNAGTPLSYTNSAVEAFVADATDIRDLLFKYRADAEL
                     LKHELSSFVHREIDEQAQFSHLRASVNQTELASLRDPRFIEYLARREAEEKRVASSAF
                     SAGDATISNRTDGVGATNASADCQWWAQRMKEEGSPWLRCWAPDAALPLAAFRRLSDV
                     WKGWKHTSAAYDTEFDRMLEEVYARAPPPSCSANTRYCCFGNGTLCILPIEDDVAIVN
                     DLEKRVSQMAGASSEPFSSSPPPLSTDDAGYAVASVLDSYFAELTSAVAMTRDELHEK
                     VSTLVQKRTLTNADSHATVADSFRLTGDAWDTLSFARPDRLRHAVMVRGFFFKGGLSL
                     VEQLGAEVDVVPLFFAHEKGSSRLEERGQRVQRLFSQTLSTLYRELERACDGVTMLGE
                     TALPPNAALTVAVKVPSSERDVVKGVLLDVHPVSPQLSFDGHVTWMDVCAVGRQRACA
                     PPGTQEPLGAAAVSRGSSDEECSVLFRLTRLPVASLQPYDAVSRRVFPLLNRQLIADQ
                     RRKHERTVEDVEVPTGGVADVSYSVPSMTIPICVGAVACVAAALSVTRWVRRS"
     gene            <423158..>423496
                     /gene="META1"
                     /locus_tag="LMJF_17_0890"
                     /db_xref="GeneID:5650821"
     mRNA            <423158..>423496
                     /gene="META1"
                     /locus_tag="LMJF_17_0890"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682295.1"
                     /db_xref="GeneID:5650821"
     CDS             423158..423496
                     /gene="META1"
                     /locus_tag="LMJF_17_0890"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682347.1"
                     /db_xref="GeneID:5650821"
                     /db_xref="InterPro:IPR005184"
                     /db_xref="UniProtKB/TrEMBL:Q25307"
                     /translation="MEMKNLLGKHKIVSVNGKPAPAGVTVEFKASENSGSVYMHAKVA
                     NIMNGPLKLANRKLSGALVSTMMLGSDDLMNIENALSQGFMEGMTYTVKDGGKLTLQS
                     KTHIIMLVPA"
     gene            <425289..>427316
                     /locus_tag="LMJF_17_0900"
                     /db_xref="GeneID:5650822"
     mRNA            <425289..>427316
                     /locus_tag="LMJF_17_0900"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682296.1"
                     /db_xref="GeneID:5650822"
     CDS             425289..427316
                     /locus_tag="LMJF_17_0900"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682348.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650822"
                     /db_xref="UniProtKB/TrEMBL:Q4QEA0"
                     /translation="MLNAALRTKRNGAAPPAPVPAESEFHQMRMQEQLRNHAIKDFDA
                     TEQQVSPSYFVASLQELCAQRLADSFAECAEVDALREEQPDLYAMVLERLPTQPDTML
                     PLRIAVPRIIDEKYWQRCCKARWPLGQLSRMTKGQKLLEKEYGWKRLFLEQVLSDFLM
                     ALGSSSNAGDGNGSLLPPGVMTVVAGEALAVSQKGITSLASAVGTCTPRDADASRFDL
                     SLDDEAIAALRELCAICRDYIHTVDLPCQLVHFRPYEHLFAHVPGILSFRLTFGVANC
                     GVRVSVTDMIGFRDEDAQLIQQLLRHYTALESLRLPLNRLENRHVQMIAAGLASSTTL
                     RVLDFSQNSLTDAAVVEAVSLLLCRPDFPLEELYLADNQLADKAAAALAEALRFNKTL
                     RILHLQQNCIGDAAGGALLVRSLAVHPTLANMNLGSNRLGTSTAEALSEVLPQLTQLR
                     VLCLSGNSQLVGEEVSSLPFPSEGAAAAATVAPTGSTTSISSVYSTRLLTVSAKESEA
                     EAAETGTADSQKADEEGEEDEADASLTHAGIAEGESYRFTVTARPSVATVAGEDVSTL
                     QHRGPRASRKQKDTSQLLPTAASPPPPLAQTAGGRLIAAAVKANASLVELDVRFCGLT
                     PAEEQEIMRAVQKRVYQHQMDTSVALREAEQRRALQHRAKERVARMTGRSV"
     gene            <428605..>430038
                     /locus_tag="LMJF_17_0910"
                     /db_xref="GeneID:5650823"
     mRNA            <428605..>430038
                     /locus_tag="LMJF_17_0910"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682297.1"
                     /db_xref="GeneID:5650823"
     CDS             428605..430038
                     /locus_tag="LMJF_17_0910"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682349.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650823"
                     /db_xref="GOA:Q4QE99"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="UniProtKB/TrEMBL:Q4QE99"
                     /translation="MKLTLRGGIALAGAMLLAIAGFSLFEACVVLALYLAKYVFGDGA
                     LMPLYRLANMHHDFMQRTYLCWVGGLVENILGTSIAYTVVDGDGQEHLEQHYMKSVRN
                     EEGAVERYLDLDKVLRPPSQPGKAKIIIMNHHCRVDWIYTFMYFARTRGIISHIRYVL
                     KEDLKHLPVLGWSMELFRYLFLSRHWEADKVYMRRMVDFYKATGDTPVILIYPEGTDL
                     SPSNIQRSQEYAAKVGLPKFRHVLNPRTTGIVALMDMLGGADRVEGVVHLTIAYTYHA
                     PGERPNELSLANGHHPKKVHLLIQSYRVADTAAAAAQKNPKHVCPTEEAALTAWIHEC
                     FAEKELLLSRFLITNPIGFDAADVRAVLGEGVGIASYDDDEERLHHPNRPWWRRYYQQ
                     VGFFGAVIAPVYWIASLIYYVFFTRWWLSTLWVLVVFVVFMKGVKAIGGIQQSLYLNV
                     VTPEATLMQRLRRMLEDRQVRKDKKSD"
     gene            <430938..>438044
                     /locus_tag="LMJF_17_0920"
                     /db_xref="GeneID:5650824"
     mRNA            <430938..>438044
                     /locus_tag="LMJF_17_0920"
                     /product="putative ATP-dependent RNA helicase"
                     /transcript_id="XM_001682298.1"
                     /db_xref="GeneID:5650824"
     CDS             430938..438044
                     /locus_tag="LMJF_17_0920"
                     /codon_start=1
                     /product="putative ATP-dependent RNA helicase"
                     /protein_id="XP_001682350.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650824"
                     /db_xref="GOA:Q4QE98"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR004179"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QE98"
                     /translation="MSFVNHLGRSSLATRYVPHSDLTKSHYERLLLDVRRYLPPGVED
                     DVEEIAEQVLNIVCSAASGAFSSAATLSEQHRSLERLLDTRLSREVRDHLMQYGKLIT
                     DYVASDKAAEANGTYGLPATSTGALGVQDLNFAGPSSGDSDSDDSGDAVRSDAEERRN
                     VELLTGGASSSAAERKERRKKRKALMKADQNLMQYAFAEEGGIADTVEEAEAWGASAP
                     LGAGGAAAGELSCDEYDEDGALATGVADTPRIPFEEVACNAQFLKDAVRRLFPAHDAD
                     TCHSLAQRVLNFLSEREEDDFTLETQLTTCLGGYEDEVVMDWIGDVVQSRWSVVYGLR
                     YAQCTAQKERHAVMDAMQRHALDDPRVEHLYQSITGKEVDPLNTEQLQQRRESAAAGG
                     NEDVESKLVSTAPRQPLLRRVNLQACAFQDERAPHLHVRATVPQGTQRLTYETHDEVL
                     LPPTSSYNTSTPLIRVATSFPSWAVPVFSGVEELNAMQSKVYDCAFHSDENMLVSAPT
                     GAGKTNVAMMAMLRTIAAARNPVTGVIDGHSLKMVYVAPMKALVQEVVRTFSKRLESL
                     GLTVAELSGDAAMTQQQMATTQLIVTTPEKWDIVTRKSVELGVASLLKLLIIDEVHLL
                     HNERGPVVEAIVARTMLQQQLRGEGGIRLVGLSATLPNHADVAAFLQVNRQRGLFVFD
                     SSYRPIPLEQTYCAIKKMKGVAQSAVMNLVAYDKVLQAVQAEEQVMIFVHSRRETEHT
                     ARYLQKRAAEERRGYYFVRPDSDNHKALVEASSGAGGAVLRRSLQQLLPDGFGIHHAG
                     LSRDERNTVEQLFADCHIKVLVCTSTLAWGVNLPANRVIIKGTRVFNGSKGQSELLSA
                     LDVLQMFGRAGRAGYGAAVGRATIITSPDDLHYYLSVLNQQLPIESQMMRRVVDMLNA
                     EITLGHVETVEEGVQWLQRSYLYVRMRQVPEVYGIRASASDPLLLHHLANIVHTACEE
                     LRESKMADYDARSRKVAGTAYGRIASYCYVTVTSMAAYLGLMSNAMQDVELFRVFASS
                     SEFANIGVRAEEQAQLKELLESAPVAVRESRYTPMAKINILLQCYISQKGLEGLPLMS
                     EMVYVKDSAQRILRALYEICLVREYGRTARQFLELYLMTVHRQWAVQSPLRQVRDYLP
                     AKHFDAILPALERVRVPWEEVRRWSVEDLAEKLSDDRRAQSAYEAIHAVPHYAVDAVV
                     RPLTRGMLYVDIDILPDFDYVESLHGCSVCEVLLMIEHTNGRLLHHESIPIPLANVVA
                     KAAYACPPVVVPMVEPAPTHLFVRVASPHWLAATAFTSVCLLNTLLPPVATPLREVDQ
                     RSPSQDANITSVAERLAPYQLHTVGEMLFPFQDFTALQSDLIDPIFLDHPRNLLVGVP
                     PGGGKTAIAELFVLQFLLEEALKEKERTAGVQQQQQRNEEEGSTTQPTLLLPGKLLYL
                     TSNPDVVHRRALDWRYKFGEVLKQRVVELAGGAGEDTNADGAGAVSNAVEVASAAIVL
                     ATGENLIRLVRRGDSALASVTHIVVDHLHLLRAPEGQAMEECMARLNSEPFLVRHGAG
                     RARVLGLTYPLISTAELGRWLKVSVSHQYNYGASYRQLRVRMVGMELPGPRSRYESGA
                     IAALKLLRRPSYAAVPTVIFVPTARQAREVAQRILLRCRDNYIPETTEHATDDARLAV
                     FLAAGVAYMHKGTSELDALAIQELVDAPAVYPATQALLPLRLVCAFDAAWRLPAALFT
                     NAIVCCGERLTAFESEDGERGMRYQDCTAVELMQMASRAMNEAVMCTRTSRVWVLGKL
                     LNEPLPLESSLRYADDFRDTVNTAIAQGRAHNRVDVLRVLSSHYFLYHVKANLHFYGV
                     PTVADVSLYASSFASHVVTSLKELKCIEELRVRRRHADGDGDADEDGGSNNPELGEAE
                     EDEDPHAPLRPTARGMALAHHCIAVSTAEDLVRVLPGSLEAEKKAALYDCTTYLWQIL
                     SHHCVELTPAHLGDAARVTEAAEYRALHSLARALPESIGVRYIDLDFGATGTKIYVLV
                     LAYCSRLFPATHFHAAGSASSIKEDSAAAAAFDEHFGHSLYHAAVPAAARDALCNAVS
                     DDIAQRLVRDVRSILPTVRRVATAVVELLDGDTQAWAVARLIRFVACLQQQEWDSEPP
                     VAQLPCWRASRWASVDARQAIQSSCTLQELQTNPAEAVSKLEPALRGVLTTDDAAVVV
                     PRVLASAAQDAAGVPQVVSISAKGRVEEMNGVLAMVVGVTAQLRWSAPTTLKLSRGSD
                     GVDRTPQDDLTEDAAPALKWWVRCVISRRPSATSRAGASASTRQLALRVSVAKSVTGA
                     EATSLYEVSSDVFFSLARLEAEDLDAVEMRAVLTSMAYCGVEATAAVRFEADEEEVED
                     REGI"
     gene            <441637..>445539
                     /locus_tag="LMJF_17_0930"
                     /db_xref="GeneID:5650825"
     mRNA            <441637..>445539
                     /locus_tag="LMJF_17_0930"
                     /product="putative formin"
                     /transcript_id="XM_001682299.1"
                     /db_xref="GeneID:5650825"
     CDS             441637..445539
                     /locus_tag="LMJF_17_0930"
                     /codon_start=1
                     /product="putative formin"
                     /protein_id="XP_001682351.1"
                     /db_xref="GeneID:5650825"
                     /db_xref="InterPro:IPR015425"
                     /db_xref="InterPro:IPR017987"
                     /db_xref="UniProtKB/TrEMBL:Q4QE97"
                     /translation="MIAAQGDTDLMLAILQSEMDVQLASPANIDVLHFGTQETVRRLL
                     LFLELPREWEGEVVRTLNVTNGDAQEAAAILAQKSGQRSISLPNDVTASRQQVLTATE
                     AEELPLLLQRLGQSPNGETRQLQAEFPDRTTDEIRTALQLTDGNMENARVFLREDHTA
                     SKNSRDAISNIFARAAATRGSRPRPDHRKEIEAVYRKLNGAVGISNSAAEVIDVATGE
                     DVVKTSLSLQDLQVYRSSGGGGGGGCTAAEGADSASRQQPVPQSGDSTPTASTLNAFA
                     FTKTAPSLLTPDTGASRGSDKAPDLRRPHQRPLSPAMSMTTPPFSDRGTSGTRHPSNA
                     TRLNVMRASSHELPSTAAVADTMQRAALPAKRSRRPSLSREAKNVSTRLTSRLDLPSL
                     HVVRTGGGAAEAGSSAAALNDSTSTSAADSSVSGHSSRRSPPSPHSAKVIAPRRSSVA
                     AVNLNDYRGSGPAAEAGRADHVWTSAGGGAAGSSGTYFASVAPGSALIASQQLTGQPF
                     HSPHTESLLNTVLSQLGKNTESHQDKEQQQRQRQLSSELVDTTSLRPFWPAGSADNNG
                     TPMSASSVSSPTPTAPPPPPPPASSATAPTAVGPAPPPGLPPPPPPPGYKAGGSASSA
                     PLPPPPPPPGGSGVSSPPAGLPPPHPPGLPPPTGGPKQPPPPPPPPPPPPPPPPPPPR
                     MGNGPPPPPGKGASGAAAPMLNSSTTRNVPINGAVGDSDDAIFKAARPIELTAGARDK
                     LLALFPKAAPKHVIEEDEATSRVQRILDVNRDRNVGIVLKFIRLPIQQIEASVRTFDT
                     LTLGEERISGLLKIIPTSDDFEAIARAQKEHGGPWKRAEEQQLPQAVRFFLMTQRIDH
                     YAERIHAWSLRYELHGRLEYLEQKLSKADKAIDATFASPSLPDLLYFLLEVSNFLNAG
                     SRFQGAKGFPITQLPQIMDFKTTDGKGTLLQYVAEILDTVNPHLQAISSELMPAVDEG
                     RDIDVASIEQELKKLRGRLQKCKHLIEQLKNDVRWTNVLGKFIYRSLPELERVEKLAE
                     SINGKAERLQEFLCEKKETFSLNEVLRVLSNFCKRYEQEREKQRLRQERQDRMEDNKQ
                     RRQSTVSSTVASHGDLPSQTQPESSSQQRRFSQQPWQQSPQRQSPSLQASWNGADRVR
                     ATPDAEFSTSRLRGRASLRASGIAPASRSDGSLGTAEHGRSHPPHSNGIGAANGAEDR
                     TSPPVDGTSGSTPVSSNTGGGYRRRLSNGEVKQPGVSTTAVSARGPPTSSSARAGTGT
                     VGGEVLPPVGKSPVVLSARASNSGRTHVESTRRDARQT"
     gene            <447407..>450613
                     /locus_tag="LMJF_17_0940"
                     /db_xref="GeneID:5650826"
     mRNA            <447407..>450613
                     /locus_tag="LMJF_17_0940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682300.1"
                     /db_xref="GeneID:5650826"
     CDS             447407..450613
                     /locus_tag="LMJF_17_0940"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682352.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650826"
                     /db_xref="InterPro:IPR022035"
                     /db_xref="UniProtKB/TrEMBL:Q4QE96"
                     /translation="MNVRTTRDGVAEVFERDRVALIMQQALAHRYAHPLPSPLSDGVH
                     DGHLVDSEGYGTATSGIAAKSPSSPPRLTCPLHYTLRRCSRTEYYLRFIPPISDTAGF
                     MEPSTAGGSSSVSTQWQSRDDEASVATAVAAECWRHAAFTALTQRDLRRLCGLLEETG
                     PGTNGHRHDPTPSSPSLSATPVASNPRRSSPPLVTHHEFFEMPPRWAMQSLGEVDQHT
                     FHNFAEWDCRRLVTPLDVGATVVKQAMGAEAVVRGAAASAPGGDQTVSPAGPAASLYS
                     PAQMMTERGDAAPPSSSYLSRTSASPSEAEHVLRRQERFRVRSTAAMARGAYWVDVVP
                     LTAEEERDRREIGVAASTDAAISAVADTENNSITCERVDRDALLLHPPVALYVDPLLP
                     CDELYSERGVNTSVYVFFLRALQQQQHKLADGRILCGTAASDSSSDCSGMRPGTGIGT
                     PDPPEAAAALALQLALCARQRRLELASRIHRAINAANRSSVLRRVPSRAVATCVQAGT
                     AVTSAKCSGLGAPAVSLQVRVDHARGSVQLRALTLEDSADSTSDALGSDWDASGRAAT
                     PTSSAAARPRLQDTETSSAAYTKRRREDAVEGEEAVRSSHNAAITKATRSPTVEVLLR
                     SAWKLAALYDITRSASLELQQAERSASDESSEVRVTSPEGAQMRASLPASLSSWLATS
                     LLRRLTGRPQAVSGLTASGTTGVHSEASCDSSWSTVVLHRGGACSPSTMPLAGERVPC
                     PSLSAGRIDHSSASSPPLLLADDDPPTGVPAATAIASTTLTTTTTTTEERIFLGRLFT
                     LLLRYRTLFGEHGYNQGPQAAVPPPVMEHLAAAFEISAEAFASPLNAQLPQFGSLFPD
                     TDRHFGSMGSFFDLQFGGASGDCHAQRAPIPTDCAVPPPGCHIEVNPPFDTTLLRHMG
                     THLLSCLTRAQESTQSLLFLIVLPSHDLTDAEKAAAAVASTRLPTQAAAAKRLSSDRL
                     RGSTAATASVPPSTERTLRESPYCLGHVLCAAAESAYVDGHQHLLQSPFFRIETPTRL
                     ILLGNTAARTRFPHATTQLEAVRAAWKEVTESALRQQR"
     gene            <452956..>457740
                     /locus_tag="LMJF_17_0950"
                     /db_xref="GeneID:5650827"
     mRNA            <452956..>457740
                     /locus_tag="LMJF_17_0950"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682301.1"
                     /db_xref="GeneID:5650827"
     CDS             452956..457740
                     /locus_tag="LMJF_17_0950"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682353.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650827"
                     /db_xref="GOA:Q4QE95"
                     /db_xref="InterPro:IPR002073"
                     /db_xref="UniProtKB/TrEMBL:Q4QE95"
                     /translation="MPGRSASEAGGVAPSAELGAPLSATGATSARSSSGRGHLLHSSA
                     SASFCLGEAVPAHGQHALANAGEVVHVGRGGGQSQRSCLPTIIDTPATGPTAVGASSL
                     RCDFTSPPAVLVAGVPMSSHVSTPAQSTHAADTRSVQLLQHLQQLLQSNVPTAMLQQW
                     VSAQLLQATSTATVARPPAAVVVVSSSSARPPALTALPPSALGQPTTPRIPGGSRPPR
                     RPAPAVSFSAFTYPHRQTQQQQQLSEQQGSPLDHVHVSSEPSFTPSTIGCVCAPNSGS
                     APSALTSAVDGGAVALAPAMCSDTSVVVTVPSKADIEAPLSGPSLPFLAGSAVVPSVE
                     RGGPCPSVNDPLASGACNDVDPAEAHQRFSGKGLRKTSRLHRQHSQCCSLRSHSSNTG
                     CSSPTTPSSGVWPATVSGTGAKIAPPTIISHSRSPSPAGSPTHCRIASALHSATKAAI
                     HATTSQLVAVKQRNISLLLGERFSRHPQNLVRRVATPLVHVGSGLSGTSALSGATFSQ
                     GRSFCERDFTADGDNSSLANENTVLERVEAPTGPLVAPQTRFPSVASAPIQVTEGGAA
                     VAAAGFSARCASLPSVAAAASASGPARKVPASRSSRAITPLSLLVTVMDVSESGSSGV
                     PSLRGNGSVSDDRSPVSNAPCGCNAAAAAAPSPLPASAESASIHRCTDSIPSEQPANA
                     EAEAQLKLLLQRGRPSSALSAVMAAHPLTAVTEAASGYVPEPVAATEVPDVISLVAAD
                     TEGASVPCTPFREPSSHTNSSLLSGGDSHQLPRWWGGSAAHDGERYHLPHRGAALTLP
                     AVNASATPLAWAQPPNVNSHALGLDASLSQLAPLPSAVIQVTRQVSVTPRRAASFVSN
                     ASSRLGCGGATGGHGAATLHNVAGQDSFSLHDDVPSFNSSHTAGMSSIGDGASSNRRR
                     RFSVLHLSRSSMNGGVDPMDGVMPSFILDNINGAQRRSGPRFLRSFCRHTPVRAAESV
                     TREALRGLGVPFIADIDQASVPTDVLKLMDAHRFTDSCAFYVTMCLNVFLRYGLVQRF
                     GWNLQKLKRFFEVAATYFRGGNPFHNPVHAVDVVMAAHQWLNEGSTGAALSDDEAMTF
                     LFTAMVQQLAHTGADNRLLGQLKHPYAMLCSYASPQQGATVALVMALLSRPELHFFPV
                     PFLATAHTADASDIADSAVVKEWTTSRESQMYDMLADLIMATDERNHATLKHNIVRIG
                     EENARRHGCMCACTHTAHSSPQADTATRPLYPSQPGNFCLNCCAYITDAHVPDLLKAV
                     LHFIDFAYLFRPYPVYLCGNITYTAELYRQSQREYQLLQRLQEQQLPRALPDEADGER
                     VGEEVPRRRSAAQIPGALFSAPATDAYTPAVAFATALLAEQQPWRQGVAQASTMTSLQ
                     RNGDEAVIVADTPPQSRRVTDVTLPSGTTARRHSSMYPPLLALDAQLMQQATRASQDE
                     EASASNALDSETRAQPLKSLGRDIVLISLEDLCLPFLEQLSPYMPEAWVAASYQNHQR
                     LMKSLPTPEKFDEIVNRLLGMGEETEAERLEEDMNKEGEFEDEETDWLAAERPFTLPW
                     RLLRPMRPIEAEWTVDKDGLVRRVVKEIMRGPDQLLKESDAS"
     gene            <460520..>465757
                     /locus_tag="LMJF_17_0960"
                     /db_xref="GeneID:5650828"
     mRNA            <460520..>465757
                     /locus_tag="LMJF_17_0960"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682302.1"
                     /db_xref="GeneID:5650828"
     CDS             460520..465757
                     /locus_tag="LMJF_17_0960"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682354.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650828"
                     /db_xref="InterPro:IPR011333"
                     /db_xref="UniProtKB/TrEMBL:Q4QE94"
                     /translation="MAVSCSLLSGVHTTAPTVASASLPSTTCTTAACCSTVQSYTLAD
                     VGHVTPGSVFGGVHDISASRSPPAMATAEDAGAASLVSRLRAEAASRKKPRLLQCHAM
                     TPMLLSSGELLTWEQPALSAASSLPAATAAPATSLVSPPTPNAVPPARFFHTPPPPPP
                     PPPPPVPQHQAQQCELRLLRCVRRSGVPFIEQLQQRCRTATGLAQHLVAPQCSPRASG
                     DSAESPSHAAAVVMRQSCGSHSTPLSPISFACGAHSGPASMLGLHSSAELLSQGTRQL
                     HWSKQGRVPAAPRASSDADDGRSPSIRESGLLGSVRGTPVSLREPSELRRDDRDGGMG
                     TDDGALHRVSLSTLLLFQAPSSCSADADAAASSVAITAGTVLVHSTTEPANDTCNLPC
                     SYSRSSGTRYHLQTPRKGHSDVDPSHLAAHPLVRHPLFLSSAAAAQGLLCPPGNGRAS
                     ATATAPHARDSRPLTFHSHEGGVPSPSLSRWPSTLQAHSSISLPSSAAGAAAVPLMSS
                     VQPGPFLTMSQQQQQQHLPLFAVLPSTSVIPSSRCMPRATNGMSAAGASNSSTPPLVF
                     TAIDPAAADMRSTSGSPYLSQEMQLASRLSSAASMSPHLAHGDDRGGSPARAFMLQQH
                     PFSEPVVATSALATSLPPSRTVTPPGIAGNSHDRIAHVDPFATTPRATSDAAVVGSDR
                     PRCAHHPHSQAPEGAVVAAAAVASAAASPSRASVFQHQQPPPLLSKPAEGHHRPGMPP
                     PLPSLPAMSHACETPSRRQQRPPAERCCATAGAHVRQAETAVGGAVEAAAEMVALPSA
                     DTAMLLVVPGGVSSVPATSIAAITGPSGDAPSWGSDTHADAALALIEDVMEGGSSEEG
                     RLVSRGQRVGGGDSGAGSAETVTERVVTYFPIQKSVLAQRSAYFAALLDEGSGCGPYV
                     RSTPDEHVDFTSLLPLPTTAELAEARDAHLCRAGGAGGPCPLTARIPHAYRRRDHLRR
                     GPATATASDDAQPACSVALAHRQRVPVYYIPTPETVSCFTDDSSGARLGRSGAHSRIG
                     AGDPAAASTAPTLSHACVCQLLHYLYTGVLPIFHRLPGRTGVAEWESTAAAGIASLQS
                     DALRNGFANDYAAVLWMGLYTGLSSLTSSMLKLLWRFLALSRDVWPYWIAAVHWRVPE
                     MQLICEAWIEQHLCAMLRASTAQGLWRGLRLDQVQMLVSLRKKALDAEAEARAAQTSP
                     MASNASPRYLLRRTTTGGDAAAEASMSITTTTMPSFLREQVNDSDAASSVDDSGSLSE
                     EAAEQRRAQLSLRPPAPPVATIGWPAEVLRYQQLHPLRPRGGSGSGVGTPSLSSSQPG
                     AGRVSSVDNLRVSPTTEGVPVLSRDAEASPSRPPLESLSPFALPTPPPALAMPPALAT
                     PLAFDGVSSPSAMAGVASAPLSRQSSRVSTPLFAPRAAAAVRHFRGFSGRPPALGVAT
                     TTATPGIPSSAALTLDDLSGVDGAQAAEGADNTAAIAGGPRGHRTDLGGGGESGTVMR
                     GAGLTSRMETPSAANTAVAFRTLVTTGDAAVLRSEAAESPTLAQADIPVRDNAEVPRR
                     SPLTTRGVHDLFNDSHAEPRSSSRLHVAYPPITSANAYYTTPPNGVAIQPTLQVLADG
                     AWAIGGCGRLYTAETREELEKRQAYWFRAEWEHQQQLPSAVLLTETEVLERLWTWWRA
                     RSEDSSNQPTETEVRAVVEMLPKVRLSDAQAALPCTSPRDDAAYDGFRALLAEEQRFL
                     VASEVGLPNAAVVTVQSPL"
     gene            <466924..>469149
                     /locus_tag="LMJF_17_0980"
                     /db_xref="GeneID:5650829"
     mRNA            <466924..>469149
                     /locus_tag="LMJF_17_0980"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682303.1"
                     /db_xref="GeneID:5650829"
     CDS             466924..469149
                     /locus_tag="LMJF_17_0980"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682355.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650829"
                     /db_xref="InterPro:IPR007244"
                     /db_xref="UniProtKB/TrEMBL:Q4QE93"
                     /translation="MQPPPKPLCDLNDTWEDVLTAFNDCLKGESTWSCHCLDGIDKEV
                     ILSAPEIMDPKTDSGFNCEEIYSLSHLLKTEEVPSAATVSTEAALLDVMDYIHVKELT
                     YLQGYSLTQSYLDFPYFLRMDLLKGQNSTLHAYCRGVLRSLDCVLHAVFSTTNRSEEE
                     FMLVPPELDRQPDCSVDEILAELETAAAKSSSPAVAARLRFRKHFLAALSLLLDSKKR
                     SDIEAACDICQEALALLESDLYIRSSEPAPEAKLLRAKEIAYWVSVVTPTKALPATSF
                     AGAMSAYKRLLQQLMSFKTLVNMESLACIADFIENFGALQPLLPARSLCAVVLFSRDP
                     NESFLYGAPLYRRMLETLTKRYGAPLYQKIFEANEAMVDGVVEYRVKCTMNRLKVTPE
                     QRMLLRQQTIDSVRRWVTEVSKLYLVFLETMLCNRGLAHRRMMNTMADFIRLQELSYT
                     TDLSVFLANMPGVSKELEAECIRCSTVLTLFSNDCVLRAMELIMSFEVELDLLTQGEL
                     VPAIWYINFAQRAQKENMTALCLQSTNFIPATLINKRTHIPVHNLALTTRTTGQMDLA
                     RDGLLDACCSLSDATYLSACLMERKNLIDLASAPKGSLISVENIFNHRLLLCYGQLRN
                     PPLRSYERCMSAKPSLDDVSKTPIYAKKAAEVASNAAEKLKAVLSSSAVDEVRKAAIR
                     RNAEGLEKTAHIVAASLRAFSAVCENSEELKDYYAAVERPGLPSALAFTFRKRKETTT
                     A"
     gene            <473767..>493212
                     /locus_tag="LMJF_17_0990"
                     /db_xref="GeneID:5650830"
     mRNA            <473767..>493212
                     /locus_tag="LMJF_17_0990"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682304.1"
                     /db_xref="GeneID:5650830"
     CDS             473767..493212
                     /locus_tag="LMJF_17_0990"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682356.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.0990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.0990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650830"
                     /db_xref="GOA:Q4QE92"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4QE92"
                     /translation="MASAPPIDLEGFCLAVRYNVFANYRTLPVRCAQRSYEQLPVRYR
                     AGLEAISADVLQQQQHRNQQQGSADAVSASDEAANVAVSTSVGSGGAANMGHPRGRRS
                     EGSSAGLSAAAPGTVGYVTEGCRDSVTFIGTGYYGAGARGGTWPATMNLSGSISAAST
                     ATTPAASPGWLSRGGSMCLDTSVFPSLPSCAMEERATATIASPVSVLTTSTPGGATAP
                     GAAVSPLPSSSPTSAVTTTSATIGDAAAGAGLASRVALLHHVQQTIQSFIARGEREVA
                     LHFIMATAPYRFCGTTDSDRVLAFFNQIRFFLPSPRFGIVMLAMEAWRSLYRPSVGAG
                     AADCTHMTLELLALIETYLCHGRTYAEYVSGLLMLRAVLALAMENSTFCSRTAAAVLL
                     QHRSLLQGRLPTFLLAVWLILMELYTIDDTVLPPRRVLRDLAANAMQDLFTVALELHM
                     TLPVQNVVANAVNVFFAGPQPQPQLGLSPLVTAFSGGAAVSVEPAHRGGAEASNSSSI
                     NAKATAAAVKTAHSLYSTAASNAGKNVDSEAMMLPLPLRTLDVPAAAAAAVGVGVGVR
                     GSGVPGSGAARSPFLSRPTPSIGMAASDDTANTAAAPLQPLRVPEAGGASAAASACLS
                     RDPTESSQSTLRTRVVTLASPVPQAPAFSYRAVTKSMWASVKRAARRLAHSTSVPSPS
                     PALATAAAVDSRRDATEAAGATQDAASDAFVGVLEPSASDLPRRVASARTMATNRHPS
                     PPLLVEVLEDIFRESMEADLSEHAEAVVRSTGSVQQRVPLYTTSAAAGSHWLVQSSSS
                     PSSQVVRRVAVTNSTAGGGRGTMRSPYHALRQPSATGSPLLRPGSWAQRRQQRRSFSV
                     TAAAATTLGLESSSAFSDSLWGDTPFDGTAPNRDALWTLPLARALRAAGRPQTLEATV
                     AASTLTLGAFLCAWRIAGLSDETDPDYAGSRASRHPSGMATAAAASLGASPTEVSIVP
                     SGEPPLPRYFGPASGGAGAGDADPFTEGCVLPFLTSESLVAAAGPGVPAGCRDSLGES
                     VALPYPSPATGGSTAMPSGVGASSGAFGASTGEPEKPVPMLPTPISALASRTGASRCR
                     GRLLASTATDADPEWQSVESAATNVYVPPVAGVAPPIVRASGAASRAARDEVSAATPA
                     VSTDMVALLAVSPLAGPRASPSLHVAQGAVATAATAGNGLDNTSADHVTPAGLPGVAA
                     AAAVATPDAALFHSLACTNGSMQGAAGLVASATVAGRQSGLPATIPTSTAGLCRARVP
                     PTAAADASVSDDSRSQVGARGADDTARSTMTAPRPATATGTADGRPNVAATVAQTPSL
                     SFFLPSWVAVRVMERCVRPCWDATDPAALSSTADGVRTATRRTSAVAVTKEAEILLSS
                     VVPLLSQYYVDALSASAVTAATQVLVNRAIQSVKSLSQGLRDCSSRLDANSCGGAPTE
                     TTARASSGGTTLPSSSASPESNVAPRDSDMGAPHNGAEPPASSPRATAPTDTASPATA
                     ATPSTPFASPFSTWPAEDSALVDGTELLNAILFMTTVAERYPAVYERMIHQRLYPLLH
                     HILLLHNAAVEEPQLWLSMPLSSAAVAAHLKVGDRAAAVPPLAPQQQQQCNSQSATTP
                     TAMGGEAVIQRMRLITARTMYQRLAMPALVLLSYNMPDDACARRCYPLVVRLAQLGLR
                     RPFSMASVTTALCICTVYPPLSRVCQSELVRAMTVVLATPDDGLSDGDDDGANNAAAT
                     TASREAEVDGVRVTLHSRRVPPQARPEDEPRGTREEDVMTSKPAGPARGAVLSPRPLP
                     MAAAVAAASQALLPRPSSRRAAPTTAVAATRSAAHPMWRNRLNPQLFVPFSTNVGHLR
                     LPAELVRGARRRQAAQTRLIKHHCFRAMSLFYSSWEGTTLFFLEVCLPYLWHPDAQLR
                     LECVQCCMRWLLSDCWHSTDQALLHHHATTPTASAGGVDAALSTALTSFRGSVTAAVT
                     RAPVRDPRTTANSGSSPKGGVHGTTALRCLTTLSAPGPTQAGQVRVPYHAPPRRAAKV
                     LRSGVSSGFDEGATAGLAMPAATTRASAMPIFTVQHHGRTHVNALREVVHHLVELAVC
                     DPEPLIRKCALESLSPETYPLLYPHDPFLHQLFTVLWDSHMPNRSRAAVLLCALAPLN
                     PSSIFPRLRQVLVQYTEDLTNSIARLAAPSLPATSTSAPLPVAPPGHIHEDALFVLFQ
                     ITSRLKQSTHLYLPQLLSIVSSVLRSRSSPRGSVLQALHFLVALREDSTEEQSPLFAP
                     FFDLVAQQLIDGDGDTARLLATVAALQSLLQQFTGSAHSSSHTLPMVVERLHSLLYRK
                     PSVVTEFAMAVLQLLGTISSIEPWDPEAAPRAPALLRRPQNRYALPPLSSSAGVLGRG
                     RAVRSRWLDRDERADTAAEALAQLQKADRFAPFTARAWCDTVLRALLRTVSGYVNGTM
                     SQTQGGLCTCLAAIMNILTNTVAIHHLELYLPTVLTLVIDLLEKRQTRWRDIETAYQS
                     SAVGPAEVGKINDSSEAIRQLFLRRLFDLVLVAGRRIGPMYPLLNVFLRRSWRTMSPR
                     GLVQCCEVLDALCWAVPDLLRDDYDVWIPSLLEALIQYDALVVTHCRAHEGVPDSAPA
                     AVNTSTGAAATGTAAGAAVTPAESEETPVAPASTSRNFSASANRMSPARHGSVAADAN
                     DSGRSPLKMPNTQPQSLHSAAVADGTEEAPWEQQLKLVYQALTLCLTSLQPLVPPLAK
                     RFVAVSLSECLKSSHVPRREAVRRTAAPPAAAAPTDGRAEQGSGFDAAHSATLATSTR
                     SSLQSLWPATVATTASAVFDLMADPHEELISFLNACVCRPLLEYMVHSNLSTVSMKLV
                     KNLLSRLESLSAVHEEALQRLWGAMSRRTASLLSQPEGNNGLSWIPDVASGTAACPDG
                     SVGSLAAPARAQLEVKLREARELLHLQRARQHGEGVGSANVSGCGAGAFSSIATFNSA
                     PRSASEALWFKNAALSCMWVQSADRAVTVRRYFPFDAVHTSWETEGEVQLLGCLLVSA
                     AWHHPPSTTAFATTLHTYFAQRFGPDSVAVAYVRCICSSYYNLCMPLASAHDEEMAVK
                     WAVQQQQRVANTGSGSDAGTESDTLFTTATRLAGMRDPGFYYAAGQIMREGSADVILR
                     HLSSPLTQTAVATAPARRNTVVSPRDGAALPGSSGMGSRAVSWEEDAPAPAIAEGEGT
                     SAPSSAAATAFVGASGTRATTRWAQGSSAAASLGSALTTTAIVCGDSANMALARPMTA
                     YPSMECLDSSSDGRHSAEMNTTVRFSDHDEDQDGNRRTWADSHYAHHARSGNGGSAMP
                     HRPHISSQQLNANQLHQLQYPLPARTATSTPFCGPNSLPRTITAHSINGADTSLLTTH
                     NHSPTTVTLAIPVEAGVGGSLDNYVNASAPVGVPGPRSGSGSGSSFYPGSFFTSAVVA
                     EGRVGCDGGACRGVVNSSPHRHHLHASLGAGGGGSSADVESVYGRGGSEAVPPAHAPV
                     GGGTGAHLTTPICRPFQLPHPQPFPAGQSYGPYPISSRASPNVTLGQQPAVSPSGSAG
                     MLSVGSLTAASVDPPRGALGLPASVFSPVGGAGGGTPGAAGGPGGIPPRWRFASIAAS
                     VTAVDAASPNSFTTPPAGGGVGGATLPFTVASHDAAAVQQHACRRLSPLISHTPLHHH
                     LSCGTVTPATATTRSRGGSGNDLSGYQLPPPPVQHAQKPPPPAPFSAEASATSAATWT
                     AAAGAVRSTATTATGTPPLRAEMRILTSAVQSPTATTQMDHDDSTSPAAEAASGRVGK
                     EAATSPCVVREMSEACAAFASAHEAGEVAHNNSLIAYFELHRSISGHGWRSWWEQFCL
                     YLLQCSPDYCIQACEPFARQHHIAFSYSELLPLALLSTLPSCTVAELVAWLRALRDFY
                     AFHTDPSAPVPQQVASGVARVAHDIRLYHRTFFPPEVVSRVVDVWLPESVVAELSNRS
                     LNPPLRILYLEQDLARFFSWGCTALLMVSADDVASALERTLFVQDPRFQQWLSAAAAT
                     ASEMRSRGGAVTRSPGRWRRRCKAVVRSAAAAAKSSSSTIDILTPSALEMLGFHHAAA
                     LEYVRMYEEQQLSERGDSRHGVAAGEDEAAQRSPGPTSKDTATRHHSSAAAARLIIGA
                     MRCHICLCDFEAVLRLWEAVKGRGAADATTSMTTSSPSQDACSEASDGDSGSPVVWDG
                     CGRDSSCVLSPETARYVVMSAQALSRWDYVQEAAHYAFGRGSAAGLSWTTGAPHAAQG
                     NTPKPGGPAANSAVTPQVQRLQQPPGSPRWAEDVGEEGRAQQFLDEVFSSDLPSSPGG
                     TVEHRAADHTRESLLQRQMEVFVGAALVAAHDYDGAKRALTAVRDGLRDSYAVFHSDN
                     DRVKLEWSSIFQQLSDLEEGMHTLEQVPAAQEGVAAVSTSTESGGTSAAWSGARLPAL
                     DREINGKLFPEVTVRRLRNITCRPVSATTTILQLFMIIAVRSAIAPVTWQLDNVLALG
                     EKLEKAGQPMRAVQVLHHYANLPVVATSFTTTAMEFKHQLNLEMLRRLIRNLSREEDL
                     REVHAYVQTVLRNDLWLARRAATWRMNAVSPTSSFSASPSAAAASSSWPLRNQLGMVD
                     AAAPCGSMLTAQELGPSLSHYQVDLLLLSVACRRRLTHVLLHRAPLAHRPSSVAVTSA
                     TLDTSAPLADATVSSSAPSWTLDTVRHPTNMLSLPINVDRKPCRVATDVVEDEKATGT
                     DSHSPAGSSITRQPSDFPATTAAPLSARSGAGSAAAVNCTGDGASCLHDSAESGRVGR
                     SGTSPAREQRAKMDEAAATAMGESVEAKEEAILSLESVTGKTAMFAEYYLLEQAVAVT
                     CYVPSVWREFGLVLFDVCMAIHAEWRSTGDEATKRNFLAQSAKAIHGLQLAAQLWRSQ
                     SESVFSRGIGPFPATMLRRHGHARTALPSAHLLLKALHLAVTCEVIVQDDARAAAASA
                     TEAATAATAAAVVATPSLSLAPFSASSPGSRPSSLGACSGTAKAADGAEVASGTGDGG
                     RPCSAFTTPRSLSASQRTEQPRAGACEAGTTEGTETENSRDPTAIENSADTTAQPSPH
                     WASQPQPAAAAAVTEQQGGFACLDFSAASYLQWAAVAPFLLAAATRHHSLYAALRDMC
                     VQSRDMLRQLVFPLIAAFEHGYGTMLAQQAGHPRYHRAAATEEAPAATASLHLTSAFV
                     ASGRERQEGGRRRQQQQQRRGPKASARVLEGEDGDEHVAGVSCSSSTEAPSLLEHPGM
                     AEGDTSDAGLIAKRAAGTSVIEVTDRRQKGGRRVPRAALATPLLPTRAGTSDGEAATL
                     GGPTASYTASAPHCLMSPLERPLEEAEREVCSSLLADIAAAGPGHRRLIYEAMQLRSF
                     VQGLWAVPTAASQRRNSLGAAMRQDGTDTSLASLGVVEGAPPSAQRAREAASSGAASH
                     GATRGKGAGSGFVAIDDAGGVQEEMELLLDGFCPLPAPLWLLPSVFGVGLTAGDAGGS
                     SAHDNTGGGEGARAGKAHSGGVGPGPDAATRGRPHGGQSAGPTSPASIAPVTQTAGYR
                     GARVDDGGGGVAGLPRPSAVGLPASAAAAHDQRAAHSPTTSAVSFTPVTVPTIMHVRR
                     YAVLKPAPHHQCEEVIFVMLSDGLVCRFRHAAPAATTKSGEALGAWESPHGAAESAIV
                     QLGPPRRSGAASVGAGAQDAPTASGHAGAGRYVLPCALMEQIASLLLSHLPLTHLQRP
                     FVLPLAVQDYMTMLPEHRTSPLILDAATAASVRSDDPQGWRHHMTLLTGPSSGSSAAS
                     LRTATQLLAWSSDATRTPPSLYHLMDDYTVHLRLREMALAAQEAVEAYPALDLDAMQI
                     AAETGRRPGVSADNAYPFNWAYGYPVSAPPTAEAAAALTSSHRYRDLVQRRRMNEERF
                     DQLVAAAYDDGCVGPLIAFLQGMLAARPPPPPSSSSPPAPATQTGAAALANPASTTAT
                     TTSPFSASSSAPAPQSFRSPEETFAMQQRLYAYAAVLPRTEAHLRSVLAAVSAVAAGG
                     EDNLTKESSTPSSSSSPLSPAASPVLNTKKRHYGHRQTVAATQATPLSARELQACRLA
                     LFRLESARCRLALSDAFSADSSNASHWLEARRTYAKELSEWSVMEYLLDVHTRECGTV
                     LVNTYDGHVAVHALGRYCLQPPPRQSRGASAKETATYAADIAPLIVSPFPTHDATLFR
                     LTPVLVAGLPLQSAHAAFQYHASSILYEIFQYVRDLTGIATYGVDCVTAFAHAAAAPN
                     AAPSPSSHTSSTETPLSTCRSSDFSVTANGDLWAAGPSRRAALRPEGSRACASGSVNA
                     GAASEGAPEPSAAAAPRRAGTKAAVAPTKKQREPPPPLESLVSVPAAVASTAPSSAFG
                     AFPARGAALRHPHSPLDDAADASTLPLPPRCFDSSSFRLKLSYDALLVLHEEAERSGR
                     ATMLRLLRSQREATEAQWLHVTPTSPSQDGDDGNAVEAKLSAASHGATGVEMGRALPS
                     PLSNAADDDDNDDDGAPRSTSAFDLAAAMITAATDEKNLLGVDGLCPHTWRRWAPHW"
     gene            <493961..>496150
                     /locus_tag="LMJF_17_1000"
                     /db_xref="GeneID:5650831"
     mRNA            <493961..>496150
                     /locus_tag="LMJF_17_1000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682305.1"
                     /db_xref="GeneID:5650831"
     CDS             493961..496150
                     /locus_tag="LMJF_17_1000"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682357.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650831"
                     /db_xref="InterPro:IPR023631"
                     /db_xref="UniProtKB/TrEMBL:Q4QE91"
                     /translation="MSSTAASATLRFSRSSVRRMVRQLHHSVVEQRQAVMECRNRAEA
                     MSARDTARSGRAGEAEQSSPPCFAEVASEKAVKQSFIPDGLLSGIAVAVSDALDVQEF
                     YTSSRLCIPMFHDAACKEFPLISWLRLHGAQFVGKLRCCTPFALSEGIVFGPEKPASI
                     AIAELACDYAISCSLNGPPSVLCAVHHDMVGFKATSQTFGTFTERFELAVPSMTVGLS
                     ARCLDDLMYLWQVYTASIDPEAYFEVTTAKRAQSKTSSTAGSTSASSPPSALTHSGAS
                     ASAATAGELTGEYSTASVAGDAPPLPDLSTTVAPCGGDPSHQQASDSPARLVQLISSW
                     WSGKAAPKVEHPDDVPKYSNPDILDHSPYNYTVRSRRGHIADIDVGWCDYNAEAAMAD
                     DLNQPSQPGFLRRFFTGAQSYEAPKVELAVGYPAEWIDQYCTNKYTSSAEFHQRITDA
                     VSMYSALHYNQKLEIVPLAFDFSVEEVMEAVTIISRYELARAFERLVAPATAPAQADK
                     DAKSGAAHELSGSGDNGKDNSTVSSPSKGLQLPVVPGVEPIALSGGDASATNGPHLLV
                     GLSGAPEDLPASLVDSVQAGQKLSICDYHRALRVRDDVVRSTEEQFMDVDCFVTPLLC
                     DPYTSGDVRSARLMLPFQLAGNPILSLQMDPQTPVAMVGELGRDAALMEDAFCFLQFV
                     RGASPSLWREVVGESPAAAPGADGGGRAGAAGISTQSRLAGSTAFTT"
     gene            <497329..>498342
                     /locus_tag="LMJF_17_1010"
                     /db_xref="GeneID:5650832"
     mRNA            <497329..>498342
                     /locus_tag="LMJF_17_1010"
                     /product="hydrolase, alpha/beta fold family-like protein"
                     /transcript_id="XM_001682306.1"
                     /db_xref="GeneID:5650832"
     CDS             497329..498342
                     /locus_tag="LMJF_17_1010"
                     /codon_start=1
                     /product="hydrolase, alpha/beta fold family-like protein"
                     /protein_id="XP_001682358.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650832"
                     /db_xref="GOA:Q4QE90"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q4QE90"
                     /translation="MLSPEVTELNEADDMPRELRGKGKPMPCDKFVKVCRCPSTRKEV
                     IICYRTLGDPSDPCLLLVIGLGGTMVHWPPEFLSELLKNGFFLVMLDNRDSGLSTHFD
                     GYPTPFLPCMIFQSWSPLCGGAPPYTLYDMAHDAWCLLTVLGIRRAHLLGTSMGGMIV
                     QCMAIQHPERVCSLTICYSHSSGPYVKPQACRVTLALLDKPASLSLKDVEDYVVRSDC
                     LFRGDYLLDEKHVREVAVANFTRSPPYKQGLLRHVWAVQRATNREPALRRLRCFPVLV
                     IHGRKDLMIPYENGLRLACVLWNAKLVLFPHMGHSIPRPLYVEIALEVGLQKLRIVEK
                     VPR"
     gene            <500526..>502442
                     /locus_tag="LMJF_17_1020"
                     /db_xref="GeneID:5650833"
     mRNA            <500526..>502442
                     /locus_tag="LMJF_17_1020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682307.1"
                     /db_xref="GeneID:5650833"
     CDS             500526..502442
                     /locus_tag="LMJF_17_1020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682359.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650833"
                     /db_xref="InterPro:IPR021067"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q4QE89"
                     /translation="MPDYGQVPSLLKRPLRVPRRRLSTRRRQILIAFVAILCLCGLLF
                     MHFFSTSSSTAPSELSDLRDKPWITSDENLTRFENIVEGRTPGTAWRDPRFNMIVSFS
                     KSGNVVHVTPTNYVRHRRGSDDSPGAFRKWESIYQASDKYRIPAWATPADRDALHHAS
                     IFTSLAAFRDHECALTLRNLFDMAVAPHRLYIGVSEERSPSDASCLSSIGVDNLASGE
                     TRRVLYGLDAPRTLGVEVRSLTWADVVAPRQLLDVDAVLSVPTDSAAGYGAQPAGVFL
                     HPAYAGERVTCVAGELETARDRLLLAEDDVRQGMDGGSVFRRGRGGPQQQPSRALAGC
                     RVTTRVAEPASARGPTFGRYITSLFFFDQDYYMVVDSHTRFSVDWDMKLITRVFQLPT
                     RGVLSHYPNGYREGHDREEFDKETVMLMCTAQVLSNGMPKLGARWMSLSPHPVLQGFA
                     AAGFMFGDAQFMLDTPFDPFLPYMFDGEEVLYSARMWTAGWDLYGPGQSDVFHHYGRP
                     STPKYFGIMTPKEAARRVLSEQRTLYMLRRAHPWIEVLVRRGYVSANGQLTLKPLPPV
                     EAPETRLIVTEEVAAETREISVWATYYGMGRERSVSAYWQHTELSDVFVKVKDEENRW
                     MGGVGLCHKGGALS"
     gene            <505442..>507910
                     /locus_tag="LMJF_17_1030"
                     /db_xref="GeneID:5650834"
     mRNA            <505442..>507910
                     /locus_tag="LMJF_17_1030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682308.1"
                     /db_xref="GeneID:5650834"
     CDS             505442..507910
                     /locus_tag="LMJF_17_1030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682360.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650834"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QE88"
                     /translation="MYGGYYVMGSGMHQGGGYGGGPMMQQQQCQHPQLQQNVQQPPPP
                     PHVQARLRSSGRGGVPPGQPSAVAGGGSPGQLNRNPSFMMMYNDRNFGQANPMLQRMG
                     SFNSMGSIGVIPRFGSFSAHGCGGSQPQRHGSFSSVGTSAGSLRRVNSGVNFDFSTGS
                     QVRRGGPLMRTNSYGSMHQGGGSFFGGSAAPSGGGRPLQQLSRQNSALCSYSYGSFRQ
                     PSFTQGNVHNGATGVGPGVSLNSIHGMFKLADSGCSGAGSPSTAAAPHGDIGATVAAG
                     APLESPALSLARQDSARLLQRKYSISGQFYNYGNSNNNDGGVDQCAAAPVLQHRLSQL
                     LPGGGPMMGGGGGTMALNALTATVGQRGGAGVMTQQRQHYMMMQQQARMRAAGDSSGV
                     TASDAPPSKGTSENTTVAEGQPQVLGRKNSVQNLTRKSSEKRVGMYFKNRAAEQDGMQ
                     YKKDGDPGTSGKSNSGERNPSLTNTLKASLLLDTSGGRSPAIEVDGRTIRASKPGAEE
                     VQKYDMRDIMYVNRNTDVQLSSDSLEEMRDNFLYGCNVGMIMADAGFSAARPTEWFTW
                     LALKSVVKGSFGKLASTQFEFTVSVCLLQDDQVMDLLSDPPQRFMNLTVAESPLFGNV
                     ANGMVYVCVEDAGEFNDVLDASLHRAQEHCSPLAEEQGIVLCTCVLKQVKTSQSSGKE
                     DVIVSSIFASGVGDGVIHYNRIIDKNPAEPRALFYSVMHRSVHSTALFSCAMHDDEIF
                     NYLATLQRFSKIETRRPKVGSARAFVAYGTSTIPRIREELEETKDVRQRAMMQRQLEK
                     LELMVMDAEDMLQSPADCVPKTYI"
     gene            <513677..>514975
                     /locus_tag="LMJF_17_1040"
                     /db_xref="GeneID:5650835"
     mRNA            <513677..>514975
                     /locus_tag="LMJF_17_1040"
                     /product="hydrolase-like protein"
                     /transcript_id="XM_001682309.1"
                     /db_xref="GeneID:5650835"
     CDS             513677..514975
                     /locus_tag="LMJF_17_1040"
                     /codon_start=1
                     /product="hydrolase-like protein"
                     /protein_id="XP_001682361.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650835"
                     /db_xref="GOA:Q4QE87"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q4QE87"
                     /translation="MPDPAAPSTLSPPQRTAVLRPRDQLAEVGRCHSTGRTIRLCYNT
                     FGAAKNPCVLLVMGLASPGLFWDDRLCTLLAHSGPYHVIRFDNRDVGCSTHLDDCKGG
                     DGVLPVGPTSYLRYANAALRPGARSIREVYTLDDMAADAFGLLDALRIRFVHLVGSSV
                     GGMIAQCMVLAHPERVLSLTLMSTHSSSPHAQWPGIRDIMSFISLAPKSTSARYASRI
                     ARATSAEERQRLCAERDAKRVTAYASSFAKVLERMSGDQSKYPFDHVAAQRQMTRIFK
                     RSLCVTGGPRQFLALLNAPCRDDALRQRITSVAPMSQSKAGGDVENISRHATSAIKTP
                     FYVPTIIIQGDCDPLVPASNARHLASVIAGSRLYVVEGMGHTLIPALRDTYIQLIRDN
                     VRAGEAAAQSLGRKSQRTTAAAADGGLFAKKQPVKAASRL"
     gene            <515809..>516981
                     /locus_tag="LMJF_17_1050"
                     /db_xref="GeneID:5650836"
     mRNA            <515809..>516981
                     /locus_tag="LMJF_17_1050"
                     /product="hydrolase-like protein"
                     /transcript_id="XM_001682310.1"
                     /db_xref="GeneID:5650836"
     CDS             515809..516981
                     /locus_tag="LMJF_17_1050"
                     /codon_start=1
                     /product="hydrolase-like protein"
                     /protein_id="XP_001682362.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650836"
                     /db_xref="GOA:Q4QE86"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q4QE86"
                     /translation="MLQHNDGGDVVVNAGSTSPHPQTATKQPTIPEDMDLPPAIFEEL
                     RRIFPHPPDDAFVSVGRCASTGKDITLCYSAFGDPSDPCILLIMGMNVTSLLWDTRFC
                     GYLAAAGFYVIRYDNRDVGLSTHFDEYPSPFILRMALPAWASIGEGSLAYTLEDMAED
                     AAGLLKALKISQAHIVGCSMGGMIAQLLTLRHPDMVASLCLHSTSAGPVWPRASLLMN
                     ILDQPESTRDVHSVLDYRVRFFKAVAGDMTFHEHEFRLGMWFDFARAPYQGGGRRHLA
                     AIVRSKDRSAALKAHINRLTSTTASGSERGSSSLPASGTAPSRCIPVVVLHGGKDPLV
                     VLSNAQHLASCINGARLVVFPKMGHYFSKEMYRAIADEIILNARTDATAIVNAFPS"
     gene            <521121..>523271
                     /locus_tag="LMJF_17_1060"
                     /db_xref="GeneID:5650837"
     mRNA            <521121..>523271
                     /locus_tag="LMJF_17_1060"
                     /product="hydrolase-like protein"
                     /transcript_id="XM_001682311.1"
                     /db_xref="GeneID:5650837"
     CDS             521121..523271
                     /locus_tag="LMJF_17_1060"
                     /codon_start=1
                     /product="hydrolase-like protein"
                     /protein_id="XP_001682363.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650837"
                     /db_xref="GOA:Q4QE85"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q4QE85"
                     /translation="MVVRVRDCPASQMQIDICYQCFGNPDDGLPAVLLIGGLNMQLTA
                     WDESFCESLVYAGFYVIRYDNRDIGYSTKIENCGKIKAPMLLLPGRAAKWLGEELPYQ
                     LEDMAADAWALLDALHIPCAHLFGISMGGMIAQLAALQAPERTMSLTSVMSSTNAPDL
                     PEPELWVKLWMLRWPPRNCTVDELLEFRVHSLRHLLRYALPPDGEYLKRRFLMSLRRS
                     SYADGLVRQAAAIRRAAGRDALLQQLHVPALVVHGVHDVVVPPMNGYRTATMLPYARL
                     LVLKSMGHYFHPAFFSTIIAVFVDMAASTDPAKRHLRPVLPITSGDSADDRGAGGKSA
                     SVEELGACDYEDEPSGEPGDAIDPKTRMMASLGEYIVPVVADAESPIGKAVCRSVMVA
                     IPGGNSNPAVPEAVIVENLFQRDPYAAVSVPTPAIAKRPVPSSSPQSAKQRAAPAVST
                     GDGLMIASLRDARRKVQRSSSRAAKLRSSPPPSRMEGAKPFVSCSPSRWHELEPFPQR
                     RAAAAAVGGAGISELSRGGRPSAEKTATGFPGSFSSASSSVAALAVETPACSAVKAAE
                     AAEAPLWHRLPRFHPVVAGVTVEEYLRTHPTAPKGSGIIPATAAGSTAVAGAGRASET
                     AAAVQANDDATLSVSAANGAVAPRDAALAASPMAPTVAVTGGGAVTVKAAHDESPSLS
                     PASRVSSEERRADEAFLHSEAPQDVVKASSFTSL"
     gene            <525246..>526832
                     /locus_tag="LMJF_17_1070"
                     /db_xref="GeneID:5650838"
     mRNA            <525246..>526832
                     /locus_tag="LMJF_17_1070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682312.1"
                     /db_xref="GeneID:5650838"
     CDS             525246..526832
                     /locus_tag="LMJF_17_1070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682364.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650838"
                     /db_xref="UniProtKB/TrEMBL:Q4QE84"
                     /translation="MPVTPLSDTRVRHDTDVEGTPLIAPLVNVNGRPATPEHNQERQQ
                     RPYHTGDPQSTSQDAGAAAAAMPDTPDQRQLSQMQYPGLHLEQRPGRFLTSTHNTDAT
                     MPRMTDHTFVSAEFSAMQLLPARQVESPSRDSEAGGGVGRTGPEAYPQQWASRNAESE
                     AGSGWHDIAHLTSLFRAIPPATSPSLMGAALLQQVRIATAEERRVRLLFHTRPRIRLR
                     ERPRMVMNPVLDRPGWVQSLCYPVLCIPCMRNTIYSTPLSTVMRASCETDFFGSAQPS
                     VAFLASETSVLPGEQPRPDFSGAAHGGSRALGAPLTTAMPTAPAFYHVPITAPRLAQS
                     SAYHRRADSELLLHRMPLPPPLNPLSGIGERAAANSHRELLISSIETPSWPVRFAHNC
                     SHLMYRCFCVRCAIASQMQALQVDADIRGAKMTLFPLCTCLGAASKSHTEILSTLCLL
                     DFLTLGAPFGCCCYHGLGSAFYGWHLRYMLRARYRIFAWTSIDLLIMCCIPGLALDQQ
                     GAELLLNGTPEATVGLQFMA"
     gene            <529047..>531269
                     /locus_tag="LMJF_17_1080"
                     /db_xref="GeneID:5650839"
     mRNA            <529047..>531269
                     /locus_tag="LMJF_17_1080"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682313.1"
                     /db_xref="GeneID:5650839"
     CDS             529047..531269
                     /locus_tag="LMJF_17_1080"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682365.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650839"
                     /db_xref="UniProtKB/TrEMBL:Q4QE83"
                     /translation="MLFSATRQLRALRAKQHATRAVVEEQMAAYEAARYAYEAAQRQE
                     AELRAMLRAAEARTAQLLRDFDDAEAQLRNTTTDLSHTQSLCHSLESRIAEHVRCQRS
                     AVLLLAPPSSSMSQSSAPPRLCHMDPYSLLHTPTGEAFTYDLVELSSCASADQAVGMF
                     IRGESDDGSETEGRSDAEVVGNNDEGDDIDAEANQLPSSPSITSLLTEAVRDALHGYH
                     YTLLCTSSGGCRLCAQDENLTNKVCPATTPLTSDTPAAACGQPRKHRWTCQPASLCLR
                     LLQLLQREAARSGTRALSITIAAGCVGEREAARIHGPGVTTRTASAEASDRAAAACGW
                     TDLLLSAAARHQQVTVSMEAAPSQEREETALPSMTSDVRDMRGTSGSSAGAGSWLDDG
                     CTRPNDRQSLLLSTPSAAAAKGVPLTTHTPTLEGVPVGSIEAAAFWLREVGLLSTPDT
                     SNIPKDRVALRSSTATSTGHVDAQATTAASSVVVLLVGVDSQDATGKLHRSLLRIVSD
                     AHFDLGCLAHARPLLKSGRGGINVDPPACCSPSTFALYMSHVLGAVARAAAAKTPDAP
                     DTGRCGTLVSGEHDGTAASSPVPMLLLQRAEVAPLAACEIRATAQSISLQCPAEVCAI
                     WTAARRHASSRSQLDAAWSLWAALLRPVFGGNSKALWLHCTSGGGRGGGSRGTDGSVG
                     FHDSTESASRPDDLPSPPVPCDDAAVLRLSSLFCRLVRHDAVASEVSPDLARLVRVCL
                     "
     gene            <532905..>536837
                     /locus_tag="LMJF_17_1090"
                     /db_xref="GeneID:5650840"
     mRNA            <532905..>536837
                     /locus_tag="LMJF_17_1090"
                     /product="putative ubiquitin hydrolase"
                     /transcript_id="XM_001682314.1"
                     /db_xref="GeneID:5650840"
     CDS             532905..536837
                     /locus_tag="LMJF_17_1090"
                     /codon_start=1
                     /product="putative ubiquitin hydrolase"
                     /protein_id="XP_001682366.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650840"
                     /db_xref="GOA:Q4QE82"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:Q4QE82"
                     /translation="MSHGRRMLEAQAQKERTSGTSEDCRLDDGHLRNGSRAFNDDGTP
                     VRPSRGGARPSGSDRGRDDGHDDTALVSPPPRPSVRLGFGRAGDGSASASSVATAAGS
                     ALGATVAETANRQQRISGIGPSPAAPFSCARLAVPRRLQSSDAAEGVRVSAARHIDVD
                     AEEGENDDNVRKMRGTLAEAATRGSPRRKGGGGRDDSLAGGDSAQRCMSSEARSRSRT
                     GGSGHSSASGLRYPVSRVNASASTATLSAAPHDLPSPLDRSRTGSRSPPPMTALQKAS
                     ASTSLFRQPRATPLPAPITAAVLRPSNTESRASPTPDTGTATAVTHAARQPPPLRQES
                     SSRSAGGPGFTTAMAPAAKTPPLQMLISPASPPLRAGVSPRMLPLHPTRADASTASMF
                     LSRAASASTVTTTVATTPSSSQAQLPPPVGSQVSPYELQQHQPYPMPPTPSSTAAAVM
                     PSRFVVHHDIGDLAGDAAGEDRAATEAEPYTLLRSTKPLSQKSEPAEATTAGPGWQSA
                     PPSPLPTSAELLARPRLPLLPEATVPYDEVGITPLANRVDRRIYPFMRDFSGFHNTGN
                     DCYGCSLLTMLLRSEVFRRALHASPLVCAMRRYEALLTGKVERRVLWTSGYVNAAAET
                     KAKKTAARKRARAAGWSADASDDGRQTEEASVAGVCGLPDTTPRAPAETLAHAQYVWR
                     PTADVQHTLDVLDTFSLSELEDVLEVDLEAQCVPATLHGALAALARAQRWREHMTTLV
                     NMPQMQAAERQRLLEAKIYHDNDRDFDGQVYTYGIRLNAVANLFDGEFFLGDQEDAHE
                     LFVSVMAKLETEAVKFQHRCDEVLERRSSVTPTEGSNAEDEVDEEVESGEGRPDNEEG
                     ASFAEKRLLHGARASSASSMSPSDVPAAASPPKQRRLSVSTTAGEVWINTLVQTRLLN
                     IIRCRTGECRHEIVTDEVCVNLSVHIPEAPLTSPPPAPPLPPRSCFPAQPPPLSPTPI
                     VPSSSIAASVAAPLPAVDGEGGRGCSLANLLHDSMAYEALSEYRCDCCGSRTSQFQGG
                     CFYTRPPPLLVLQLKRFATQFVNGTIIIQKNSRRVAVEDKLVIHALPSAGEWHAGQRR
                     RERQHRCSLDPVEPIEVTEAVEDAREGAGCCPYYDPDKKCFSAALQEACDVSGGGGLA
                     GRDGLKDEKHDGTGDDFLTTLAAAAPPSSLVRAIRCLYRLRSCVLHLGQSLHYGHYVS
                     DFAVDGEEDGDDGETARTCCTAEQEAGVSSTSQATLNSCSAARRRWRRANDERVEVLS
                     DEVVQARRAGCSDTYLLLYERVEEERVWCPVEAVLPTPVYRSSEGDKT"
     gene            <537743..>539374
                     /locus_tag="LMJF_17_1100"
                     /db_xref="GeneID:5650841"
     mRNA            <537743..>539374
                     /locus_tag="LMJF_17_1100"
                     /product="3-oxo-5-alpha-steroid 4-dehydrogenase-like
                     protein"
                     /transcript_id="XM_001682315.1"
                     /db_xref="GeneID:5650841"
     CDS             537743..539374
                     /locus_tag="LMJF_17_1100"
                     /EC_number="1.3.99.5"
                     /codon_start=1
                     /product="3-oxo-5-alpha-steroid 4-dehydrogenase-like
                     protein"
                     /protein_id="XP_001682367.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650841"
                     /db_xref="GOA:Q4QE81"
                     /db_xref="InterPro:IPR001104"
                     /db_xref="UniProtKB/TrEMBL:Q4QE81"
                     /translation="MSADARIAIIAVVHLALTWVLLRYIADSAMPFYVYREDSSSAGA
                     AHGASVHTAATHEWDLWPPFLVPSQEAYVAQLARQQRATSAADAVALNSRVVWRSSAF
                     HLTLAIFTYALLRFGVTAPYGRHSWSLGFQLTLPSRVSWMLQESPTIFQVLYHAFLEY
                     PRLMGHSPSQPSLWPASSSASGPTGAGMPSSHSSADTCHSYWGCVRVACTQQHLGLLL
                     FVIHYVHRSWLYPLSIPATARDVPLVVTGMATLYCLFNGRLQVLASAGAAATACAADT
                     AARSSACTPAYTASMNLVRCWRERHALQSLSSPSSASTSVGAAAVRVGWWLLLGLYAL
                     GVLGGSALFFLGQRINMQADYYLVRLRRGDKGSISHGGIKPVGRRAVNVHGDALASSS
                     SSEASRAAQHRSSVDGYRIPVGGWFDSVSCANFFGELVEWTGYVIVVAATSAASNGSC
                     LSVTTALEEELLRPLSSSSWWSLMNPIMWLRLVARVFFSGSESRPAALAAFSFLVYVF
                     SNLAPRAVAHHAWYARTFGDLYTRLGRQALIPGVY"
     gene            <540178..>544470
                     /locus_tag="LMJF_17_1110"
                     /db_xref="GeneID:5650842"
     mRNA            <540178..>544470
                     /locus_tag="LMJF_17_1110"
                     /product="putative kinesin"
                     /transcript_id="XM_001682316.1"
                     /db_xref="GeneID:5650842"
     CDS             540178..544470
                     /locus_tag="LMJF_17_1110"
                     /EC_number="3.6.4.4"
                     /codon_start=1
                     /product="putative kinesin"
                     /protein_id="XP_001682368.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650842"
                     /db_xref="GOA:Q4QE80"
                     /db_xref="InterPro:IPR000225"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR022682"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q4QE80"
                     /translation="MSTAVVSRPRVYVRIRPLNDREVRDGKGELACRGDTRQQDLLFL
                     KKDETLEQQVRFDQVFDQRSNQQLVFDHIGPEILRTLFSGYNASVFAYGQTGSGKTYT
                     MEGDKGGGVSGGASSEEQEGLIPRIIRGIFSSFKSNADITDALVEVSLVQIYQERIQD
                     LLNHRKQVEIHMDRTSQYVARDATWRTVRSLEECMKLYGEACKMRATSATEMNLVSSR
                     SHMILMLRMQWDEPALPGSHAQLNMIDLAGSERLSESGATGESMKETITINKSLSALG
                     NVVVKLVEQAKKPNKRIHIPYKDSKLTYLLQSSLGGANLVHFMLAVSGSAMWRSETTS
                     TIEFGKRALQLVLRPVRNAIDYTRLAEMEAMIERMRSHIESLEEELQLKRNFEAAGFL
                     QLRQIAQSDDDPVQRRRRHETSTNHKHLKRQTELTRIMANLPETFDDLTSHCVLFPES
                     KVTFRELGGLEKLIYFVEKCASNYYRASAAQTIASVIDEPGREVFASLGGLNALAVLL
                     RVQEERCKEAACVALEAVCRGCVTNKRSLSTDVYAELVDLVYGYSNQQVQEAACAAVA
                     SIVDGYAEATRRFERLDVVPKLLETIRTCPAEVVNLTKAATNCVGRLAHGDKDMQQTI
                     ASLGGVDLLIDVLFSSSGDRDHQVPILASYALVNLCCSSHENLKMAMEHSRYGEVKFR
                     LLEGLARAFGTNASREGFGRATAQETAGPFPYYGVTIQDEWTYASSGGRPIFSTFMDN
                     PQFHLYVREETDIAFIIQDTLYEARMRKKRRNNSVYMGIAIFEGEPTLAKLGLKQLDF
                     HGKMIEIGHYTSNCENVLHCTLPASDTPYMVVPFTSQKGRRTHFALSAFGNHPIELTS
                     VPDQVGWVHTVLQGKWTEFTGRGGEAFDWRCNPQIRLKTKEACRVVFVLSYLSLDEQR
                     AQLLQEEEEREGQNTRPRLHGRLFSNAFAAHKRYLKAIVPLPQGSTFVASNTFASNSY
                     ITTSANLDRSGDYAYIPFTEAPFQDTYRVSVYCDSDDVEIKPMQGQSSEWMCASLSGV
                     WQGKPVSIDLDTIGKLVAVMYSPGAFVRPRLLSGSNQKRIAGIDSYWNTEATVEYDSD
                     GQLTLQVEAMMRSGTPGAAAARGNTQSATNQVTQVPATDIKFDLFIFTDRKCTLTRVG
                     FDASPSSWPCPTQSTSLALLAYPQLVEDVDAIGGDDEDNSDSLASELCRDDSDSISAA
                     AQEARETELLRLLEKQEAANHILKLQLAQQARELEELRNGGASATTLSNSDGKRGSSV
                     KPSGTKTPKRTLSATMDGYAGFSEEGHRSRKEVGGDGSAQATLRNPSSGNTSGSAETK
                     GAAAKPPSTGLGQRDTNTNGAGAWGQKPLPLAGTTLPTNRSGMADNTASAAPSPQVKE
                     LVDYTLVKLIEMGKRAATSARLADKKEDRKWRAMLKDIEEVHQRLHDAFSIL"
     gene            <546747..>547103
                     /locus_tag="LMJF_17_1120"
                     /db_xref="GeneID:5650843"
     mRNA            <546747..>547103
                     /locus_tag="LMJF_17_1120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682317.1"
                     /db_xref="GeneID:5650843"
     CDS             546747..547103
                     /locus_tag="LMJF_17_1120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682369.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650843"
                     /db_xref="UniProtKB/TrEMBL:Q4QE79"
                     /translation="MLRSLHRTAPLAVTATTTTLSASAVPLALQTAARTKYVRQPSAQ
                     WDPVHEDINAHVKRRIPGETRVDRVRRFAREWRNVELELGVYKDSRGREIKYRKTFVY
                     RYTYPNAFDEFWWPCK"
     gene            <548202..>551846
                     /locus_tag="LMJF_17_1130"
                     /db_xref="GeneID:5650844"
     mRNA            <548202..>551846
                     /locus_tag="LMJF_17_1130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682318.1"
                     /db_xref="GeneID:5650844"
     CDS             548202..551846
                     /locus_tag="LMJF_17_1130"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682370.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650844"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="InterPro:IPR023267"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4QE78"
                     /translation="MRLWASPPSLPPPPFFPSQLQQPLLPAAAATAMMRPTRRAFFDS
                     FRAARGELDHLFSSMKSEQHMRKAVRQYLIPSLSRRLHRSSGGRLGRAQERSLFRTNA
                     SLLLQEARRRCNHRVAAAALDVVLAESQLSHFAQLFEPTWIKDAVSSCRSAAELRVIE
                     GVLRQHERRVLASGSAATSEGFLLAAAFGRSRATESALRLGDDDADADADAGADADDG
                     AQGGSLASTRTASLQATGDTLASRGPAEGSGAGVTISKEARVSAALAQLPSLTDLATT
                     GGTGSDALWSSPEERAAAGLRGLQRQQRNLTAGPNVSFTRYFLHQGLVRHEGELMALY
                     QAMRARPLDVSFRVVGGGDAASEAAQSPRLLSPHASAVHTLLQRRRGLHRVPWLPPAM
                     GAYTLDTRASIPADTVLANRQLLRSLARERLIVYQSLPSMLPIYYLDPQPGECVLDMC
                     ASPGNKTALILDCMHADGNHHAHWPSSTTSEAGVTACETGRRALVGSGCVVANEAQAS
                     RISDLQERLRNVSPEVVVTQGRGQALGLGDWHEGSSSNGGVCGGGDESPLAHGAVLVE
                     GLYDRVLVDAPCSGEGRMGRDALSWRLWHPGRGIEFFPLQCALLQRAVRLCKTGGRIV
                     YATCTLNPLENEAVVAAVLRACGGAVELIPPPRPLPRRTELQTEEDGGGSVPPLRLTA
                     GLRSWDVPSGAGGFLCSATEAYAQGESAARLPPDMFAPASAGADGDRTDISGALQRCC
                     RRVMPHLNGNADGFFVAVLEKRAGVPHMLGTAESRSLVAPPSRLDPAPATAVRPTSTA
                     AASLAVSLAGGSNILNDRGFVRLPPSHHLVLKHLGGFFTSAPPRQASAPATASSCMAA
                     QPQQGECASVQAFLEGHGWTAVWCEGEGLRLLSQATVQLLRRHSTVPVALPKGRSNSS
                     ALGFARHPEEASKASPAPPSTGTELLDAGVLVVGAQGELTERGAALIRPSARSRVVSL
                     PLPLAQLLLANRTLDVGASLQLMPAYVQEADQALGPQHGFLAPSSAAMRGRDEPASSE
                     AHASTWYREALAALTPALSGGAGAAGNAIVVVRVSSSGPSASPSWAAPLALWAWPVRV
                     EVIQPWSWHDIGDTPRGLARLHLTLPTAARHRTQALIGRLQGHAHRQRSTQERLQASS
                     RHDPSLMMGQQALHGSAMQASQQHRLLFGGAAQASALRARPTEALPARDSTMTTPATP
                     LSQSLDVFEL"
     gene            <555288..>559484
                     /locus_tag="LMJF_17_1140"
                     /db_xref="GeneID:5650845"
     mRNA            <555288..>559484
                     /locus_tag="LMJF_17_1140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682319.1"
                     /db_xref="GeneID:5650845"
     CDS             555288..559484
                     /locus_tag="LMJF_17_1140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682371.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650845"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="UniProtKB/TrEMBL:Q4QE77"
                     /translation="MNEIPSSGEVFRGEDGTVSTILPSNYGQDYEASEGELEEYAEYI
                     GIDSAKEPELMWIAKEGLRAALPDGWRACQTDENEVYYFNFQTGESLWDHPMDEHFKA
                     QVVSERAKRGGGGSSVGAAAGGPLHADRTAAGTGSTKAIADSFFSKPSAAISSNRAPG
                     SLADIGGGGVAAATTGTATAKDSRTPGSSMKDGASAPRAPPDVSDILALSSATSHFPS
                     LGASRATANAGLSRMKEREAALRKRLEEGNEAQLRALRIELDKKAGAERQRLTEARAK
                     LQKDLDAAWEQERSCAAGDTVAASSVASAATQRRLQIAREVKQIEESWKARLHDVGAR
                     VRELQQQVEEKQQTLLKAFQQSPEELRKMLEARNAAEVAQLREAKKKENDIALVHLKS
                     EQASALAEARLRANDAVATAAKATEAEFEQKVQERRVRNGAMLASLKAVVETKQADLA
                     AKEKASAAASSATTPSTTAAAAAAGASSGAEEAALAAAQAAADAEVVKAREASAAAVA
                     RLREEYAAKKREKEASLKAAQPPPLSRSSLTSSAISSPTVGLSSPADSFSARGIGAAE
                     QAKLDEEDQKLRDEADRAARIFEEETQIMVENKKAGRPLTAAPSADVAASVSAEAIAA
                     LGRTANQEQRAREAENTRHFMVMKQLEAKHDQAVRALKAQLDKNLASPTSSSAPRVFN
                     PHQQPSFVTQLAARKREWLRDHPAPSAEMPTLLPVPTLPGATLQSDVAAVRMPDEEEL
                     AKLIKTRLAQVREEAQRQYDQEAQALQATRQADLEAWRETYRSSRLVEVEKAMTALKE
                     AAAAAGASAGEGRRLEKLQSELQALEAAIKAADSEHERQTRALEESIAGLEASLAQLR
                     TQERREEEARAEQLHFQQRRLLPKGEHKSPSSAHAAAALPSRTSVPASSEAHISEEEA
                     ADEAAALRARWTALIKALRAAVQREMEAYQRALDESAAQHHTTSAAGAVGAHPAGTAA
                     AVVAANAGAPIHTVSTPRDRDPAACATSFLPPPAPSAMLTGSALPGRPAALQEQKPPQ
                     PTSSLPAIGITTANPSGYTTPLQRHPREHDDSGAGSTILGGAATRMSSSSPAPQLCLM
                     DSRLGAVSAHGDLPVQRPLHSSSLQPQSQPHRLWPDASVAPSSDAPMGVRSCHLDPHR
                     NTSVSSAAAPWTTVLGDAQGGGPLTCTSAASAQQVTEAPVDRSSYSGGPASGSASVDA
                     DGARARHHAARLAALQQTVRARRRDLQARRREMEALRDEWRADMRACKQQGDRMLACQ
                     LREVKTELEVRARELNEEVLQLKKMHETVHEEVRQFRRWLDVRQQPEGQMERGGGDSV
                     SSSAAWGGLAFTGSKLAYVCRGEGDRSPASSSEKTADVMGLLHNMVDRTERLEELLLM
                     SRLETHSPSTHHSGMRHSGR"
     gene            <561331..>564825
                     /locus_tag="LMJF_17_1150"
                     /db_xref="GeneID:5650846"
     mRNA            <561331..>564825
                     /locus_tag="LMJF_17_1150"
                     /product="putative 5'-3' exonuclease"
                     /transcript_id="XM_001682320.1"
                     /db_xref="GeneID:5650846"
     CDS             561331..564825
                     /locus_tag="LMJF_17_1150"
                     /EC_number="3.1.11.-"
                     /codon_start=1
                     /product="putative 5'-3' exonuclease"
                     /protein_id="XP_001682372.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650846"
                     /db_xref="GOA:Q4QE76"
                     /db_xref="InterPro:IPR001876"
                     /db_xref="InterPro:IPR004859"
                     /db_xref="InterPro:IPR027073"
                     /db_xref="UniProtKB/TrEMBL:Q4QE76"
                     /translation="MGVPKFAAWLARKYPSMVMDSCPGDVHGLYIDLNGLIHPCCHDE
                     HDPSVALRTQEEKLRSICLAIETLVVTVRPQRVIYIAIDGVVPRAKMNQQRARRYMSS
                     AAPLTDTDKPIHGGSHKMSATIVAAIEKEFTQAECDGVERELADVSQALMGDVLYGGC
                     ATMALAEDATEKAEAHTLAAAPWTIPPTLASEGKKDACCAAAQVGRQPAAAASPAKFD
                     SNCISPGTAFMDAVATAVRDYIRRKLAPKENDAGGKAEAEAGASPAAITATCAHWAGL
                     TVIFSDSNTAGEGEHKISDFLRTQSAFPGFNGSGCHVIAGLDADLIFLSLSLHIPRVV
                     ILRDHKRSSYEQALLPDTAGGTLVTKKVSPKAKPWQVRRPAVSSLSMSSIGSAATPTA
                     AAGDEVAIAGGTASMTAPSDDEADGCGPFWRSETPSSPASPATMAPATAPPQHIADMV
                     VEPSSGYEYFDVDVVGASVVSEVYQLCLENGMQLRGDPLECADNCVSANGFCFHRYKG
                     TSSREVDGGADVDGDRSGDAKAERSAAAKGGGKLGGTLDGRPKAPLPPFHPCTSTSNS
                     KIIDDFIALGVLLGNDFLPHLPSVYCGESAMDTLMDVYVRAVLPYGYLTGGEYDIQLL
                     QLERLLRAYAAVEAARFRQFAIQSGAMTLHDAATPELCSAADRRCWRDVYVRTTSLRD
                     EAGAQAACRSYVEGMRFVWRYYSSISLQVSWAWYYPFHHAPLALDIADFLRAQGPQVQ
                     TTLAAPKLEWQPPSPFCQLLCILPPPSRQLVPDALRATMASPPAELADTFPHRWVVDR
                     TGAYGKDHLVTVLLPFADVLRLQELVAAASGTYTEAEQQRNALRSGHLVFEGRPAQLA
                     QDSTDASTDATPTTATTGNFTDLAASERADPAPFPTPRRASPARKEPPVAGSAAAMLR
                     GYRIQGSGLSTLSAGETPADMRDCTAIVCSSLVEVVPPLSRPRTYSYTVPIPSLTVLP
                     DGSRLVAERRPQYVKGGRRPRDGSGAERPGRNARARAASNNAADARAVALAMLFGEFV
                     LCLVAMGILTAEATLWCALSTPSWSRHWPVLLQLCGIGAASVWLAFALGLAVAPKGRS
                     AGSGLHRHSIFTAFADWQCSACLSVNFSRNRRCFICCAPYDPHRCVALFSSRYPPELP
                     LMDPDHAAYAACYTITAV"
     gene            <567197..>569089
                     /gene="USP"
                     /locus_tag="LMJF_17_1160"
                     /db_xref="GeneID:5650847"
     mRNA            <567197..>569089
                     /gene="USP"
                     /locus_tag="LMJF_17_1160"
                     /product="UDP-sugar pyrophosphorylase"
                     /transcript_id="XM_001682321.1"
                     /db_xref="GeneID:5650847"
     CDS             567197..569089
                     /gene="USP"
                     /locus_tag="LMJF_17_1160"
                     /EC_number="2.7.7.64"
                     /codon_start=1
                     /product="UDP-sugar pyrophosphorylase"
                     /protein_id="XP_001682373.1"
                     /db_xref="GeneID:5650847"
                     /db_xref="GOA:Q4QE75"
                     /db_xref="InterPro:IPR002618"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q4QE75"
                     /translation="MTNPSNSNLQALREELCTPGLDQGHLFEGWPETVDECNERQIAL
                     LTDLYMFSNMYPGGVAQYIRNGHELLARESEEVDFAALEMPPLIFEAPSLHRRTAERT
                     ALENAGTAMLCKTVFVLVAGGLGERLGYSSIKVSLPVETATNTTYLAYYLRWAQRVGG
                     KEVPFVIMTSDDTHDRTLQLLRELQLEVPNLHVLKQGQVFCFADSAAHLALDETGKLL
                     RKPHGHGDVHSLIYNATVKRDVVPDSGDGTATAQPLVNDWLAAGYESIVFIQDTNAGA
                     TITIPISLALSAEHSLDMNFTCIPRVPKEPIGLLCRTKKNSGDPWLVANVEYNVFAEV
                     SRALNKDGGDEVSDPTGFSPFPGSVNTLVFKLSSYVDRLRESHGIVPEFINPKYSDET
                     RRSFKKPARIESLMQDIALLFSEDDYRVGGTVFERFSYQPVKNSLEEAAGLVAQGNGA
                     YCAATGEAAFYELQRRRLKAIGLPLFYSSQPEVTVAKDAFGVRLFPIIVLDTMCASSG
                     SLDDLARVFPTPEKVHIDQHSTLIVEGRVIIESLELYGALTIRGPTDSMALPHVVRNA
                     VVRNAGWSVHAILSLCAGRDSRLSEVDRIRGFVLKKTAMAVMDCNTKGESEAGAPSGA
                     ADPAKL"
     gene            <570322..>572139
                     /locus_tag="LMJF_17_1170"
                     /db_xref="GeneID:5650848"
     mRNA            <570322..>572139
                     /locus_tag="LMJF_17_1170"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682322.1"
                     /db_xref="GeneID:5650848"
     CDS             570322..572139
                     /locus_tag="LMJF_17_1170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682374.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650848"
                     /db_xref="UniProtKB/TrEMBL:Q4QE74"
                     /translation="MQVTLTTTVKAVLQQVQETVERCMCASVCAGYTHGHHHEISGGD
                     SAPCSLVRPTSLLGRSGGKDYSSGSVVDGAHAADPSTSRTPHLTDCVHEAELCLCLQD
                     KDGEYRWVGGTQHFHKVAVLRAPFITEVCLRTHAVFEEERRQWRRKARQERTSVRSSS
                     SSSLSLTLASHASSMFPSLYRSAEDARNVSDSRERSDERSDQSAKSTHETRGGASVNA
                     PATSAATAAANKGHAAHTLTDQSFARKASRLKFAFLKGVVVPIVVLRQCNPQYAMGGK
                     HHPYGRTPRQYAEVRVPADMQAEPLDDSLRSSGTVAASGTAQVKSKESVAHAEVLPPR
                     VAPVSTSDRLSDTALRSPASPHSTSTPATRDTSAETPCLAAALMSTSSSSPSASSAST
                     LPSRSASLDQSCGAVEDAHGPRSHPSVFDTHQVHSYHSTAAAAARTATAAGPVGLVAH
                     ATTVERTSEASDPRATAATLRVRGTVKAQAGELVAREEAAVRSALAAAQQDYTAALAE
                     YKAVVACSSAKSTAVGECEVQPLQPAACADAELVALLQRRIELQRQLQVCREAEQQCE
                     RLTMLAERLEKEVREQEERRVPRMPLRHGDDSAAFVAGY"
     gene            <573118..>575955
                     /locus_tag="LMJF_17_1180"
                     /db_xref="GeneID:5650849"
     mRNA            <573118..>575955
                     /locus_tag="LMJF_17_1180"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682323.1"
                     /db_xref="GeneID:5650849"
     CDS             573118..575955
                     /locus_tag="LMJF_17_1180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682375.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650849"
                     /db_xref="UniProtKB/TrEMBL:Q4QE73"
                     /translation="MRSALSTTGTRHRHTRGPTSTTRITPLHMPSSRVHPDVRAMVVV
                     VDVARPLAQATVSSLPTTALAVERLEIDVDVVPCSTTVAALLTDVAVALQEMQLTMCV
                     SLQAAALASGRVLPPVAWIREAVGVNGSSGLDRRQRSWIPFLGRRYAEAVQHAPNSVD
                     SRHMPAAAPALSSSLVLRIGSDYVVEDTAGQLSPPTAVWSVVPQPMEAASSIAGKAPA
                     QAALPIASSLHLLTPDPASEGVAVEAHGALHAPLAALPSPSRGGAATVMPASSRVRGG
                     DLLPGSQTTVASAAVERAAADFSHDECLSMPSLTVGSTAPPPSPQPPLPQQQPPAPVL
                     SLKDADAVAFGHLQAHQAQILTRDAQRCDDSPNASTHVAAPAEGQRHLQRTLSWAAAE
                     TAVQAEVERLQAEHVLTGEQGEGGAATATRRGAGANLNDAARCATRDETAIHTAGRRD
                     GGSASDTLSPPRLRAPSLAAAREEIGAYERETAALRRATEKARQWRESTKQQLREEFA
                     RLEREAAERSAALAERDVLRRRVEQLEAQVAAAKAVEVALLATQGTAAVLPPASADAQ
                     RVKRGCRGTSGSAKSHRPYVTAAIAMPALECFSETSASEHGDSSEHSSPPLPPEPALP
                     PPPQAYRSAPRVNGYAAEFGMGAHCWSGRRVSLTHCDRAAAPTTSTAYPLPAAQRQPS
                     HSRSGFAMERSFLSPSLEAEVRAALESDDDDDTGSSVTDSRSNGTASTEATVEGGSGC
                     GCDTIAGKGAEAARQPPAVGTRRRGQRSTATASRTAGDASSELLRASWMTVDTAAPAA
                     AGAAVDATPFCTAARTASSPYPASPSATSPHPHRAGAAAFAVLPRPSGGGEGTTGHGV
                     GAYRQPRRGMAKVTATASGAGCSATAVHLRLADRHLARIALGDGDVTSSPMDVSSVRD
                     TSRRSLSRGGPPSRRLGHGYLSPSRCTTPSS"
     gene            <578018..>580171
                     /locus_tag="LMJF_17_1190"
                     /db_xref="GeneID:5650850"
     mRNA            <578018..>580171
                     /locus_tag="LMJF_17_1190"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682324.1"
                     /db_xref="GeneID:5650850"
     CDS             578018..580171
                     /locus_tag="LMJF_17_1190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682376.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650850"
                     /db_xref="UniProtKB/TrEMBL:Q4QE72"
                     /translation="MSGMCGAAATAAEELMAPLNSPPEREMTVPMHDISAGVGSGAAA
                     LPRNISSWELLDVEADGGPVAFSGSSPIQAGRRPTCVEVAVDHGDGGSHALQASAATE
                     EPKAVPGEPPVVLLQLFDTESRHTSGDTSSEHAPSGAPAPKGCGHHRSGVGKLAEAHH
                     SLTRSVSTVWSLLSTTSQAHLPVAHTGLCPVLGAMTTTTPKDACCLGIAVTEATSTGQ
                     AGAHEQHDDNINSLHASSGMAGTWRVDSLPSSLPLAPQSIGVSHSSYELATEQASHGT
                     CASSSAMPMGAATNAILIPRVVSVATTSLASDGEPCMGESRRAGVWTPILADTTPLSD
                     QAAVTSLTSTLPSPSHGAPVLSEDSLRRLGEEVAAREAQAAAAAMALEGQLEFDGSSS
                     MPPSPCPDPGASAGPRCACEQPAELLTWLMKPLASLCDHRPHPCTCEEDKEESDAANT
                     PDAGLAGSASAQSGQRDERRAAAWLSRRVSFISSSSLATSLLPSAMAKTTFPSAAAPA
                     TSAASSSIFTLESSLLWSQACIVCAGSSQRALKGLHQLCDYIWQDLKNHWYPQLRLVL
                     GDHSSARKIRYGHRARRRLKPKRTSGNGESATATSDAPTDTSTGVSSAASGAAAASPV
                     GAMRCRSVSSACFFNGDVRITSDSAAHPCMSWRDRAAAAATIHLHASNSNSTNSSGAS
                     SPLPAQATKEGMRLYAVMTAEAVASAAQGLLVFLL"
     gene            <584273..>586774
                     /locus_tag="LMJF_17_1200"
                     /db_xref="GeneID:5650851"
     mRNA            <584273..>586774
                     /locus_tag="LMJF_17_1200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682325.1"
                     /db_xref="GeneID:5650851"
     CDS             584273..586774
                     /locus_tag="LMJF_17_1200"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682377.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650851"
                     /db_xref="UniProtKB/TrEMBL:Q4QE71"
                     /translation="MRQEAHDRGGYDSGGSCCSAAGPGDAGRAAAAAAAKGSNPPEDL
                     AHVLDRPEHRSAAAGIAGGDAAPSSPSTSPLTGPPSGAPDSDYGEALSASEWGKHLHR
                     DDAARISTAVGQPQHFSPPPQAPLTAPHNDTQQQDQHPHLRQGHRDAASSSSRGGSSS
                     RYYANQRHLDGEHDAHHHHAHPRLSPDAVFKCGHDGAPFSQNSSFTTAAAASAPRRQS
                     ATDRVCRTSCSVSSIADLYGHADRTTSASRRFSLGRSSSTQSRKYIDSTLPSTAHRAG
                     ARQDRCGSITRVEASLVALQVELAAEKRNNIEAEHHITTLNREVKRLREENARLSREV
                     AVAATAAHGASAPPHSVAPGGGEDGAGAAFLSSTAHANSNAVAAERRIEALEARLGEL
                     SRNMETKQRELDTKDERIRLLEHKLADQLLLYSGMSYMEGMSTSPPQALQPAAMVRHN
                     SPTAPKHQQQRRPSRTRQKGSEKVSSVGAHASPSRLYWQAQAPDTTLAGPKVSAIRSV
                     SVRNLHVGRSDNGGSAGAWGEGAPTHAGPQPSAFSLRESQPNARVDRPLSATRNLRQQ
                     TPRTSSVRRRPYSTSSQPGSSDLSAGTRSAAGTHSSARRRCSRGAFGSVGHADGDDAV
                     GRTASGLEKAHPSDRSGPASSPRRPSVQRRTSSSSLRSARTATREDSQRASSRRNSAA
                     SPARRNSGSIAIGSHPMRLSVGASAGGDARVPSPGSPAYGRAQSIFLSNDSTARRGSA
                     TRSVAQQSVHSGTSTRSRPQITYSADNESATIKGSTTTVVFRSGNATNASVHSYYGGS
                     SYARDGAPLLPSRLTASGPVVASGDTGTGAAVDLP"
     gene            <588958..>590322
                     /locus_tag="LMJF_17_1210"
                     /db_xref="GeneID:5650852"
     mRNA            <588958..>590322
                     /locus_tag="LMJF_17_1210"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682326.1"
                     /db_xref="GeneID:5650852"
     CDS             588958..590322
                     /locus_tag="LMJF_17_1210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682378.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650852"
                     /db_xref="GOA:Q4QE70"
                     /db_xref="InterPro:IPR000535"
                     /db_xref="InterPro:IPR008962"
                     /db_xref="UniProtKB/TrEMBL:Q4QE70"
                     /translation="MESRYSLRNESLTEGLVLASSASKHDALFPQRRYGASKAHPQIK
                     IEPSCLVFPPPHFGRCIQNAISIYNVSKQPCVFKMRSQNPERYVAKPHVAIVAPESAT
                     RSFVTLRDMNTLGMKNLPEGTQDRFRFSLKLYNPTTVDPSLSPKDLWNLLTERGDKVD
                     HEQDLIAYFTKRDTPVGGLVTFFPPTYIPVIPPAVPKAAPPPNSATAPTSAHTSSSTA
                     TRVLNRDGSTVAQRKKAAGAAGGGATSHFLAASDAVKEWAKAAATMRGLWLGVFAAAL
                     IMLSVAVVTSRMWGAGDAAAGRMQATAASGCPAPQAHAMQAGRADYTVPAAPPPNHAE
                     PVTHYDVPAAKPVQTQQHPQHHGEHPNIHPKAASPIVGPPYAYHKAPPAQEEVHHNRH
                     EHWRHLEAPVEPAVAGPVHGTQAEQAAPQEQQWQERTLDYAQQQRESHSEQNRYQEGP
                     YARP"
     gene            <593304..>593639
                     /locus_tag="LMJF_17_1220"
                     /db_xref="GeneID:5650853"
     mRNA            <593304..>593639
                     /locus_tag="LMJF_17_1220"
                     /product="histone H2B"
                     /transcript_id="XM_001682327.1"
                     /db_xref="GeneID:5650853"
     CDS             593304..593639
                     /locus_tag="LMJF_17_1220"
                     /codon_start=1
                     /product="histone H2B"
                     /protein_id="XP_001682379.1"
                     /db_xref="GeneID:5650853"
                     /db_xref="GOA:Q9U8C0"
                     /db_xref="InterPro:IPR000558"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:Q9U8C0"
                     /translation="MATHRRPSSKPPHSHKSHRKPKRSWNTYVGRSLKAINAQMSMSH
                     HTMKIVNSYVNDVMERICTEAALIVRANKKSTLGAREVQTAVRIVLPVELAKHAMAEG
                     TKAVSKMSR"
     gene            <595523..>599791
                     /locus_tag="LMJF_17_1230"
                     /db_xref="GeneID:5650854"
     mRNA            <595523..>599791
                     /locus_tag="LMJF_17_1230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682328.1"
                     /db_xref="GeneID:5650854"
     CDS             595523..599791
                     /locus_tag="LMJF_17_1230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682380.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650854"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q4QE68"
                     /translation="MHTMQIPRVILRSVALDQNCAIAVTCIMLIISCILYPMTQTILC
                     TVLLFVLYGLCVLLQAYHFWARVTEMKYRTASVAREVLVRWWRRVQEMPLRRSQTAEE
                     RRRVFIESFSQLPASAFRMVAVVDERTGRLKHIHKSLMVKMSKRLDEVTLKVRSYLEP
                     TSICKLVDVMRITLECDAMVLKPLTDRARPPRLPNLLLSNKPFVEDEDTTDSSDHERE
                     SRTVLGGGNTITVSHHMEYFVHRVFLLVWAAVMVLTVGTGVMFCRFVRLPLGEGVFLD
                     PAVAALGLLPLNAIVLNRVLIFYANVYLDKLFHYMVSRRSYALEDRLPRFSFWSTLVT
                     MARVVCRMPPPNGGRNPLVFSTSLVDVFGMATVVSMLDQTGIVTDMVLVPKQVFLLKS
                     DPQQQQQQQSSSSGESGDDDDGTTIVKGCFSQRSERDARERRRDMHKLIKRKKYQERR
                     FLELRLMQSTRQDLAVEFADEKARHKHNSHLKPLCLAILVHALAREPTQLATWTEPFR
                     FCDRSLLWARAMHWIPRACGFHDRVTHNFLILARIFVISTSTGSGYCDAYPEQACSYL
                     VEGSDGALHLFTIGTPYLVCHHSTTHWTGTTIEEFDAHGKAEVLYMGKHQWEEGATLE
                     TVALSHRILPERYRRYVATLPRHAHHYNEFFFRNGVEVNSTTAKKAQMERRHRRQQRA
                     AAKAARSGVAALQPQVAPRPADSRQEPRGESGTSKCRVMRYNGGGADTDGGAPIPSVA
                     MQRERTETTVRAGDRKVDVEKEVGAVGVSDGSAMSSHDDDDEGGGDRDIAVAERDISG
                     RDGDRQHQPCGTPRRRCRSAPPVRSTRPANVQPPRNRSFGAAPTDVVGDIEGDDCITV
                     NTFIWLMATTSHTFLGLVGLQDSVRPNVQSTMSLLDESGVRCMYFCAGTERQTKSFGS
                     RVGLDTDWNCCISLKEDAVALDPHSIRAQLPFGIKSIRKHILHVDPIPLQVSLFSHAL
                     GVSKRAMLSVLQDNHEVVVAVGSVFNHSNVRSFVQADLSIGVLPTRRGTNADKEGALK
                     HTRVVEPSDFAAANSLNRDIPLYRNVAELIGCSCSLRAPPTTSILPIVAMMIRQARLR
                     LSGISNGAEFVMHANFFLVMVNTGSLIVGVPLLLTPSVTVFELYVLIPILALCCTYTA
                     YAGMDAMRVMPSRHNHFVRRAIFRHSAVVWCLRYAISVVVLLALGITASTKLCKVRVL
                     KLITMEEATCMSSGQGYVALTFNYWLMVHCWTHISRHHPISLTFSLKLEHGRRSTYLF
                     RSFRWVAASVLVTLLSIIIVVLDTPKAALHHAFFPSVPHFIVSLLFPVLILALDWPVK
                     RWRERRFTNMQKFRKLSYGTRLGMHSPRGDYEPEGITYTHTSTVGGAGREEAASAERV
                     GLLKRVSEWFYRFSSMRGGKLELNCVCCDHIGGNYATYHTTANV"
     gene            <600652..>603516
                     /locus_tag="LMJF_17_1240"
                     /db_xref="GeneID:5650855"
     mRNA            <600652..>603516
                     /locus_tag="LMJF_17_1240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682329.1"
                     /db_xref="GeneID:5650855"
     CDS             600652..603516
                     /locus_tag="LMJF_17_1240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682381.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650855"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q4QE67"
                     /translation="MELLLTLPSPLEGIERYIVSDRLQLTLEEAGELSSRYHAAVELH
                     LRSSSSREAVREEAAADGIVSALTFALRLFNAENFSGELTAAERARYGAVLNHFGGTL
                     PNGYEGPDGRNSDNEEEAAAPVATSPVAPSSATALTPAQRERLQGLFLQRLLTTDGEM
                     PVPAMRLPGLLLCIISIAKAELEPGVPLLPLTSPWRLRAFFRHQLCLSHRSNTVFLAL
                     AACVDAVLRLPSEEQTVEMLLEVGQVQRYYHRRDLAKATFEAAMRLSGLHVEETSMMG
                     VRTRWQQNQHVQMVLNATSSRPVPPQSMLEEQPKTIMAEKDGHDLLDRPRETPEAALQ
                     PLTPLHPEDKAILLALCMDIRNNNPDHGLTRHHMMTYIERLLADPAPSPFMVRCQTLL
                     MRARLESRRNRVQERAFMQLTELVEQYSARRDPTHEVFGRTASDYFYSVAFPPVWALK
                     REYADFCVEETLYKTALDVYEQILDWECIIECCKKLDKRRRAESLARQMLETDPLNPM
                     LWVALGEATRDDAHLWKAWELCGHKMAAPMRALARLALDREHYAKVVEYFDEAVRINP
                     VFGGDWFALGYASLRLGRLERSGEAFTRVCQIDPSDAFGWNNLASVMLRERKLRPSFN
                     AMSQAIRNNRRNWRMWQNYFRIGCELKEVVETTSALGIALDIAQRQIHLERDTLELFV
                     DNTVAYLKGEIHGSSLDAAETEGSKADALVYRSLGILPDENDIHHAPVAQTMATAEED
                     EEIADLMPLGADVESPEPVTGAAAAHTTKEHDAVLAGIRRRHADRVRALFARILELFV
                     SDPDIYACAAKLMHFLDGPMASFRYRQKELRACQQKEQWCREEALFSRTVECLEAMAS
                     DVFEAFSEVQNGGAAGATVPYAETTPAGTEGVSQAPIPLAGEALQQAIVDSFKEIQTN
                     IKGALDAAEEHMEEHAVYKRLRELSTRVRRCAQGAQEAFL"
     gene            <604246..>607431
                     /locus_tag="LMJF_17_1250"
                     /db_xref="GeneID:5650856"
     mRNA            <604246..>607431
                     /locus_tag="LMJF_17_1250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682330.1"
                     /db_xref="GeneID:5650856"
     CDS             604246..607431
                     /locus_tag="LMJF_17_1250"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682382.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650856"
                     /db_xref="GOA:Q4QE66"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR007807"
                     /db_xref="InterPro:IPR013562"
                     /db_xref="InterPro:IPR027992"
                     /db_xref="UniProtKB/TrEMBL:Q4QE66"
                     /translation="MVKRKVDDRIKTLIDDIARHKHRGLILLVGDRAKDQVVNLHLMI
                     SRANHNAKVNVLWCMREDPDFGSTGKKQQEKRARLEVKGGLSTEASKEAFQTFLAQTN
                     IRFCKYKETHKILGQTFGMAVLQDFEAINPNTLARTMETVKGGGLIVITFRAMRSLRQ
                     LYTIAMDVHARYRTETQRDVVPRFNERFLLSLADCDTAMCVDDDLNVLPITHKMKSYG
                     KSCKSDAYNADLAVQGRLQHEVDLANVKETLRPSEDVGPLMQLCQTMDQAKTVLSLMQ
                     TVMEKRLDSTCVVTAGRGRGKSAALGMTIAGAIAQGYSNIMCTAPTPENVQTLFEFAI
                     RGLKELGYRERTDFEALQGVSEEFAKCFIRINVFRGHRQTVQFVSATDTAKFAQAELC
                     VIDEAAALPLTLVKRILGPYLVILSSTVSGYEGTGRSLSMKLVADMRRGSSSGAADAR
                     HLKELSMSDPIRYGPGDPVEKWLNKLLSLDATMENTPLTTSPHPSACELFYVNRDALF
                     SYHPLAEELLQRIQSLLVAAHYKNQPNDLQLLSDAPGHHLFVLCADSVESSAASAPTS
                     STSGAARQQVPDIFCVIHACEEGQVSAQSIKSHLSHGLRPSGDLIPYTLSQYYLEEGF
                     AKLAGLRIVRIATNPALPRAGYGSRALSLLHQYYSGSISLTAAEPKTAIATHRRGDSE
                     ADAREQAGKEHEGDDDESSAPTAMLAPRSHITNLLTPLVDRPYELVDYLGVSFGLTTE
                     LLNFWKKASYIPLYVRQAPNELTGEHSCVMVRPMGFDLRPLQREFQHRLLPLLAMPFR
                     HLPTELALSLVGDFEAHDPHKLSAATDLSEVDHHVVRVDGVVQATTDDIAATFTAGDV
                     QRLRLVSTTFIEGGNVLDLVPTLAKLYFGKRLFRCPDGTDGVVLSHAQAAVLLAVGLQ
                     CQTTEELAAQAAFTGVSTQQLRGLFLKALSRLSEHLVALQKIPQRAQRDGHNAGVVAG
                     KRARSLSDGAVGDSAADEDVEDAEEVYDSHGNLKGLKVARKVKVQVCTDRTLLRDASL
                     SVSGNASAASTGRDSLQDVFYRPTKKASKRR"
     gene            <608718..>610079
                     /locus_tag="LMJF_17_1260"
                     /db_xref="GeneID:5650857"
     mRNA            <608718..>610079
                     /locus_tag="LMJF_17_1260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682331.1"
                     /db_xref="GeneID:5650857"
     CDS             608718..610079
                     /locus_tag="LMJF_17_1260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682383.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650857"
                     /db_xref="GOA:Q4QE65"
                     /db_xref="InterPro:IPR000731"
                     /db_xref="InterPro:IPR019332"
                     /db_xref="UniProtKB/TrEMBL:Q4QE65"
                     /translation="MSSHELPFLILNLAVEMIFVLNSRLHAQAVPPERAASVLRDIGT
                     NIFDTAFVNELFARPAMYSSTSVLQVFTALSSSTIMRLSANSMRKLYDLVYMTVKYQV
                     FTLRHPLELLELTLNHLDAAQKILPAEIQPLTSAAEKRVLRLASTLNMGDWASTRRSL
                     LNFFTGRHVRVSVFLENEVQDRTSGAFYIPRDAFLSPSPACKPPGLVYVAGVPQPGTF
                     PHPDAHLPYPPRIPLGSWRPRKGAARMTSNGFDIYAAAAAAAAAGSSRSDTVAGGAGA
                     HATVAADPLLRQTLEMPMPKKPPFGGAGAVTAFASPSTPPPVSVAAEDKQCAYDAEVN
                     SLAQLIGSVNRAGGVQHFELDLFPDGAGSSGGATAVVPVPSAAPTSITNAAGSRGAGA
                     TPAIPVTRMTASAVQEQNKKLLGIMSDFQSPKEAGSGDAGGAVPATGGATMNDLLDIM
                     DEL"
     gene            <611439..>612392
                     /locus_tag="LMJF_17_1270"
                     /db_xref="GeneID:5650858"
     mRNA            <611439..>612392
                     /locus_tag="LMJF_17_1270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682332.1"
                     /db_xref="GeneID:5650858"
     CDS             611439..612392
                     /locus_tag="LMJF_17_1270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682384.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650858"
                     /db_xref="GOA:Q4QE64"
                     /db_xref="InterPro:IPR001041"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="UniProtKB/TrEMBL:Q4QE64"
                     /translation="MLRLPCFATRAAAVPAVCASIMAVSAAKRQYRIIPHLYNEIEEL
                     AETQRRGRWSISHRNCLQQPLKKAEIMCDKLNLRESRRSGVLPEKSIARRLSQQYAVD
                     GEVCESKSKTKTINITVVNFDGHPFHFRTYPMPDVTLNTLIDGSGMCHGHATHWGKCN
                     NPDCSDWNHGDGCMVNVDIETLDRLLPPNRWEYTSLTAWRATDRPDITFNTRFSCQIP
                     ITEELDGAVFALKQLWTRALRESVSDWGLVDDQATIHGARSKRIEPWAPIIEEPTKVD
                     FPITWDMLWATGYQDIMKEKYSNFRRKDGFHTKPEMWAAYV"
     gene            <613380..>613583
                     /locus_tag="LMJF_17_1280"
                     /db_xref="GeneID:5650859"
     mRNA            <613380..>613583
                     /locus_tag="LMJF_17_1280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682333.1"
                     /db_xref="GeneID:5650859"
     CDS             613380..613583
                     /locus_tag="LMJF_17_1280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682385.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650859"
                     /db_xref="UniProtKB/TrEMBL:Q4QE63"
                     /translation="MAPFWTNVFNYTYARGFIRIPIVLALPIFFNKYVLCAYEDAFKR
                     WNAGHNQVDIWNRLQQKVAADAE"
     gene            <614550..>616679
                     /locus_tag="LMJF_17_1290"
                     /db_xref="GeneID:5650860"
     mRNA            <614550..>616679
                     /locus_tag="LMJF_17_1290"
                     /product="putative translation initiation factor"
                     /transcript_id="XM_001682334.1"
                     /db_xref="GeneID:5650860"
     CDS             614550..616679
                     /locus_tag="LMJF_17_1290"
                     /codon_start=1
                     /product="putative translation initiation factor"
                     /protein_id="XP_001682386.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650860"
                     /db_xref="GOA:Q4QE62"
                     /db_xref="InterPro:IPR011042"
                     /db_xref="InterPro:IPR011400"
                     /db_xref="InterPro:IPR013979"
                     /db_xref="UniProtKB/TrEMBL:Q4QE62"
                     /translation="MTDVNFGRHILIDGLPNNVTPDKRDLFQRHFSRRIGELLGGEKF
                     SLHLLTDPETALLSGAILSCVTETQAEAALAKLNRFPFTKSAVLTTYRWSSLEEARKD
                     DGPYVPPPTANDDDEEEAELVHNMAEDPDARPQFLIKSGVSFDCDWYWFNWEKNEPDL
                     YRRRKISKDDPLCRWSEVDRDNKKLVSGMVCSALPVSRPLPVWSTYGSMVISQHEKGL
                     RVWAGRSMRLHFEITMDINAFMVSPCEKYIIVQTPKDISIINLRTAKKIRTIGNLDLH
                     SDDLWPIMRFSADDSLVVVCKTGYRPMDSAEVPEGHLNIYVSETMKLLKGRGSSGHSF
                     AIPGLYKAEWNPVVGTQMAYVCELGPNQGWKAVVADMVVNEDGEVEQRVLNERNFLVA
                     TRLDMLWHPAGTFLCVRVAAKGPTEYFLFHVAERNVPITRLSIKRGYIPTRFAWQTGG
                     DKFAVLLKRDGVGAGLGETGVLQIFMIGKQGPKVLHEVATSATHLFWAPRGGRLAAAN
                     FDKSLLHFFVLHDNNTITDKNKLSGISATNCEWDPTGRYFAVWVSSIHEQTLAPQYRI
                     FDYTGNELFKKAVKPLSHFAWRPLPPTLLTQSDVKKARDMIKTLVRDYEATEMAHKAE
                     EQERIDKERKSKEEDYIKRMKMAARYAEEKGMVQTREEQRANSKWVRYNNNRLKALPD
                     EEHIIHEDVTEYHLVSRRQVGTGVAKK"
     gene            <618613..>619179
                     /locus_tag="LMJF_17_1300"
                     /db_xref="GeneID:5650861"
     mRNA            <618613..>619179
                     /locus_tag="LMJF_17_1300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682335.1"
                     /db_xref="GeneID:5650861"
     CDS             618613..619179
                     /locus_tag="LMJF_17_1300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682387.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650861"
                     /db_xref="UniProtKB/TrEMBL:Q4QE61"
                     /translation="MPDPEPVRWVQPTYQDVDTLPIVDGKGEYIVSRVQWPTGEVAYR
                     TPAPVDAKLAPRFGYNVVQVRKHVSWWKYNQKYPRLSLAYINIQVLFLLGFAWLVAFL
                     TSEYRQTMEAMRTPGAMVGEHRGRGPATNSTQKISFEKDEMNALLDKAQSNWYDGKAE
                     ASYVGSKAYKMKKIPRPKEFSADDFRKR"
     gene            <620622..>623768
                     /locus_tag="LMJF_17_1310"
                     /db_xref="GeneID:5650862"
     mRNA            <620622..>623768
                     /locus_tag="LMJF_17_1310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682336.1"
                     /db_xref="GeneID:5650862"
     CDS             620622..623768
                     /locus_tag="LMJF_17_1310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682388.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650862"
                     /db_xref="InterPro:IPR025714"
                     /db_xref="UniProtKB/TrEMBL:Q4QE60"
                     /translation="MPARHSLALPLSADYAHNEREGFSFFCTSGSHDSTTTLDRYLDD
                     LCAFLRSARLIQSHPDNYFQFIRGERWAASSAHFDNSPVEAEELAHTKALLSAFIPLL
                     KGDDAMSKLRALVRDGPPTDAGQCAGVLAGDVGASSTSWSPSSSSSLTPLQEFYAATR
                     RLMLGRARRAENDVASLTLITEAERRAIDRDSSSAQARQQHEQDILDLVVSQGMSLKK
                     QHEVPIMRMTIRDLVLCCNAGVGRTSAVQLQTGEQEDVRGATGKHRCGDVAPVRTVIN
                     IGEGKGYVSRAVSLCDNLQVVGLDCNPAHKERAVERFESLVETSLSSRDGRPRVNLLY
                     EPRGHVASIACRVGEKVDWESLLHGHVRTCADQCCLLSKGCSGDTCSAAGSVAEDQGA
                     IAEDDAAALARTRGDDTVKLACRVCGKVVRQNSTTAIMKHVYKHLHGSIGPRAASKEA
                     HALDNATETLSPRPPHQVRVPALTEVQQWNASLPQHTYVAKLTEHFFTVTDVETRHLS
                     NRNDAVLLKRVAVDGEGGAALRGSSSKATPRYLTLAPRAHGEACGDTSGAQRRRSPPE
                     RASVTLEPAYTARGYRVVLLMAVEEATGSKELHMLSPTRSSSPVDEGEAQRAVVTPPA
                     RERDAEPDLTSSAAGQPPQMWSYTQVLATIVGYDGGVDSHQVCVDQESKKRTLRLYRL
                     RAGATAAAQECVLESTGRHGGGIACVGNWQLPDAGTWGRERVALVLAVLPPALPSTPV
                     VCVPSVRNTVLIGLHSCGDLGSNMCRIFRSSSARGLLLVSCCWHALTPHGFPLSRALQ
                     RRGLTTNSISLLLATQPLDAWSTASPEGHRSSAKLLFFRSLFKLLWRQLAETWEAGRR
                     DGSVPRPSGCAHTDTLGGDDTCAFPDVPPYLEPAFLRRISRDKDTLTFTRFVHAVAAE
                     YVYSESSKDTPYTPWKIGRCCAVCRTAQEAHARYVLTRQRLPETMGANFEQEHFASFL
                     GLTVLRMWMCHLVESLLLLDRTLYLHEELSELHSRAAAAPADEAESSAVALVPLFDGA
                     LSPRMYGILARRGGSACA"
     gene            <625229..>626800
                     /locus_tag="LMJF_17_1315"
                     /db_xref="GeneID:5650863"
     mRNA            <625229..>626800
                     /locus_tag="LMJF_17_1315"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682337.1"
                     /db_xref="GeneID:5650863"
     CDS             625229..626800
                     /locus_tag="LMJF_17_1315"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682389.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1315"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1315"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650863"
                     /db_xref="UniProtKB/TrEMBL:Q4QE59"
                     /translation="MRPQRHRRRCTAMPSLTCWLHVFFILVSFGFPFVHCRSTIASRF
                     LCLPIPLLLPQHVGSVCVCVCVCVPDIFAFAATPLSSRATLVAHRCGMTSPPFRTHSL
                     NPSHAHPRRLLRSPFHLVRSRRRVLHRCFGAGTAASLGPLPPFTRNERIADVLLGRVS
                     FACVARRFPVHFSCASTLLFPLLRSLVRPSSAHSCVCPPPPTPSSTVTLLPKRVLRLA
                     SPHSPSFSFTRHPLNTPFLPFPLTHWHRERWLVYTTSAQLASALHLSVAPFIGYPTSL
                     SICCFSLRLLLTHPLSERVGSNVVTPRSHRQSRTRSSREGRPNTGKAKRSITNHEQAP
                     HPLPPSNNSSKFREGGRDGANTWRERASTHPHLRFVISHIVYIYIYIHIYFIKFSRDF
                     VLAFLFCRCRCCFACDCCGCGCRWISVPLLFFAILPLSLSLLFCTFTSLPQSTLFFLP
                     FSLAFPCAARVARALDVLLSTHCALVILSPSDTFFFFLVSCFRYPPPSLPPSLPLPAR
                     DKQLRVVDRAALTRH"
     gene            <627198..>628970
                     /locus_tag="LMJF_17_1320"
                     /db_xref="GeneID:5650864"
     mRNA            <627198..>628970
                     /locus_tag="LMJF_17_1320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682338.1"
                     /db_xref="GeneID:5650864"
     CDS             627198..628970
                     /locus_tag="LMJF_17_1320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682390.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650864"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4QE58"
                     /translation="MQQQQQPSSNSWRGASRVGSVKYAHSPYAYRTNVDDACFSPLSD
                     QGGRHESASLPVYLSPRSFSASASMHELPGSHVLQGTQNEGSGQQLSQPSTPLSRSSG
                     VQEYSQPIQVGSAPNVHPRYRRRMQSPITYGGSIDSGSLSGFPNTPPSSLPPRSSFMP
                     RDDSGSTFAGGESAPVRGHNDPYQMNANAGRSSPRYRLQLSASSRDAAAEVESRSQSP
                     NPHYTAHGTPPPPPPLPVGASVPQYGARTSSQHTSPTHANGAAASSYAPTGFSVPLKM
                     VSVSNGGSGSYHGSLGGRGGSQSPSYGDPRANHPFPSTMSGSNGAPPLAFAAAMKQQQ
                     HQSSSFQTSNYHGQARSGAYLASTPFGGPGMSGGSAGVTHRAEAPHFSDSYDTNTKTV
                     TTMADETMSFSSKSSSSASSIRDDLPLCPNDDACTLINDRKHQKKFAHTCRLLPCYHG
                     HVARHAKLFRHSPGQVSLPEGVSANMKVSSHALASVNFSTISPEAPNAYRIYVSHGNM
                     SYEIFGDWASVKVHTFKRYLHQVYHIAPSAQVLSVVKTGKVMDDDINTVKGFGIEEDS
                     VVQLHSNIEDTTVPGRIGISLDDL"
     gene            <631956..>632681
                     /locus_tag="LMJF_17_1330"
                     /db_xref="GeneID:5650865"
     mRNA            <631956..>632681
                     /locus_tag="LMJF_17_1330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682339.1"
                     /db_xref="GeneID:5650865"
     CDS             631956..632681
                     /locus_tag="LMJF_17_1330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682391.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650865"
                     /db_xref="UniProtKB/TrEMBL:Q4QE57"
                     /translation="MPGLGSLWRWLRGEPAIPGVVYSDQLQNIREEFERQQSIRWAGN
                     LRNVRLESAPDLIVRTSSSSAALPGPEEEPYTYWERIGLVPVHPSRVRARQYYHPITD
                     FALYDYDEVSPEEKELTAKWMARVMEFNGATPAGILCAAGCLVLPLHTVYRMPLLVAA
                     GITGMAVEVTRAYMAASQQRQDLDDFLLAKEIWYIKNVETYQLGIPRIPRGREREYQQ
                     YVDGGALMQLQELPEELARDLHC"
     gene            <633672..>634595
                     /locus_tag="LMJF_17_1340"
                     /db_xref="GeneID:5650866"
     mRNA            <633672..>634595
                     /locus_tag="LMJF_17_1340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682340.1"
                     /db_xref="GeneID:5650866"
     CDS             633672..634595
                     /locus_tag="LMJF_17_1340"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682392.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650866"
                     /db_xref="GOA:Q4QE56"
                     /db_xref="InterPro:IPR004821"
                     /db_xref="InterPro:IPR005248"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:Q4QE56"
                     /translation="MPPSTAAPYALRTDKLKPLEGYVAGCSVSPAEVASQVASSLQPV
                     VLAICGSFNPIHNAHLKLYDAAKRSVDGADGRVVLGGFLSPVGDAYGKPGLRSAADRV
                     HIMRKALCHHPDLNVDTWECQQPVYMRTFFVLQALEEHINAWYAESEPAAVEWLASHD
                     RRVRVAFVCGADLFSSFWIPGCWQLRLLRQLLDSFHLVVVHRDGGRGCVRGADDFAHV
                     CQTAPLLSETAEGGEKIEIDMSQYTFTFATFSAPDDTSSTAVRAAAMELARTPQGDAV
                     TRAALQSRLRAMLPEAAVQSVVELYGKVLTS"
     gene            <635397..>635936
                     /locus_tag="LMJF_17_1350"
                     /db_xref="GeneID:5650867"
     mRNA            <635397..>635936
                     /locus_tag="LMJF_17_1350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682341.1"
                     /db_xref="GeneID:5650867"
     CDS             635397..635936
                     /locus_tag="LMJF_17_1350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682393.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650867"
                     /db_xref="GOA:Q4QE55"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR018506"
                     /db_xref="UniProtKB/TrEMBL:Q4QE55"
                     /translation="MPEHDWSGGVLAVVVLLVATACGVISGCDVCGVSVAKRVMAPSD
                     RPDGGVPEATAVTSSGSTATATPMLELDDHLRGAATGKADTYVEEFYQAAGHLRCPQP
                     QRHTQEEVARHRTKDDLWIVVDGNVLNVSAFVPHHPGGDVLLDGVGGQDMATVFAYFH
                     DPSTVRLLVSFCIGRLLLQ"
     gene            <637740..>639248
                     /locus_tag="LMJF_17_1360"
                     /db_xref="GeneID:5650868"
     mRNA            <637740..>639248
                     /locus_tag="LMJF_17_1360"
                     /product="putative L-gulonolactone oxidase"
                     /transcript_id="XM_001682342.1"
                     /db_xref="GeneID:5650868"
     CDS             637740..639248
                     /locus_tag="LMJF_17_1360"
                     /EC_number="1.1.3.8"
                     /codon_start=1
                     /product="putative L-gulonolactone oxidase"
                     /protein_id="XP_001682394.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650868"
                     /db_xref="GOA:Q4QE54"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="InterPro:IPR007173"
                     /db_xref="InterPro:IPR016166"
                     /db_xref="InterPro:IPR016167"
                     /db_xref="InterPro:IPR016169"
                     /db_xref="InterPro:IPR023595"
                     /db_xref="UniProtKB/TrEMBL:Q4QE54"
                     /translation="MSAHSAARRWTNLAGIGSCHPRHHHYPTSTKEVQDAVELVRSQN
                     GKCRVAGAGKSPNTATFTNEHLIHMERMNRILSIDTVAHTITCEAGAVMEEVMRSVDK
                     VGLMVRCVPSYVRTTVGGCIATATHSSGIQCHCLSDYVRGLKIVDGCAQIRTLVAGKD
                     DAELRLAACHLGVMGIVTEVTLEVQPRIQWKLVSQPLLMKDATNAALVAEKVKSTEYY
                     RWWWVPHTDGCYESYGRVESTTGISALPPLPDALTAQDDAPVQLSPAALQEESRTNES
                     AERAGDRSISLIVKSALKYIATDFVRHQVVECSLYAACLCPAIQPYVNKAYRRAFFSA
                     PQVQRGSALECFTFDCLFKQWANEWAIDASRAVEAFNRLRDMIDREGMLLHFPVEFRF
                     TAPDVSDMSPAVGRPTCWIGVVMYRPYGQEARDTRRCYDGFCRVMEEMGGRPHWAKYY
                     DWGHREITATYGDHWERFLALRRRMDPDDIFVNGWFRNLMSPDRVNSTACTP"
     gene            <642250..>644847
                     /locus_tag="LMJF_17_1370"
                     /db_xref="GeneID:5650869"
     mRNA            <642250..>644847
                     /locus_tag="LMJF_17_1370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682343.1"
                     /db_xref="GeneID:5650869"
     CDS             642250..644847
                     /locus_tag="LMJF_17_1370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682395.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650869"
                     /db_xref="GOA:Q4QE53"
                     /db_xref="InterPro:IPR007949"
                     /db_xref="InterPro:IPR012977"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR027312"
                     /db_xref="UniProtKB/TrEMBL:Q4QE53"
                     /translation="MAEPAFRGTLLLLQNRTRRDPESYRDEFLAQLDHFRASSATVLS
                     QRSLNPQFIAVLNYVCHVGHCFPKDAAVIVNIVLELLRASKGNGLPMDLRLALVKSLI
                     LLRAKDLVSTDHTFPLFFELLQERDKTLRKLILTHVVSDIRKANMPGAKNGAQINKRA
                     QNFLFSIMAEDDPVQARCAEMVMIDLYRRRVWSDERTVEVLTKACFSKHTPILRTALR
                     FFLLQMPRITSVDDEDGEDGEEQDPGRTISKLQQKMKIVKKTSKRERVLKRSVRGAKR
                     KYDRQEKEEALFAKQHVDPVRLLRDPQQLVERLLAKLQRTSERFEVRLLYLNVIARTV
                     SEHEVLHLPLYGFLERYMEPSQLHATQLLALSATCVHAMVPPDAIEPLLRTIANHFVS
                     DRSSADAITVGINTIREICKRQPLAMNADLLKDLAEYKNRRGDKGVMMAARALIQLYR
                     DVYPELLPAKLRGSKAGVADTATRPVYGSKHVYTDIPGLELLYHDIENNAGDDESGSE
                     SSSSEVDSSSGEWVTDSDSEADADDVDGEFVDVADSSAEEEDESEDGCPQLVPVHEHA
                     HSATDRTDADGEGPHKRARLEEAAPVSVASQNSAALSESSADNEDEGMDSDGDEDGEE
                     VVSNDEEAEDESEFGWEEVSDDEESECDEESTAEENEEAPLSLSAALANANSGADWFE
                     DLTDGMSSKNASSSPRAGSVSSSKASSTTSISSSRLLTDSDFQKINQLRTQHGSHQSL
                     RGKRKERDVRSKKRHDLIHGISNDLDAHDIEHFTEKKRETDKQAKIEQAQELRKASSK
                     FELRRKKKSKLNSTHGEHSKRGKLFQMTKRSQRVAAKLKSSVADRATRAKEMQKKDIK
                     FRIKRGWKA"
     gene            <645602..>645988
                     /locus_tag="LMJF_17_1375"
                     /db_xref="GeneID:5650870"
     mRNA            <645602..>645988
                     /locus_tag="LMJF_17_1375"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682344.1"
                     /db_xref="GeneID:5650870"
     CDS             645602..645988
                     /locus_tag="LMJF_17_1375"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682396.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1375"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1375"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650870"
                     /db_xref="UniProtKB/TrEMBL:Q4QE52"
                     /translation="MSVQAFEFSSSILSPKYVGLSPFRAPKESRLDTSPPGVLSSMCE
                     YTMCAKRALNTRIIGFAEPTLQQCIEEFARALKASTFIQDKDATSALLRQRRGTVDPS
                     QLPWSPRPEYLAWLRAQGRLEETVSL"
     gene            <647067..>649145
                     /locus_tag="LMJF_17_1380"
                     /db_xref="GeneID:5650871"
     mRNA            <647067..>649145
                     /locus_tag="LMJF_17_1380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682345.1"
                     /db_xref="GeneID:5650871"
     CDS             647067..649145
                     /locus_tag="LMJF_17_1380"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682397.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650871"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="UniProtKB/TrEMBL:Q4QE51"
                     /translation="MDALFLTSAGTDGHPLAQPFWSSSRSSLPTFDAHRRGTARGRLQ
                     NPALIDSIRRSEGSRVGQDTCRYMQAAAASSQKAVHQLLSRLQTYRSFKPFLSPPAPY
                     RDNLFTDDRGFSNFHGPSYGRGSTATVSRDQLWQMVDGILDTSVAQLLQHNAEGHFIM
                     TLQSTLGLEAPISTAKSGTVIESRKAATPAIKGGATELASEERTPAGGPRQPLPPALQ
                     KTAVMSSFAPASALADRWALDHPSATAAAIEEQHHAWAKFEQQRQRTSRCFYLQAMQE
                     QLDVLQAEQARDAADTTHSPPSRGDRSHRYLVDMHSPSDSEDAVAKTEEERQQALWHT
                     FHDGPVLGVGASESLHETALGVPGIVSAYLESTDLQDWLHCSWAHRTHRHESAALRIQ
                     CAYRVYRARCKVREMRYERRQAFLASLSAERKARQVWDLALQVQKDTTTTTSGTDSTL
                     RALQFFINKVNAVVAKHRARKQYQQRQDAEICRYAATRIQAVYRGHRTRAFVTELRHP
                     EIVALRKHLQQENCAKLIQTCWRRYTAQRQWWRARHAACVLQSMYRCYAARRMLAERR
                     YQRSLEASAELTKFAVQRIERWYASFLAARNAIGRAHVAELLMLQRVCRGYQGRHGVQ
                     KERRLSRFRFAVRTIEQRRWRVMEVREAIERRAALSATNAAKRTASMRDDAAVTIQRA
                     WRQRRVLHVC"
     gene            <650271..>651137
                     /locus_tag="LMJF_17_1390"
                     /db_xref="GeneID:5650872"
     mRNA            <650271..>651137
                     /locus_tag="LMJF_17_1390"
                     /product="putative myo-inositol-1(or 4)-monophosphatase 1"
                     /transcript_id="XM_001682346.1"
                     /db_xref="GeneID:5650872"
     CDS             650271..651137
                     /locus_tag="LMJF_17_1390"
                     /EC_number="3.1.3.25"
                     /codon_start=1
                     /product="putative myo-inositol-1(or 4)-monophosphatase 1"
                     /protein_id="XP_001682398.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650872"
                     /db_xref="GOA:Q4QE50"
                     /db_xref="InterPro:IPR000760"
                     /db_xref="UniProtKB/TrEMBL:Q4QE50"
                     /translation="MTQPTLTEDELDDALGLAIRAANTAAFISNSVIDDKTNNIVEAQ
                     TRNNPNDLVTQCEKHCKEEVLNILRVGTPSYAILSDDMHSEAVLGDGPTWIVGPIDGT
                     VSFKHGLFDFCISIALALRKEPILGVVCAPRLQEVFTAVNNRGAFSNGQRIHVSLVDS
                     LRQSVVLLHHSGTRSDAAVRSVAAMQAELAKLPVQGLRCNGSAALDMCLVAAGRAELF
                     WKAGVNPWNVAAGVIIVREAGGVVHDVESTDSFDLTCRSVCCGCSLDVTKHGVELSLK
                     HNYRSSVLNTSS"
     gene            <652372..>653184
                     /locus_tag="LMJF_17_1400"
                     /db_xref="GeneID:5650873"
     mRNA            <652372..>653184
                     /locus_tag="LMJF_17_1400"
                     /product="putative otubain"
                     /transcript_id="XM_001682347.1"
                     /db_xref="GeneID:5650873"
     CDS             652372..653184
                     /locus_tag="LMJF_17_1400"
                     /codon_start=1
                     /product="putative otubain"
                     /protein_id="XP_001682399.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650873"
                     /db_xref="GOA:Q4QE49"
                     /db_xref="InterPro:IPR003323"
                     /db_xref="InterPro:IPR016615"
                     /db_xref="InterPro:IPR019400"
                     /db_xref="UniProtKB/TrEMBL:Q4QE49"
                     /translation="MDEGLPIDASEAQLEAIRREVAQYPLLSLSLPLNKESMIVKEME
                     HDDAYLAQTLSLFGASPVSTKQYDFGSIRYSRRDGNCFYRCAGFRLCELIVEHPERAA
                     EYVALLKSREESLSRLFGLFVFDFTDALAEILKGVADKTITSVAQVYNRFISDDAAYV
                     LAALRYLISAYLQEHEEEYEPFVSGLGYGAVRDYCNAEVELVDHESDNVQLAAFAKAF
                     NVCIKVYALDRNAGNNITEYSFNGEDNDAGDRLVVGLLYMPGHYNLLGRGPG"
     gene            655128..656138
                     /locus_tag="LMJF_17_ncRNA1"
                     /db_xref="GeneID:12981448"
     ncRNA           655128..656138
                     /ncRNA_class="scRNA"
                     /locus_tag="LMJF_17_ncRNA1"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460145.1"
                     /db_xref="GeneID:12981448"
     gene            <657202..>658695
                     /locus_tag="LMJF_17_1410"
                     /db_xref="GeneID:5650874"
     mRNA            <657202..>658695
                     /locus_tag="LMJF_17_1410"
                     /product="putative zinc-finger protein ZPR1"
                     /transcript_id="XM_001682348.1"
                     /db_xref="GeneID:5650874"
     CDS             657202..658695
                     /locus_tag="LMJF_17_1410"
                     /codon_start=1
                     /product="putative zinc-finger protein ZPR1"
                     /protein_id="XP_001682400.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650874"
                     /db_xref="GOA:Q4QE48"
                     /db_xref="InterPro:IPR004457"
                     /db_xref="UniProtKB/TrEMBL:Q4QE48"
                     /translation="MSEREHDETPVTAEGSAAAHEGSNMDLNGNESRASYIKTDLGEL
                     NMIESMCPKCQETGTTRLMITSIPHFKEIIVSSFECQHCGEVNNEVAFGGTFGPKRVR
                     YELQVRSKQDLDRQVVKSEFATIAIPELELEIPPESQKGNLNTIEGVLEQTYSGLQLQ
                     QPLRKIQHPDVYEKIEAFCAKLASFRSGDVPFTLTLDDPAGNSYIEPIHDYYHPTLDP
                     QLTKYEKERTEIDRQLLGIALDYNTERTQEEEKDVEEGQFSDVTQILCDCPACRRPGY
                     IMMHECDIPYFKQTIIMAFKCEYCGYKSNEIKAGGEINAKGLRLVLHVTSEADLKRDV
                     LKSDTATLIIPEVRLELAPGTLGGFFSTVEGTITQVRDQLMNLPQAAFAAGDSADDNS
                     KTMLEFVKELDELLALREEFTFILDDPLGNVYIQNPCSHLPPPDDVDPKLEREEYTRT
                     EEQDEELGILSMRHNEGQAGIEKSEDEADHEGEERNGAAAEEQETQQ"
     gene            <662315..>663088
                     /locus_tag="LMJF_17_1420"
                     /db_xref="GeneID:5650875"
     mRNA            <662315..>663088
                     /locus_tag="LMJF_17_1420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682349.1"
                     /db_xref="GeneID:5650875"
     CDS             662315..663088
                     /locus_tag="LMJF_17_1420"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682401.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650875"
                     /db_xref="UniProtKB/TrEMBL:Q4QE47"
                     /translation="MTATESKGFAELYHQLLQDGVQLQKELEAYYLRQEGYIRKRVAV
                     LDEMQENIADERRCLELQHQECRAQISTTRKQAASFLSDERKVSQAVRHAQPFLAAQE
                     AEIDKRLDELQREKEREDTALLNVMARQEALGKQEALLACRERQRFLEEQDLQKALIE
                     MRSLNREMEERRKSLLRKHGTVADWDRKLESRERELLVCQDQLRENLKALEQEENALG
                     IHPAQRTAVAPAVSQRTVMDDHDMSIEHDSACEEIDYED"
     gene            <665834..>667336
                     /locus_tag="LMJF_17_1430"
                     /db_xref="GeneID:5650876"
     mRNA            <665834..>667336
                     /locus_tag="LMJF_17_1430"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682350.1"
                     /db_xref="GeneID:5650876"
     CDS             665834..667336
                     /locus_tag="LMJF_17_1430"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682402.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650876"
                     /db_xref="GOA:Q4QE46"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q4QE46"
                     /translation="MLTGSAVVQTRERGLEGPHESMLPSLPSIQDANKFGGSHLPDAA
                     SVADNCRDGSESDDVIKATPLRFVILALFAAFGFINQVQYVAFASITRETQAYFGVSA
                     LEVNLLILLIPIVYVLGVVPGCLVYNRVGLRYGMIIGAALNAFASILKLVAVWAPKYP
                     LLVVAQVFVAGGQILFLSLPPLIAGIWFPPNERTVATAVASLMGFAGMAIGMFYSPHI
                     IFLPDHNTRKEWGVSMGSQFGFSTLVLLLMLALAGDKPKHRPSFTSTEHYKLPLLKFL
                     KSTFQYLSFVLLTVAFGLITGFFTAIAGVLAQLLEPFGISETKSGILAFSGILGGSAN
                     CALVGTFVDRTHYYKYTAVTLAAISTALLLMVVIVVKSTPNLGAVTFAFYVLVPFLAF
                     LVLPIVPVVMELAVELTYPCPETVSSTIVLASMCFVSFVGMIVFSLILGDKPTVDSSF
                     YVLLITLIVSAVSVAMLFFVKEQLRRKAQDKILCQTENGNASEVFKRPTL"
     gene            <669283..>673527
                     /locus_tag="LMJF_17_1440"
                     /db_xref="GeneID:5650877"
     mRNA            <669283..>673527
                     /locus_tag="LMJF_17_1440"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682351.1"
                     /db_xref="GeneID:5650877"
     CDS             669283..673527
                     /locus_tag="LMJF_17_1440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682403.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650877"
                     /db_xref="GOA:Q4QE45"
                     /db_xref="InterPro:IPR005821"
                     /db_xref="InterPro:IPR027359"
                     /db_xref="UniProtKB/TrEMBL:Q4QE45"
                     /translation="MRAFAAARPLRFFVFVPWWREQLVPLCRGFPQLLDVMITLGLCL
                     LALGLIGVMGVGGELHQRCYITNTTASSPYENLTLPFLLRNISAACGVGFSCPTVSAE
                     VTVQCLAIAHARRDRFFTYDNAGAALLLMFKVASMDMWFENLEDIMNVKGAGAALYLV
                     VVALVSLFLFVLLTSVVHSAYVPVDTWCAPSFAAKVGPAARQRQDCGVQTLPAWPKMR
                     QHCLARPTHARQHTHSMEDGREVEGDVRRQNPLSGDGGGQQVPLYASHISAEGTLVAR
                     QFPRHVRDFVRDLHVLGFWAALRALEVTTTAGADGAPLRPLMASLVDSLPFVILLMVL
                     SVSSVLLLAVVSTSTPDLAARLLHTISAALAVFFIVPAALRLISFGVVRASVDVWNYA
                     DLLAAVSGVLELAAPSLFNYRVVGAVRVLRCVRVAKYLCPLYRYEYRLKSLLSLLLLT
                     SAILTLYALLGMQLFAGTYDAEDAPAPFGNGDFNTAWTALLACFRAFTGDTWTRYMVA
                     VSEGSTIATGSLFFLSLQLVSRMMLFAVANSVILLGSRNAACDEDALRSNAFPPLLLL
                     PPLKNDDTTAADAALDARNGASDLSPSPDAGPTVDRWRRRRGAGRKASELVTAKRLRV
                     RGDAFLFIGPMNPVRLLLLRVLGSPFYTLISTLCVAIGVVALFFERRHLDADTERTLH
                     LVNIVCLVVFVVEMVMKWLAYGVVTQGWGDGEDHYRDARSRYMPAYFRYPLNWVDFAA
                     NGLALAAVAYPPLRVGRVIRTARLFTTQERPNKSFVELVKVLRHTVRVAPLIFFLYVA
                     FAVTAMQMFAGGLFRCSDAAVTTSAECFGDYNTTVMGYTGSTTSVRKRRWVRAGFHYD
                     SFGPALLSVFAMTTVNHWGNFMDDVVAIKHTMMAYNHSGYYVAFFIVALLLIRFFAVR
                     TIAAVFIAELRGVVMDSLGTAQRTPHQTRFVVSRECIAHLTQLQRFLPPLPTAASRLC
                     HRILSAQPAQWPNTVFDAVVQGVLVVVCGFVAATHAGESLWQKRMIVAVDCVAVALCG
                     AEVLLGMLAYGVRYLTRASYAADVVLFVLMVVGIAAPSLRFVTVVIFVKLIKAASTAL
                     ALLPATRHIQMLLSSGALALLVLYAYAVVGTLLLGDIAPDGVYLTDTRNFSTVIGSLL
                     VLLDCSTFDQWHLVMHACFDGAACHSDASATCGHTYSAVIFFVSFIVIESLVVSQLML
                     ASAVVVFAVPLFTDVIQPFVDVRRAWQRGVGAGESACDFDTFLTLLSRFPVSLTDGIT
                     SETSTKADLMAFLSSLRLLLDEHLRLRYADLLRGLAYRKYKVNLDDARVRSSARDRRM
                     CLTAGEYYGQLLVQRYCDEMSRLAHSAVGGARALSTGPPAATPRHDGVGDHGVLRIHG
                     DDTLVPKGALPIPSSNVFLYTFPGESNEDGVLPSTS"
     gene            <674249..>675709
                     /locus_tag="LMJF_17_1450"
                     /db_xref="GeneID:5650878"
     mRNA            <674249..>675709
                     /locus_tag="LMJF_17_1450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682352.1"
                     /db_xref="GeneID:5650878"
     CDS             674249..675709
                     /locus_tag="LMJF_17_1450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682404.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650878"
                     /db_xref="GOA:Q4QE44"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:Q4QE44"
                     /translation="MNDLSFFVLHHQRRTLTPQLLRDTLDFAKPHAEEGVLFSWRWHF
                     FLGTLPLPVEDDVKLEDCRAACERWRRQWQDAGRRLDQSIRESPRKTGKAVRFGESSS
                     DSEDALPPPSALAPLSALSTSGDGCTVNPLAPASESSYALQFQADMVRHTVAKDMSRL
                     SWDVPPFHDVRAKETVADILLKYSLMENEDYMQGFHEIVAFLYYACYRDKELGERFVQ
                     EHPALRSAAFIELFELVYADLPAAVYALFRRVISENDGGMCLSKWYYSNAHGEQSGVV
                     LACQRVQKGLLSRVDPALQNLLDTVYEIESVVYLVRWLRLLFLREFPFEQALRIWTTL
                     FCERYIVVEQQKAPFVLNNSLALYFAAQMLCHMRDALSVDAAGALQVLMKYPPTKHVD
                     DMLYAAAISSSDSPLCRYARAPRLVDRKDAPALPAEVTLRQGEVLARVIGGLEQCWFR
                     DSNATAEAQELTTEMYAQFIAQLKKVRDVLLYGMGV"
     gene            <678917..>680074
                     /locus_tag="LMJF_17_1460"
                     /db_xref="GeneID:5650879"
     mRNA            <678917..>680074
                     /locus_tag="LMJF_17_1460"
                     /product="ferrochelatase-like protein"
                     /transcript_id="XM_001682353.1"
                     /db_xref="GeneID:5650879"
     CDS             678917..680074
                     /locus_tag="LMJF_17_1460"
                     /EC_number="4.99.1.1"
                     /codon_start=1
                     /product="ferrochelatase-like protein"
                     /protein_id="XP_001682405.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650879"
                     /db_xref="GOA:Q4QE43"
                     /db_xref="InterPro:IPR001015"
                     /db_xref="UniProtKB/TrEMBL:Q4QE43"
                     /translation="MSCAPGPTKAILLVNLGTTTAPTAPAVRRFLREFLSDRRVIDVP
                     RFLWYSALYGFILPFRPRRITPLYKGIWIKSDSGVVINGKTEGSPLTLYSESLVAKVQ
                     ASVEKTSGGAVVARHAMRYGVNNIPSTLKALHDEFATLRELVVLPLFPQYTSTTSASI
                     YDEVFKFYTDTQRRSIPSLRTIRDYAEHPVYVEALGSSLLSSIKAHVTAKAGAAKDWK
                     SALADQLPEIGIIITYHSIPVRYVEEHDDYPQRCEATTAAIKAYIEAESGISLSDCLV
                     HVYQSQFGNQPWLGPTLNAAATAFPLPPHDARKQAFSDAHRNKALLTKQATICFAMAP
                     GFAVDCVETLSEIEREAGEVFKQSGGHKLIYVPCLNDSDTHVKVLTSVVGA"
     gene            <680810..>681541
                     /locus_tag="LMJF_17_1470"
                     /db_xref="GeneID:5650880"
     mRNA            <680810..>681541
                     /locus_tag="LMJF_17_1470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682354.1"
                     /db_xref="GeneID:5650880"
     CDS             680810..681541
                     /locus_tag="LMJF_17_1470"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682406.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.17.1470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.17.1470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650880"
                     /db_xref="UniProtKB/TrEMBL:Q4QE42"
                     /translation="MEFFQVVDPVTLAPASYAHVALQLALAVACAVLLGVCLHVLPER
                     LVCVSKTARAKVPREALANAATPASKLSVANTPSSLAAASATPSFSAAAPVGTAPKAQ
                     AKAAAPAASAAVAESTLHDVLEAFFEEETLLDEALLDATAPSALPEKETAPANRTPGK
                     PTQPPLKKTGDFSPGLAAKMTQRLQVEACPASTASSPQVASKPPERNNTAERELEDAL
                     DAYMEEEQLLDEAILDSAVAAAHRT"
CONTIG      join(FR796413.1:1..684829)
//
DBGET integrated database retrieval system