GenomeNet

Database: RefSeq
Entry: NC_007263
LinkDB: NC_007263
Original site: NC_007263 
LOCUS       NC_007263             716602 bp    DNA     linear   CON 18-JUN-2017
DEFINITION  Leishmania major strain Friedlin complete genome, chromosome 22.
ACCESSION   NC_007263 CT005261
VERSION     NC_007263.2
DBLINK      BioProject: PRJNA15564
            BioSample: SAMEA3138173
            Assembly: GCF_000002725.2
KEYWORDS    RefSeq; complete genome.
SOURCE      Leishmania major strain Friedlin
  ORGANISM  Leishmania major strain Friedlin
            Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae;
            Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Rogers,M.B., Hilley,J.D., Dickens,N.J., Wilkes,J., Bates,P.A.,
            Depledge,D.P., Harris,D., Her,Y., Herzyk,P., Imamura,H., Otto,T.D.,
            Sanders,M., Seeger,K., Dujardin,J.C., Berriman,M., Smith,D.F.,
            Hertz-Fowler,C. and Mottram,J.C.
  TITLE     Chromosome and gene copy number variation allow major structural
            change between species and strains of Leishmania
  JOURNAL   Genome Res. 21 (12), 2129-2142 (2011)
   PUBMED   22038252
REFERENCE   2
  AUTHORS   Ivens,A.C., Peacock,C.S., Worthey,E.A., Murphy,L., Aggarwal,G.,
            Berriman,M., Sisk,E., Rajandream,M.A., Adlem,E., Aert,R.,
            Anupama,A., Apostolou,Z., Attipoe,P., Bason,N., Bauser,C., Beck,A.,
            Beverley,S.M., Bianchettin,G., Borzym,K., Bothe,G., Bruschi,C.V.,
            Collins,M., Cadag,E., Ciarloni,L., Clayton,C., Coulson,R.M.,
            Cronin,A., Cruz,A.K., Davies,R.M., De Gaudenzi,J., Dobson,D.E.,
            Duesterhoeft,A., Fazelina,G., Fosker,N., Frasch,A.C., Fraser,A.,
            Fuchs,M., Gabel,C., Goble,A., Goffeau,A., Harris,D.,
            Hertz-Fowler,C., Hilbert,H., Horn,D., Huang,Y., Klages,S.,
            Knights,A., Kube,M., Larke,N., Litvin,L., Lord,A., Louie,T.,
            Marra,M., Masuy,D., Matthews,K., Michaeli,S., Mottram,J.C.,
            Muller-Auer,S., Munden,H., Nelson,S., Norbertczak,H., Oliver,K.,
            O'neil,S., Pentony,M., Pohl,T.M., Price,C., Purnelle,B.,
            Quail,M.A., Rabbinowitsch,E., Reinhardt,R., Rieger,M., Rinta,J.,
            Robben,J., Robertson,L., Ruiz,J.C., Rutter,S., Saunders,D.,
            Schafer,M., Schein,J., Schwartz,D.C., Seeger,K., Seyler,A.,
            Sharp,S., Shin,H., Sivam,D., Squares,R., Squares,S., Tosato,V.,
            Vogt,C., Volckaert,G., Wambutt,R., Warren,T., Wedler,H.,
            Woodward,J., Zhou,S., Zimmermann,W., Smith,D.F., Blackwell,J.M.,
            Stuart,K.D., Barrell,B. and Myler,P.J.
  TITLE     The genome of the kinetoplastid parasite, Leishmania major
  JOURNAL   Science 309 (5733), 436-442 (2005)
   PUBMED   16020728
REFERENCE   3  (bases 1 to 716602)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 716602)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire, CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR796418.
            On Jun 1, 2012 this sequence version replaced NC_007263.1.
            Data release policy www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..716602
                     /organism="Leishmania major strain Friedlin"
                     /mol_type="genomic DNA"
                     /strain="Friedlin"
                     /db_xref="taxon:347515"
                     /chromosome="22"
     gene            complement(<3313..>5241)
                     /locus_tag="LMJF_22_0010"
                     /db_xref="GeneID:5651944"
     mRNA            complement(<3313..>5241)
                     /locus_tag="LMJF_22_0010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683103.1"
                     /db_xref="GeneID:5651944"
     CDS             complement(3313..5241)
                     /locus_tag="LMJF_22_0010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683155.1"
                     /db_xref="GeneID:5651944"
                     /db_xref="GOA:Q4QBZ3"
                     /db_xref="InterPro:IPR003492"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q4QBZ3"
                     /translation="MRGVDGKGEPGREGVEVDAVAGVVTEDLRKDGVVDNPSISLSQN
                     EPSGIEESDRYKRDAATVHRLFKRTIIRNSVFLWLVGFINNFHYCLIMSAAASLAEGY
                     GLKKLVALITWANIFFGIFARVLNMFIATRVSYNVRITAMALSSLLGIFFVSFAAPIG
                     GYNNVSAFVVMLIGVVLLGTASTYGESVMLTFVQRYPDSIVGAWSSGTGISGVAASLI
                     FLGLTSAGLTQQQTFLVTTPLCIIYWLCFMLGMVSPRKVLVATRTNGNREDIILYCPE
                     GEEDAHICLLHERALARHDVVSVSEDYTIKMVMNIRAVSWHQSPVVHKPEPSAEEGDG
                     LYYPCCRVICGCCSPSNGLRRWWRDVGPDLIFMHNTMAWFFFNLAVVYIAEYAAQLMA
                     PFSFYCEPEWKDNFWVKNSYVVCQFCYQLGVLISRSSLLIVKIPYVGVISIIQVVNAV
                     CWIVQARVMYIKSNTKSRQVGLSFILFAWMIFIGLMGGASYVNVLYLILKRSTTLRER
                     EEREAVEAYLTSKARDVSGRRYAEDTELRKKAADERAALVVAKLEGKPVSEIMPKPSQ
                     SDIASAAPQSQILGLALTQEERDAIKAIHCNLNDVWAARREMGMNIGALYATVGITLG
                     TVVDLIFTNTMLKHSKSC"
     gene            <10032..>10319
                     /locus_tag="LMJF_22_0015"
                     /db_xref="GeneID:12980675"
     mRNA            <10032..>10319
                     /locus_tag="LMJF_22_0015"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721745.1"
                     /db_xref="GeneID:12980675"
     CDS             10032..10319
                     /locus_tag="LMJF_22_0015"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721793.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0015"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0015"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980675"
                     /db_xref="GOA:E9ACS1"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="UniProtKB/TrEMBL:E9ACS1"
                     /translation="MQYVAEPSSIRVYYRGNKYDVPLEFATRMHPGGSSILMRYKDCD
                     ITKDFEKMNHSVDAAVILNEWLVDGKHFPEAYMSASSCKAGKEDENRQKKE"
     gene            complement(<11185..>11619)
                     /locus_tag="LMJF_22_0020"
                     /db_xref="GeneID:5651768"
     mRNA            complement(<11185..>11619)
                     /locus_tag="LMJF_22_0020"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683104.1"
                     /db_xref="GeneID:5651768"
     CDS             complement(11185..11619)
                     /locus_tag="LMJF_22_0020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683156.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651768"
                     /db_xref="UniProtKB/TrEMBL:Q4QBZ2"
                     /translation="MSSTVPHAASAKVVVDCKEIGVTIDLHSPPTASNFLAYNRVCSA
                     LDSDYLMQPINEAQYDSETQACVDSLSNGPTSFYDHYVRKPTRKRGLAVGCESPMEHV
                     GVSEDFLMPPAQRDLPAACAQAGAFSDPLTRRLATGRMPPRD"
     gene            complement(<12239..>12805)
                     /gene="RPL11"
                     /locus_tag="LMJF_22_0030"
                     /db_xref="GeneID:5651769"
     mRNA            complement(<12239..>12805)
                     /gene="RPL11"
                     /locus_tag="LMJF_22_0030"
                     /product="60S ribosomal protein L11 (L5, L16)"
                     /transcript_id="XM_001683105.1"
                     /db_xref="GeneID:5651769"
     CDS             complement(12239..12805)
                     /gene="RPL11"
                     /locus_tag="LMJF_22_0030"
                     /codon_start=1
                     /product="60S ribosomal protein L11 (L5, L16)"
                     /protein_id="XP_001683157.1"
                     /db_xref="GeneID:5651769"
                     /db_xref="GOA:P48157"
                     /db_xref="InterPro:IPR002132"
                     /db_xref="InterPro:IPR020929"
                     /db_xref="InterPro:IPR022803"
                     /translation="MVAESKAANPMREIVVKKLCINICVGESGDRLTRASKVLEQLCE
                     QTPVLSRARLTVRTFGIRRNEKIAVHCTVRGKKAEELLEKGLKVKEFELKSYNFADTG
                     SFGFGIDEHIDLGIKYDPSTGIYGMDFYVVLGRRGERVAHRKRKCSRVGHSHHVTKEE
                     AMKWFEKVHDGIIFQAKKKKKMIRRRRR"
     gene            complement(<13969..>14832)
                     /locus_tag="LMJF_22_0040"
                     /db_xref="GeneID:5651770"
     mRNA            complement(<13969..>14832)
                     /locus_tag="LMJF_22_0040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683106.1"
                     /db_xref="GeneID:5651770"
     CDS             complement(13969..14832)
                     /locus_tag="LMJF_22_0040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683158.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651770"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:Q4QBZ0"
                     /translation="MWKQASARLNIVVAPCVQYQYVGAKGCHGLVCKAADTVRDGEVL
                     ALVPYLACISPTIALASPWGQQLAAALRTYTVEENGVRVSYSKEAALTTVFTALAMQP
                     CSPLEGYLRQMRLDEGDGASLAVALGPELTAHMMKIDALNSLVVAQMHEDLSRWHIRV
                     PMADLVRAHRACASRCVDVPDSEEVFGGPSLVPVVDLINHGITEPNVTVYIESTNRLG
                     PLLRRHSRLNIMDNLVKAGAFCVVIRATRDVMGGTEFTYPYIDPTEDPTLYASKLYWA
                     SRFRFVPLEAA"
     gene            complement(<15455..>16867)
                     /locus_tag="LMJF_22_0050"
                     /db_xref="GeneID:5651771"
     mRNA            complement(<15455..>16867)
                     /locus_tag="LMJF_22_0050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683107.1"
                     /db_xref="GeneID:5651771"
     CDS             complement(15455..16867)
                     /locus_tag="LMJF_22_0050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683159.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651771"
                     /db_xref="UniProtKB/TrEMBL:Q4QBY9"
                     /translation="MGPPALTSTATSREEGDSPTATVPSMEERWSTFQRLAQASEATF
                     RSMSEATARQHADVTAHQKEIAAYQESQRQLTLQQQQRLDSLTRECAQLRQTEASTKE
                     VVAHQVERLVALESELQTTRVQLSEIRLAQAQCVEERKRLQQACKMHEVHTSELQASL
                     QFADEVVRSMRQTVAACEREKNEALMQQYSNFESYRNNLIAAYDKRAAEARDEFAKRV
                     ESLQAGMLETVAKREEQLKASWEETATRMRHEYDELVRLGQQRRAAMDTELRERKEQL
                     ERDKEFMRVQQREEADMMEQRFRAREETLLDDIARRERELREREAVLRAAQAQQEVDV
                     QRRLQAREAELRAAHDAALKRMADQAAAEREKLSENFMERLQQLSNAHMQQERELERM
                     HREKEREMAQRYRLSGIDGGDRGEVRDRRATEYALASPSMAKEALLKKFETVEQRQRE
                     RSDKLRSAFSAQENELQPPL"
     gene            complement(<18390..>20708)
                     /locus_tag="LMJF_22_0060"
                     /db_xref="GeneID:5651772"
     mRNA            complement(<18390..>20708)
                     /locus_tag="LMJF_22_0060"
                     /product="transcription factor-like protein"
                     /transcript_id="XM_001683108.1"
                     /db_xref="GeneID:5651772"
     CDS             complement(18390..20708)
                     /locus_tag="LMJF_22_0060"
                     /codon_start=1
                     /product="transcription factor-like protein"
                     /protein_id="XP_001683160.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651772"
                     /db_xref="GOA:Q4QBY8"
                     /db_xref="InterPro:IPR000967"
                     /db_xref="InterPro:IPR001374"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="UniProtKB/TrEMBL:Q4QBY8"
                     /translation="MAEANVENERSVRVADELRREVYECPSCLERVKLQQPIWSCKEC
                     FQIYHFACIRRWAQVDRDTVVFSCPQCRHMQPKPLTDLCFCGKVSKPKYDPLVTPHSC
                     GRLCGLVRPFCTHRCPAQCHPGPCPRCQLLVGPQRCPCGATIYTYPCGQPDPETTCDN
                     PCRRPLACGTHTCPLSCHTGPCPPCSESTTLICYCGQTTKQHPCTKETSFACGSVCGK
                     SLRCGKHTCTLLCHSGECPPCPTDPASVHTCPCGASELQTVRYACTDPVPQCGRICNK
                     PLSCGQHRCQLKCHAGACPPCEVRVDVSCRCRKVRKRLSCAESKNFTCTYECGTKLSC
                     GRHKCKVVCCPDRNKTQTNSHMCFQVCGRPLPCGHTCEDLCHASTQCPPCVHVVTEML
                     TCYCGAEVLRPPQQCGTQPPVCKRACRIPRPCGHPVGHNCHCGPCPPCGALVKRRCPR
                     HNTLVTLPCGVTDLACEEECGMEMPCGHFCDRVCHSGPCVEEANPCHQQCDRLHEECG
                     HRCAKPCHGATPCPPCSVYLRCTCNCGRVTRSLPCAKVGKRKAEGPNKFAVVVPCDND
                     CLFTRRLDVLTSLSKTKNEKFLYSLMLWDAAQQDACAVQQVERQLMNFVEGKESVVSL
                     PPTNSATRALVHALAKYFHVHSEGVDNEPNRSCLLTKTGATAAPPVLLSDAVRDAQMD
                     PLQFLMQRAKPSLKEKLCLVVTGHHLTEVLLASLLSDLAGRFVIAPPEVGKDGAQSFL
                     IAFTTHKRAEEAVKKLEASNTQRTFTVARATA"
     gene            complement(<21623..>22492)
                     /locus_tag="LMJF_22_0070"
                     /db_xref="GeneID:5651763"
     mRNA            complement(<21623..>22492)
                     /locus_tag="LMJF_22_0070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683109.1"
                     /db_xref="GeneID:5651763"
     CDS             complement(21623..22492)
                     /locus_tag="LMJF_22_0070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683161.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651763"
                     /db_xref="InterPro:IPR011335"
                     /db_xref="UniProtKB/TrEMBL:Q4QBY7"
                     /translation="MNTHVISVGSRWVHHEVTQALRQRRGVRVEVNEELQHCDFASRA
                     SSVLYCDAHSAEMQRDQASLVLRLQEARQRCGTQPVILMVRMDSDNEVSLERLSWLNL
                     ECGVAQQCGLILVWSLDDAVQYLASLAAYAVTSLEFTGAARPYVGDAPLPVLVDALTQ
                     TPQVVTRNDVVRIANRKTSVADALMSEASEWEGIAGLGRKKAARLQHLFRTPFLSSQQ
                     RIDSFVPATGGSSFSTASKAAESHLSQPTGESTARPTEALSVDTAVTTEGRRRMMSAL
                     QQRLDKEDEEGGE"
     gene            complement(<24633..>25628)
                     /locus_tag="LMJF_22_0080"
                     /db_xref="GeneID:5651764"
     mRNA            complement(<24633..>25628)
                     /locus_tag="LMJF_22_0080"
                     /product="putative heat shock protein DNAJ"
                     /transcript_id="XM_001683110.1"
                     /db_xref="GeneID:5651764"
     CDS             complement(24633..25628)
                     /locus_tag="LMJF_22_0080"
                     /codon_start=1
                     /product="putative heat shock protein DNAJ"
                     /protein_id="XP_001683162.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651764"
                     /db_xref="GOA:Q4QBY6"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="UniProtKB/TrEMBL:Q4QBY6"
                     /translation="MFGGGMDDMLNAMLNGGMASFGGGRGGRVQRSRRGRDAAYALPV
                     TLEDLYNGKMVQVERKRTVMCPDCKGTGSKRRNLPRCGNMCPVCRGSGSRVMVRQMGM
                     MVQQMQVVCDACQGSGEHIDPRNRCGRCSGNKTVEVDASVQVVVEKGMAHRQRITFPR
                     MANEELGVERAGDFVVVIQQVKHNVFTRDDCDLHMQHHLSLAEALCGFQFKFTHLDGR
                     ELVVRQARGTITKPGDVKCVIGEGMPVHKQANKFGNLIIEFNVKYPDRIEAEQLQLLR
                     EALPPPKSVDVAADNEASDVCYVTREDLSVLEEEIKKDEEAEEENEGPQTGCATQ"
     gene            complement(<26368..>29481)
                     /locus_tag="LMJF_22_0090"
                     /db_xref="GeneID:5651765"
     mRNA            complement(<26368..>29481)
                     /locus_tag="LMJF_22_0090"
                     /product="putative methyltransferase"
                     /transcript_id="XM_001683111.1"
                     /db_xref="GeneID:5651765"
     CDS             complement(26368..29481)
                     /locus_tag="LMJF_22_0090"
                     /codon_start=1
                     /product="putative methyltransferase"
                     /protein_id="XP_001683163.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651765"
                     /db_xref="GOA:Q4QBY5"
                     /db_xref="InterPro:IPR004971"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR013846"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4QBY5"
                     /translation="MQLQSLKALSEARKDAPHHRWCCHANDAWYNAVHADGAAGVSDA
                     QMTDVEAALEGMLNDASPLCAEMLQCVLRHANVTPNPNDAEFPGPMCTPLCKKDTARL
                     RQHAYTVTEKSDGIRVVVVSLWTPRFPAWVADSAADAVSASVNLSHLASVLALERARR
                     ALRRYAGQGEDAAVRATISLGGRSCTLELLSTLEPCESECFTLRVATAADDASPSTMV
                     TLHRHRRGRHFAYAVDRSLDAAYLFMDDHTTLQYHTFVLDAELMSVHRSAAASPAVPR
                     LVLGVFDLFAYAGAADNVLVNLAKRSMVERYDALKAVVHTCALPVSTGECGYVSWYVK
                     DMWALADIGACLAKLRYSAESQCFLYDGPHGPTENDGLIFTPDEFPVAVGSSSLQLKW
                     KWQHLLSIDWLLQASDKQPDMYTVSLFFVKKNYGHREDVAGHWRLRKPMHILNPHGFE
                     MPVDAAIVAECAYDEATQRWYIQRLRPDKLGANSIITAISVYESLVENISLPHLLELL
                     QVDAEKAKGQADTLESAARARVGTASKALETVSSALDTIEAENCVTAKLALRAIRESR
                     GNTELYLITYTNNTNKTVLYPLPFPLRKIRDCIGLGYHPGIRDGTPVPSLEEALYIQL
                     ANAGGCYAWSDYVVDAFYAGDSGYWEIIHANPRGNNKEAIFDNVIEHLDWLLRHRTAP
                     ETATLLERKRDAPLVVSRPHSSEATQQTSRHYSTVAKELANEERSDLRRFNNWVKSVL
                     LTTMAAAIRRALKPPAKLHVLDLCCGRGGDLLKWQHIHPAFLFMTDASVECVAEAAAR
                     YSTSEGQSVKVAKGKQKGFPAFFAVHDAFHAASGLREDLLKRGPFQLASCQFSMHYGC
                     RSQESMRYFVKAIADSLVPHGRFVGTTVSDVELLYRAKEHGAEFGNDVYGVRFGAEAF
                     AQLQSANFEPAALSFGVPYAATVERSVQDMTEYVVPWDAFVALCAEHQLKLVLEDNFI
                     HYYGQHKDTEAGKAMTLEQRRKRHNDGDVVDCPLSPSEQAAVGLYRLFVFEKTKAKQS
                     SCGTAER"
     gene            complement(<43190..>43921)
                     /locus_tag="LMJF_22_0100"
                     /db_xref="GeneID:5651766"
     mRNA            complement(<43190..>43921)
                     /locus_tag="LMJF_22_0100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683112.1"
                     /db_xref="GeneID:5651766"
     CDS             complement(43190..43921)
                     /locus_tag="LMJF_22_0100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683164.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651766"
                     /db_xref="UniProtKB/TrEMBL:Q4QBY4"
                     /translation="MCAAMSIAETSIPLVNVYAKPQEVETRITPSRLTVSFASRASSS
                     CSPMPVVPSCARDDMALQKEMVEAHKQAELAAFIAKHEKTCAISEADRRRSIIMLLNT
                     AAQRDIDEGSRAGYPQQVVDFMRQTWAAFIQQAKDFYQEDAHEPFTMELSRNALENTS
                     SIGVWFTGPQISLPLRRYTVQVVGADGAPQNITAVGLLSFTYSTYVMHLRSMSQQSAL
                     DGLARMQEQLGTDSLFLPQILVAPS"
     gene            complement(<46558..>48528)
                     /locus_tag="LMJF_22_0110"
                     /db_xref="GeneID:5651767"
     mRNA            complement(<46558..>48528)
                     /locus_tag="LMJF_22_0110"
                     /product="putative GMP synthase"
                     /transcript_id="XM_001683113.1"
                     /db_xref="GeneID:5651767"
     CDS             complement(46558..48528)
                     /locus_tag="LMJF_22_0110"
                     /EC_number="6.3.5.2"
                     /codon_start=1
                     /product="putative GMP synthase"
                     /protein_id="XP_001683165.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651767"
                     /db_xref="GOA:Q4QBY3"
                     /db_xref="InterPro:IPR001674"
                     /db_xref="InterPro:IPR004739"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR022310"
                     /db_xref="InterPro:IPR025777"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:Q4QBY3"
                     /translation="MSHEGAPQGEYVAILDAGSQYGKVIDRKVRELHVETSILSLNTP
                     AEKLRNDANLKGIIISGGPSSVNDATSLAYDRAIFSMGKPVLGICYGMQMLTELYGGE
                     VCRGKVREDGQDNIQVDTSSPIFAGLESTEAVLLTHGDSITAVGSELKVIARSSAGII
                     SAVQHRSRPLFGVQFHPEVELTVSGKTIFKNFLQLCRCNFSFTMEDREAVALRLIRER
                     TSGGQKVLCLASGGVDSTVCAVLLLKALGPERVVCIHIDHGFMRLNESVQAVEALNAA
                     GVRVHLVKAQEDFAQASTEMTAKGSRAAYTTNKLREVTDPEEKRNIIGNTFMTVCDRV
                     IKELQLDVENLLLAQGTLRPDLIESGSKYASVNAAAIKTHHNDTAVVRLLRDAGRIIE
                     PLCDYHKDEVRELGARLGIPCRLLERQPFPGPGLAIRTLCTDGTPFRDGNFEDTQTTV
                     KRVCMGADASSAEVAALAQKATLSACILPVRTVGVQGDGRTYAYAAALSMQTFPTAEQ
                     WATLIQLAKEIPKTAHAVNRVVFMFGPPQSESPSTVTPTYLTTDVLEKLRVADDKVNS
                     ILMKHQLVRSLSQVPIILIPIGFDKAGGYSVVVRTFLTNDFMTGIPATPGTAFMPLAV
                     LEEIFNEVQKLEFVGRVMYDLTAKPPGTTEWE"
     gene            complement(<50395..>51129)
                     /locus_tag="LMJF_22_0120"
                     /db_xref="GeneID:5651773"
     mRNA            complement(<50395..>51129)
                     /locus_tag="LMJF_22_0120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683114.1"
                     /db_xref="GeneID:5651773"
     CDS             complement(50395..51129)
                     /locus_tag="LMJF_22_0120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683166.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651773"
                     /db_xref="UniProtKB/TrEMBL:Q4QBY2"
                     /translation="MDKSHVTELIQRWRVLKGNLTEKASELETVRKSLQELEGEHAKM
                     MQQWDLEKETIRNTSSAIEAQVASKKDELQRIKQETQELHRKVEERRRRNEEHQLVLS
                     KRKHIVDARVKEAEEKDAAARERLTTFQRSRDEARERLLAAVKKYEAAIPQDQAAHED
                     KVLQLKSRISETLAAIEAEAKSWALEQAMKEWNEKSNARKHILDEVAAAEEGKDAWAD
                     LLHEANNIHIQDNLKALAELRAIVSA"
     gene            complement(55928..57273)
                     /locus_tag="LMJF_22_0130"
                     /pseudo
                     /db_xref="GeneID:12980676"
     misc_feature    complement(55928..57273)
                     /locus_tag="LMJF_22_0130"
                     /pseudo
                     /db_xref="GeneID:12980676"
     gene            complement(<59936..>61591)
                     /locus_tag="LMJF_22_0140"
                     /db_xref="GeneID:5651775"
     mRNA            complement(<59936..>61591)
                     /locus_tag="LMJF_22_0140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683115.1"
                     /db_xref="GeneID:5651775"
     CDS             complement(59936..61591)
                     /locus_tag="LMJF_22_0140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683167.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651775"
                     /db_xref="UniProtKB/TrEMBL:Q4QBY1"
                     /translation="MLLLRVSTSLCVALRLLLLSPSHAASERSLVRFVSVTGVVVAIF
                     FSHHWFVRVSCSSFVFSLLVCYVRKLGVRVHVVLPLSRRRRPASVSSQHSTMTYYGYQ
                     PEQTKAQIRSTRGETIDLALPVTCLVGELRSFLIEEYGYDPNTRLLYNGLVADDNSYV
                     CDYPFGSLMIATPADIHSQRQSLPPRQPAVAHVPPHQPQQEPTPEFSRPTAHLSPTVS
                     TSADAVLKNKPAETMPTYSSAAARKMSPAEAPPETAKAKRNTTGLKHRPKNSARQLRS
                     ISTESTGSQSRLMKGDGASDTASSVPAPSPPAPPPPLSAANNGASLALGSGRALPGTG
                     QRNSPWPQGSQNATAAPSSAAPSQATDLPPSPRSEEPSVAAAVPSGEGGNEDDNQRRR
                     VQLTVECHIPSLNQVVPVNVNGDSSVSDLILAAAAAVPGLKPDAQVVHRGKVLMASPQ
                     AKLFDHGIRSDARVFIAEGEYNNAEKIALLEIEEDIAVIERAMESPLTDLQRKGYYEE
                     LMRILFRTDGLQSLEGEWRQRRKDAVKHITSLQDALGVDVKES"
     gene            complement(<62431..>63858)
                     /locus_tag="LMJF_22_0150"
                     /db_xref="GeneID:5651776"
     mRNA            complement(<62431..>63858)
                     /locus_tag="LMJF_22_0150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683116.1"
                     /db_xref="GeneID:5651776"
     CDS             complement(62431..63858)
                     /locus_tag="LMJF_22_0150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683168.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651776"
                     /db_xref="InterPro:IPR019128"
                     /db_xref="UniProtKB/TrEMBL:Q4QBY0"
                     /translation="MDHIFVRSDFACRHEYRLVSVDDACVQQLKEQVYPSPSAGKGAT
                     RSKRARASSPPSATIRSDDVAVVFVMKGDGQLCLHDARSTRSVRRVEYSNTMLLATRR
                     LNRAGRSAVCESRDRGSDVCNTEGTATATATPLPASRVRQYTNNVVVSSLSRMFDSHA
                     AHPQDNVSAVLGESYLTIEELEGTDGGSGGSGAAGPSGRGYTFAQLARMFRSSPAELA
                     DLLQSIGAVVHRGLVRLLHPSLAHESLAAVLTFLDTAEPCNASWAAAREHLCPSVYPD
                     VVLRSLEAVYGAPRGAGEATKDNDSVVLVGMPALLNLPRVLVGLAGGVFDAHQGVVHR
                     TLGTGEVACGLPLETFAKAWMDAIPSSLFGVAGIPHRGAAGVQKTLMEKLRGYVVVES
                     RSGGFGGSMQDTVWWVPKESLSIDFAARLRALFELRPQLWDQIELKVYLGTLVPPDQS
                     FEHVILRHTREYRIPGKPVQYAPLA"
     gene            complement(<67116..>68348)
                     /locus_tag="LMJF_22_0160"
                     /db_xref="GeneID:5651777"
     mRNA            complement(<67116..>68348)
                     /locus_tag="LMJF_22_0160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683117.1"
                     /db_xref="GeneID:5651777"
     CDS             complement(67116..68348)
                     /locus_tag="LMJF_22_0160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683169.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651777"
                     /db_xref="GOA:Q4QBX9"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:Q4QBX9"
                     /translation="MSYTSHFGSHSSLPTVRVGSAANSMPAGLYGSRNMACSLESGTL
                     LRPRQSDRASRSPLICSQRLGKYIAGMSSISAIDTASTKLSIPITAVEPTLAFEDDGL
                     VPGLCRLFMEGRCRQGDRCFQVHANPSVVEQLRQEAFNTPSCCPAHGAKCNMEGFPLG
                     LAVIIDPPREKESGAMVEAHAARDNGSAAGSLSNGETNTADTGGDAYSGHSINNREQV
                     PIALHNVCPTRFLWSRYEENGGMLLHMPRSKVCREHRKGLCRFGNECSFLHVCRQMPI
                     GSGDEELLSHSRTPLRHSTVQGSMQDFSHPPSFATASGSLCHHAHSQSYSQANLQHFQ
                     GSTVMSQNGSYMDGSLGNSQTGSRPHLSRAPTASESYGGHQPLLRPLGGVQNSHSSVA
                     ARGSFSHNPYAEASSFQS"
     gene            complement(<71221..>74775)
                     /locus_tag="LMJF_22_0170"
                     /db_xref="GeneID:5651778"
     mRNA            complement(<71221..>74775)
                     /locus_tag="LMJF_22_0170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683118.1"
                     /db_xref="GeneID:5651778"
     CDS             complement(71221..74775)
                     /locus_tag="LMJF_22_0170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683170.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651778"
                     /db_xref="GOA:Q4QBX8"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="UniProtKB/TrEMBL:Q4QBX8"
                     /translation="MTDGSYSYTGSYTGDYSYSYSYSYSDGTGSYTDSTAEKSQGRVP
                     RAAPAAKNTQSKKMPSPSKPEPTKNVESEESYSYSYSAPSSPNEGTAGAAVPAAVNSA
                     SKQKRPTNANESDDRSYSYSYTDGDDSYSYSYSDSKAGTASPPALRAPKVEVAGAGQQ
                     HTTPAAGHADRSAGATPPPVTSTAAAATNVASTGSYSYSYLDSDDDDGSYTYSYSYSN
                     EGDYTDDSHYYSDGSYYYSNGSYYYSGGSSYYSDSSYYYSDSTSYYSDGSYYYSDGSF
                     YYSDTYSYTGDSSYYYSYSSSVTSGEQRGRRGKPGAETASGSSDYYYSYSSDYADLSD
                     SYYYSSSYTGEDSYYDYSYPSYSYSSYTDSEGIHHHAVDRAKRREAAGGSGTSSYTYS
                     ATSKSPTSTSSYAYGSFAAFLLSESRTAAQRELLVLRAPVKDVPHPPQAPNRCFVVFK
                     TTEDAVWAFLQRLMAVQKLYEERRAAAAGQVVAPISFMECAKSPSLCAAGTFGSEAAE
                     QEDTVTPFIPTKDGCFSERSMRIAFRVLRLNHLERREALKNALLPLPMEVMLDIFSTC
                     VAARAKEHVVQAFLAHDTYHSGEMSLTQLCALLRRLGLGTSPIIEGHRISIGVSTEGA
                     LEMVVNVEQVVQSGAPAAPVSAKSQKPVNWEVTPVHVLRIIRQSAARNESAPVRWKNS
                     RLYMGRHAIVCNVTTKALFQRLKTYIEAATHLCVLAKVFSIKDAAKGTLTVQYPQFIR
                     SVLLAEPSAHYHADTAAWAAPRKLLYIENVFRAVFHPFGVLRAYAAGRPVPRYHRDWA
                     LESTLYSTKDTEEKRRRNVVPGIGTDMRLMPDPSSRPADEVQLSFVLQKVRVPAQLPR
                     YARCFCLVSAVTPANVFLPAVEVPVRLIVASATKCGYYTWMLHDKKHKKRDAVLQFAG
                     SAVDRIYVECCYETHDIWPPENSEDTAASTAPSCTTTVWCAGYAVFAVNGARTAVLPV
                     KAGSLLQEQPYYSTLLGSGVAAGTAASAMMMTPGGNYAKLQNDSYCCASKSSRCCQHR
                     YAADKAHQIKVKVLKSEKPIPGAERLPARYIAFQRHVPMISQLRAAVELVGRETSHVG
                     QAFRQQAVRYIFSVAADPALLDQLCGLWKYRERHWSKAERKNEEHKQRTLLSCVAALY
                     ALKNSCAGSQEIFAKSLEKGKPLQMTIDPAAPMVPVRV"
     gene            complement(<79177..>79959)
                     /locus_tag="LMJF_22_0180"
                     /db_xref="GeneID:5651779"
     mRNA            complement(<79177..>79959)
                     /locus_tag="LMJF_22_0180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683119.1"
                     /db_xref="GeneID:5651779"
     CDS             complement(79177..79959)
                     /locus_tag="LMJF_22_0180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683171.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651779"
                     /db_xref="InterPro:IPR007999"
                     /db_xref="UniProtKB/TrEMBL:Q4QBX7"
                     /translation="MPRTRDTRQPVEEVVDGMHGVASQVHVNVNEAAQNAQKTISDAA
                     ATMQNAPDAAQNGVQNAMSTVQSYVHEGQRFASEHKAQLQEAVKKAVNAAHGYVEDAR
                     KKADPYVESAKAKVDSARASVENARHSAQNAVDNAKEQVTAVRTKVTVKTQPYVSNYQ
                     EFDVTKTAAFHVLTHVISGLLYIVWRLTQLIPSAQHMITVIQKKEADAAVAQNCATVM
                     QKVPVVGPRAVEVATIAFNNVCTDLNEQISQYATATQRPKTA"
     gene            complement(<83439..>84785)
                     /locus_tag="LMJF_22_0190"
                     /db_xref="GeneID:5651780"
     mRNA            complement(<83439..>84785)
                     /locus_tag="LMJF_22_0190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683120.1"
                     /db_xref="GeneID:5651780"
     CDS             complement(83439..84785)
                     /locus_tag="LMJF_22_0190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683172.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651780"
                     /db_xref="GOA:Q4QBX6"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="UniProtKB/TrEMBL:Q4QBX6"
                     /translation="MAKYFVPDTTFGLDAECAVCCCLWTDPVEISECQHIFCRGCVEG
                     LETCPVCCGPVTRLDTPGKFILRLLQRTQGSCSACLWKGTYSDFKEKHFECLEADEVQ
                     SSDEGKILATTECVAMREYYLEGSGAKPEGSAPSPAAVDSFLVHPVAAVNAGSPHAQP
                     FADATNNGAPVADAHLTCEQRAQWRQSLTSTARDYGMSDREYRELMECFPDFAVPVPD
                     RGMAPELRWRGACRLLRFLNYPNHPDDVKNLFEMADRDALTESVPFHVLCLWLMLNRR
                     NPAQWYHMTAEPYEQFLKVAQLLDVEATGLFQLDQCRILAEQYFERDVCDAEWLRIKR
                     LLRSKDAEIRQSFLSSANRRRVNLDESFALPSAKLPLHDVLCAFTRHVDALKKEQQQQ
                     SEAERVQADYVRRIKRIVDFYEPDAVNQLDATLQKFTGEEESLLMTLTAMYGPEPP"
     gene            complement(<86332..>90918)
                     /locus_tag="LMJF_22_0210"
                     /db_xref="GeneID:5651781"
     mRNA            complement(<86332..>90918)
                     /locus_tag="LMJF_22_0210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683121.2"
                     /db_xref="GeneID:5651781"
     CDS             complement(86332..90918)
                     /locus_tag="LMJF_22_0210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683173.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651781"
                     /db_xref="UniProtKB/TrEMBL:Q4QBX5"
                     /translation="MPPPHAARRGRSHSGGVNVSERQPNRSASPRNGGNHSSRPRIPA
                     AHAHGERNASGASRGRGTNPHKSGALRLKKGLTKYHEKKFREQRGRQQTHQHSGASRI
                     HADPARSGSSNQTRPPRMASSSRTKDIDINLAAKVSADLRESLNVFKTRRANQSVFCQ
                     DLNKRLFRFVPPPLIQQHMPDSVSSFRTYLSRFQKGAPTMVSAFLSWYEWASFEANKG
                     KTFSKPQSSGAGTAAAEKGDADEEAAPVKGEAAADGDDKKASGRKLSQTHQVMSQTLK
                     EREHMRALLHMCLRHNAEKRKQGQHAFLNHLNAKMSEDDVDTRNLERLRGSAHHSVLY
                     ALSRLLLGMVTDDFAMLCLHCHALFLVMTQTTISPAVVLELMDEEFALSTRMKAVKLR
                     LESRSCRRDGEDDDGGIDPDDISDPTKGERNQRLMATVFALGAVVASQKRLSLPEASQ
                     LATVLAFAYVEQKATRVLSANVLFQVLAQHSDVYQQEEPLQWLTFAFFHYPKMEYFRP
                     EAIQLLLRLMETDTKPPARVLPATVEEYLTLDPLSPTTMEQISNALFRKEQVTAYHPM
                     VHPVWHDIFQLVVRRVAMGESIKEHVGTILHNMIVPYRRGSADVPRRALFQNLVTELG
                     YIAVQSDDAEQRMEVLKLASTHVGYGKRTSAKATPMQELKKMPISALHRKVEDLLRQY
                     AMTADSDPAAVTNRTWVLRELRNCLYVPVREGVDHAYVDAAVMRLLEFGLFPPRHSRD
                     TLSQNRCIYLFADVYSFTFHGPLTRPKSSVAATTIISAYLAAEEKSKTRYTTAVQHSS
                     FRKSRNRVVEALEAADEQRSVLFYERADMDILLVLLFLMLSVDDPTNRDAMVIAKSVI
                     PDLAQFYTAGTLETLDLFLDALMALLMRTSAPLHVMPLMTCVRRIAMGFILKFAKFIR
                     TKSTLDILLAPLKDAYHTDSREQARQRKAKQAAGDGDGQSSSDEDGGDAGASSDGDSV
                     DGDDGDEAAEGGVGSSEDDASSSVEESSTETVSATASDSEAGTLEEEEDDEAVADEVT
                     DAESSEGDDEGAFEEEEAPTQQYIDALKGMVGGMDLDHVYPTGTASQEKADVVRAIRL
                     ATRVGLAMRSAEVVHVYQVLLAVARENVKTADDVVFHSAVSSLEMLLLTKNRYFGSFV
                     AATDLFQLLGDIQSYLRKLSRVLVSKDGVMAKAAAAARRRLITVKGIALRVFHFVAML
                     ASKNHAGEEVRIVLSEYYKSVFCDRGWDTKKLLPSLKKDLYHYRQGFAWALLPAVLEK
                     NEEVLPLEGPQRVRVFTGCCVFVEAMLPRLSGLPGELKRSASAAICGFVQSVPVAQVF
                     AMKHTLPYNYLHMVKMVLQYNSRVQLDTAWVASAVIVPAVDDDDILLSAASIRLLGAM
                     ERMLGLTPRARETKAPSPVKLLYEQFAKRGAKAKSDFYRRAKKVRSRVLKALLAHRND
                     DPTDEERSAKRRRKEELKIEDRLQRQVLRSARTEALTKEEREEKRKRIMMAKQERIAK
                     NRERKRRLHEARQRSFEKWRQAKLAAASQVTEDD"
     gene            complement(<92299..>94983)
                     /locus_tag="LMJF_22_0220"
                     /db_xref="GeneID:5651782"
     mRNA            complement(<92299..>94983)
                     /locus_tag="LMJF_22_0220"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683122.1"
                     /db_xref="GeneID:5651782"
     CDS             complement(92299..94983)
                     /locus_tag="LMJF_22_0220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683174.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651782"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013618"
                     /db_xref="UniProtKB/TrEMBL:Q4QBX4"
                     /translation="MKGPAKYPLAAKLAPWRLLCSADTYMHAFLLLIAAAIFSNGVRL
                     GMAFDDDAAVVNNPDAHVDKTSLGSIFYNDFWGKPIDSFDSNGSYRPIAVLTFRIQHR
                     LMGYRHSPAFLHGFNYTIAYLNVCLVFYLARLYIYVVVPSAVLAVENAKPQSLTALLI
                     SPVHAVPLMAALLFLVHPVHVDAVTSIVGRCELLYCLFGLIGFFCIHRYLNQVDETAS
                     TAPVTAAPPAKQSKGARVPQKQSRKRVSTEHYLVLSIGALAVSVLCKDSAITFTAVYG
                     VHACVMYACGRCQKRRSFVVIVLTVVELLSYLAFRRAFVGDVDLRTNPLLNQSEHPQY
                     FVPKGLFHWLSIRWLIQMKNLELLFFPTSLCNEYSFNCIPHVHSMRDPRVPSFLAITG
                     ATVLTLLSLLYGTFALRSRAALAGLAGFLWMAIPYAPVSHLFVAVGTFIAERCLYVPS
                     IGAVLLITFVVAAPSLRDGVVARYFYALLLLCVGWGVFSHRRNEDWQSNEHLSRAATR
                     TCPNSGKAHFQLAAAVAARESFVTPEVVALARRSLELDPSSHHGYYHLALYELEVNDD
                     KRKAYEYLRECLDDRFAYMPCEDLYRRLRSVVYPHMTTVEQYVDLATVLHRDSYKAVY
                     LREAGLIALQRDAKPCLAKKLLDSAMTRWNNSNVYWMSDEVSRGVGDSTYCNALYWYE
                     QSFLQCEKELMAGGVESARGEKESEGDDTDDGARSSSSPPSRKFTQPTQQEAVRAAAA
                     AAEHFRHCGTDWHSLLSGPTYNYITIPHRMTDYVFVGTSTASFIAHFISYTARDTPAR
                     NTLLLAYLDTTLRQYCHFSALLHDDYVNAKIRQLFKDKMQSIVQTYSLMRGTLVSRIQ
                     STVRDLRGSSSLSATQSETLRSLLATSPCASELPSFAP"
     gene            complement(<101894..>103351)
                     /gene="AAT22"
                     /locus_tag="LMJF_22_0230"
                     /db_xref="GeneID:5651783"
     mRNA            complement(<101894..>103351)
                     /gene="AAT22"
                     /locus_tag="LMJF_22_0230"
                     /product="putative amino acid permease"
                     /transcript_id="XM_001683123.1"
                     /db_xref="GeneID:5651783"
     CDS             complement(101894..103351)
                     /gene="AAT22"
                     /locus_tag="LMJF_22_0230"
                     /codon_start=1
                     /product="putative amino acid permease"
                     /protein_id="XP_001683175.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651783"
                     /db_xref="GOA:Q4QBX3"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:Q4QBX3"
                     /translation="MSHNPDYTVMQSGGHQRCNDETQSSTPASGDNRGAAEIDAAICT
                     QEKEMHETFDQVHQLVTECNAEVEEPKQQPMFLVRLTRRVIPPGGFASGVFNLAGSSL
                     GAGILGLPYAFDTSGIVMGTIYLIVIYLLTVYSVRLLAIVYGKTGIRSYELTARILFG
                     RGGDIFTAVIMFIKCMGACIAYVICINDLWHAFLNDDRVQGYYRSVSFQRILTSATFL
                     LLMLPLSLPRQINSLRYVSLFGVAFVLYFVVCVVIHSATHGLKEGITSKGLRLFNTGN
                     RAIQGLGQFVFAFLCQSNAYQVFNETPKPSVRFFELQVLVSMLICTAFYWVTGFFGYC
                     DFGDKVGSSLLRMYRPLTDYYFAVAYFGLVVKLCVAFALHILPSRDSVHHLIGWDLRT
                     VAWWKNAVLCTFLSLVSLLCGLFIPNVNTVFGLLGSFTGGFIAFVFPALFFIYSGGYE
                     LKKVGYYNYFGAIVLLICGVTIICFGTTATIYGVV"
     gene            complement(<104856..>105845)
                     /locus_tag="LMJF_22_0240"
                     /db_xref="GeneID:5651784"
     mRNA            complement(<104856..>105845)
                     /locus_tag="LMJF_22_0240"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683124.1"
                     /db_xref="GeneID:5651784"
     CDS             complement(104856..105845)
                     /locus_tag="LMJF_22_0240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683176.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651784"
                     /db_xref="UniProtKB/TrEMBL:Q4QBX2"
                     /translation="MSAHSTEEHGVLLPGTQSQRQEEEAQQQPKLDASSVPTETRTDE
                     AVSLSPAAKRHCFEKQAQKEVTAGATRLIDLNEDADLESAARVSATVALRDDLASPVD
                     ARVGGAIGSVDVSGSTLCVEADVTSVSDKTPAGSDRAAEPACAEKGAVTPSVREQEAL
                     SHTQPPQAMLHTECEDTPAQHLPMEDGNAAAPPVCRGIDEEEAVASPPSALSVTLAHL
                     SQAEEKTASGVTALNSDTLDGNGAPRCHAEGRVGSATETEPTADTVTTTEIPSPIPED
                     DENDCLPPSRLSEAATPPPSVAAVDERPMAAGKHLTFADDAAPQLSMTRSSTA"
     gene            complement(<108240..>109016)
                     /locus_tag="LMJF_22_0250"
                     /db_xref="GeneID:5651785"
     mRNA            complement(<108240..>109016)
                     /locus_tag="LMJF_22_0250"
                     /product="phosphoinositide phosphatase"
                     /transcript_id="XM_001683125.1"
                     /db_xref="GeneID:5651785"
     CDS             complement(108240..109016)
                     /locus_tag="LMJF_22_0250"
                     /codon_start=1
                     /product="phosphoinositide phosphatase"
                     /protein_id="XP_001683177.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651785"
                     /db_xref="GOA:Q4QBX1"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR025163"
                     /db_xref="InterPro:IPR026893"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:Q4QBX1"
                     /translation="MAAHKRIIEAEGLQNCRDLGGYRTRDGKHVVKYRHIYRSDNVGD
                     VTPEGKKMLLEKLRLKYIIDFRGAEEKARSPYAFAGVTYLPIPIETCFVTEHMLTKPS
                     LDGPSAEALLRRIATTFLIDFKDVYKSFFDVFLREAKGQPVLFHCTAGKDRTGVAAAL
                     LLTALDVPAETVMEDFMLTNRCCVPPSCETVKVGNCIISKDAVDLLFRAQAFFLELCF
                     GEVCKRYGSVNAYMEKELGLGAVQLQKLRSYYVRPTSSSS"
     gene            complement(<111818..>112666)
                     /locus_tag="LMJF_22_0260"
                     /db_xref="GeneID:5651786"
     mRNA            complement(<111818..>112666)
                     /locus_tag="LMJF_22_0260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683126.1"
                     /db_xref="GeneID:5651786"
     CDS             complement(111818..112666)
                     /locus_tag="LMJF_22_0260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683178.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651786"
                     /db_xref="GOA:Q4QBX0"
                     /db_xref="InterPro:IPR005595"
                     /db_xref="UniProtKB/TrEMBL:Q4QBX0"
                     /translation="MLGALRKLFVLALVALLIASIVVAEVVPAEDSDAIYFSGEEADD
                     MNAESEAGAGRAPYVSRVLFLNASSQSFPSFHVGSKANVVIAFQNNGHEASQVVFLVV
                     GLLQPPRQYHTTIQNFSVVRQAREVKKSETVSIQYTFTPDVHLESGEFNMVLGLYVQD
                     SATNQTYFITAFNSTVMLEDPLGTDPRTVLTYFTLLAIFGGIAYVVGEKLGVVKMIKA
                     MTHSKGNSNGSGSGAKHMEMGTGRTGYDPAYINADHQRYRDEVLHKKSPTPHSRRASA
                     SPKKKK"
     gene            complement(<114151..>114378)
                     /locus_tag="LMJF_22_0270"
                     /db_xref="GeneID:5651787"
     mRNA            complement(<114151..>114378)
                     /locus_tag="LMJF_22_0270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683127.1"
                     /db_xref="GeneID:5651787"
     CDS             complement(114151..114378)
                     /locus_tag="LMJF_22_0270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683179.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651787"
                     /db_xref="GOA:Q4QBW9"
                     /db_xref="InterPro:IPR004217"
                     /db_xref="InterPro:IPR027247"
                     /db_xref="UniProtKB/TrEMBL:Q4QBW9"
                     /translation="MNLGVKQESFRIEAMMSSLREECFNLCCKELYKDAELTKDEVHC
                     IDRCSWRYLHTNKIISNSLDRKTQGGGKKLM"
     gene            complement(<116632..>117036)
                     /locus_tag="LMJF_22_0275"
                     /db_xref="GeneID:5651788"
     mRNA            complement(<116632..>117036)
                     /locus_tag="LMJF_22_0275"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683128.1"
                     /db_xref="GeneID:5651788"
     CDS             complement(116632..117036)
                     /locus_tag="LMJF_22_0275"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683180.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0275"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0275"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651788"
                     /db_xref="UniProtKB/TrEMBL:Q4QBW8"
                     /translation="MRRSVYYMGRSFTQRHLNACCSPLATGFVRPNAFSSTAHGLVAS
                     PLCGIGCIGSGVVGANSAVVASAEASLSQLLAPIIVQGNSISMLASLLCIQNISTCVC
                     ASVRVLAGFRMSCSPPFQDRLAMRNGLRISFE"
     gene            complement(<118745..>121270)
                     /locus_tag="LMJF_22_0280"
                     /db_xref="GeneID:5651789"
     mRNA            complement(<118745..>121270)
                     /locus_tag="LMJF_22_0280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683129.1"
                     /db_xref="GeneID:5651789"
     CDS             complement(118745..121270)
                     /locus_tag="LMJF_22_0280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683181.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651789"
                     /db_xref="UniProtKB/TrEMBL:Q4QBW7"
                     /translation="MLPVRAGALCSPAYHCVALTSNGATCTATPDALVGRHRKAQGRL
                     RCSTAGVLAIAQTRRHRALLLGGSAAHLQFSCRGEPLVMSCRLNSVRQTFASSTADDR
                     FVAYLRSLLRSTGPIPISKLASMIGDEHLERLGNVGGGLAQFIRWHPEAFIEVQLPGR
                     VHVAMSNDTALPFRSNEDKTLGLRVIGLLTIAQHMTGTQVATSLGFSSATPTLTELCK
                     ALRHWSLVSPIQLKRFFHQYEEVFWYHPMSLHVRLRWAKPCATPPVPTRSSSPDHALP
                     RAQHSRLQLWLSAVVPSQYHVPLSYLMDAAGTANMSATLFGREAPSLEDVRHAFQRLP
                     PQFVDVRAFGASPMAIFVRLLRPEPLLLQAGVRSYTSDAPPPESAASHHDPARLGRKL
                     TEALQKGAAEDRLKQLGLMKGLNMVHLRSCVPANLVREIEVFYGLVEGGDLRVSVLLL
                     DRLRHLWEVQLDSSRVRPWAFLPASEQPSSLTLETSPVPRAMVHLQRILADTGPRLPA
                     DLYAELPEDLQEALLRTYGPVEEADATPDTTTGADAVSSFVETHSLFFMRQGDHIYTP
                     RLAAEELQQPAKADATLFGARGREEGAYVGKPLGPTSTPRRPAKPEVEMSELEIAQLL
                     HDAIPVGQPVVVDGLRSALVREHRRRRLASEQARRFVRREFFERYRRLFKLYEYFAYD
                     KLIVGRAEDPSPPPHVLQPRMTNIGHVIKFIALLSSQSATDGALTRALPRDGRMLLKA
                     FGSATDLAEQLPMWFLTQRDKHNFSSSLIRYIGPLAESEKPSAWALKPPPSGVLTRKV
                     PNDPFADIGSEDLDGKPAGWNDDWNEDEVHGGTKQAAGESRRT"
     gene            complement(<122430..>123824)
                     /locus_tag="LMJF_22_0290"
                     /db_xref="GeneID:5651790"
     mRNA            complement(<122430..>123824)
                     /locus_tag="LMJF_22_0290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683130.1"
                     /db_xref="GeneID:5651790"
     CDS             complement(122430..123824)
                     /locus_tag="LMJF_22_0290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683182.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651790"
                     /db_xref="GOA:Q4QBW6"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q4QBW6"
                     /translation="MAASSALTRSAKEAGFREVDAVRDEHDKDNFCYSAGPALLSGAS
                     QAILFNPIDRALYVRVKFRRQHFLDKRNFERPFQGFMNAVVYRTLVGASYIFWQDSMR
                     IAIERLGPAVCQWDTSPQLNSMLIGLAAGSVNGFSLNALQAVKFRMWNTNERGVTFLR
                     TALHMYGEGGCLIFFRGCFTTMVRDSVFGVVYETARRASAWKRFFDDQVGVLYALFST
                     PSSTSSSPQLPAGRSARATNAGSRSRADGGASALEKSAFNDLKANETVSVGHDAVLAD
                     PTLKCGAAAFISNLVAAVLASILSSPFNYVRSIVYGTPAGAIPLGYIPLLKSFYTQFY
                     YTYRHGKSYTDRHGVPELGETEHPCSASASSSSTASAAERRWRHGGSAVAGTEVADGV
                     QGTARLSNSPASRLVVRLRAWAALHHHHPKAAWTWANSRLNIGWGSLRVGFGMAMGQS
                     LFYLAQDYVRNDAR"
     gene            complement(<125264..>126949)
                     /locus_tag="LMJF_22_0300"
                     /db_xref="GeneID:5651791"
     mRNA            complement(<125264..>126949)
                     /locus_tag="LMJF_22_0300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683131.1"
                     /db_xref="GeneID:5651791"
     CDS             complement(125264..126949)
                     /locus_tag="LMJF_22_0300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683183.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651791"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4QBW5"
                     /translation="MAPKKKAASKTSPAAEETVHDGCEEHSTAPVVEAPVAAAEEAAT
                     ARAAEPAAPVPVVGSTTEMYSQLQSILSVDGALVNHYLPQVLELVQAAESIETPILLR
                     VRFLEFVGQHVAAVRDNNALRKLVTSLVKIVGGADNTPQLLTAAVQAFAGLGPVSVVD
                     KNWEYLAREGADVLMQVMVDRDAFPESVRQAASKSLDSLTSSAFRSVLAKLLHWLSLD
                     REEDDEEQVQKERHMALARLTRLIMAPSQRKHWTEETQLYAEPLLQRVLSTVDVREFA
                     QLARVTAHLPINQDKGNLPLLEWYVKTHRLNDDRHVEAVAIIGRFVSSSVEFDLHAAL
                     EAAGITSRDIDASSDGGVNTAKVVLLASRIATAAAAEKLYPYVYRQVVSLMSDMRGTL
                     TTANLITVEALLFAAVALARKRSAEALQQLNDASFNASAISAAQAAADVYKQVVFAVK
                     KAAQSKQADGASANAVASLNNIKTITEAFAAKRLPLGEIKESWTRGLNSIPAAKRDRE
                     APRGAMPPPPGVQRAVEAGKKSSSSQNAPDRKRARNDHKSQYNDRPSRHGGRR"
     gene            complement(<128582..>130612)
                     /locus_tag="LMJF_22_0310"
                     /db_xref="GeneID:5651792"
     mRNA            complement(<128582..>130612)
                     /locus_tag="LMJF_22_0310"
                     /product="carnitine palmitoyltransferase-like protein"
                     /transcript_id="XM_001683132.1"
                     /db_xref="GeneID:5651792"
     CDS             complement(128582..130612)
                     /locus_tag="LMJF_22_0310"
                     /EC_number="2.3.1.21"
                     /codon_start=1
                     /product="carnitine palmitoyltransferase-like protein"
                     /protein_id="XP_001683184.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651792"
                     /db_xref="GOA:Q4QBW4"
                     /db_xref="InterPro:IPR000542"
                     /db_xref="UniProtKB/TrEMBL:Q4QBW4"
                     /translation="MQPCRPRLCACQDARSVGIGALYASGNWAALRTNVAVSPRATVQ
                     ELLTPSLVPTRHYQRSLPKLPLPALHDTLQRYLAAAAPLCTPQQLASTSATVAAFLNG
                     EGRHVHEELRRTDKANPHTSYISSDLFEQTLKGRSALPLRSHRTWLVRPDPEKQDMLV
                     RSAYWLWASVHFYKLYLDNQLRPEVRYAADGIWTKRSGYCTSEWFQRTAALLPDYVST
                     PFVHGTSLGVAQPLDMSQFDCLFNSTRMPGVLQDEIKPVGFVPHALVQYRGHQFQITV
                     ADADCVPLSIDELYAQLRDIVRTNLAPADTDVSVFTALPRTEWNGIRTMLLRNVVNGK
                     SLEAVEESMLVLNLDADDEGDALVDPMSPVGVTAKSPSVRAGNRWWDKSLSVSVNSRG
                     DIAVSAESSWGDGVAVRRYINDVYALSRAAHSHVLRKDAPATHRLRQLQWHVPDELVA
                     TAQRVTRRVSKDRERLDVAAGVLDIATTPTPAVEATVQLAAQLAMFRVHQQQPMNCMQ
                     NTDMHRYRRGRSERIPLTTLESTAFLLSMRSSVRETQQAACYAALRRYKVEKEAVSRG
                     SSTCSHLLALRLTAERFLGRVPDVYNDPVLSLVTEPALCLEMVEAESTYGCGYTLHPC
                     SCHLTCSRTGSTLLYQVTSPPPSSIGVATSSATFAAAFTHACQEVSALLAPC"
     gene            complement(<131983..>133056)
                     /locus_tag="LMJF_22_0320"
                     /db_xref="GeneID:5651793"
     mRNA            complement(<131983..>133056)
                     /locus_tag="LMJF_22_0320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683133.1"
                     /db_xref="GeneID:5651793"
     CDS             complement(131983..133056)
                     /locus_tag="LMJF_22_0320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683185.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651793"
                     /db_xref="InterPro:IPR012989"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4QBW3"
                     /translation="MEARGNVDGEKFRSINTLRTRFPALTVSDARALLERHNWNVAIA
                     GAEAERGERQRTKADSANYFVGGGDKGSGQQVMAPSGESVSDRSGEIASGSGVHSMID
                     RIFRKAEVEGAKASGGDGGSGVEDNEPRAFYGRGQRLGYTANPSPYVASTLRAERSVC
                     ITVYRDGFEVDSNGFVPLNSDEGRQFVEAMDKGYVPPSLAAKYPNTDLTVNLRDCLQV
                     DYVPPSYIAFQGDGHRLAAPSSTAASSAAPANAQASPATAGRSGTPAYDPSRTVEVRS
                     DEATSFVVLLNTRGERRQVQVNPERHTVDDLYSLAHAYQPELQNFILVERGMPPRRLE
                     ASTRSQTIAQAKLSRAVVALQQM"
     gene            complement(<134984..>138253)
                     /locus_tag="LMJF_22_0330"
                     /db_xref="GeneID:5651794"
     mRNA            complement(<134984..>138253)
                     /locus_tag="LMJF_22_0330"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683134.1"
                     /db_xref="GeneID:5651794"
     CDS             complement(134984..138253)
                     /locus_tag="LMJF_22_0330"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683186.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651794"
                     /db_xref="UniProtKB/TrEMBL:Q4QBW2"
                     /translation="MDSTRGSTQCGAAFVEVSTVAGADAAPDAPQQQGEGCRTPPHVH
                     CGLPRLCTESVSTVTSLASLGDDVPASVAAKPTLLNSSPLPLAKVHPATESTSSMPSS
                     CGATTETENRFGDLQSHAVATAVVPPVLKSSSSLPSSLPSASAIAAVGSARRLTPGST
                     SSTDGAWTRSRNVDGPRTMSLRLSMTSPRTLHGSASLPTPGEESAPLAEMSSHAESSR
                     STPSVPLLCCGLPHTHASEEERRASSAETFLTRVPLPQEDMTASSSQPSSPTAANRTV
                     VPCSVMHTCSDAAEAQRAASPTVLPSGSPTGFVTTTAMRSTPQGRSRSFDMPFPFASG
                     VSGGSCDDLSRCYAKRRELSTITASIRTSEHFNERLGDTHRPPPFMYPSESTATLSTL
                     RASVVGVTVPATAHSNNNSGGGIATFSSNTSTNGADAEAQVGTGTGLRRTISCDTLAS
                     VSSSRSRPVLTPAALGPPEASGAASGTASTTTTSVTYTRRNVCLGALDFYGNPVTSLS
                     SLLVQMSLRSGDHEEADPLETRLAAASPYPLTQQQQQQRNTLSMQNLMAHTQQVGQMA
                     PEDKVKRFHAKPDSGGIAMCRTTGTTIPRRRRPCAKPCSTTAAASSSAAPLAGTTAAA
                     SAQPQVGSLKDVLQDCNFLSLKDVLSAIADTHVHELREAQQRLSNTHAGASDGKNVDG
                     RIASTAPASVVVNALSTCVASVSSKAEEPSAAAARFPGGIQPTVTCHLGGAGSEWACT
                     SSAREGDSGLCLSTSASTDATCIPALHPSVNSLDAQQVLTLAAAITEASLNLDRSAEA
                     SFAGSTTAAAVSVSFPTLLGETVPDGSAASPPSAMATQMSLQSVAPSASLISSTHADA
                     SRGVAAASAASTGGVSEALDYGSDPLERKVLLLQPSSDDVDDVVRSGMWECPGDRSVI
                     APSPRTLKATAAASPVTVASPAQNRFAATGSPSDRQRGGRYVANWHGLSSGEEAPGKT
                     TTPRTVIAVAAKPPPMLLRQAETMASADRSMCASSRAGKQEDAGVSTATCDRAPVTRP
                     SITAGDTSASVGDVRVVVESISFCSFDDELNTVSQLRQWARSIARLEHLQPSTETEVI
                     T"
     STS             138342..139511
                     /standard_name="fc09g10.x1"
                     /db_xref="UniSTS:192405"
     STS             138342..139089
                     /standard_name="fc09g10.x1"
                     /db_xref="UniSTS:192405"
     gene            complement(144682..146072)
                     /locus_tag="LMJF_22_0340"
                     /pseudo
                     /db_xref="GeneID:12980753"
     misc_feature    complement(144682..146072)
                     /locus_tag="LMJF_22_0340"
                     /pseudo
                     /db_xref="GeneID:12980753"
     gene            complement(<146832..>147584)
                     /locus_tag="LMJF_22_0350"
                     /db_xref="GeneID:5651796"
     mRNA            complement(<146832..>147584)
                     /locus_tag="LMJF_22_0350"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683136.1"
                     /db_xref="GeneID:5651796"
     CDS             complement(146832..147584)
                     /locus_tag="LMJF_22_0350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683188.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651796"
                     /db_xref="UniProtKB/TrEMBL:Q4QBW0"
                     /translation="MDSAASGVHLSAEGALPEELQTFMTELGRLEAVSKSRAQELARA
                     KATERALSEQLAAVTYVAQKARHARLQLELDAAATQVRTEGARREAAEDRKRLSHITA
                     QLKGVEARSISLDTQNEEGQDRSCHDIPREVPAGKRATAITGNMATLPNTFAGDHQLY
                     RSLNCIHRHPRLSNLLLAPLVRLLRELGAQYTAALDDKSLAERVAPPLHSLCSLDAFQ
                     VWLRERACGALTDEDVRSLLFIANVADRHVAG"
     gene            complement(<148763..>149794)
                     /locus_tag="LMJF_22_0360"
                     /db_xref="GeneID:5651797"
     mRNA            complement(<148763..>149794)
                     /locus_tag="LMJF_22_0360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683137.1"
                     /db_xref="GeneID:5651797"
     CDS             complement(148763..149794)
                     /locus_tag="LMJF_22_0360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683189.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651797"
                     /db_xref="UniProtKB/TrEMBL:Q4QBV9"
                     /translation="MVLPPVVRGNGGGGGRCSASGHTLETSLVGSLPDITGSDLAEST
                     LVASSPTEEVLRGSLDHLAKYLRQTQARETRQRTLLVEEALAHFADIIRRHVAYLDIA
                     ASCAVLQATRNAQAQAKARQAQQWQLQILEDALRGTVAEEEKRRNAHAQAELSVRRSL
                     VQLQHAEVHPVLLREAFFRLMHAEHVRRSFLHREEARAVEAMGIPSFISLPCRSAPHD
                     APFGFGGGGKADAKQSVVELSKLDLMAGQRCPFRCAADCPYMLQRTRQLGKRWAAAVA
                     SGEDTRATAASLRLGRRTASPSPVSRPSQRWRVSGLGITEVGKQRVRNAMAMGHYSAT
                     AEFLPALRL"
     gene            complement(<150566..>151390)
                     /locus_tag="LMJF_22_0370"
                     /db_xref="GeneID:5651798"
     mRNA            complement(<150566..>151390)
                     /locus_tag="LMJF_22_0370"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683138.1"
                     /db_xref="GeneID:5651798"
     CDS             complement(150566..151390)
                     /locus_tag="LMJF_22_0370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683190.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651798"
                     /db_xref="UniProtKB/TrEMBL:Q4QBV8"
                     /translation="MKDASSFLDVLLAAKKLQATELFGPWDMDANGHIAIEHLRPLLR
                     SVFPSSSSLSQHGCASAVDHLSVSQVKRAYESVTRRPWALPPSLLTAPASAKQSRRCL
                     DPMYLGPTLNEVHAIIDVLCGGETQPEVALRLDSRDPEEDASTWLAEARQRPSSNTAP
                     LTPTTDTIGRRTAAMRAVHHPSLTNHARVAFLYGSMEEIYRTFCLAASSPGEPVPDTL
                     PIDAAHLGRVAWNVHAQRLKLWEGRALHQLLAATATTAEADAHLTLEAFVELLCTT"
     gene            complement(<152227..>156063)
                     /locus_tag="LMJF_22_0380"
                     /db_xref="GeneID:5651799"
     mRNA            complement(<152227..>156063)
                     /locus_tag="LMJF_22_0380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683139.1"
                     /db_xref="GeneID:5651799"
     CDS             complement(152227..156063)
                     /locus_tag="LMJF_22_0380"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683191.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651799"
                     /db_xref="UniProtKB/TrEMBL:Q4QBV7"
                     /translation="MFFAPPAKVPRTQRLTMTSSSAAPYVYKRATEADSGLAEASPTS
                     LDGAVLFDAASGCTVPTSSFLSGTGTHMCWLVDENTKLLRLWNVSRPGWQTAAPRLAE
                     IPYFAAAKEGLPLFVSEMGGEEESLAFCSERGAISSLDHSIEMQMMDDDDVAGMTASS
                     FVCSRRWVNAEAVLVTVLGTTAGVLVVDLKYDGAHTAMRLDRRDPASFRWARGGHNNL
                     PQRSGGGGDTETSADTLFTDCAEEESQQRVSSEYSGTGRPFASPNTSSWLWHSLKCLV
                     TGGNSPSGDREDDDGTGTGSAASASPVWPLSAAGNGQRGDSPLAFTHVQLRCHYPAQV
                     VAISASGEVFLFDFSPVPPAVAGVGPQPRISIKWATSLPASLGRRGQIVSCTESQHKV
                     IVLYYVRSSSAHPLPALWLVTLDASLGKVVNYVVLNAVADVVSAAARLPPHHIKLFSC
                     DKHREVLISVGAYVLRVNNQVGVRQPCSSEDTVCFAHLEQPVASLLLEDGSLVTLDAS
                     GPHLTVRDVLAGRMTHAAGGDGPRRVHDGDNSGEAELRSILDAVRTDSKLSLDSAVLY
                     ASESLSSSPDLPHQCRHGTGNWARRNLNAEDENIVLRVTRQLTFQQQAHRSFVMAVLR
                     HQQLRTQLSHAAMAQLLSVQEALVSLCALRSMQNVGLQAEHFFGASDDGVTQRILPPF
                     STMLKTAPSGGGAYLVQRRPSRHHNTQDSVNDASSAPAAPRLVKSTEQMARCQQIMRR
                     AIVAVAEAIRAEQKAAASGVSARLQGSVEGLTAAEICFTNPLNLVRLLRFLVVYMTEV
                     QQTVSLPLEEKFAECYAAGCIYVVVAQTIVESREDVRRVCEISKGVLACLWTASSDPV
                     SGVAPCFSQACVQLSNILADVCDAASSNLNDSSDGHASAGDGAARAASEAAFASLTLR
                     HKCDMLDVIAYLLYFSLANSLHHDSRFVASAVTNTLLRAPFLTGPVGYPYGAPTASRG
                     CAEIGRRVLGVCETLALRFDAMPILMVFALSTPIDDPASCPEQYERLQCYCQQNTLVL
                     DAALQTLWEQRREWELLSLPAVLPGCPDARTRRNSFLEAQAPHLLWLADPGRYDALTA
                     EGQASPPYIPYGEGQLQHRSRCNALARLAWVATGAAPSSRFNDVELSESIVAAQQEFL
                     APDCNNVTLGPQAVVQRLLEIEDCVAAWAQAAVIASHTMQPTSEDLLVQVLRRCRAKD
                     GGSRLTNIYANSVSELETDASLRQTALGQVMVACAKLQDAETLRRVGETLLTDEELTL
                     LSSWLAYLWTASHERV"
     gene            complement(<157075..>158430)
                     /locus_tag="LMJF_22_0390"
                     /db_xref="GeneID:5651800"
     mRNA            complement(<157075..>158430)
                     /locus_tag="LMJF_22_0390"
                     /product="putative DNA primase small subunit"
                     /transcript_id="XM_001683140.1"
                     /db_xref="GeneID:5651800"
     CDS             complement(157075..158430)
                     /locus_tag="LMJF_22_0390"
                     /EC_number="2.7.7.-"
                     /codon_start=1
                     /product="putative DNA primase small subunit"
                     /protein_id="XP_001683192.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651800"
                     /db_xref="GOA:Q4QBV6"
                     /db_xref="InterPro:IPR002755"
                     /db_xref="InterPro:IPR014052"
                     /db_xref="UniProtKB/TrEMBL:Q4QBV6"
                     /translation="MQVINENSLREFYAHVYPVELVTQWLSYRLSQPRLSAGSSVAVV
                     KGEPTAVSGEESKDGVRHVLGIKAEPCDAVGAAAGADDEDKEWLNGKGAAAAEGYLAR
                     REFCFTLIGDIFTRFRSYRSSEELRAELVRCFPEKIDVGAVYNIRPNQKQGLANVFPV
                     ERELVFDIDMSDYDNVRSCCSGKSICSYCWAWMSCAAHVLHTVLRDDFGFKYILPVFS
                     GRRGIHLWVCDRRARRMTNDERTALVGYLTVVAPKTLRSTIVADLANHRLIHPTIRHV
                     LRTQLDRAFTSLFVASSSDNPNNIQHHPTAAYIVHDATSAVLKLGRRDALNRFQQHVH
                     FQQGNVLDWATYLRALGSEQEATDILHAVQLLLMYPRLDEHVSTRRDHLLKLPFCVHP
                     GTASLCCPLEWDEVDGFHPTEDAPKLHEMLLSRSLDVRWTLPLERMLKDMRTDEDENS
                     S"
     gene            complement(<160049..>162229)
                     /locus_tag="LMJF_22_0400"
                     /db_xref="GeneID:5651801"
     mRNA            complement(<160049..>162229)
                     /locus_tag="LMJF_22_0400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683141.1"
                     /db_xref="GeneID:5651801"
     CDS             complement(160049..162229)
                     /locus_tag="LMJF_22_0400"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683193.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651801"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="UniProtKB/TrEMBL:Q4QBV5"
                     /translation="MPTLSSLTVAEQVAALPPLSQLLGIDPPGAANHKTKDIGKAPAW
                     QVSTRGGVSCATKASSSQTLSAVTPRRSPLDAPAGVAPTIHSHAAAANLEAPVGSSSA
                     RTEETLRAAPSTPLADECTGGLSEWRRVRQSLQLPIAYRAEEEVYLSLRLLRSLSLFA
                     PLLDDDLLTLAETMAVMEVTDAGKVLLRKCAAAHAAHLSSSTGAAAEAMAKMPADRPP
                     LSLDALLAPPLLDDEEEQERPQGVWAMPAARLFQCFREQMGRGEPPSLPSERTENVVG
                     SHMDDALPPITVKTTRRSTQRSQGEYTVGLTRVPATGVTTAPLFFPDDDTLNGDGTFA
                     LVLLSGHCRLEWPRERGLVEDAAQASPWQSYELQPGDAMGYALIWGALPPGAQYVTSE
                     TITLLVVSSEGRPPEVAARLRRVCRRANEAVLRAQRRFLAHELRVPLFAPEDTATRTT
                     RATGTGVGEAQEEQGPQGHAAATVAEAAVPSVASLLDRAARSLIPVRVPTHTVLFSEG
                     LAPVKECAIYFILDGGLAVVRRIWSQDQQRLFSEKMQLVRALTPATGICPPLSPLPAM
                     DSMEVAQLRRGDYCGDLAYLNEDPDHVASMDAEWTAAYWQSTLAQPTARFSQAGRCRD
                     THGQCSRDVADHASGHGAKSSLFRRHKATVVAQQASSLYVLLPRAADEALTGVVEQRM
                     RDHVHRDYAGYRHVFAEYEKLYKWALYKERVLSDVSQKAPVNFR"
     gene            complement(<165627..>169184)
                     /locus_tag="LMJF_22_0410"
                     /db_xref="GeneID:5651802"
     mRNA            complement(<165627..>169184)
                     /locus_tag="LMJF_22_0410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683142.1"
                     /db_xref="GeneID:5651802"
     CDS             complement(165627..169184)
                     /locus_tag="LMJF_22_0410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683194.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651802"
                     /db_xref="InterPro:IPR009030"
                     /db_xref="UniProtKB/TrEMBL:Q4QBV4"
                     /translation="MRQRGGSAFLTGFRRGNASTLAVPTVAVLLLMHVACGAAARLCT
                     SADIIHFFSPCDRQTGKLTVLSYISSDAGCEQGNLFVPPPRTTACYDCTDGYRLDPLT
                     LECALCPAGTYSSYTTRYVTFDPLPEGVRTYCTPEPCASWSAVEDTYGTVISSGVQPT
                     ENRSMTQWGTIDESVESTLDFLVDVIESSGSLEFDYSISSEEAYDGLVLRLNYSIVRN
                     PDTEVGNYRFFATGVHRDWYHASIMLPQGVTQVLFDYVKDSTGPFYGEELTGVNDRAL
                     LRNIVVKGTCKTVAEMQCVSCPPGQWTARDGSGGVGASQCVRCPRNTYRGEGDTQCLQ
                     CPPNTSSREGAGNCTPMRACTGGDYIAQYGSCRLSDNTRLRSWVKYEGADCVEVEGSR
                     PTATRVDCAACLPGMRHADSRARGACVSCPAGEYLLGDRCEVCPLGTAAIPKLVYSSG
                     FDGLGGDVMALPGISLSRTYCTGSASRCQKEEGKGFELVGLPFADEDNTLIGIRQEHL
                     ASSTYSLATLTYTFHAEEDGWANITFAYINAEGKYVQRMDWRTTLNVRVIVDDDAEYL
                     ARTFATQTGGMDSMFYSIRVPYYVDTALPASGSDSTLRGMQHRLSWIVEELAFTSNPI
                     SVVIVGLEVFGDLSGGVQKCQPCRAGFSCPSRAAKMTPCSPGAVQPSLQAHRCEPCIG
                     NTYAPGYGFTTCLPCPSNTVANADHTGCSSGCVFKRHGMLYNFSELRGVVLNTSVGYV
                     LPINTSLSNMTVEEADEAGVPRLYYSPCDPLPVRDARATSERDSALTPITRDRLCVPS
                     ARGRNISSSAYVCQRTSATSGHHFGDATTHMEVGRHLYLVTQLGSPYTFYGFDTSADD
                     WVYDVKSNYMAFVELECSTRADEPKFGTLQYAGENYENLVLRWRSAYACPLCTNESYE
                     KVETSCNDPPAKTRRVYYALRTESMSCVGGYVPPEPIVVKCTECTLDSYTVRWLECDP
                     VTKTQEGVYTLLPDRANCTPGAFPLPVVQPRPCDPSGGTAGRGASRKTVVVLLVILGL
                     VLAGLGVLTVYYRRLRERVARAARGEGAELDAYGGILDDPYDNDDGGDPAEPSSFGRD
                     STAATVHQLWGVVVSMGQHIRDAVSHNDGRSVRAAARASADARDNWNGYDFAAASDGG
                     TSESGGGSGSGSGSADRDGHVQNIFSLAATDDDILPGLR"
     gene            complement(<174339..>174797)
                     /locus_tag="LMJF_22_0420"
                     /db_xref="GeneID:5651803"
     mRNA            complement(<174339..>174797)
                     /locus_tag="LMJF_22_0420"
                     /product="putative 40S ribosomal protein S15"
                     /transcript_id="XM_001683143.1"
                     /db_xref="GeneID:5651803"
     CDS             complement(174339..174797)
                     /locus_tag="LMJF_22_0420"
                     /codon_start=1
                     /product="putative 40S ribosomal protein S15"
                     /protein_id="XP_001683195.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0420"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651803"
                     /db_xref="GOA:Q4QBV0"
                     /db_xref="InterPro:IPR002222"
                     /db_xref="InterPro:IPR005713"
                     /db_xref="InterPro:IPR020934"
                     /db_xref="InterPro:IPR023575"
                     /db_xref="UniProtKB/TrEMBL:Q4QBV0"
                     /translation="MASNITAERYEQLKKERTFHKFTYRGLEIDPLLALSEEEFKALV
                     HARARRNMNRHADRRPPVLLKRLREAKKHVKVGEKPKAVKTHLRDVVITPEMVGSVVA
                     IYNGHQFNAVEIKGEMIGHYLGEFSMSYRPVLHGRPGVGATHSSRFIPIK"
     gene            complement(<175801..>179460)
                     /locus_tag="LMJF_22_0440"
                     /db_xref="GeneID:5651804"
     mRNA            complement(<175801..>179460)
                     /locus_tag="LMJF_22_0440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683144.1"
                     /db_xref="GeneID:5651804"
     CDS             complement(175801..179460)
                     /locus_tag="LMJF_22_0440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683196.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651804"
                     /db_xref="UniProtKB/TrEMBL:Q4QBV2"
                     /translation="MYGQPWNTPTTLHSLVESVTRESGEAAAARAGTSKSTVPRLAVS
                     RSLPCSTTVVQETVTNTGRVVSTVATGAAAPSSLLTGTDTPTPLWRSTATTAAVRAEH
                     LRELEDFLEQRGGRGTSMEGRHKVIQKALSLLPVVYPPLAKVAEPMQRYIEDVAASLR
                     RAATEKAEALQHQERELYGQFEAFFEGKIRELMRARKQAEEEAKAEHAAAFALRQERD
                     VELMAVKEQLMQRMNTCEKTEDQFRDFRHLIASVFNTNQQLNLRIEQLEEVLARHRID
                     LPPASEEMMAFQTSLDGQRSFVPQASTVDGDGDDDSSSGGGGVRGGRNKSHKLPVKFM
                     AAAKQELVNSRLTLQEELLHSAFDDHSAYRMRITGLKQQNLDLSFTVSELEEQVRDLY
                     TYIHEKRFARQVDEQGNEIAVMTPRPRGVPLALQTELGIDLRHSTANILSELSTLSIN
                     MKHQLNSALLRARQLHTLSAWLDEGNETSVSGGGVGGMLERVSEAAAIPVFPVSAWPS
                     IPHFLRTFIAPDVPNYFWTETQAACILYNFFKRYKAIRRRARFVRDNKMLAPRVYQLF
                     EHREVLLTRLDAGKEDVAAAEENTPFGYVVTQFAREVLANLSPQNTQPHLPLVLPGTV
                     ALRFPQTSSTPSQSKSLQSGDVVGDGMHGPGSQRTPIADERLTVKDCPWKEAAPIVEF
                     ELARFTYNLWYAAVRYQPSQPLCELFLKLVDGQVPMETFDLMETVLGRLRRRIEGLDS
                     DGTRRFAYSRLVKAVVRSVSDMDAKVGLRAVQAVAQTFEANHMPLYGGTLGSVALFAD
                     ETYCTRESLTASLEKGTMRAVVGCAADNTAAAAAAKQTIRTPLPSSLITHEVPLPKSF
                     TASSPPSMLPPIGATCIIRFCRHLVHDTLEGLYIRIEAALCPLVEESEVVLGLYLLPL
                     PRAKAALAALDEVTREEGIHAALVGSTGTGDDNSLTRATFGCISAAARAGAKLRPEAA
                     DLLGVHGLTKDYMNLLESRKNVLKDKQTEDRHVATRMVDKVVQGLPHFKTSTHFPFRG
                     KNAAWLGESGGPGDGDEEPRADSPHEADATLRNTASASSRGNGLDKNSAKKGGRRTTT
                     QETVATRRSGQPPVQGSRENSKTKARRSPQVKRSNKGKGGQASSLSFEGGRVGAAESD
                     DALWSGTAKALLAASEEGNLVEWYSLRHALRCTLPTLPWQIFQPDEQEQETTTAASVA
                     PTLPPLVAYEEAAPH"
     gene            complement(<180994..>181863)
                     /locus_tag="LMJF_22_0450"
                     /db_xref="GeneID:5651805"
     mRNA            complement(<180994..>181863)
                     /locus_tag="LMJF_22_0450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683145.1"
                     /db_xref="GeneID:5651805"
     CDS             complement(180994..181863)
                     /locus_tag="LMJF_22_0450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683197.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651805"
                     /db_xref="GOA:Q4QBV1"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:Q4QBV1"
                     /translation="MPPKNAVKRNQKSSKQRDNFDEAAIDALIMAIEGKAKKGTTKSQ
                     LKQKEDKSLSRANGQSYVLSEQMRNALLAQMQQPTAQEEQYVNVPVPLTGEEKGWQEV
                     APNRYIRYEQFGGSDAEMNFIVNLFTAELTEPYSSFTYQYFVFGWPDLCITAFGVESE
                     TKPDNSVVGEKVGAVVSRVTRKGAGMPLRGYVAMFAVVPKFRGYRLGSRLVSLTVELM
                     RAKGCDEVYLETPTSNVRALGLYLNLGFAKTKYLPRYYLDHSDAVRLKLWLKDAIPKS
                     VPETASTAGVEKA"
     gene            complement(<182669..>183127)
                     /locus_tag="LMJF_22_0460"
                     /db_xref="GeneID:5651806"
     mRNA            complement(<182669..>183127)
                     /locus_tag="LMJF_22_0460"
                     /product="putative 40S ribosomal protein S15"
                     /transcript_id="XM_001683146.1"
                     /db_xref="GeneID:5651806"
     CDS             complement(182669..183127)
                     /locus_tag="LMJF_22_0460"
                     /codon_start=1
                     /product="putative 40S ribosomal protein S15"
                     /protein_id="XP_001683198.1"
                     /db_xref="GeneID:5651806"
                     /db_xref="GOA:Q4QBV0"
                     /db_xref="InterPro:IPR002222"
                     /db_xref="InterPro:IPR005713"
                     /db_xref="InterPro:IPR020934"
                     /db_xref="InterPro:IPR023575"
                     /db_xref="UniProtKB/TrEMBL:Q4QBV0"
                     /translation="MASNITAERYEQLKKERTFHKFTYRGLEIDPLLALSEEEFKALV
                     HARARRNMNRHADRRPPVLLKRLREAKKHVKVGEKPKAVKTHLRDVVITPEMVGSVVA
                     IYNGHQFNAVEIKGEMIGHYLGEFSMSYRPVLHGRPGVGATHSSRFIPIK"
     gene            complement(<184606..>185886)
                     /locus_tag="LMJF_22_0470"
                     /db_xref="GeneID:5651807"
     mRNA            complement(<184606..>185886)
                     /locus_tag="LMJF_22_0470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683147.1"
                     /db_xref="GeneID:5651807"
     CDS             complement(184606..185886)
                     /locus_tag="LMJF_22_0470"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683199.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651807"
                     /db_xref="GOA:Q4QBU9"
                     /db_xref="InterPro:IPR002547"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:Q4QBU9"
                     /translation="MQFLINSSSILAPALQHALGSVLSVPELCIEMCAEGPHRVTIDG
                     KTFCGLQPFLQALRRTAVTPEQKAFLGEDEEQVSLVNQWVGAAAVLDADAARAVAEAA
                     TSVAKALYSDVERILVATSNAASRYLTGSERATMADVLLYAAAFNHSAHTEVLPTTMK
                     WAACAQEDAYLAPIRSSAVKTAESQSAGKANGAAASAAKAQVSYAKPSEEEILRRRAE
                     KEKAKAEKAAAAVAAAAGTNAEKTSASLSAHAPEGKRATKTELGSTSLYVRVGQLTNL
                     RRHPDADRLYVEDMVLGDETRTIVSGLVESYAIEELEGTQCLVVCNMKPKSLMGVTSQ
                     GMVLCAKRDTEVKLIRPPAGAKPGDRILFGASYDAAIAAAAPPEPISSNKMSEVLSHL
                     HTNADSVLCWKDEPARHPSGAAVAIADMANCPVS"
     gene            complement(<186829..>188163)
                     /locus_tag="LMJF_22_0480"
                     /db_xref="GeneID:5651808"
     mRNA            complement(<186829..>188163)
                     /locus_tag="LMJF_22_0480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683148.1"
                     /db_xref="GeneID:5651808"
     CDS             complement(186829..188163)
                     /locus_tag="LMJF_22_0480"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683200.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651808"
                     /db_xref="GOA:Q4QBU8"
                     /db_xref="InterPro:IPR001401"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QBU8"
                     /translation="MVMFLGNHSSGKSTLINYLSGCEVQETGVAPTDDGFTVIKRGAY
                     DMDADGPSVVSNPKYQYQSLQQFGISFVTHFKMKTRAMPATSQIPMDMVLVDTPGMID
                     TPVHASSAEQAGSGDHTRGYDFLAVTRWFAQQSDVILLMFDPANPGTTGETLDVLTKS
                     LTGYEHKFFLVLNKVDVFEKVTDFARAYGTLCWNLSKVMKMKDIPRVYTTSTPLKKLN
                     ESSGKSPTETTPATSTVPAAELSRQRNEIINEIRAAPMRRMDNLITETEESARNLLLA
                     CRVSKVLRHDYRQREVFVYCALGAACLMGPATAVALSSITITGTVLVALVSVAVGSGG
                     LAAARMHLREFEHYLLQSCDNALGRLFTTKTRTKDVEVRWQRTVKPELLRIAAASHEK
                     GDSGIMALPSCSARACRGMQYVIDHEVPALRRRVSEYKEGFFQRQCAAEHHT"
     gene            complement(<191983..>194154)
                     /locus_tag="LMJF_22_0490"
                     /db_xref="GeneID:5651809"
     mRNA            complement(<191983..>194154)
                     /locus_tag="LMJF_22_0490"
                     /product="putative protein kinase"
                     /transcript_id="XM_001683149.1"
                     /db_xref="GeneID:5651809"
     CDS             complement(191983..194154)
                     /locus_tag="LMJF_22_0490"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001683201.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651809"
                     /db_xref="GOA:Q4QBU7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4QBU7"
                     /translation="MRSRRPLSASRASARASAASRPQPHTTVSSDDASRSQTTAPIYR
                     PLRYVGRGSFGVVLLAEEVHTGDRVAIKRVHYDARLHNREVAILNSVLVDNPRHQQPS
                     STAVDSNDASRRPGGAARASCTSFLSASSSSHTVEDVHLWPGTHHPNIVELLDFYVTY
                     DTASSEQALGADMVGAGGAGAGFEFLPSYHPAAHRYPLSGGSGAASASAPPVPAPLAA
                     FAYLEMVMSYLPMDLCYVKRYYFRFHDMPTIATSSSSSPIASPEQAPTELSSGELPEG
                     TADRLPASPKHAGTGCNGNNSSRHSSTSSSGGDVCNHLPLRWVKVVLFQLARALAFMH
                     VRHVCHRDLKPANVLVDPDTGRVQVCDFGSAKQITRPAEEKNVSYICSRYYRAPELLF
                     GALHYGCAVDMWSFGCIAAELLRESGKPLFRGCTSIDQMAELFKVLGAPSKREMYAMN
                     PQCAEALLRTRAMHRHQSLDNDPHSGSGGGVRQDRSCGLELEVDYQAEEEDDVELRGG
                     AQQGGYDVDSHGEFLRDALDDGISSQASASPGMATASPPSSSTKDPRDYKTTFSAPPS
                     TAATAMLDDVAPTPFEEYYDVLKVRAIPWRRLFPVDTPTEAVALVASLLCYAPDKRLT
                     AAELVEHPFFDDLFSAADAQLATVDRDAATAVASGATMSPSEDDGVASAALRLPNGRL
                     MPLSMFQVTEVERGLYTDAFLTRMARQAELVAAVMKQDEYP"
     gene            complement(<196415..>197953)
                     /locus_tag="LMJF_22_0500"
                     /db_xref="GeneID:5651810"
     mRNA            complement(<196415..>197953)
                     /locus_tag="LMJF_22_0500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683150.1"
                     /db_xref="GeneID:5651810"
     CDS             complement(196415..197953)
                     /locus_tag="LMJF_22_0500"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683202.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651810"
                     /db_xref="GOA:Q4QBU6"
                     /db_xref="InterPro:IPR017923"
                     /db_xref="UniProtKB/TrEMBL:Q4QBU6"
                     /translation="MEEEDSILGLVPASLPVHADSEGSVVASGYMGCVSGSPVAAGAD
                     TDDGSGWTFEHVLRAAIAGAEENNNNDAEAGQGGGDEEDDGSDAADKDEGQAEDAVDF
                     RDGGASSGAEGHAGAAAGAVEGGHTDDVMLLSIGDKKAAKQLGKRLYKRWKKLHKTAR
                     SKKDTHKRSKKAGSKKSKGKEKASKHQKASGSRKKKGTKARRDDHDDDNGEGSMFLNM
                     ADGELGLVPAADLSDAAAAIEARLKKAALREAKMRTERAVKKVAQRKTSSAELAAIAK
                     ELVSAMAKARQLDEDIIRGRNTLPNAFPLNRVALKSIVQARCRQGYMVGPLVEAGILQ
                     ELSYWLYDVDRADPAPYELRTTALDILVSLPMEGSIAATEDLTAFMGVGREHLIKTDL
                     GRALNALRRYNEETIDNKGKCVQLLTTFSRVISGASDKDQMDEHKSKAVWKCQSDPTV
                     ASPFEVLETCSEAFQKSFMRPDPRDPTSYNGVLPWRPPAATITNVSGKLGDYIEKANI
                     DPRR"
     gene            complement(<198692..>200437)
                     /locus_tag="LMJF_22_0510"
                     /db_xref="GeneID:5651811"
     mRNA            complement(<198692..>200437)
                     /locus_tag="LMJF_22_0510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683151.1"
                     /db_xref="GeneID:5651811"
     CDS             complement(198692..200437)
                     /locus_tag="LMJF_22_0510"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683203.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651811"
                     /db_xref="UniProtKB/TrEMBL:Q4QBU5"
                     /translation="MNSVCLVTTAAAAAPSPTRASATGEGALISSCASQAAEQRLAYE
                     VAAAHALRGGRVLFLSAPTSQAFSLARFAVTIERQWMALQPRRQEALSARQADTARLH
                     HADNVTQVGCAERTASSPASARTASSEPWLQSLSSEAQLRVRQRAVLDAVRRVEVLPC
                     TSMEDFYAVCQAYTFPTVTVEDDAPKTSAPADMPNSPSSIVCGVTGSRGSEQPRVSRE
                     QQMRGELVFPSSLSFTDSGAVTVTTAAAAAPASSLAALSAAASSPTAARTSTPHEADI
                     VPLCIVDGFMGPTSTSALLERASGQTIPLLHYVLCLLQRRLKCAVMVVEAGGSVARSD
                     GSGGGACWPSSSSPSESLTSLSSLSGGRPRSRSNGCGALPSPAMVLAASDLVQRLRSP
                     HMHPSPIVPVSHAAWSLAQVPAERFSEVSGEAERQPGTKAARADGAAEHSARTWLSQA
                     PPVSLHDVQLSVAYVEWDAVWRPLRHGDRHMEACDARNGATSRHDGLLLPFSVAWRYR
                     VHLMKTTVGEAAGTRVGGTDNLLQNRQSRPSGPLWPPSRGSRRSSGVLTCSSGTPCNM
                     QYIGSWMQSCQWRYL"
     gene            complement(<201655..>205059)
                     /locus_tag="LMJF_22_0520"
                     /db_xref="GeneID:5651812"
     mRNA            complement(<201655..>205059)
                     /locus_tag="LMJF_22_0520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683152.1"
                     /db_xref="GeneID:5651812"
     CDS             complement(201655..205059)
                     /locus_tag="LMJF_22_0520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683204.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651812"
                     /db_xref="GOA:Q4QBU4"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:Q4QBU4"
                     /translation="MSLSAQGLLKLLNEKHRRYEVFEQISLAEAASGAALSSRRVLRG
                     SVVVPEADNHSAGGGGITRVIPTATVVVRTPSPQLLQLPWPLSQPQASTPTQAHGRMY
                     VCELPEDTWNLISAVAATSAPSQRQFAFANEAPAFCTSQNPSIVDARDGSTGESSVQA
                     SPTTATVTAISTLDHTDHTEEVREEPESLSNHDRSVSTSGLGPSSVATVGGIQLPQLS
                     SPTGQRVMELPASPQALQTAGEDVRNALNAALVGCRGADANSTPPQSPQRQSPGAAAV
                     EASVGKQNNTVAVVLWVAGDAATTGAVDTTDMGQVGDALYTLAAAPLGTPSLRRDPQR
                     MTSTATAPQKAASAASTTAESTEDIAGGSTQLPGCLCFAVRDIHEAESSVTDMLTPRD
                     RRVQMLTLQLESGAAVYAAKCPSDVFVRVGSNSPGCALTSPSEISSGAVALSSRPSAP
                     TVSVSFVFHKGGITRCMAALRQHSPGLVYACRGSRNNLSLLLQDGANGATSADGISTW
                     SPSRIRGASNPSELPASHGVHRLGSVHLGLPLSPAGGSTSSAGAQPTQPPEDEMHGWR
                     QRLSTHALFRSGARGVGDMLSNYTSNSRYEAVGGVAPHWPSALTKFEQEADHTDDRRG
                     RGDRRVSSATRARASATNSPDEAQDYSSASSFEDLTDEMTAIRLGACYSPPRPVLPVD
                     GGSRTPSPVTAADWERVFDVPPEQQRHPHQHGDLPESHNTHGATSTALPPQTRRLNAD
                     RYRAFRQAVYERGGLKDSSIRFEVWCYLLGAYRVGSTEAEQAEALRSGEALYTRLTSQ
                     WKSFLPEQEAHFATYRYAKQSIVKDVQRTDRAHPAFREDDSDMLRVLQELLLAHVMLD
                     MDLGYSQGMSDVAAVVLLAALPSLPPAPHLSPASEAAMFMCFRKILSEHMSANFVIEG
                     RTAGAPYAAVKGLQRKLYQAQVLTRHFHPGLYTHLKKNCMADDMSFCFRWILVCFKRD
                     LPSIEDTMRFWDVLFACPYTTSYEVVVTVALLGALAAQIITHIQAYETLLQFTNGLRS
                     EISLDQIVVCARAFYENVCVAETRELRRRLRLQNAEAAARTRGSAATGGAGEPLPGWY
                     VGPHSKAAAVAAAVPPGKVDDDDDESDYFPSVEDMVALFLKTDGPL"
     gene            complement(<206335..>207657)
                     /gene="PAR45"
                     /locus_tag="LMJF_22_0530"
                     /db_xref="GeneID:5651813"
     mRNA            complement(<206335..>207657)
                     /gene="PAR45"
                     /locus_tag="LMJF_22_0530"
                     /product="putative peptidyl-prolyl cis-trans isomerase"
                     /transcript_id="XM_001683153.1"
                     /db_xref="GeneID:5651813"
     CDS             complement(206335..207657)
                     /gene="PAR45"
                     /locus_tag="LMJF_22_0530"
                     /EC_number="5.2.1.8"
                     /codon_start=1
                     /product="putative peptidyl-prolyl cis-trans isomerase"
                     /protein_id="XP_001683205.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651813"
                     /db_xref="GOA:Q4QBU3"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR000297"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="UniProtKB/TrEMBL:Q4QBU3"
                     /translation="MSSFQAHVAKLARAAETVSADAEQAPPAVAIPLHEAAQSLPPHI
                     ITATDPVKLNKQASIFRCPAWAGLPSRPFHLHCVRGKVPYPALGLQRFPYYLFGKNPV
                     CDYVLEHPSISSVHAALIFNKEHVCFVLLDLGSTNGVRLEGKRVEPRKPIPIAVGSVL
                     QFGYSTRTYELRAGAPPQLKRLREEGDEDKAAQQHGSGLASTDSGLCEADKVSLSAAV
                     AGGTATCSATAPSAVVTSSTSADAAVPPAPEGQVASEQRTCSVTAEAATSSAHGAVTS
                     AVGRMTEPAATTVMHTAADATGGSPAEAATASAAAEYAPIHLFQLVIKHKDVENPISR
                     GRNKGEIITRSRADALDMARYILADHQRRVPVAPALGFSPWTPEEFVAAVDEYCEVSA
                     KKKRGDLGVVEKGTFADEIDEAAFKLRRGEVSAPVETQLGIHLLYRCD"
     gene            complement(<208260..>210935)
                     /locus_tag="LMJF_22_0540"
                     /db_xref="GeneID:5651814"
     mRNA            complement(<208260..>210935)
                     /locus_tag="LMJF_22_0540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683154.1"
                     /db_xref="GeneID:5651814"
     CDS             complement(208260..210935)
                     /locus_tag="LMJF_22_0540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683206.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651814"
                     /db_xref="UniProtKB/TrEMBL:Q4QBU2"
                     /translation="MSSIQVSGRHGSYATQFWKPSVWAVAASRFRNRADMRAAYSRKA
                     IDRRLVLPLDSHNWIRALEVLNAGYARLGRTPEHFKMVLRDMVEHHGPYAERVTLPSS
                     AFAPPCPTQSRGGRDGAEARVFSGDGQQLPSTPTEMPAGSEGAADILPAVDALRDRAY
                     AGEIPSNRSLWVTLVWSYCALDQPSSALDTFHLAARRFRFSSATMQHMATLLLPVLCR
                     HAQLEEATKLYETYLKVDGTKEDADGAPASRHHRSRIEDADARRWLAEAAARRGDWKR
                     AQNFAGDARGPASSASAADDHPHAITRGSPSRRTISSLFHDTASSKTPALSPGGAHLF
                     ASSEGSSRTEGQQVTPRSAAAPPAQPMLQALSREAVRQLFRCLCRGGSESGSHSQLRD
                     ALCCWEHLYGPVLEAASTVDRDAMGRCRDGNPCRLTRPPPLEDVHELLNLFASHRRWK
                     ESLSVFCHLFLNRPATVYVTATLADLQVLSSSTGSSGGPWAASANGETPITAPVLRLD
                     ATTLNILFSSLPAAAAPLLVRTRKSTPTSTTTASEGCNHEQLPPQSHAASEEFELRLS
                     ASAVPVTVVRLLDDLLLLRDDMVLTDFVMAAVGPALLQVGQVERVFDLLARTPMMVAA
                     SQRQAPVYVSAEHQARKAELVVLGYAAFALCSSPARRHDMVQRLPHLFPPEVVRHFAT
                     GGEGNTPSSCAIVEGRVVLENDSGTATVSSTAVTMKSDDTVPLNGSVDSLQSHTRANT
                     VSTTALSLLDMKWHTPTAASAFRGGPLNVPTRPGRRSSAATLTSLADDAMRRDYVRLH
                     ERRRDAFTGSHADAERDPRPIPKGLHDHASGWDFFGRGGEMVFANHKRTPHPFTMQPK
                     VMRDLRNPYRGWNPRRNSSLAHKENVIKWNGKSAV"
     gene            complement(<211839..>214514)
                     /locus_tag="LMJF_22_0560"
                     /db_xref="GeneID:5651815"
     mRNA            complement(<211839..>214514)
                     /locus_tag="LMJF_22_0560"
                     /product="putative kinesin"
                     /transcript_id="XM_001683155.1"
                     /db_xref="GeneID:5651815"
     CDS             complement(211839..214514)
                     /locus_tag="LMJF_22_0560"
                     /EC_number="3.6.4.4"
                     /codon_start=1
                     /product="putative kinesin"
                     /protein_id="XP_001683207.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651815"
                     /db_xref="GOA:Q4QBU1"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q4QBU1"
                     /translation="MISTQTASSIEVAVRVRPIRGEIRESRTAWHVDATSLTEIAQPD
                     CAFTFDRVYDIAATTAEVYERNVRGNIVARVAQGYNGTVFAYGQTGSGKSYTMFGDTA
                     TRSPGLIRLAVHDLFEAVGAEQQLKPYMHTEVFVSVLEIYNEQLRDLLRGGDAGGGGA
                     NGAPSATSAHGWASASSPPTTASLSASPPVLSIRENAYGVYVHNALRMQVASEQECTS
                     IIYTHAASRVSAATAMNEHSSRSHCVIRISVERSHYIEDALSEADGEEDEDEGLATQE
                     EDDEDDGRASSTQTGLSGTSNAGRRAARCAGTTARAKSAKHKKKVISTLNMVDLAGSE
                     RVAKTGATGMRMIEGGHINKSLTTLATVIDRLANEASHPHTGGAASFIPYRDSRLTHL
                     LKTAIGGNSFTVVLCCITPAIESADESRSTLQFASRAKRIKNKVRVNEVANVHTRMRE
                     LEGALRHTRKLLIAQTLYLWSKNLKIQKYEAQLPHIGQTNSPLSEHTPAASGPPLLMN
                     RQQQQSMIIAQLTAQNDALQEELRDLKTRVELAREGGGRDGGGNVLTCAGAGALAELV
                     SLRQSLDSTQQLLKEREATLEATQASLHELDGLCRELEGENKAQADKIKALARRNSEA
                     EELMCAVEEEHGALQQEVKLLRSQLQQSQARLLEKHRGDDYLAELTTLHVAHQNLQHS
                     YNQLKEKADREKAELMQRLTRLTESNNTLEDELDEAKDRGSLINSHLWRLLSAAAQVT
                     QGTPLQINDPAATVRDTQVMEAVRSLTNAAAMANRRGSDGAGAGESVNELRSRIRLLE
                     EQLGAKDAQRDVIIDAKLKRIQGLVLRLNSVNIVLIEEMRQCFHDNELLLEIAMKTSK
                     TQKKVEKAGLTMRSLEAALNRARLTQPPHKPLYHN"
     gene            complement(<216456..>217769)
                     /locus_tag="LMJF_22_0570"
                     /db_xref="GeneID:5651816"
     mRNA            complement(<216456..>217769)
                     /locus_tag="LMJF_22_0570"
                     /product="putative proteasome regulatory ATPase subunit 1"
                     /transcript_id="XM_001683156.1"
                     /db_xref="GeneID:5651816"
     CDS             complement(216456..217769)
                     /locus_tag="LMJF_22_0570"
                     /codon_start=1
                     /product="putative proteasome regulatory ATPase subunit 1"
                     /protein_id="XP_001683208.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651816"
                     /db_xref="GOA:Q4QBU0"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005937"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QBU0"
                     /translation="MSNEKGACQTKNTVRVKDDDKEEKEIIPLDKDDIALLNLYGSGP
                     YHASIKELEEFVKSHVEELNKMGGMKESEMGLAPAVQWDLNSDQKVLERENPLHVGRC
                     ERILNKGQDDARYVISIREHAKYVVTIGERVAPEDIEESMRVGIVMGYSKIQIEIPLP
                     PRIDRSVSMMQVEDKPDVTYADVGGVKEQIERIREVVELPITHPEKYTQLGIDPPKGV
                     LLYGPPGTGKTLLAKAVANRTDATFIRVIGSELVQRYIGEGARMIREIFQLARTKKAC
                     IIFFDEVDAVGGSRGSGDGDDEIQRTMLEMVNQMDGFDSRGNIKVIMATNRPDTLDPA
                     LTRPGRMDRKLEIGLPDLEGRTNILRIHSRSLSCEKDVRFELIARLCPNTTGADLRSV
                     CTEAGMFAIRARRKTITEKDFLDSVNKVVKGQHKFSATAKYMVYN"
     gene            complement(<220180..>220731)
                     /locus_tag="LMJF_22_0580"
                     /db_xref="GeneID:5651817"
     mRNA            complement(<220180..>220731)
                     /locus_tag="LMJF_22_0580"
                     /product="rer1 family-like protein"
                     /transcript_id="XM_001683157.1"
                     /db_xref="GeneID:5651817"
     CDS             complement(220180..220731)
                     /locus_tag="LMJF_22_0580"
                     /codon_start=1
                     /product="rer1 family-like protein"
                     /protein_id="XP_001683209.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651817"
                     /db_xref="GOA:Q4QBT9"
                     /db_xref="InterPro:IPR004932"
                     /db_xref="UniProtKB/TrEMBL:Q4QBT9"
                     /translation="MPSSNDLLGPRVGNTFLRKARVTYKRYLDASVPHCALRWCFFAF
                     LAILYVARVVTFGGFYVITYGLCIHLLYLLLLLITPLSDPDESEGTPLPMTHTDSDEY
                     RPFMPKVQEFVVWKQMFTVLFVCLFLTMFSFLDIPVFWPILVLYFLALFATQVGGRVR
                     HMIKHGYVPWNAGKPKFVPKSTS"
     gene            complement(<221760..>223226)
                     /locus_tag="LMJF_22_0590"
                     /db_xref="GeneID:5651818"
     mRNA            complement(<221760..>223226)
                     /locus_tag="LMJF_22_0590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683158.1"
                     /db_xref="GeneID:5651818"
     CDS             complement(221760..223226)
                     /locus_tag="LMJF_22_0590"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683210.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651818"
                     /db_xref="InterPro:IPR001378"
                     /db_xref="InterPro:IPR023368"
                     /db_xref="InterPro:IPR023370"
                     /db_xref="UniProtKB/TrEMBL:Q4QBT8"
                     /translation="MSVTPLSPFLQAAVTSVSPPTSATPADTVAGSTAPAAERVVRDG
                     VSKRYRVRANYFLVGDLVWVRPAKLPYWPAVVADCDEAANRVRARLIVPPPAAVLAAN
                     LAEEQRKYRRREEARLGKMHKKKAEPASSTATGNEASIVHGQSSPLGLGVDSGTLSAS
                     GGAAPAPPEPQSDVVTANGQVVYFFDKLRTTEELDVCLENRLQRNKHDVTLYEDAFTQ
                     AVLQANRLARISLSPEKLQPYEVCAVGIVHSLMRAHIEAPRQPNTGTFEPQTGLIRLR
                     TGLENAARDLAGFEFIWVLFQFSFAAPMASGEGQESMRKFREAREASASATTKPALAV
                     PDSVPATAEKASPTADGHVDVCRDSDGEALSAWSLSSFRRRQGFDRAAGFKTMIIPPR
                     DEEWRGVFATRSPHRPNFIGLSCVRLVAVHGLDIHIADHDLLHGTPVLDIKPYLPYCD
                     AHPDARAGWVEVLDASGKGKGDHKYDRQTTQVHRVSLE"
     gene            complement(<223892..>225370)
                     /locus_tag="LMJF_22_0600"
                     /db_xref="GeneID:5651819"
     mRNA            complement(<223892..>225370)
                     /locus_tag="LMJF_22_0600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683159.1"
                     /db_xref="GeneID:5651819"
     CDS             complement(223892..225370)
                     /locus_tag="LMJF_22_0600"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683211.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651819"
                     /db_xref="GOA:Q4QBT7"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:Q4QBT7"
                     /translation="MQPGERTPLLRLSASLLAADLSRSRCLQEHRVLSPMINEHVCLI
                     SQELVLVPYLAPFVPRYHEWMCDPGLLAATESEPLSLEEERENQLLWLQSTDKMTFIL
                     LAPATLHHADASAVGEDSPSRGAEERQQRQNEEGAHARLLSLCGTVPPLEEVFATASS
                     SPAASLASFCRPAAAVSYPGSIVTTADYTCTVSELHPQRERTSTSGCAFPLLKRYAPS
                     QVKELFSSDTLSAGSQPQGACARAEEVQRRALAQSYVMIGDCNLFLLEEEDDGGDGVG
                     DGVAAFGWSSSCEQQQHSRSPTSAAIPSDGSPPLTPVSALAPSRTFEVEVMVADPAFR
                     RRGLAEAAVRMIMQYAVAVCGGTRFVAKILATNTGSIALFTERLKFAPFKEVKVFNEV
                     HFARSLRTEKERRAWELECRRSRCGRTACSSASLHGRTAGCESPAGAVPDGSRGTDKP
                     EELPSALPPHSQQAGSELSHTYWCSPLDKVVASSIRIFTQAP"
     gene            complement(<227862..>228644)
                     /locus_tag="LMJF_22_0610"
                     /db_xref="GeneID:5651820"
     mRNA            complement(<227862..>228644)
                     /locus_tag="LMJF_22_0610"
                     /product="ubiquitin-conjugating enzyme-like protein"
                     /transcript_id="XM_001683160.1"
                     /db_xref="GeneID:5651820"
     CDS             complement(227862..228644)
                     /locus_tag="LMJF_22_0610"
                     /codon_start=1
                     /product="ubiquitin-conjugating enzyme-like protein"
                     /protein_id="XP_001683212.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651820"
                     /db_xref="GOA:Q4QBT6"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="UniProtKB/TrEMBL:Q4QBT6"
                     /translation="MQAARLPTRIATGDGEDAPQTPPVHAPATPAATDEQETDQPQQA
                     VGEATTPADRAGFQPPSAEALATRQSRNSAGAEKMGGGQRLRDHTTAQRRLMQDYRTF
                     QKNMAEGTSSNITALPVDGDFFHWHAVISGPCDTPWEGGLFKLDLIFGDDYPFSPPKV
                     RFRTKDVFHPNVYVDGNICMDTLKSSWQSSLNLEALLISIQSLLSDPNPLSAANGAAA
                     RLLTENRSAYDEKIRALVEESLEQSFSMDDDSDDAEVDEEAV"
     gene            complement(<230766..>232100)
                     /locus_tag="LMJF_22_0620"
                     /db_xref="GeneID:5651821"
     mRNA            complement(<230766..>232100)
                     /locus_tag="LMJF_22_0620"
                     /product="putative proteasome regulatory ATPase subunit 5"
                     /transcript_id="XM_001683161.1"
                     /db_xref="GeneID:5651821"
     CDS             complement(230766..232100)
                     /locus_tag="LMJF_22_0620"
                     /codon_start=1
                     /product="putative proteasome regulatory ATPase subunit 5"
                     /protein_id="XP_001683213.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651821"
                     /db_xref="GOA:Q4QBT5"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005937"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QBT5"
                     /translation="MPSAKEVAEARAYAQAQEEATDKRKLQNISETELNELDTLTNDQ
                     LRTRARNLHQETQTLRSFENRSKQELVSLKRDVEMGKKRVKENNRLPYLVASIAEVLD
                     LSDDEDEAEELAVGRKKPERKQKSAVVKTTNRYTVFLPVAGLVDAERLSPEDLVGVNK
                     DTFLVLDTLPPDYDSRVKAMEIDEKPKEKYTDVGGLDKQINELIEAVVMPITHKEQFE
                     KIGIQPPKGVLLYGSPGTGKTMLARACAAATDACILRLAGPQLVQMFIGDGARIVRDA
                     FALAKKKAPSIIFIDELDAVGSKRSDEGKHGSREVQRTMLELLSQLDGFGSSDDVKVI
                     AATNRIDVLDPALLRSGRLDRKVEFPMPDEEARASILEIHSRRMNLDKDVNFKELARC
                     TDDMNGAQLKAVCVEAGMLALRHDRTYVAHEDFVEGVAAVQARKKTNLNYYA"
     gene            complement(<234277..>237702)
                     /locus_tag="LMJF_22_0630"
                     /db_xref="GeneID:5651822"
     mRNA            complement(<234277..>237702)
                     /locus_tag="LMJF_22_0630"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683162.1"
                     /db_xref="GeneID:5651822"
     CDS             complement(234277..237702)
                     /locus_tag="LMJF_22_0630"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683214.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651822"
                     /db_xref="UniProtKB/TrEMBL:Q4QBT4"
                     /translation="MLQTVQQSWPRRGRDFVLPEVPILESPEWSDEDDDINRTRTPLS
                     VETEARAPAARIADSRPMLSPAMRLPPMVRGASPPFAHQMAPPSAGFNHPCSYEAARV
                     SDSRSANEGNHRFCASRKANGGGDTGVSATPCSGDAARKQHSILNVGPRECWPVDGHN
                     GDDSDSPPQMSIGPFVSVRGPSCFPFEAGSLFVSSTHHLGDDDDESSSAATGSSNSSS
                     DTDRTRTSSDSTDSSSNYQQQRASMSPFSHGSTQVGGLLGGGGCPQQPSAPSYGIEVG
                     PSIFVRLPQQNPSLLDTPVAGRTGLITAAEAAPSIFRTFFHEDDGSYDMTGFHHDSAS
                     AFHQDDTAALSMTLSAASARAANGGARVAISCGREGRADATNSAAAGTHQDSSNHTIT
                     TVSGDGGLQRGPLSNRRQGSFFTTVDEALYETHAHPTAPRSPNAVVLVSTDVSPMHHM
                     DAFQASRGATEPQHQHQGATHNGNNDSRDTRRRRMQPALWHSSPPEKTSTQLSGIHAA
                     LAEYVLLPRREASPMMPSVATVKSTPASNSGVGDANRKGDTQDGDKDSRPQEHGTRFL
                     ESADPEPDILLGRDALEGGTRDNDGCLYPSMVWIKAKQLSSAPSSVRTSHSSAKPNTK
                     RLNFRSRITPRGHRAAAAPVAGATASNQAPAVSERRCTDSTAFSLEAPDGTGFGATDS
                     ATNCTANAGGGGGRTGHNAVMMDWDEYGLLAWATKSPLRTCPESAAAFGARGGDGGAG
                     AANESVTVTDSAASHTTSRKATLPISVKASSAKPTRRWTDKVRPRRGESPHTAVTFVE
                     ETAPFAPVNDDRSPSSGATLAAPPCEQAPSTPPHLLATMAAVTTESGRPQLLPTASLL
                     CPTTYSMLAVTTGKVAGSGTPAATAPSPSVSGEPSVATTAAGPRAAPSHTLSPPGEYF
                     FNSFHTNLTIAGSLGDEDNASDAVLVSPLPNMSNPADAEGHTTGAAQRRLSSINGGSR
                     QNHPTIPSFQWLGQQRQQRNGGRTGSHIFIPSSSASSSAASASTSVASTALAWRGMKG
                     AQGNTVATLKADYELLTVGADVTSVNGRRTGGFVALEARTNLSAEAQASPANLGRVAS
                     RRPIIEDPGDVESVDNSRRRSEPASIVSAEEVQPPRNRRKSPHWRLHASPAER"
     gene            complement(<243107..>248470)
                     /locus_tag="LMJF_22_0640"
                     /db_xref="GeneID:5651823"
     mRNA            complement(<243107..>248470)
                     /locus_tag="LMJF_22_0640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683163.1"
                     /db_xref="GeneID:5651823"
     CDS             complement(243107..248470)
                     /locus_tag="LMJF_22_0640"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683215.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651823"
                     /db_xref="UniProtKB/TrEMBL:Q4QBT3"
                     /translation="MPLVSATTSQEGGGTGGSAYLIHSICAVDDVTLIFAIASAAGAD
                     SAAHSPYDAALFSFCKAADGSEKAIPRGLRPSPSGTCCTGGIRDALYARSLAGSRETD
                     FSSSAHEECGGCPTGCSGAEAASGVGNSVAPPTSGLHSRQSCVLLAHSAAAGAMASLS
                     EGPSDSLAALRASQLMHLFHRSEADAKAPLADVTAGAPPAFSRSSSPHLSGDALAALH
                     VVRQEAWQRSSDAANAPTPLVTAHDAASASVISTDVLCYFDCGCAALATFKLTRDSPR
                     AEWLVQLGGCVWIPSAASSMSVPGRSAGAVKGWASALTWATGAPLVSSLVRPLPPTAS
                     LTASAGAHRDGSNSLLELLVVWCSPTVASSSLAFSSFTDARPVARYASLCCCSGNSPT
                     AAATMSAWRLEKQAIFDMSELLRLAPRQSLSSEGVHDSVCSCSALPHASVRGLHWLPG
                     TADFTQSYPLLAVLYAAPTVHSRRIDNLRGGPPEPCLDSMAVCYLKEDGPHLSATSVP
                     AAVVPHKAPPMVMGRLLVGPWSVRGLSLAHPQFLFATALAGWRSPPSRPPPAANKQRA
                     TVAATSAPSAAQAFRAALHSCSDAATPVLGVFQRPAQEPYMTSSFFRSVADAVVRRGR
                     REKTLAGAEFSDGDVVRLREFPHLQRAGIEQEGLQALRNSKVFAFVLYGGDGEVARCV
                     LDGYVDDAQTTWMDPYIMSANVVGSPRATGNPRGRGGEVEKRTVARVCALLSEKASAL
                     SAERVHGHSAVVITIQAQWTRALPVVAERRHSNEVRTDGGIGASEHWSFSLHLSHRLR
                     SSAGPGGLLRHSWCAAPLAMMGRILCWRSATASDDVSCLVCGYATAPYHGDTTSDEVD
                     AHPHALLEGVFELRLSSSLMNGGDVGGRPAAVTETTNAALGVATRVGAATSQPSAALA
                     NLCPWAVGRCTRVLLPSAFSGVLHKASTADTLTTAFDLLSHTPTFSVAAARLGAAVSD
                     SAVPVVLAWVAGEAHEAGVDNLAQTAPPLSATATSSRSSLLSCVRQLDAVALLRSGDV
                     VGWRCASRSSAAEVRSAGHLRGEGAVLHLGAICHGLGHDVAPPLEQLFLESLLNRGAG
                     ADVVHMEVVIAPVEDSSRQVDHRQPSAGLSPMEAESSSLASAVTETAAKSTVLLVLAV
                     GSLVGVVDLAAGAVVVVRDLRADLRDLPVREDGTTHSGDAPLATTDGAIRATAAVLRL
                     QRLPVATPCGWMARGDAAQEGGGAAVGTSWYFVWRGVREGQRDHSSLTFVLRLSFLCF
                     ADVVSAHVGAASSSATGGATPAASVLDTENSTLPLVTLQVDACWAEEPKPAARSNVVS
                     SASTPATSHHLSLRHAPSSAVAYFGWLPCATGCVDNGVGRAAPRGTAANTGSESSSAE
                     AADSLPFLSVCDATLLRSLWPAMATDEIKMSVNQNCAPSSPPSGTVAPRCRPPLRFLR
                     WGGVVPRPSLPSFCFLYNRIGATCVMEQLAGGGAAAGIGMPLNIVYRWLLGERRGADA
                     ALTPPERDRDVDLPYRLPCRQVLYVSTLRLDVRAVREHYDEHEPLPPDRAVSGSPPVA
                     APGSEPARSSLDPTSWHVLLCTLLLDKGEQASKTNCSTRTLSGVSASFDVGAVAASAT
                     RIDWRQSRAASYLLCGVPACAPVVPPQQQPGSAAPAHHSPLFTWHWIPLYVSTSFPAP
                     DSSGGVQQHNVPLAVTRVLPSPRRSSAATLSSTGAATAIAKNVRHGVTPRSYFYCEGI
                     LCSPAAAAAPHDPHACYCLSVEGDRLRHLLDQSAIAASTEGIEQVYMYATVNPDLVRV
                     VGA"
     gene            complement(<250097..>251599)
                     /locus_tag="LMJF_22_0650"
                     /db_xref="GeneID:5651824"
     mRNA            complement(<250097..>251599)
                     /locus_tag="LMJF_22_0650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683164.1"
                     /db_xref="GeneID:5651824"
     CDS             complement(250097..251599)
                     /locus_tag="LMJF_22_0650"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683216.1"
                     /db_xref="GeneID:5651824"
                     /db_xref="UniProtKB/TrEMBL:Q4QBT2"
                     /translation="MRSACGRHSLQSTRNRGAFHPTLAAAALCVSHRYRSSTGPTISD
                     TRALGPQVAFSSKTVKLKYEEVWQLWNEGNLFSLQVAQMRDFLADAGIAVDPTAKKAA
                     VVRRMEEYLHSKDSAEQHGGTAAIAGAARGAGKESEQNYGNWAGAGVTQPEKLLDLAQ
                     AGFYQGTANMVPKAFQLLTTGSCAEAVVSRVNTSAFPGFPANTECYTLSSSDAAGALQ
                     TRYSKVLQWCLLNMNNLRMDGELTVEVGKLLLTPAAMRYGEAVVSAYTLQQRLQLTKP
                     YTWIAAMPESAIPLVEAFLKERGFQPVSKNARLTYEAGIKRAKDKLEVVLNEQIKVEG
                     VYGEWVDVQTAFCTSVEKPDCRILLRSRPAVSAQDRETYTRIPVIELADDDVNDVLPP
                     ENGQLVYLSENETRHFERLNDKGIAIVVRETKRQPLIVLRDEEEDLRLEYQLSVTIPA
                     SAGSHSMDVRAVGLEVLALSDELSTLLKEPFNEAYGCAPALDTGSVAATA"
     gene            complement(<253266..>256589)
                     /locus_tag="LMJF_22_0660"
                     /db_xref="GeneID:5651825"
     mRNA            complement(<253266..>256589)
                     /locus_tag="LMJF_22_0660"
                     /product="glucoamylase-like protein"
                     /transcript_id="XM_001683165.1"
                     /db_xref="GeneID:5651825"
     CDS             complement(253266..256589)
                     /locus_tag="LMJF_22_0660"
                     /codon_start=1
                     /product="glucoamylase-like protein"
                     /protein_id="XP_001683217.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651825"
                     /db_xref="GOA:Q4QBT1"
                     /db_xref="UniProtKB/TrEMBL:Q4QBT1"
                     /translation="MAVAVHPPLSRGSQRAVSTAASEPASVSSATTSVASRASTSNTA
                     SAPATLVSDRPLNQSSPPPPLPFGTAAPTGPTRASTVSTVPQNGVNPRQTTANTADRR
                     STRVHTPAHMRPQQFHAPPHTHRGDGNGNTNGNGGSSSGGPLASTAVPHAFAATYASS
                     PFFQRVTDTAPMPQSSPDAPRAAASTASANAKDEENSMLQLQDVTPITNAGDSKQESQ
                     LLSQLRATAESGCDSGHYSHRQETADHDGSAGVTPAVSSATANTAPLQSSPFTGAHNA
                     FVAGGIPPWSTLPYAQPQPCPMVRVLAHQQSVFFPCECNTSQCMAAKPFSQSTSPSDT
                     ARLCGTPGGLSTSQSVTMCSTGQRRSRGAVSVAAANGTAMSSACPLTSPESVSGHLSG
                     IYASPPPSSSQAYASGRDQCCSPLPTPGSTRRRCQKTGTAVISSPAYAHVPHQHHLFL
                     QHYGVDGVSGYGSRGGPLMPSSPNLTVTPLSMWASVPEAACAATTAMAAADQGRTSAS
                     AGTSTAQGASGGASDFSAIARGLSGVALQKQLLYASKGELTRILLELASCNPEASRFI
                     HSKAFFFAFRHEHGGEAVEACEECPAATPVTTAAAAAANKNGQHYALHGGLGSGFTSR
                     TVDTPERDRSFEQSGVLKRPVAGAGTLSGAAAAYDHVIARCIFPVEAADDEDGDGDGA
                     GDDSVAKIEHSDPTVTKGAANATMPRRCLYPEDRAFSAELHPCLRWYGACRNATSCVY
                     ANVPRNVCLSWIRGSCMADTGCSGVHRLPSPCPPEIRRIYELNHGLARRDTPVNACAA
                     RVSLGHSLPIPPPFPGCTAQARAPLANGSVAAALPTNPNANAPAAELAEACAGANEAL
                     GMCAVMMEGLGGEKVVVHTPTDQSIHKDTFLGGGSTPRRHPHGRDVELCISAMTMMER
                     CGGAHTMTAGDASLWDLSNAAITRNVCGPVDHEMLQYTGGILGADASAGAAAAAAPPC
                     LFGAGVRPGGQRSGVVSSAGNSRCSTAEGCDSRTNSVSRYLGPQFDRAATAVLHRDDG
                     RADSAAMSWATQEQQPDPKKSIKSICGCVCEANEPLQVVPVRPAGGVAGALIDVDDEC
                     DFSAPAAGTRTRMQSPLYQ"
     gene            complement(<259487..>259960)
                     /locus_tag="LMJF_22_0670"
                     /db_xref="GeneID:5651826"
     mRNA            complement(<259487..>259960)
                     /locus_tag="LMJF_22_0670"
                     /product="prefoldin 5-like protein"
                     /transcript_id="XM_001683166.1"
                     /db_xref="GeneID:5651826"
     CDS             complement(259487..259960)
                     /locus_tag="LMJF_22_0670"
                     /codon_start=1
                     /product="prefoldin 5-like protein"
                     /protein_id="XP_001683218.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651826"
                     /db_xref="GOA:Q4QBT0"
                     /db_xref="InterPro:IPR004127"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="InterPro:IPR011599"
                     /db_xref="UniProtKB/TrEMBL:Q4QBT0"
                     /translation="MSINVYQLPIEQLEGLKEQLGNDVRSLGTAYDGLYNGRTRYQDN
                     HDVVAQYHAVCENAAKTEAAQEVLVCMTSSLFVRGTVVPSDKVLVDVGTGYFLEQSME
                     HAKKYFLSRAAQIKESMDQVEKTIVLKQRQQNQVIDALQQKTMAMQRYHEEHGSE"
     gene            complement(<260827..>261126)
                     /locus_tag="LMJF_22_0680"
                     /db_xref="GeneID:5651827"
     mRNA            complement(<260827..>261126)
                     /locus_tag="LMJF_22_0680"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683167.1"
                     /db_xref="GeneID:5651827"
     CDS             complement(260827..261126)
                     /locus_tag="LMJF_22_0680"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683219.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651827"
                     /db_xref="UniProtKB/TrEMBL:Q4QBS9"
                     /translation="MLRACLWDHATLPYKPTSPCVLFYLVPGDPVWRVSVPNARGEYP
                     DLVPGLPYQEWHAMEPHYLQEYAPPALSIHESAEVAWEELPTPPFDDFRRFLAPS"
     gene            complement(<262931..>264730)
                     /locus_tag="LMJF_22_0690"
                     /db_xref="GeneID:5651828"
     mRNA            complement(<262931..>264730)
                     /locus_tag="LMJF_22_0690"
                     /product="3'a2rel-related protein"
                     /transcript_id="XM_001683168.1"
                     /db_xref="GeneID:5651828"
     CDS             complement(262931..264730)
                     /locus_tag="LMJF_22_0690"
                     /codon_start=1
                     /product="3'a2rel-related protein"
                     /protein_id="XP_001683220.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651828"
                     /db_xref="UniProtKB/TrEMBL:Q4QBS8"
                     /translation="MCPVSHQGLQRNRSPHVSTARVLQRVLLLVVLLYSFSLMTAVVT
                     TPCDDGAHGALCVSALHGAVLGRGKGLRAPPLTVSLLQPVALPRHTGSAVVVTAARAD
                     GDVDDIATFSQAGDLFALEESASASVPSSSSSGVSPGASGRGNEAAKAPETTASSSSL
                     SVEPLSRESSAVSSLRRSSLLPSAADIVVVLVGEGDAGTELPPSSSALPPDNFGTRHP
                     PAMRLALLGLIALVVPAAIIALVVWCVCRRTRYKRKVKGLRLNGTRQPGEVDDVDMGN
                     VVRGGDWLNLDAAAPGRTKIGAHRTRFSILVPSTAACVRTDATFDPIGQRAAETRQRK
                     RARRVAVAAAEAAVIPANGVGNGGSDGLASPLSGESGAAGSEMWSSDEEEHSNGYSVN
                     GGVSGGNAGVAGGSAQAHATSSVLPGTRATGAEVSSGAGPHLSGGVVTSSVVTAVPSL
                     DHSLNYFNETTRVLLGRYKAESGGGVPQMPPSALPGGGGAATQSLRLASGNEAESSNA
                     VVNKPKSAFEQILSFAVAPLQVGREFHQRGDNTDSGNVADSAGGPKALAAPVPRDRER
                     AERHTEKEDLEEDRAFEDDEELDEEYKDEAYGD"
     gene            complement(<269119..>273966)
                     /locus_tag="LMJF_22_0700"
                     /db_xref="GeneID:5651829"
     mRNA            complement(<269119..>273966)
                     /locus_tag="LMJF_22_0700"
                     /product="5'a2rel-related protein"
                     /transcript_id="XM_001683169.1"
                     /db_xref="GeneID:5651829"
     CDS             complement(269119..273966)
                     /locus_tag="LMJF_22_0700"
                     /codon_start=1
                     /product="5'a2rel-related protein"
                     /protein_id="XP_001683221.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651829"
                     /db_xref="UniProtKB/TrEMBL:Q4QBS7"
                     /translation="MMDITIGSPSSSYRSCSRSSRGYTQRPDLARDAASSGGSSAAGQ
                     GTELLTSAVGLDDTNDGGEGHHARCSSADSHGGFGEDRSDLDHRAAGASRPPPSLGER
                     EQTCRPPPPNTSAAPAPQHQVTNELVYALSNRESLSPAQMTPSSIPFSASLPSSSSSM
                     TGSGGAAHLPPRRAPQLLPHDHLHSRVEGMVWLCSAADRDRAPAPIPWASGRASCAAE
                     ERKCTDDAVGVRGPRASSLEAQARASEPTAVAAAAPVTRWPERQEQVIPRAFARTESP
                     SPLRRVAQMELATGDAERNAAAEASPGTEVSGARCGSLRKLALPSFCSDGGLEVMDNQ
                     PRSERALRLARVSNTVTLSSPPALSSTSTSAVPLPGPPRLSSASSPSVPVQQQRLRLP
                     SHSPESVSSASLSRAVVRRESLRGASATAATSSDSYDRGEAHDHHCSRRKRSDSRYRA
                     VGDMDDDDGTTSSSPGLTETSGARPPSHAPAPLHPSSFLTQVPPHACRSLQSSSDSAK
                     ECGPGEAQRADAARQALDPSQASSLVPSPLASRSPSLSAAPPAQLPLQRTVEETRRDS
                     SSNGDGSGAARRTPRYGTCPAMTEVAELQLPLATPTEAAVGCGGSGAAAVVSESLPPL
                     PPAPRGAGDGASSLHPSCRENHRHSKSSATEARGVVLQAAASEADMASEARAGDGEAR
                     ASRERKAFPAAASLRDGVAAALELDGARRGAAPPTDAPCHVQPPPPQRRALDRWRSQA
                     SLVGSRAADTTALSSSLRAATHSSRGSAAGQVTERDDGHPSQSARECGEAGKRAFKGG
                     VNVARWVRSTVGGEGDLSGASLIPPPVRKAAEARVCAPPTNLGSASATSASGTAGDFG
                     GNEPPRVLAVSLAALPRRTPPREAVAPAVLAEVTQSCASAALVSGRQAYQGMAALSWT
                     LPSRSRVRLTVIASPAQERWASRAEGERAVGGAAQVDPRDRSSGARWREAGSAGEAFL
                     VRSDAHRVEVAAVPQRAHPVRSSSSGQRASRPGLAAVLAPRTSTMCGPASSAEVDGAD
                     EDKEMRIVARTWRPVTCLEFVRDDDRRRSTGDDCQSSWGAAGTHRWGQGPHHPRAAQR
                     SAAIVGALSGGHQTRPAHHPHDGSHGCVLSIEASPLVSPVSLAAEATSDVGASTRQAC
                     SAATWRAGAASNGVGGVVLSSTTLVPGYAAVYSPRMLATRVLEARKALLGAPSAAVPA
                     APTSVCPPGPSGALPLHCGSRAMPAVGATVAAAAASTSGGVSSWSPSSLLSPPHAHID
                     LKERGADDGVMPGATADAAPWSLYLSGSPDAEESMRHRTALPRQLTRGQQHLHEQPDL
                     PADTSPYPVARRIPFGFAAGTLAGAASVQAVSPSPDGRLRSCHARTASPAADASAPVP
                     GAHLHAEGGYQRARRLPCHTPAEEQRSVTASAPSSPIVARSAAASVAAPLGRMLTTLS
                     PTTASSSAPRASSAGTAQGRHQSIPPPEQHAAIHAAGAGSQASERACSTSRRFWRAAT
                     NADQSHDAPDARPKRQSRILAQQRLVQEEAFHRRYIRMQEDHRFAVEVTELNYQRAVE
                     YVHQASAAGAVATPARRSGHCAALLTTDCDAEPLAGLQRVRRDQAAMTATLSTLAKEL
                     AALSP"
     gene            complement(<275553..>276461)
                     /locus_tag="LMJF_22_0710"
                     /db_xref="GeneID:5651830"
     mRNA            complement(<275553..>276461)
                     /locus_tag="LMJF_22_0710"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683170.1"
                     /db_xref="GeneID:5651830"
     CDS             complement(275553..276461)
                     /locus_tag="LMJF_22_0710"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683222.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0710"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651830"
                     /db_xref="InterPro:IPR004401"
                     /db_xref="UniProtKB/TrEMBL:Q4QBR4"
                     /translation="MEVYRRIAERVRGALWAHHRRLMPERQFHRILAYVYNNKYEYQI
                     RFDRMSVVGRAWAGRVEVMTTPGGFLKRVRVHPAVEDLSPAQQHKLVLAAYADACQQG
                     RALMEQAELKVYKQFLQDLKPIILGIRDNPEFYTVPEDSVETIGGVLRRDQAPLDGGA
                     AANAAGAVHRTIPMARAHQPVDEVRRRHAWEDQWLASKQGQRWAHSLRGKEYFTRHGP
                     QYRPRGAPGAKTRTLPFELLAPYTPMDEGRLLRTNWVAYMDSKHVAESLWTRAKVADR
                     EKQLRQLQERGQAWHRPINEDAVQRW"
     gene            complement(<277188..>280688)
                     /locus_tag="LMJF_22_0720"
                     /db_xref="GeneID:5651831"
     mRNA            complement(<277188..>280688)
                     /locus_tag="LMJF_22_0720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683171.1"
                     /db_xref="GeneID:5651831"
     CDS             complement(277188..280688)
                     /locus_tag="LMJF_22_0720"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683223.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651831"
                     /db_xref="GOA:Q4QBS5"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QBS5"
                     /translation="MLCPVLRSIHGACVPRASAVRQVPLRRLTTSAGAAAVAAILAPV
                     TLCCSIHQRRHYHSLRHTLVTELKQSTWKNDGVRGQPRPSNSSKDDHHGTDTAASSRY
                     LTADGSSRGAVHTSECNHSAGSSRQPPGSLQAQRQKRPRPRRPSALFMSLQEVEETTA
                     AASSSLAPLSADEQVADVQDDDIVLDTPASLLPCMAERGASTSELRQAAQRARHQRRS
                     GGGGTDAAHEPAALEKSEHAHPAARGVGQDVIDLVTDVFTAQRDAEIKKRREVLYELT
                     HPNPIDYTYNGKLVPPPPLSFGQVTEEARALGNRMMLGQTYSLVRQAGTRASADDFDV
                     IGSSASTAGRGAAAATTVSPASSIEASLAAPLSTFSSRHAKGYGDRTAAAPYRSRARD
                     ANIFRDHNYFFEINELYQEVAFAGRACAGKSSLLNALLGQHVAKTSSTPNTTRKISFY
                     QSVTPEQLHAFHVKEHHNQLVKLPGGGLQLTFVDLPGYGIEGMSDKWRDAAIELTDAY
                     FGVRRSVNTVLYCMDCERGLTKTDIKYLEWIENVHGACFMVLTKCDSVPHSRVCSVMR
                     QVYALITKHRRKYRKVFPFIIPVSAKDGTNIELLRGLITETAGIIPGDKLRELLQHKR
                     AALTRTALLAEVSRIDAARQLERHQAKAYFQLTRDGTGASAAAELPPEARGSERSGAR
                     REREGSGGAGAGAQGTSAERGATLLPNVAASETAASPPGAAFGSRHRRYVLPLGNGAA
                     DAEAAALLSGCASDLDAAGDTADFFPTESSMAAAAAEGRCERRERFLAWRRAHPLRTV
                     SPSYSAIHEQVGYDPTRPAAASEQVAGLPGSGRYRLNTGLDNPGAAHVVLELHGEPDV
                     SEGECDARGKDGTEARHGGGDMEAQNSRATAVAPAGEFSHSPLPIAAACRGRRFSVIG
                     LSDVDTDGSVAPGATASAAPPAVAPSCSLRSASAGTVSRFLDVMERYGRQHNVVSSAK
                     QKRREERWRRRGGGGGGARGRHCAVGGLLAEDASGRLSAYRAGRPCGPALVSTNTDVD
                     RRQAEWRAEQLKTLLAKENPEAPWAALHQLRRTIQAREEETALAGMRKKEVAAYVRNA
                     GRVTASFEKFEGEVTAAKYMNEIRQAPTLRSQQQMHLNATAKINYRSMPPGLWKRYGE
                     KDTYWQTSQLLGRSEDESHR"
     gene            complement(<282803..>284122)
                     /locus_tag="LMJF_22_0730"
                     /db_xref="GeneID:5651832"
     mRNA            complement(<282803..>284122)
                     /locus_tag="LMJF_22_0730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683172.1"
                     /db_xref="GeneID:5651832"
     CDS             complement(282803..284122)
                     /locus_tag="LMJF_22_0730"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683224.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651832"
                     /db_xref="UniProtKB/TrEMBL:Q4QBS4"
                     /translation="MSAQQQPSEENSDRMVAARTKAEAARMAVERRRSMNSDAQERSN
                     SPDHHDTPTPLRGATQERSSSVDLANGGIEDPHGDSGEHRPNSSIVKRRSSMPKNGVR
                     DGSRRGSGVVAVGPPNASYSGTKKTADPQTPEEYAAAIEEMRQEYERIIMKDAELEER
                     LQLYSDVVGLRKELVIVQEDEARLRQQLAATEAVIASSDPTVKKVVPIYEEEAQQSVL
                     QKLWMEESECHNPDTMEWAAIDVNNLRERVDAAHKKFTAAAEMADSLYLQQEEAINKT
                     TDARERERAIIAENHEREMEGLSEARVHARQVAAEQHFHRHRGTAQAPPVVLTQDKKR
                     TTRQRCVDEVEFHTTAQVGRMKDELTELMEQVKMLKRHLDDSRQVTEKKRREYEATLK
                     AVEADGSEAREMKEGLLKEEEELKELKADIQAVLHYVRAKNREEEGW"
     gene            complement(<293126..>294898)
                     /locus_tag="LMJF_22_0740"
                     /db_xref="GeneID:5651833"
     mRNA            complement(<293126..>294898)
                     /locus_tag="LMJF_22_0740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683173.1"
                     /db_xref="GeneID:5651833"
     CDS             complement(293126..294898)
                     /locus_tag="LMJF_22_0740"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683225.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651833"
                     /db_xref="GOA:Q4QBS3"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:Q4QBS3"
                     /translation="MPRTAPAKGRHISYNADGELCMTVVDPVTRKLLIPTQYIFETRA
                     QQRGTLPSLCQLFLSGRCRKGQGCYQLHADWEAVQRLRSQVDSLPCCCPTHGDKDHIG
                     VLENALLRESVSLGHPHSHHHGNSEQNSADAAAAAESTVGANDVVLYVPGCSFFEGSY
                     APLDRVSYTVGLRRLLEEQRVLLTPSTARISLLNQVTGFPEEKIVADASAATVCRLHA
                     MGRCRYAEECKFLHLCKDLTTADPQLTASPATGGVNGNANCAAPGSFEASTTTAGLTN
                     GTETSSMPSDRRLKSSHYHSSSAALNTPGAPVRQSVFTSISLQQQQQLPLGNGGALAA
                     DPAGIATMVKVGLASSLQPSQSMSYHQDPSVMVPADGSTGSARGSSRPYLMGSAGASE
                     SGRLLVPQREDVSNGIEGAGTASAVPYLSKSCGYRIGAVGTTSLPQRPLQIESGVMPQ
                     MMNASTGSFPGSSQQNNSSPSAAPYGLSPTKGNRVRVSLSLPATSSTSALTYGAALGT
                     SNSSDKTSSPPAEGSMGMSSSHNSFSRSVTQMQASSNSTRWHHNPYLASWPKTEAPYG
                     CSGKCDGLRCHPTGFYALPIARAA"
     gene            complement(<303223..>306663)
                     /locus_tag="LMJF_22_0750"
                     /db_xref="GeneID:5651834"
     mRNA            complement(<303223..>306663)
                     /locus_tag="LMJF_22_0750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683174.1"
                     /db_xref="GeneID:5651834"
     CDS             complement(303223..306663)
                     /locus_tag="LMJF_22_0750"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683226.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651834"
                     /db_xref="GOA:Q4QBS2"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:Q4QBS2"
                     /translation="MSWWNDFSTHRNGGVVDGLPRPRQHPASDSFSTQETATQGAVDH
                     HEHHTSNANSPNKSTYVSKANLSDTSVGSGFASHEATWGTATECSDVGSLWQRATSVC
                     GVTESDPLGVSAAVSAYGSPALQKQQEKPPAQQEEPPAQHPLQPLLLLPTARAVEGVQ
                     SSSTKGVRCGSGSNSDSSGAYCSGGPVGALSFAMDYYGPSFTSGTEGVKTNAATYSRG
                     GHASSSTHTINDDSDSVVSGDIDEAVDKDVRYEEVDVGNISSLIAALQVRDAASLTNS
                     DAPNAEDEEGKKAGRSSCAQDKPPARDSQAQADTGRGVDVTANSAAAKKQQHQQQEAG
                     HTTMIANFAPVFHDPNAGAPLIASVNTTQSISRRHSSNMYNSSTSGSALAHNVSSSSG
                     FYEVPLGEAPSGSVVSTSGRAGPGASPRHHGDEVAPLRLTSSTLHNVLASFQSALVER
                     SSDVPLPGTIGDLFNARGWDTSSQNGSNSSGAAGGSRLCHHSSPTAQEDWGTQTSAAP
                     ATAGASVAVTACGSSGDASAVLDAPAAARNGSPVMRGRVNSVVAHKLNLDGAPRRSQM
                     QDLRGSGGFPPAAASLDSTCSSDTHTPTLSTHGRLCAPHHVYTQERAASPDSSGDCFL
                     AHTSSSALGMLHHHQRVTSSVTAEDFATPHHHMRTASEVSLPAAAATYHGGSALQQRI
                     DDRGCIAVVDPQRRKLHVPLSAIHMTKALNGRLKTPSLCLLYQLGRCRQGENCYQVHV
                     DSAIVERLRADAKNTPCCCFQHGDSNGQVMDRTAYEGRSLGIAGQFSVPLTRVAYTAG
                     LQRVLQDQPACAPVKASVLCRLHGQPGGCRFGADCRFVHVCRQILQNELASIMANAVA
                     AAQQQQQQQSRSGNGSPLLVDLINSGLIPSSSGTMHGGASTVMMSLNNAASSVVSAAD
                     FSLSQFSQSVPASSTTLMTAFASRVPPSSQQQQSSTPSSVTMQPLPCASTLSAPSAGA
                     YYTLAKFQQRVSQVQTPAGRPFPLQASLLGSPPSACHDHVRTLSTHSNGTYQSYASPH
                     LAQTPNHSEAASPINMGLSMARSLTAFPASAATTAGGSGCGAFPSLTPHPLSHQTTPP
                     QRHQPSSLAQQQQQQRLLGLQQHQQSTSQQIYVHQMNTDGSVSLVPINVMQDFGGSGV
                     "
     gene            complement(<313489..>313851)
                     /locus_tag="LMJF_22_0760"
                     /db_xref="GeneID:5651835"
     mRNA            complement(<313489..>313851)
                     /locus_tag="LMJF_22_0760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683175.1"
                     /db_xref="GeneID:5651835"
     CDS             complement(313489..313851)
                     /locus_tag="LMJF_22_0760"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683227.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651835"
                     /db_xref="UniProtKB/TrEMBL:Q4QBS1"
                     /translation="MLQATLTARLFSKPIGQGYVALLPKPQPGPTGRAWMRAMDANSD
                     VRDFYTADTERYNTWYRETYGIEDLSDGSAASGAASNRLLDDTRNTQQAAEEYDLRAV
                     REELEFWGQEFQHVTQLR"
     gene            complement(<315686..>316555)
                     /locus_tag="LMJF_22_0770"
                     /db_xref="GeneID:5651836"
     mRNA            complement(<315686..>316555)
                     /locus_tag="LMJF_22_0770"
                     /product="putative NADH-cytochrome b5 reductase"
                     /transcript_id="XM_001683176.1"
                     /db_xref="GeneID:5651836"
     CDS             complement(315686..316555)
                     /locus_tag="LMJF_22_0770"
                     /EC_number="1.6.2.2"
                     /codon_start=1
                     /product="putative NADH-cytochrome b5 reductase"
                     /protein_id="XP_001683228.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651836"
                     /db_xref="GOA:Q4QBS0"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001834"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="UniProtKB/TrEMBL:Q4QBS0"
                     /translation="MKAFIASVVGFAGASMYQSGSEVEAWGSRPAFSQEKFQPYKLIH
                     VENESHNTKRFRFALASSKTRLDLPVASCITLRYTDAQGHEVMCPYTPINLVEEEGHF
                     DLVVKCYPNSKMGSHLFSLKVGDSIDVKGPWHTFDVKPGQYTSIGMIAGGTGLTPMFQ
                     IATNVLNAPENKTMISLLYANKTEGDILLGKELDTLAKEHPGKFATYHCLTTPPKRWT
                     GYSGHINKVIIQETMPGSDHQGDSCVLVSGPPSFMKTICGEKDYSSYPPKQGPLEGYL
                     KELGYSSSGVFKF"
     gene            complement(<318190..>319059)
                     /locus_tag="LMJF_22_0780"
                     /db_xref="GeneID:5651837"
     mRNA            complement(<318190..>319059)
                     /locus_tag="LMJF_22_0780"
                     /product="putative NADH-cytochrome b5 reductase"
                     /transcript_id="XM_001683177.1"
                     /db_xref="GeneID:5651837"
     CDS             complement(318190..319059)
                     /locus_tag="LMJF_22_0780"
                     /EC_number="1.6.2.2"
                     /codon_start=1
                     /product="putative NADH-cytochrome b5 reductase"
                     /protein_id="XP_001683229.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651837"
                     /db_xref="GOA:Q4QBR9"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR001834"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="UniProtKB/TrEMBL:Q4QBR9"
                     /translation="MKAFIAVATGFATSSWYNSVSSSSNCATPSSPFSQSEFRSFPLM
                     DVYDESHNTKVFRFALPEADMPLNLEVASCVSFRFFDKDGKEVIRPYTPLNRSDQLGY
                     FDVLVKKYQDSKMGTHLFSMKKGDTIDVKGPWMKLPIKANQYKTIGMIAGGTGITPMY
                     QVARHVLHAPKNNTEITLIYANERKEDVLLGNELNELMEAYPRFSPYFVLSKAPSDWM
                     GGVGFVNKEMIKSLMPAPNRAGDSIILVCGPPPFMEAISGDKDFKSNPPSQGELKGCL
                     KELGYMPKMVYKF"
     gene            complement(<319845..>321842)
                     /locus_tag="LMJF_22_0790"
                     /db_xref="GeneID:5651838"
     mRNA            complement(<319845..>321842)
                     /locus_tag="LMJF_22_0790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683178.1"
                     /db_xref="GeneID:5651838"
     CDS             complement(319845..321842)
                     /locus_tag="LMJF_22_0790"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683230.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651838"
                     /db_xref="GOA:Q4QBR8"
                     /db_xref="InterPro:IPR001950"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="UniProtKB/TrEMBL:Q4QBR8"
                     /translation="MFKKKCTSKEAQSVGKSDVKKLRADVVSVIGKDNADKFDLVVGK
                     KDTITKQKYQCGPGSSAFVYSVDKVPFFISIDRLGKEEQDIIIQADSFSFLMIPTVFF
                     FLRLHQLLAEKGDEWATLVNEGVVTTVCRGPTSRFLLSGAHLMMPGILSARKKTPVVV
                     GDVALIYSLGVDVPYAVGIVTSNMIAKQDAGVGVFVVQCFRDNLWQEFESRFITNRSL
                     STQSPLIPSEFGEDEVRERLPEVGSATKENENTDNDVSSNGAAEGKETPVVDYADIFL
                     DEDTLLNFCLCEAMKQVSPSLLPMPMTQFTSIVVTSYPRDGAHTSAIQFKDTKHKKAL
                     AFFQGFPDLLTIAETSPGTHCVIQINKSADMMRQHNALYADFLSTTHREGCEKEAQAL
                     QAELLAEGTGVFRQYIVSADVFYAAPRGLEDDLVRILLIGEELNIQRDALFPTIEQVV
                     TGTVPVFHRTPIDTSVLQELYTRKTLVDNLKNYIKTHNLLIVNEAEKCKLPSVKIDDT
                     LSMIFASKAYAPEIPLDQLVQSMLSLFKLQHEIILQTAVEGSSLASGNLNLKRIIKNG
                     PLPKVHLWSEKSTNNKFITVVQSLESFGFDLQMLAHRWKKQFSTSSGVVDPSTKMKNL
                     KPGTKIPLEIHLQGNLQVKVAASLLNEANLSSSQLVCQKKR"
     gene            <323572..>324636
                     /locus_tag="LMJF_22_0800"
                     /db_xref="GeneID:5651839"
     mRNA            <323572..>324636
                     /locus_tag="LMJF_22_0800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683179.1"
                     /db_xref="GeneID:5651839"
     CDS             323572..324636
                     /locus_tag="LMJF_22_0800"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683231.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651839"
                     /db_xref="UniProtKB/TrEMBL:Q4QBR7"
                     /translation="MSVNDVSHKREKYEGHLRDLILLLFAQPVKRGFCSESKRALAVL
                     VCGFSVVEVSPSGNHAPREQDHLWLMGRLLALCNHLAHSVFMPKHPVKHTTLQLLEGV
                     ANPAEPLSFTVLFDFSTCNGLRFCLRSFSLWHLVSLTMQPPKTECQMQQEQSDELFAR
                     QLQEQLNSSHGVVDVPPPQSGPSKSVQEAADAAYARQLQQEIDLQEAATDVGASRASD
                     EDKIPVECPACTFVNYMKPSRSSKHWKCAQCSGPLMENASHSSPVSHKDLVECRVCHS
                     LNKLPSTKSDVVLCGGCYQELGLPLSSASPVESEENQRTVQLRCGQCSVINAVTVGAK
                     VKRLEFICGGCGVLNTMTLE"
     gene            <325364..>326482
                     /locus_tag="LMJF_22_0810"
                     /db_xref="GeneID:5651840"
     mRNA            <325364..>326482
                     /locus_tag="LMJF_22_0810"
                     /product="putative protein kinase"
                     /transcript_id="XM_001683180.1"
                     /db_xref="GeneID:5651840"
     CDS             325364..326482
                     /locus_tag="LMJF_22_0810"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001683232.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651840"
                     /db_xref="GOA:Q4QBR6"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4QBR6"
                     /translation="MMRRVGDYEILDVVGEGAYSKVKRVRHIPTGCMFVAKIVPKTNQ
                     QVENDVRLEISILRRLKHKNIVQLIEILESTNNYYIILEPVMGGDLCDIIVGMDRPLP
                     EQDVAALLIQLVAGVRACHRNGVAHRDLKPENLLLGTDGVLKISDFGLSRLHRESNFQ
                     ASTNEYAHTLTGTLAYLAPEVFGGSYDAFRADIWSMGCIAYVLLTQNFPFGSTTDPHA
                     LEVRIRNGEVSVMPSSVSAEAKNLCKWLLSPRPEDRPTLDAVAQHDFFKRYLPAEYLR
                     MTANRKSPIVHGANMNEFSSQVQEEAPSCSPSTATAKRKHQYVRSGSAARTSPSSSAV
                     AGAATSSNRSSESGRDREDLVSHGTQGESDPGGYCGDV"
     gene            <329922..>332849
                     /locus_tag="LMJF_22_0820"
                     /db_xref="GeneID:5651841"
     mRNA            <329922..>332849
                     /locus_tag="LMJF_22_0820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683181.1"
                     /db_xref="GeneID:5651841"
     CDS             329922..332849
                     /locus_tag="LMJF_22_0820"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683233.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651841"
                     /db_xref="GOA:Q4QBR5"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QBR5"
                     /translation="MAERGASTSELRQAAQRARHQRRSGGGGTDAAHEPAALEKSEHA
                     HPAARGVGQDVIDLVTDVFTAQRDAEIKKRREVLYELTHPNPIDYTYNGKLVPPPPLS
                     FGQVTEEARALGNRMMLGQTYSLVRQAGTRASADDFDVIGSSASTAGRGAAAATTVSP
                     ASSIEASLAAPLSTFSSRHAKGYGDRTAAAPYRSRARDANIFRDHNYFFEINELYQEV
                     AFAGRACAGKSSLLNALLGQHVAKTSSTPNTTRKISFYQSVTPEQLHAFHVKEHHNQL
                     VKLPGGGLQLTFVDLPGYGIEGMSDKWRDAAIELTDAYFGVRRSVNTVLYCMDCERGL
                     TKTDIKYLEWIENVHGACFMVLTKCDSVPHSRVCSVMRQVYALITKHRRKYRKVFPFI
                     IPVSAKDGTNIELLRGLITETAGIIPGDKLRELLQHKRAALTRTALLAEVSRIDAARQ
                     LERHQAKAYFQLTRDGTGASAAAELPPEARGSERSGARREREGSGGAGAGAQGTSAER
                     GATLLPNVAASETAASPPGAAFGSRHRRYVLPLGNGAADAGAAALLSGCASDLDAAGD
                     TADFFPTESSMAAAAAEGRCERRERFLAWRRAHPLRTVSPSYSATHEQVGYDPTRPAA
                     ASEQVAGLPGSGRYRLNTGLDNPGAAHVVLELHGEPDVSEGECDARGKDGTEARHGGG
                     DMEAQNSRATAVAPAGEFSHSPLPALPIAAACRGSRFSVIGLSDVDTDGSVAPGATAS
                     AAPPAVAPSCSLRSASAGTVSRFLDVMERYGRQHNVVSSAKQKRREERWRRRGGGGGG
                     ARGRHCAVGGLLAEDASGRLSAYRAGRPCGPALVSTNTDVDRRQAEWRAEQLKTLLAK
                     ENPEAPWAALHQLRRTIQAREEETALAGMRKKEVAAYVRNAGRVTASFEKFEGEVTAA
                     KYMNEIRQAPTLRSQQQMHLNATAKINYRSMPPGLWKRYGEKDTYWQTSQLLGRSEDE
                     SHR"
     gene            <333574..>334482
                     /locus_tag="LMJF_22_0830"
                     /db_xref="GeneID:5651842"
     mRNA            <333574..>334482
                     /locus_tag="LMJF_22_0830"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683182.1"
                     /db_xref="GeneID:5651842"
     CDS             333574..334482
                     /locus_tag="LMJF_22_0830"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683234.1"
                     /db_xref="GeneID:5651842"
                     /db_xref="InterPro:IPR004401"
                     /db_xref="UniProtKB/TrEMBL:Q4QBR4"
                     /translation="MEVYRRIAERVRGALWAHHRRLMPERQFHRILAYVYNNKYEYQI
                     RFDRMSVVGRAWAGRVEVMTTPGGFLKRVRVHPAVEDLSPAQQHKLVLAAYADACQQG
                     RALMEQAELKVYKQFLQDLKPIILGIRDNPEFYTVPEDSVETIGGVLRRDQAPLDGGA
                     AANAAGAVHRTIPMARAHQPVDEVRRRHAWEDQWLASKQGQRWAHSLRGKEYFTRHGP
                     QYRPRGAPGAKTRTLPFELLAPYTPMDEGRLLRTNWVAYMDSKHVAESLWTRAKVADR
                     EKQLRQLQERGQAWHRPINEDAVQRW"
     gene            <336069..>340916
                     /locus_tag="LMJF_22_0840"
                     /db_xref="GeneID:5651843"
     mRNA            <336069..>340916
                     /locus_tag="LMJF_22_0840"
                     /product="5'a2rel-related protein"
                     /transcript_id="XM_001683183.1"
                     /db_xref="GeneID:5651843"
     CDS             336069..340916
                     /locus_tag="LMJF_22_0840"
                     /codon_start=1
                     /product="5'a2rel-related protein"
                     /protein_id="XP_001683235.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651843"
                     /db_xref="UniProtKB/TrEMBL:Q4QBR3"
                     /translation="MMDITIGSPSSSYRSCSRSSRGYTQRPDLARDAASSGGSSAAGQ
                     ETELLTSAVGLDDTNDGGEGHHARCSSADSHGGFGEDRSDLDHRAAGASRPPPSLGER
                     EQTCRPPPPNTSAAPAPQHQVTNELIYALSNRESLSPAQMTPSSIPFSASLPSSSSSM
                     TGSGGAAHLPPRRAPQLLPHDHLHSRVEGMVWLCSAADRDRAPAPIPWASGRASCAAE
                     ERKCTDDAVGVRGPRASSLEAQARASEPTAVAAAAPVTRWPERQEQVIPRAFARTESP
                     SPLRRVAQMELATGDAERNAAAEASPGTEVSGARCGSLRKLALPSFCSDGGLEVMDNQ
                     PRSERALRLARVSNTVTLSSPPALSSTSTSAVPLPGPPRLSSASSPSVPVQQQRLRLP
                     SHSPESVSSASLSRAVVRRESLRGASATAATSSDSYDRGEAHDHHCSRRKRSDSRYRA
                     VGDMDDDDGTTSSSPGLTETSGARPPSHAPAPLHPSSFLTQVPPHACRSLQSSSDSAK
                     ECGPGEAQRADAARQALDPSQASSLVPSPLASRSPSLSAAPPAQLPLQRTVEETRRDS
                     SSNGDGSGAARRTPRYGTCPAMTEVAELQLPLATPTEAAVGCGGSGAAAVVSESLPPL
                     PPAPRGAGDGASSLHPSCRENHRHSKSSATEARGVVLQAAASEADMASEARAGDGEAR
                     ASRERKAFPAAASLRDGVAAALELDGARRGAAPPTDAPCHVQPPPPQRRALDRWRSQA
                     SLVGSRAADTTALSSSLRAATHSSRGSAAGQVTERDDGHPSQSARECGEAGKRAFKGG
                     VNVARWVRSTVGGEGDLSGASLIPPPVRKAAEARVCAPPTNLGSASATSASGTAGDFG
                     GNEPPRVLAVSLAALPRRTPPREAVAPAVLAEVTQSCASAALVSGRQAYQGMAALSWT
                     LPSRSRVRLTVIASPAQERWASRAEGERAVGGAAQVDPRDRSSGARWREAGSAGEAFL
                     VRSDAHRVEVAAVPQRAHPVRSSSSGQRASRPGLAAVLAPRTSTMCGPASSAEVDGAD
                     EDKEMRIVARTWRPVTCLEFVRDDARRRSTGDDCQSSWGAAGTHRWGQGPHHPRAAQR
                     SAAIVGALSGGHQTRPAHHPHDGSHGCVLSIEASPLVSPVSLAAEATSDVGASTRQAC
                     SAATWRAGAASNGVGGVVLSSTTLVPGYAAVYSPRMLATRVLEARKALLGAPSAAVPA
                     APTSVCPPGPSGALPLHCGSRAMPAVGATVAAAAASTSGGVSSWSPSSLLSPPHAHID
                     LKERGADDGVMPGATADAAPWSLYLSGSPDAEESMRHRTALPRQLTRGQQHLHEQPDL
                     PADTSPYPVARRIPFGFAAGTLAGAASVQAVSPSPDGRLRSCHARTASPAADASAPVP
                     GAHLHAEGGYQRARRLPCHTPAEEQRSVTASAPSSPIVARSAAASVAAPLGRMLTTLS
                     PTTASSSAPRASSAGTAQGRHQSIPPPEQHAAIHAAGAGSQASERACSTSRRFWRAAT
                     NADQSHDAPDARPKRQSRILAQQRLVQEEAFHRRYIRMQEDHRFAVEVTELNYQRAVE
                     YVHQASAAGAVATPARRSGHCAALLTTDCDAEPLAGLQRVRRDQAAMTATLSTLAKEL
                     AALSP"
     gene            <345302..>347101
                     /locus_tag="LMJF_22_0850"
                     /db_xref="GeneID:5651844"
     mRNA            <345302..>347101
                     /locus_tag="LMJF_22_0850"
                     /product="3'a2rel-related protein"
                     /transcript_id="XM_001683184.1"
                     /db_xref="GeneID:5651844"
     CDS             345302..347101
                     /locus_tag="LMJF_22_0850"
                     /codon_start=1
                     /product="3'a2rel-related protein"
                     /protein_id="XP_001683236.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651844"
                     /db_xref="UniProtKB/TrEMBL:Q4QBR2"
                     /translation="MCPVSHQGLQRNRSPHVSTARVLQRVLLLVVLLYSFSLMTAVVT
                     TPCDDGAHGALCVSALHGAVLGKGKGLRAPPLTVSLLQPVALPRHTGSAVVVTAARAD
                     GDVDDIVTFSQAGDLFALEESASASVPSSSSSGVSPGASGRGNEAAKAPETTASSSSL
                     SVEPLSRESSAVSSLRRSSLLPSAADIVVVLVGEGDAGTELPPSSSALPPDNFGTRHP
                     PAMRLALLGLIALVVPAAIIALVVWCVCRRTRYKRKVKGLRLNGTRQPGEVDDVDMGN
                     VVRGGDWLNLDAAAPGRTKIGAHRTRFSILVPSTAACVRTDATFDPIGQRAAETRQRK
                     RARRVAVAAAEAAVIPANGVGNGGSDGLASPLSGESGAAGSEMWSSDEEEHSNGYSVN
                     GGVSGGNAGVAGGSAQAHATSSVLPGTRATGAEVSSGAGPHLSGGVVTSSVVTAVPSL
                     DHSLNYFNETTRVLLGRYKAESGGGVPQMPPSALPGGGGAATQSLRLASGNEAESSNA
                     VVNKPKSAFEQILSFAVAPLQVGREFHQRGDNTDSGNVADSAGGPKALAAPVPRDRER
                     AERHTEKEDLEEDRAFEDDEELDEEYKDEAYGD"
     gene            <348512..>352573
                     /locus_tag="LMJF_22_0860"
                     /db_xref="GeneID:5651845"
     mRNA            <348512..>352573
                     /locus_tag="LMJF_22_0860"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683185.1"
                     /db_xref="GeneID:5651845"
     CDS             348512..352573
                     /locus_tag="LMJF_22_0860"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683237.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651845"
                     /db_xref="GOA:Q4QBR1"
                     /db_xref="InterPro:IPR021520"
                     /db_xref="UniProtKB/TrEMBL:Q4QBR1"
                     /translation="MSMPPPPASASAVVMGELIESVVHVLPRYYRFAAARVNEVRGTA
                     QEIWQEPRSIRKAVWCLTKLMRRWKVSTVSAVTFVLLCLCTITSVIRLYLFHRNPHNL
                     HLRTYQETHFDLTSMGYSHVSPVHDPRSLSPYGPRSDRTLAHFCGRPTASSYDGYTGA
                     PHAAYMHHDVERDRYVVRTFGRGGMRVDERRRSGVGRSTYEAFCAAPRSVQRCTPLAP
                     SPWLDGEANWQLGDAAPRHAVNGAFNFTVRPLAVPHAAAAAAAAGATASRSGNADADF
                     TKADQGLRTHYRRYTRDELLQRHAHLDFIYSYVNGSDITRSYTKPFAKTWECGNMIAS
                     VQLLWGEMQRAADTDTEAPHIAEDAFSRYIAELLFVSASSPCAMSELLADVGTGKDAM
                     KRVEASLWWAATHPNGPRSVGDAPLPPPETTLTNMELLRALGADLESTKPDDIDADCD
                     ELRHSMRGLLEHTRSWHRGRMAVVAPYGSVPLWLNHSKNFFMRSLYAAATATAARAEA
                     SCEAADGDDSRVLGTAEARFVKEAHTGTLHYTRIHIVDQRALMPPAPLTTVNSFSIEP
                     FVYRLRNASSVFIYMNDDYLVMKDVDITDFVNVYGGPVLRVSRPDDLPKDLPHATGFP
                     RAVLQNSYSLQRHLDKIPADLEELVQPAAAATALTSVEGEAAVMRRGVVRASWAAFAA
                     AVDARSSVATPRGGARATSTACASNSSAAVCAWAECARGAAEGTLTRDTCAMPRVSLE
                     GEPAWAADAAGTFALVPPSSTTPGSSEWTWAGKAQMPALVHWGRRVLDRVTADLIAPR
                     YYLETAKPVEEEPKRVPPAEARADVARDVAAFAQLMRRVDLERKLAAGSSGAQVRLMR
                     HLEAWAARFAGHAFPTHRVFKTQPRLRKYRMRLDSHAPYPQCRNMWGYIHKRYAPDLN
                     LNMFMERIRTTIDLLPPSTHTAHMLRHPWAASSQYLPYLMAKQAWRMQRGAGLSPLDN
                     DTPVFPVVDVALDNEDGCAPASFRGEELKEAAYNELDDDVQHNARRMDRIRSYRNAIS
                     FTNINSKFNLDFIGETLRNFLEELFPTPMLLEQHWRSASGDEGGTDELRVSRRIDGES
                     GARDLQFAHLDVNFKRLMRVPLILVSNDEEGFCPLLRSLRHALPNFRGRRVVQVLVPP
                     ADGVSLRAVRADRRHGYRDFLPVARCSLPADRLRRVTLPADSGVADVVVAGLRLARED
                     VAVEQWEAPALVELRGRRVALRAVQALVIDARTLHTGARGFTELPLALAVPAELLAHE
                     DFAEHLLDAAAQSLVRSPTAAEAAAVAAVVPMEEAASAGDFAASVLVLSEVDAEVRHT
                     HWAHGASEHDLLSGMPLPYDKMEDMKEMVQWGF"
     gene            <354930..>355769
                     /locus_tag="LMJF_22_0870"
                     /db_xref="GeneID:5651846"
     mRNA            <354930..>355769
                     /locus_tag="LMJF_22_0870"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683186.1"
                     /db_xref="GeneID:5651846"
     CDS             354930..355769
                     /locus_tag="LMJF_22_0870"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683238.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651846"
                     /db_xref="GOA:Q4QBR0"
                     /db_xref="InterPro:IPR001063"
                     /db_xref="InterPro:IPR005727"
                     /db_xref="UniProtKB/TrEMBL:Q4QBR0"
                     /translation="MPKPAPRYNIGLRPAPKRQNVGGQFLATQKHYARELWYKRQYYS
                     TRPFAIQKHMGSTPRILLDRTLWRSCWLTKSNLPDVNRWEKVVNSQRVTEDRWALVEE
                     DGVMYQVNWKMYCERLETELQKAQDQLPQYSFMMKAVPSAWKKLDIELSVLRGLSVRE
                     AMAQCKLSPRKGHMAVFRALEVAQQGAEGKGLDKEHLRIAYITCMPGPTDKQVDIRSR
                     GYYAWKTKKSSHLLLTLAEDPEMVLPDRTAIPYASLMTMKRAGLRTEPTMLDVPAITA
                     EGI"
     gene            <357169..>359283
                     /locus_tag="LMJF_22_0880"
                     /db_xref="GeneID:5651847"
     mRNA            <357169..>359283
                     /locus_tag="LMJF_22_0880"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683187.1"
                     /db_xref="GeneID:5651847"
     CDS             357169..359283
                     /locus_tag="LMJF_22_0880"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683239.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651847"
                     /db_xref="UniProtKB/TrEMBL:Q4QBQ9"
                     /translation="MSTSRKRYRPLDSAEERAVTVHERLQLLPLENEQSYCFSWPEAP
                     LTQWLQDDVPYASLYQLYANTGGGVGGGGVSSHAMRNQSSGLGDADVASAALGLPKGT
                     SSKLVASSSAGRRDALGLRSPTGTISFSAPHHPRSIEVPPVFTLDDFEPASALHAPPL
                     KASGGEGVASSAPYGGAGVQRLLHRVRDAMRHESIATASIVKSEVLGAKDGASPSTVP
                     SPSIVVQSDAAERAVPHPLAPPRPQSITEDSIFSLSATQLADLVAAGVPALHASAARA
                     DTQGSSQRAQAPHTSVATSAKGLPSGEAGTAPTHTRCACSGHDRQRGAELAESARREI
                     EHEVVGLEWRTWSQSQRTAAALQRILSLKAAVPFESSGDARRDAWRATVYGLWLQWRQ
                     QQLPPTPERTSAGGSAASSTRADTLGHGFSGASAVPSVSNSSCGLAASVSPSPAASAL
                     AFPKGALVPSHHQPHLPWGAPLLAGAYLYCTSNDYFISLPPSTTSATGSVGKGGGSNS
                     GGSPMNATTTASLWPAMSRRRGTYSFLRWKVELYEAQLSRTTAAADEENDGDGDEVVE
                     RDKAKGVDVRDRGGNGSATAAKVRRYSKGPLGGTETDAPASMHRPRRGEDDHDGYATA
                     ISRSTGRKAATATVVSSAGHAAINGVMSVAHMKALLHATVLTQPLTELEMDDEPTTVM
                     ERLACTDLRRDTDAWRVWLSRV"
     gene            <360329..>360697
                     /locus_tag="LMJF_22_0890"
                     /db_xref="GeneID:5651848"
     mRNA            <360329..>360697
                     /locus_tag="LMJF_22_0890"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683188.1"
                     /db_xref="GeneID:5651848"
     CDS             360329..360697
                     /locus_tag="LMJF_22_0890"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683240.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651848"
                     /db_xref="UniProtKB/TrEMBL:Q4QBQ8"
                     /translation="MSSASKASGGKWVSPRVLQYKQQQGPITGPASGNGGAGSKIMED
                     KAIAAARIKDSQSSPPPEVEVAESKFFEVQEATDALSNLAHNAESTTYELCGKPVVKP
                     HQSAEEFHKMIMEQVQKQVK"
     gene            <363274..>366066
                     /locus_tag="LMJF_22_0900"
                     /db_xref="GeneID:5651849"
     mRNA            <363274..>366066
                     /locus_tag="LMJF_22_0900"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683189.1"
                     /db_xref="GeneID:5651849"
     CDS             363274..366066
                     /locus_tag="LMJF_22_0900"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683241.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651849"
                     /db_xref="UniProtKB/TrEMBL:Q4QBQ7"
                     /translation="MSNSADEFTGEPQPPLSDQSGMEEQEVPENMAAPPDQAEIESSG
                     RDSAVGHAVAPPRAAHREDNVAYYAQLDTAEEDLAVNVAHDVRMRPASSSLRLHSGGD
                     DYDESPEYEEIPAARDESGDVDGADSDSPLKAVSVTEHHNSETTAAATRQPTQGTQVD
                     ADVDLAEQHQEGSDGDGGATARAAAGSSESQRTADNASAAPHTPKHQPVAPPRRSLLP
                     QAPHGTVEVTVTLLPMRAVTRLTVPVRCPSMYRPTDAKTTAEAASGLKGSAGDGAGPH
                     WILLVKDLFEGIADHLLVHPQSFRLFHQHKRLRFMGTLFLDCDVTSAMAGRSGAGDDG
                     GAAEGAVNDRAEPIWIAATFPVAEDAHRAGAHSKALARDDTNGEDEEAQASLMAVPVH
                     LCKLGPDNYVARCIRIRPHKLELPPQILVEGRRQGYSYDEVIQRMQALQDVQQLPASH
                     GGSGGDGAGVGASAVRPNFAIVAILQDGPVTPGKAYLGGYRDKRHPENVRLHAATQLY
                     HRDLEYSPFAATKGSSTNRCTRQTQTLGISRSCQTHREACVQTPRIDLLLDAAHDFIV
                     VARPYFTAAELQALRIEMAIIIQKMYRQWKARRIRAELEAAEAARQHRAGVRQSREEA
                     LQMAVEDAAQLRRDDPRSAADFERLKQDILNWRADEAVRIQRDPSLSPAEVRAALLAL
                     TETELQLLQQLDQRRREVGKTRQEKLFVQTLNRMAAPKQWGTVHVRTPETERAAELRD
                     LYERLCLTSSGAVAAVKASASSSSKVQGGFGSSSYPTSVGPMAGNVVRSPASTSPSQR
                     TNTAAVGSALAATPTMDNAVAGLPSATAARLDILLRVKWTVREFGASSLLTQELCELV
                     DREADLLHRGRKEASLASLRQRIQLLFAQFIEDPQYNPIAREFAQTARDRVRVKAAEL
                     AQAKLKSRKGQTTASV"
     gene            <368086..>369735
                     /locus_tag="LMJF_22_0910"
                     /db_xref="GeneID:5651850"
     mRNA            <368086..>369735
                     /locus_tag="LMJF_22_0910"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683190.1"
                     /db_xref="GeneID:5651850"
     CDS             368086..369735
                     /locus_tag="LMJF_22_0910"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683242.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651850"
                     /db_xref="GOA:Q4QBQ6"
                     /db_xref="InterPro:IPR004098"
                     /db_xref="UniProtKB/TrEMBL:Q4QBQ6"
                     /translation="MSFEGLQGLLKRKQEQRQGVSDGPAAAAAAGANASAHTQALAGS
                     LTATHTNVTPTNTTHAAPNGGGSSCCNAGSASTTYDPYAAALQSVQVLQQQQEQQGAL
                     SSTMAGQKHPREDMVQASKLVGAVHSSNGSSAAEASDELSVRSVASASTPPTASLNTP
                     AVPSVKSDEDVLAQREMGIAVLQVCLTKLEHYWAAERASSKAVASTGYSVTATASVPT
                     VSQPQHQPSSAGALLESSDSLPASSSLLSIPRALRDYLLAQFVAPNPAATRATGLPEM
                     TVLDREFELLAQLKAEMEAEPQNEAVDSASIVATKVHQVPEEQRQLAELLRALWYLVA
                     LLWQHSLDPHQRNGRSSATSTAMPREGPLAPAQQGWSPAVYLGLQNALPADVRLLQGR
                     FIAEEVDRWRALARTRQNALELLSYVCSDYDTSAAASSPSTTAADFIIPSDLRKKLHT
                     MVVRHLQQERDFMAVRQDYVDITMGTANWKLGLFSGGEVHMRRSMERVERNRIAHLLN
                     NEHATQLLQAVRELTIFVERHALARTSPFFCPACVTSTMAA"
     gene            <372389..>375163
                     /locus_tag="LMJF_22_0920"
                     /db_xref="GeneID:5651851"
     mRNA            <372389..>375163
                     /locus_tag="LMJF_22_0920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683191.1"
                     /db_xref="GeneID:5651851"
     CDS             372389..375163
                     /locus_tag="LMJF_22_0920"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683243.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651851"
                     /db_xref="GOA:Q4QBQ5"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:Q4QBQ5"
                     /translation="MCTSHPSPPPSHTHTAISKKRGSFCIDLPAGHWQPKSRVCMPAM
                     SHIRCALILSAGVAAGVSTAPYLCFSDRTPAAPPSRLPLYATRRSASGLHSGSPAAED
                     AMDAANRQASVASVTETLSSLYRCACELLDASTRALMEGTATAAAVAAAGAHAVANAT
                     TAELSHRSPVCSDDAVFQCAGRHLSGAAEAEKHAADFGTDAEVPLSASTQSVLNERTA
                     VLRAAQHKLKDRFLHYAKHDPATGEFVLSLEGFVRCMLLLPDDGVADVGWRRAGSGAA
                     SRSGAVTHKSPSPTFSDAADTAVTPFCAKAIGGRGQSRCHSSWLQQLPPAVQQRFVQL
                     FHWVDLNGNNFIGYAEFVVLFTFLSTPQQMLKRAFSVFDLEDKGRLSEWEFCHLLNTI
                     MVDPAVQVRYAAGTSGAGGSGGGAAAVSPSSALPSATPQAITTARAPHLAPCASPTPE
                     AATAAVASAPHPSTARRTGTSWRSEKEWRSHKDCLNLEISSELMRPLLFGPLPLQVGA
                     APGSTNCDREAALAASVLSSYAVQGAAAVAGSATNGTPGGVLPSLRAVSQLPDVSHSA
                     GWRKWGDTWRRLLSKVLTPYPSCAPASCDAACSTLAVASITAPVAITATAASSRLSQL
                     QLAAQEDSLLRMVSYPALLYRLDYLRSQLRAIEFGLCDPDNTGTISLDDCRRLLRGDV
                     RRTVKAEHPALQQRQQQADETAVTWHFYQKMFDVIREPDRILAALRLALDAMPPVPEE
                     TLRGGAIPDEALEAATQAIPEMVRLSVLRCTSRAAEEGAAVDVAPLPATAEVTASQDD
                     GRNVADRSPFSPTDVTTADAAESKSVGEGCAAARHLKASLVRPTALTWNQVDRVLAIL
                     GTVPQLSEAERSLFRALLDDDGSDSLSPAEFARLCTLKGAFFAQQLPRFDEPKRNAVQ
                     QFFYCMQQLE"
     gene            <376770..>378926
                     /locus_tag="LMJF_22_0930"
                     /db_xref="GeneID:5651852"
     mRNA            <376770..>378926
                     /locus_tag="LMJF_22_0930"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683192.1"
                     /db_xref="GeneID:5651852"
     CDS             376770..378926
                     /locus_tag="LMJF_22_0930"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683244.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651852"
                     /db_xref="GOA:Q4QBQ4"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QBQ4"
                     /translation="MTSLGTVGDVVDAFSSVPPAHMPGHFGNYAVQYLSSHIDSLVQS
                     VPVTFVYVLLLGYPLFAGLLRVVRPLLESWIMGSSVTLGMVVGLPYIQRNIIVQLPPF
                     FFVEVPNHNVLLQNAVLMYVCHHLWLQKPLPSRFFYQNTHMVTLLDPYRSWHASVNVG
                     SPFYVGPSKTNRSNPADVLTEKQLERLRLIKLPHKAWIPVMSDDIELYFKEEPLTVAD
                     YSVPWIRRTVSLRCRAAPGSAAKLDEFVRRALEVFAEGAPGKEDDALRWFFAYGGKSD
                     DRVFFNQYVLRSNKGFDTLFFPQRDATLTLINQFMQRRGRFAVEGFPQRLGFLVYGPP
                     GTGRHAFVKALAAHTGRHIVSVPLSKLRTNQQLYDIFFAREFQSEGGDSVQKLRMEDV
                     IFLFDDVDAADSVVCARAARRVVQRRAAARLTARAGWREAPLTNCVIEMDTSSSLPVM
                     RVEDNALPLALLLKIMGGDASKSDGAPAVGRGGGGSTGGRRQKTEETAAATCEAGAKV
                     DGGHLFGMNDVLLGDSKDKLDLSGLLNVLDGVVDMPGRMVVMITEHPEWLDPALIRPG
                     RFSVRLRLDYMEMETLVQMLGLYYGDVAHSRRGSGAGADGCAVGAGVDGRVKAARAAQ
                     YPAAGAGAAAGCAVHRELSEVQVARVRGVVAALEAEAEAAAAREVSTDGSSGSGESKY
                     RFQVTPCEVEMLCMEQDDLEGFLSQLAGLVRGTVQL"
     gene            <380628..>382823
                     /locus_tag="LMJF_22_0940"
                     /db_xref="GeneID:5651853"
     mRNA            <380628..>382823
                     /locus_tag="LMJF_22_0940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683193.1"
                     /db_xref="GeneID:5651853"
     CDS             380628..382823
                     /locus_tag="LMJF_22_0940"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683245.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651853"
                     /db_xref="GOA:Q4QBQ3"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QBQ3"
                     /translation="MNATGAPGASTTSVASVSSSVMSDDKRYEGAFDLLSGETHEQLR
                     QLAPLLHTTLSAFVAALEYWLPFPPTWLLLLGPFFVGSVQAVWPKLSSWLSVWYSGVG
                     RCYASRVLVHEAPIHLYDDVNSLNELMFNAVLLYVCGTLWRQKPLPESRLIGLQMRVI
                     LMDPYRCYSSFNYNSPFRIAHEDRDADERQNLKTETVSRLRIVKMPLDVYLPVHVDDI
                     ELCYTEESFHKRGCRDRWTRHNLTLRCKNSTDAGTKLDEFVRRALEVFAEGAPGKEDD
                     ALRWFFAYGGKSDDRVFFNQYVLRSNKGFDTLFFPQRDATLTLINQFMQRRGRFAVEG
                     FPQRLGFLVYGPPGTGRHAFVKALAAHTGRHIVSVPLSKLRTNQQLYDIFFAREFQSE
                     GGDSVQKLRMEDVIFLFDDVDAADSVVCARAARRVVQRRAAARLTARAGWREAPLTNC
                     VIEMDTSSSLPVMRVEDNALPLALLLKIMGGDASKSDGAPAVGRGGGGSTGGRRQKTE
                     ETAAATCEAGAKVDGGHLFGMNDVLLGDSKDKLDLSGLLNVLDGVVDMPGRMVVMITE
                     HPEWLDPALIRPGRFSVRLRLDYMEMETLVQMLGLYYGDVAHSRRGSGAGADGCAVGA
                     GVDGRVKAARAAQYPAAGAGAAAGCAVHRELSEVQVARVRGVVAALEAEAEAAAAREV
                     STDGSSGSGESKYRFQVTPCEVEMLCMEQDDLEGFLSQLAGLVRGTVQL"
     gene            <386285..>387361
                     /locus_tag="LMJF_22_0950"
                     /db_xref="GeneID:5651854"
     mRNA            <386285..>387361
                     /locus_tag="LMJF_22_0950"
                     /product="putative protein kinase"
                     /transcript_id="XM_001683194.1"
                     /db_xref="GeneID:5651854"
     CDS             386285..387361
                     /locus_tag="LMJF_22_0950"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001683246.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651854"
                     /db_xref="GOA:Q4QBQ2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001245"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4QBQ2"
                     /translation="MQASASLPEQQPVNDSTDHQNHHYVNPLVSSFPTVVGPKLPCKY
                     RVRRAIGRGAFSTVWLLINNKTGKTVVGKLSDASHSSSACKAFAEAEVENMRCCSHPN
                     IISLIETFEAGEKSLYILEYANAGDLQAQVDTRAQPPPGTSDGTSIPYREDEVLVIFA
                     QLGLAIRYLHDRRIMHRDLKTSNVLLTRSGLIKLGDFGFSRQYQESVSGEVGKTFCGT
                     PYYLAPEMWQRQSYSYKADIWSLGVIMYELLALKKPFQATNLSELMEMVTRQGSFDPL
                     PEDRYSSDMISLVNQMLRVDPSERPSIKDILALPLFQQRGLLILKINVRRIKNLDAEV
                     RTRLVEDVEAVLGDDNRSSEAFPL"
     gene            <392230..>396003
                     /locus_tag="LMJF_22_0960"
                     /db_xref="GeneID:5651855"
     mRNA            <392230..>396003
                     /locus_tag="LMJF_22_0960"
                     /product="putative kinesin"
                     /transcript_id="XM_001683195.1"
                     /db_xref="GeneID:5651855"
     CDS             392230..396003
                     /locus_tag="LMJF_22_0960"
                     /EC_number="3.6.4.4"
                     /codon_start=1
                     /product="putative kinesin"
                     /protein_id="XP_001683247.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651855"
                     /db_xref="GOA:Q4QBQ1"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q4QBQ1"
                     /translation="MYKAVMSGFNACLFAYGQTGSGKSYSMIGPTDALSGVTGASASS
                     SGNPSRSPPPAQRDSLTVEMPAEHGIMPRLCSDLFRLMREEREKDEGVTYSVELSFLE
                     IYCEKVHDLIAAASSLTAANSNSTYAGTSASASASLRIRQHPSRGPYVEGLSHVKVRD
                     AGSVIKYLLSGLRERATAETNMNEHSSRSHAILQLHITKVLADTDESTGGVITRTRAC
                     KVNMVDLAGSERVSQSGVSGDRLEEARNINLSLTTLGRVIQQLSEKQAGKNVIPAYRD
                     SMLTWLLSDSLGGNSKTIMLATVAPSAYCYQQTLNTLRFAGVAKKIVNVATVNEDRHF
                     QELIAELRRQIVRLTLQLESGKAAEVHLEKIDALKREREALLTENDALKLKAVSATDT
                     AVLQALRKRVKDLEAENAQLGVELQGLQERMLTSTGALRDELAQQRAETMQLHEKLTK
                     REAEVTGWANRYRALVISTTTPSTVAASTAGGTGAGGVKAAAATADAKEALRAQQQLQ
                     EELEQTRAKLQKAAQDLSAAERVKQEALDVTKMTSTQLDEYRVRYEESRRQLDLLHER
                     MQSTMSLLETTQCELSAVKSHRTTESAKTRAAEDALEATNTANVTAAEQLEQMRNGYL
                     EEKQRNVQLLLRVAQVEQERSALKRAVTQRAAEMCELEQLLLEEMETSERYYMRMRFH
                     RSEHELQHQCMVQLLHLSSMADHHRSADGMCWSAAGAMGAFPSPRPPTLRPGEGEGSR
                     GTPEVSSQPLYRDPNSANAPPMSAAHEAVTSEQLLHMQLAYECQCEELQARAAVEQEC
                     AAELARLLSQKARLRQIAAAELAEKLADAEDARKALREELHYHKQKVETQEKEYAEEV
                     TRHQSDRSALQNAEMERMRLERKVGSLEEANAELEAGRNLLIAKVAQLQDQQSMWQAR
                     CAEAERISAEVQDLLFPGSCGTSSSSPANRAGEGDGDSEDQLPKRRSYSALQLEAATL
                     TSKVREAQDAMEAKAALERQCEEYRGELGALRAQVEQIKSQTQAAQQQRARSDRAQQQ
                     VQTRFSEANAQLVQEISTITRDYESRIKQQQAMMNTLRHALDEETSMADMCRQSAQRA
                     EAARQAQEEELLAAREAAEELRRERETTTKLYLEVQAELNELRTHYHALERQLTELRE
                     REPELYVLLEKGLDEDTTSWLEKVRGEKLRLQNQRHEARRLNSELLEHVQDSNTRLRD
                     VQKRLADVSIGGDELEGDEEVSGNQQCPPHTLADVDTAELEGTLCGAADACRR"
     gene            <398853..>404783
                     /locus_tag="LMJF_22_0970"
                     /db_xref="GeneID:5651856"
     mRNA            <398853..>404783
                     /locus_tag="LMJF_22_0970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683196.1"
                     /db_xref="GeneID:5651856"
     CDS             398853..404783
                     /locus_tag="LMJF_22_0970"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683248.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651856"
                     /db_xref="UniProtKB/TrEMBL:Q4QBQ0"
                     /translation="MQQNHATNVARHTAAAAAAASTAPSANCASSDTLFRLECVLLFA
                     LDVVRGPYIHSCAPAHPPEAIRSFLESQASPASPSSAAAAYSAAAAVTSPAAGAEPAR
                     RGSLTPPPPSPVQTKVSAEMIGDDITTMSPAGSHCDAVTASPYAKMASVAMHSSPPFG
                     ACSIGGGDGGLATASFSSVIPTLPPAPCSAFSPTHSLTSAVDASPPLEVWSLQNSART
                     PLLKEQRLSPLSLANRAGAAAGLSASVLGDMAGGDVRSVSFSPVAQGRFVGLSDTAAQ
                     AETRACAVDTSGTNHAASEDSTAFSLSPQTFTSESQLAPHRPSPKVGSSALTASQSTG
                     GGDAPAADTSLGEYGGEPTHSSDGHYRDARSEAAHAVGRGIDVDSGTTPTRRLVKTPV
                     VTTTTDVYCSNASSLNATPVSAPPMTTASPSASINSGLAVSGAATKRCAVTDGQQQLL
                     HHHHPQHLLPSSPQVWSSLHPATTAATRGTPLPLTSTTAATTAADKGRMSGYNDVFVP
                     RSEFCRRVLWLYPAESGLLFLYYPEDIPGEHYQRKTLRYSLCLVFRVDHKRMTIGDGL
                     LHQLVHPYSVVLTNIAEELREAELKYAYMIRGLRSFDSASWQMSRLALKSPISSLPTT
                     ATTAFNVAAQSPATSSVATAHVAEVAEDVDEGVGQAHLATPLALPSSAPQKPCTLARG
                     RVTGQADTMAPSTATATAVAMAASATFNAASSTSLSPNSYHPPVLEHSGAVPAAVSVA
                     AAAGGTNRRHPPAKMADRTSASLMFPRQPAALPLGDEGTEAHGSAEPATATFPGGCSS
                     QQCEDSARVAQNRLDGGGGSLPSGVHGCVGCSSHATTAAASSNTVHASSSHLSVSFSP
                     PTGAHIGAGGGSTAATAGDSGVRSFSSYLTNMESLETTINPPSSSLPVRSRTISETAA
                     TFHLPSAQPRALEESTSMAASSSAACSFSLTAAPASAPYVALGGAVKTHHGGSRQQQQ
                     QHSMAGASAATPPCVPSPFQGPAPTTAVASVHILNAFITPPTEPKWTPLSELVDELFR
                     CLSYTKAPDGNGDRERDGQTGSPGVDGRTPVTASPMPAAAALGLAAQQPAGALGAGMS
                     SKALAQRPISTTSASPAGQQQQRGDMSVVHLSNRLSFHVRRMAPLQPARLLHFDHIPV
                     PVVAYDPQMMEWMDMAVLHVFRLVDGVRTVADLVFSVAVGTTTTLAEVYADALQRCVA
                     EQQAAPVIAPSATPAGAGASAGQRRSTAHRDRARGAAVKVAAAAAAVVEMHGSGESAA
                     EAANVAGLGASAAGSPSQSIVVSVPIAIHPCPSLLPGVRYPAPTAAAAAISDGQAPLP
                     SQVNVRVTPGAAIGAGAPDTGAPVRSGANGLGTAVPIASGVPDGSSVTSAAASSPPPP
                     PQISVELPQTWVATAGIVMEALLHLELSHLIKVYRPWTEGTLYSTTHSAQRVLRSVHH
                     PARHVLGHYLLCMAWLERQECREERRRVIAEWKQIQKASVKARRASVASRITTSVVAE
                     KQHASTTLGMASTPQQSSTAAEVSSLSSAAPAAAPAVMPASGVGSRAVAVRSPDLLMD
                     RSGWSPPAAPQLPSSLPCTPEMNCSGQHQQLLHPPPSLTPVAYPGFPSMPYLPQSDSM
                     LMGVGATHAGGLDPSSADTHASSTSTSLAPSPLRHALSIGASGRLQLTLMSSLPMLSL
                     SRSGVSSGAAMSGTSQRFVVGSQGSQTCGGGLLPCAATGVSYGSSYSRQQQRRHQHLY
                     VDGCLRAAPLRSCSSTSGSEDICASVSRRSSSSASSSVSSDSGHSSVSSSSSSSSASP
                     MPISASAMQPVAALSISDASAVQTSATPAKVEAPGSPSLTPSAAGASIPAQASKGAAA
                     ADAVSRSAQHSLKSPSGDGAAIEGPAAEPTAASALRAAKSQAAGVAAAEASRQERRCR
                     RRPPLKVFTPTEADVSRAAAAALCALAKFNNASVLSVQEEMRRIPVWATSFNHWSDRC
                     VKALVEVAILNNWLEDVS"
     gene            <407699..>409819
                     /locus_tag="LMJF_22_0980"
                     /db_xref="GeneID:5651857"
     mRNA            <407699..>409819
                     /locus_tag="LMJF_22_0980"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683197.1"
                     /db_xref="GeneID:5651857"
     CDS             407699..409819
                     /locus_tag="LMJF_22_0980"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683249.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651857"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4QBP9"
                     /translation="MLSSMAEAGGLADPVEGAGGTAACSVAGAQVAAAAAASTATPLV
                     PTRSPAINPHSKVEIQFTLPTTREHVDADECDAFGFEEESEDDYAADILTQVLMTIKD
                     VDRNNDPEEADLEMRGKEWYIFILDSGDARQAAAALKAKMSQLTDNELRVMLNGLASA
                     IIYHNTWAAVLHLGIQEKATLRHLVLRIVLKMLVAHRCVPCEAEKYVAVLVKMLIVGW
                     VSMKGTIDTVELCLQHDELIHVGLRIVEHSFHKSRRVVELRAALATRPRLARRLAELY
                     ATEPRFEVDVALVTRWWRGTPPTIYCSVPMENSQGDSLSNSVTCMAYFGVRDEVVTGD
                     MSGAVTLWGPPGSSRQPSAKNPLGFPHVSVRPRGVVPLPMNCVPVAMAGQRLDGQYLA
                     IAGMPFKSRKPYSKYCGRPAVRPSSTSAAATAMAAADGAVDGAGVAGDAASMATGAAV
                     GTGSAGAIIVITCNENSIRWNKGEIVLRPPGIALTAITAFRNSIVAVGESAVSAAAAG
                     GPVAAGMLGGNVSAPHRLSFVDVMSGSVMRQIPKAHDDYITALTVLEESSYVLLSGGR
                     DAAVKMWDPRSREDTPVVNTALCTGALHHETTISSIYTTGYNIITTDVYGAMIVWDLR
                     SMAAPYKRHQFAYPIAEATLIQQNRAALATTRGIVTVALDTLAPQDLYYDKGICTRLL
                     ANDAGNLLFVAREGKLDVFAVSNF"
     gene            <410783..>414586
                     /locus_tag="LMJF_22_0990"
                     /db_xref="GeneID:5651858"
     mRNA            <410783..>414586
                     /locus_tag="LMJF_22_0990"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683198.1"
                     /db_xref="GeneID:5651858"
     CDS             410783..414586
                     /locus_tag="LMJF_22_0990"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683250.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.0990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.0990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651858"
                     /db_xref="UniProtKB/TrEMBL:Q4QBP8"
                     /translation="MQCHHNVLVGWANSGSSTAAFLTQQQQQPLPPSPLRFLWADQPL
                     GSPSVLAPGCGMYRARSCGVVAASAAAPRVRTALDMVIRSYTPIYAPDPATDHLGALR
                     SADECRTLWAQHIPVPSLTRAIELWLRFGNDPVVHTAASTASAERAEGDAAPSSTSPF
                     AYVEDYMGSNMVTGTPEHVKESAELWSEYFETKYVRRMRQSRRTSKQYVGVLGAAGRG
                     RGAGESGGGSASSSIANLLLDEADHPNTKWEADTFFCEVAYLSERHLKTRVTNHLQLD
                     KLLWGGTAKPDAFVQFFEAFQQQTITRIPLPVPSIWVHESTEAKKKWAEHYLPACSAA
                     HEFFQEKLRPHAADAAAQAKLLADVAAAYRQVHAILLERRARQVQAGVYPSTWTGGGA
                     AATATEEAWAANEAEKEQRRMDEGVYDPEDLLDTTAEWATEHAKIQAILEQPLTSSGS
                     NGEKSYGFSLQDFWLHTERREALETVHVLESESLARVAAAARRRLYSETPLPDVFAGL
                     EESVAKARLDLRAAVLKPHFNSVWCRMHYVKFGAASLVQHTHTASRQLLFHYAASTQV
                     VAATAEMYYATKPLSSQLDYASPYTFRRSLARHCTRYGVEMAHAAQQPLLLSAAYLAK
                     AEGVIGRVARQAAAPFGARRRARYSAAQLNNQRLLNPVKSVQVTAPAPELLAAGADLL
                     TILREERTPKAKAAGEALKVWPLGSRQTVSYDWTSPALDKLRLTDSSLTAEQAAQRDQ
                     LRQAGRLEISLWRRRTAEERQKVRAEMKKEAVDVQALVAETPVLQEVLAYASHLYRKL
                     TREQEQEQSYSDTVPTPHAWDEASGEWVFAVMLDDDVPLSETQSTEVFLPYVDAAGRR
                     LPNGEYRVAVRAVDRELNPTEHPTLMSAATSSPFSVVDALPQLYAQYTRHPQPADKAT
                     GTPTEAPLEGDVAGKDLMSFCAFLREAGLHISLSAEFAMGQSLDKQGNVSVAEVAAVL
                     RGTEYHRSQCEHGITDAQRTIEPQCRLHWSLYHPGATEQEWAAARRRVLRRAMAEERD
                     WWLPDPMLEVTDVRTDSAGAASFSFGAYPAVARYGTELCTVLPAHGSNHMEYAVLPPP
                     PGVKATARGIGAQVQAECTVDGTGAIASLHYGAPISAADVTVEDALRAAMEAIQVAQM
                     RHNTLSMVKLCAFEKQAQTMLFCGIQGLEFGGKHGRTYAYALEKAKREMAATAEAGQV
                     ASLQAADAEKLRLSDQEQTSAAVDRFASQTNPEQRLTRFVPRSTMSGYSMEDVGPERA
                     STWGL"
     gene            <416069..>417829
                     /locus_tag="LMJF_22_1000"
                     /db_xref="GeneID:5651859"
     mRNA            <416069..>417829
                     /locus_tag="LMJF_22_1000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683199.1"
                     /db_xref="GeneID:5651859"
     CDS             416069..417829
                     /locus_tag="LMJF_22_1000"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683251.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651859"
                     /db_xref="UniProtKB/TrEMBL:Q4QBP7"
                     /translation="MPSLQEYWQSGFRGLHIEECISNAFADFAPYAGADQQRIVVSRQ
                     TPAPGRPVARSSDAAAAAAVVGTPISPAWHVASSSSVIVEENGDFTVQMRDPHAGSLA
                     FSTTGHMQMEAAVRVDMPVRSSTSGRTGTSTGAERAVAEVAALSALPPTRESVYEAIG
                     QRRAGDSTETATNAAATTAAAVVMHPVAKPAPSYLRFTDFTRPLTMAASEATAHSTNT
                     ARTPAPWGQLELDMSLPNWSANRQSIGARAGPAALRVSRALSAATAAAARSPTNSTSL
                     SEDEVAGTAGGDAGHRYQYTLDAAVCVPFGGSGADASRAARRMLDGKPVVVLPAAPWA
                     LTCGMQLPLTLGDTLVGISLQNDRASSVTTPLPGVEWVVTAPAAPPSDASTLPGDLLV
                     SAADEAHCTACVPSLLYPSHSISSGGSGDAASPSSAAATPAYVAIPSITVRLLLVQTL
                     ASHTLVRRDASDLSASQLDMSGSGYGAGTNGSRIASSYDWRQLPTLVGVNVGFDRDRL
                     RMSAASILHNGEVDLEAAAVLDVTPWMPRMPTLLKVGYNNAGRLAAGITSLFYETVTA
                     TLGMHMARGEQARFGIEVSF"
     gene            <420062..>421804
                     /locus_tag="LMJF_22_1010"
                     /db_xref="GeneID:5651860"
     mRNA            <420062..>421804
                     /locus_tag="LMJF_22_1010"
                     /product="putative UDP-galactose transporter"
                     /transcript_id="XM_001683200.1"
                     /db_xref="GeneID:5651860"
     CDS             420062..421804
                     /locus_tag="LMJF_22_1010"
                     /codon_start=1
                     /product="putative UDP-galactose transporter"
                     /protein_id="XP_001683252.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651860"
                     /db_xref="GOA:Q4QBP6"
                     /db_xref="InterPro:IPR013657"
                     /db_xref="UniProtKB/TrEMBL:Q4QBP6"
                     /translation="MSFEGGCADGRGTKSLPTPPRSAVAAVKVGASSKILLLAQMLLC
                     VMGINLCFGWWSIKQERAITKPYFIADSAFAASMAATAASAHDARRAAAVAATKSNAP
                     PGKPHAVYLSTVYGISLTQTLAGVIVSAALVGMNSLLRRSMRNYQQRSDRQRGAKANA
                     SNALDQNQCTVLSRRDVQEMLAMGFSNIFGTSLGYAAMRRISYPVALTAKMGKMLPVM
                     FVGFVWYRARYPAKKIASCLLITGGVIAFFLLECRSNSSDNASSATTTTITGGGGRSS
                     SGSSAKHGAASSSSSLLGMALLLLSLLMDGYTNSTQDILVKRHRWNGVSLMMRTNLAS
                     VLCALSLLFVLELGEQPWSWLASFTHHATNSVMRSLPMSNGALGRALVAWLKRARGVS
                     ATSVVPFHDLSHFIAFLAHCPEARHDVFLMSLLSALGQLFIFHTITVFGTLALTAMTL
                     LRKSGSVILSIVVHGHTVHSAQWASLGAVFIGVVLEGYINIQEASLRQGQATTKGAAP
                     QEAAATASPSSSSTAVPANGTPAPGYASVSAKKSKTSDDSAATALAKVRVPRAVAATT
                     AAPASSPPKAKKTQ"
     gene            <424014..>425336
                     /locus_tag="LMJF_22_1020"
                     /db_xref="GeneID:5651861"
     mRNA            <424014..>425336
                     /locus_tag="LMJF_22_1020"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683201.1"
                     /db_xref="GeneID:5651861"
     CDS             424014..425336
                     /locus_tag="LMJF_22_1020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683253.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651861"
                     /db_xref="UniProtKB/TrEMBL:Q4QBP5"
                     /translation="MKSLTSTITLTPISTPGGVAALSSVSASSALLTSLSPPSRTVPL
                     GTSAGPRGPLMRTATMETSSRLSPPPCHHTAESLSKEYLRPPPSESESHVSIRFPHHH
                     HHHLTPAGRVSLSISHRRRRRRRPPPPAFADRLDAPVFSSMQVSAPWSTAAPITGGGF
                     SAIATSSGSTCAYEHPAWQPQLHSQRQFFFDRRGASSTWSTNPVQALDIVGGSCNALP
                     YSCTEPNMSPTDAETPPAMLSVSSSYHDAPLSQVNGTSSVLGNIPAPPVLTCVAVFSG
                     GEQEVFWRRACLRVTCVPVTNTSGRHREAAAEASRIAQPSVSLEEIRDSACSSSCSDS
                     DKTGCASDKKLDLVWRWLDTLGMTDAVEDVLSPGAGRVLVVWTAGVMYEQGSRGGGAS
                     DDAQKSSAAGARLARLLGVRDGGGESRDSVVPGAPCEVVFDGMRLLLD"
     gene            <426150..>429857
                     /locus_tag="LMJF_22_1030"
                     /db_xref="GeneID:5651862"
     mRNA            <426150..>429857
                     /locus_tag="LMJF_22_1030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683202.1"
                     /db_xref="GeneID:5651862"
     CDS             426150..429857
                     /locus_tag="LMJF_22_1030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683254.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651862"
                     /db_xref="InterPro:IPR011333"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="UniProtKB/TrEMBL:Q4QBP4"
                     /translation="MDDEVDGRDIAALLAELKDVGGTVTGSSDTANARPYSEVSVRRG
                     VVGGTSGLKDPQRSAHAAPSLPHRVGAGEGGASRNTTPRHRLSVASRPGNRSSPTAAA
                     SRSLAPINFSTYSAADTGLTDAQLSSQRLSATPLGVRLTPLGDSNGAAAPAPLPPLLS
                     SSPRKAALPASPSRANAAADAGAPEPPLTSQSPLPPLPSLGARGSRTGGSSVTGVGGN
                     LGEGAPSSVLADVLPWPTSSDASAGGNENRLSKAVPAVSAAVAVATAVSSMPEAPREV
                     NFLPIMCARYLRPVGLTPTARLGHTLTPVTPDTMLLFGGLDLHGEETTSLMAFNTTTI
                     SWEPLYTLSEAPVARHSHAACAYDGRYLVISGGVAQHGGAVLNDMHVYDLHTHHWRCV
                     WDGQRDGSAENRNEPGPRFGHTMVLQDDRLYLYGGKTTSESRQRTRRGSGTGNVVAAT
                     TAAATLASGSDVYVFSLNSYRWRRRVRAAKEHRPSLPEQVAAAPNIEKPGEDANAEGQ
                     QTVRTRPATRAYHAACIRGNTMYINGGSGTSEVLTDTWSVQLHTGEWHCVHRGGTADA
                     IPREKHAIFVCGEALLLVGGCSGGSLNERITGKFTHFAVVLPLVGNAAGAPCWIPVAM
                     GNVSIVQPHKKSFAAALTGGFVYVFGGVCGAEPATNSMVRFLAADGYVSENDQAAVAT
                     SGGDGGAQRLRLKLQQLREQQRGTPFDCYVYAGTYGGEDVASAVAQLQAPWAAGAARE
                     DGGLQQQQQQVKTGEEDVPIAGLHRAILHQRAPLLLKQLEGCRTELYSCGSGGALSTA
                     RTPGQQQQQQQNRTSSSRGRDEVDALLEQVSEGQRGGGARAVDSSSAGKDNTAPAGAS
                     AGGAGGLPVYFTNGTPRVPGLAQPLTADALQCLVDYVYWGGLKAKYRVLLEEKDEDGG
                     DGAEANGSRPAASASASSFTIEYRARLVQTLEIVKAAGEAYELAPLAALCASLLAGDR
                     EQVRLARQRSTEQLRSDMAALLSAPSIGANTTMLVVDPHTQAHSAHVLHACILLAASD
                     LFTELLRPLYRTVSGGPVSGGALSNRVGPLAAKLSTAAAASLLALLTSSSKRTVLIGP
                     VPLPLLAVQPILRYLYTQQLHAPSETAFEVMLGAHQLGLSELQALCEAAVAREVVNYQ
                     TCCSLYHLARKYQASLLEEIALLTAVSGFATVRSTSAYQLLSDEEKQNIDSVAAELGS
                     STWVPPPQPMTEMKSRGTYNLRWDASAPSTL"
     gene            <431377..>433596
                     /locus_tag="LMJF_22_1040"
                     /db_xref="GeneID:5651863"
     mRNA            <431377..>433596
                     /locus_tag="LMJF_22_1040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683203.1"
                     /db_xref="GeneID:5651863"
     CDS             431377..433596
                     /locus_tag="LMJF_22_1040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683255.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651863"
                     /db_xref="UniProtKB/TrEMBL:Q4QBP3"
                     /translation="MRTYAHTAALCHPRDVKRPVVLRRLFITHSSRCFQWCPSTYLPT
                     YLPTPPRPDLNPTLSGIMYKHSGVLREVRSGISVGRLRLAEQFSTMEGWQRLQDSRFD
                     QYVKETRRKQSFDAFDQRVERAFRVAAKLHKAEVVNAFKRKAKSSSEGKWTAAVTLEV
                     KSAVEARLRWLRDVWSQIDADYRSSNAERQAKASREISDALRGEPGAYMQWVYERQRE
                     DRFAGPKEKAAREAELSAAELPEVTDEEANRYHNLSLRMADIEHNVKNRFGVAGQQHW
                     AELQAAKDEAYGQKLDTAAKLYEKLLDQSARFDESRRTALLRSNVERVHQAQVRFKAS
                     MEMEKERERLVEAHEAMREERKQQAKAVRIAILQEAAELRRSGATAEEVNQLARQRQL
                     EAHARRQAEYQLQERELLQQKKAHYLDLIEKFKDEVEMREGQEMLQQQESGRRSQRSH
                     GAVESSGAPKLNAFGFMDADRLDDPAASQLAASGATGHSTTLQGSSADRAAAASASAP
                     SLSAAQQSRKKALWDVIEKDRYEDPFMTIHQARLDAAATYDTLYAKHLAPTLAQGKKY
                     TKQGLGELAAGGDMDRHVFKAAARTMRPYQWGLSSSVVHDVDGDGSNDYFVGLNWHVQ
                     NPETGDIDWRYEKKAGGAVFRGPLLYGMGAKRESGEPGSATMDPSTATVRRFSPLATT
                     SSRSASKAALPSPARQAGSTASPSAARRRRADGSMNRRVTHSTSVVAAPSLPSWRSS"
     gene            <434966..>437857
                     /locus_tag="LMJF_22_1050"
                     /db_xref="GeneID:5651864"
     mRNA            <434966..>437857
                     /locus_tag="LMJF_22_1050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683204.1"
                     /db_xref="GeneID:5651864"
     CDS             434966..437857
                     /locus_tag="LMJF_22_1050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683256.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651864"
                     /db_xref="GOA:Q4QBP2"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q4QBP2"
                     /translation="MPTAKPAARSERLKEGLGIAPGAVGVNPTPTTSSNANGDCRSIS
                     ASINNNGSARRSDRDGVRGFGLVDNRDSATVPTLHARNVSAPDDAPTSSSNRLLDSSV
                     PVDQETVYCNLWLFIWLKTIGSFDSGAFSAALGAPNGISETWDLSTKLQGALTSSVFL
                     GNVLGCPLAGHLFSRYDEKRVLCTALIAHTVFTFLYAAFPIYGVALLNRFFIGVSLSF
                     IVVYTPVWVDEFAPKNRQSVWMASHNAGVPLGIMLGYLLAAGLPAFTSSISWSWSFYI
                     KCVLMVPTVVYVARSDARTINTRKASGGGGDSKGYDDGGDGDHAGDTGAVSACVVSGE
                     GPNGVASAMFASPPVAVVNARASASAGTLRSTSGEASMTQPLRKLADHALATIRSLYS
                     SMAPLFSNVVYMCSVVSLTSLYFVATGLQNFVTQYLREPPFNASMAIIMVGFGTAVVL
                     APVCGVIAGGILLDRIGGYKHNLRRVAFFVLAWGACAVLFSVICIFVHTTRDFLLVMS
                     VVLFCGGAIVPPGAGLTMASLPDHLRSIGAAFSQTIYNLLGNFSGPLVCGWVADATGS
                     LRYGIITLLLSSVLGVVPVIGIARFAFYGGGSGIGSAMNALIGSSGDDGTGVATEVVA
                     QDEDDEVLERQGNGVVAAKEDVVAAAVLGRHVYDRDGAKVLADAMTMQNGKLTAPPAT
                     ASMRSGAAGSTVEVQIKSPLQVYQSLAAVRCMSSESGRGTASNEKATAPLPLRSNLHS
                     LTSPALPARPFRTPSTPAAVSPAAVVLPLVTPPTQPSRIAAAGPTGDMSGLLRGPGTA
                     RLVTPARAPLSTRATAELPAALSLNCAGHRGEQQKADLVLMNLEVEAVRVMSLPNQQA
                     FGIDLVRAWLNNEVQEPNLPPRSSSRSLSRSIGEAGVAHPPHMELLPTPIANSSLESL
                     GSAGAAALTPPHHCRTLLQRHCINVEHVAEEAGVRQTHTRTHAGGHAHV"
     gene            <439678..>439989
                     /locus_tag="LMJF_22_1060"
                     /db_xref="GeneID:5651865"
     mRNA            <439678..>439989
                     /locus_tag="LMJF_22_1060"
                     /product="putative small nuclear ribonucleoprotein"
                     /transcript_id="XM_001683205.1"
                     /db_xref="GeneID:5651865"
     CDS             439678..439989
                     /locus_tag="LMJF_22_1060"
                     /codon_start=1
                     /product="putative small nuclear ribonucleoprotein"
                     /protein_id="XP_001683257.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651865"
                     /db_xref="GOA:Q4QBP1"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR027141"
                     /db_xref="UniProtKB/TrEMBL:Q4QBP1"
                     /translation="MASVSPSETGGTLITFLQQLRGTLVEIELKNASIVSGEIAYVDA
                     NMNTYMSHAKITSKGKNPVEVEEYMVRGSTIRYIIMPESLNTYDILKQASTKKNGASK
                     K"
     gene            <441269..>443557
                     /locus_tag="LMJF_22_1070"
                     /db_xref="GeneID:5651866"
     mRNA            <441269..>443557
                     /locus_tag="LMJF_22_1070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683206.1"
                     /db_xref="GeneID:5651866"
     CDS             441269..443557
                     /locus_tag="LMJF_22_1070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683258.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651866"
                     /db_xref="UniProtKB/TrEMBL:Q4QBP0"
                     /translation="MVLRTTTTTTPLPTQQQRHPSQQSYFHANVTALRSLQHRMQLRA
                     EAAQVLHTDPSSPSLGKSGSSASPAQHRHCQCGAARPAALSSSPKPTVTQTTPAGPGA
                     PFSHWSPQLHAAVLRVADLGEVDITAGACCTARGTTRRTATAQLPEMSHLGSVVGNGE
                     GVPAAGSSSGGCGACTCRGCGCLDGPNASRDEQQCRNHRRHRSSHRKRHGRSSSRRRR
                     DGSAGSCPPSSPGPSKSPTATTARLPSAVSLLATASNASPVASPFRDQEVLERIMAKY
                     RTPPTPPTESAQQQPLHIFLHCECEKTGAAPGVTALTGTSASAAAAVAPGLAAKTATA
                     STPASPPPPAASAPPPPPAASVPPPPPAASVPPPPPAVSVPPPPRAMSIPLPPPAASI
                     PPPLPAVSVPPPPPAASVPPPLPAVSVPPPPRSASALKTPPAIAGARSRSRSPTAPTH
                     SAIDKERQMLLEKADKYVWQLEQEVQHRALHYNVVLQQLAEEEARSAALRHDRDALLA
                     LNGGLQASLDYTRGSSNSRRRYRHGHSTSSSSTSTCEATAMPSPQGVIESNKKSLPPS
                     QQQQQQSVRRLPPAVESVYASLQTPADGAAAAAPSAAPSTSTTSVPAPTATAAAEGRA
                     SATQEVLRHVLLEREAALQSSPRPRPATVVVGTTNSVPHHGYSDELRRYVDRLYQEAE
                     AGAAHVRQAILPTVIPTGAAAAVSSLAPSPQLPAYQLQQRQRQSELEQLRAEVAVEGE
                     RMRADTQRWRAYLQQQQQQQRL"
     gene            <444661..>445419
                     /locus_tag="LMJF_22_1080"
                     /db_xref="GeneID:5651867"
     mRNA            <444661..>445419
                     /locus_tag="LMJF_22_1080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683207.1"
                     /db_xref="GeneID:5651867"
     CDS             444661..445419
                     /locus_tag="LMJF_22_1080"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683259.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651867"
                     /db_xref="UniProtKB/TrEMBL:Q4QBN9"
                     /translation="MGWFRSSASPEAGTATAEAPAAAAEHGSQHRQPQPEANSPAPLT
                     EAEQLDLLVAGARLDDTEAQDTARFLGSNRRHMYADGLLSCAAYTFSGLHHIQGQSSA
                     LTLLTMWTVGTTFLVDVAERKYLQESLQGTLRTAKTTSEAEKPLLLDQPPHNATPAST
                     PRKAAVVPAMPTSSDSLSSAIKKPAPRDKEKLAEQQRKVFLTQAVASWLWMLASFQQF
                     KVHKRLKWCGYSSWMGLGCAGYYTTRHLYNLLVK"
     gene            <446710..>448818
                     /locus_tag="LMJF_22_1090"
                     /db_xref="GeneID:5651868"
     mRNA            <446710..>448818
                     /locus_tag="LMJF_22_1090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683208.1"
                     /db_xref="GeneID:5651868"
     CDS             446710..448818
                     /locus_tag="LMJF_22_1090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683260.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651868"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="UniProtKB/TrEMBL:Q4QBN8"
                     /translation="MSAEQQRLKKMHCEAVTLAEMKQWLGLPLTTAASSSSAAPAAAA
                     VAAAPKSPVEEAVGRDVYDMYGLSMTAVDAYLLRYLRSKNLVIEDAVAKLRRRRAFER
                     TLPMISVTTTTVAALRSGAFHLLDHDLEGRPVLYINVATFTLPTLELDEAQRLLIILL
                     EFMQARCLLKNNEKVAAMQRRRRQHVDATAAASSFANGGRENNGGAAAPAHGAQDVDK
                     ETVSDLQEFALLVNEERVPWMMHASFLKNYSTLLSILPKYYPLLLGSVLVLGASLEIR
                     TAIKACVGSSSEDVRNSVQMIEKADLPRYMDASTIPVELGGHKQIVGSAMNFSETVLR
                     HWFTLTSQIEDECVGSDGGIADSKVPTTISAAGAANGHREDGGGAETSHSPPRPLYVP
                     PPPLGMTQRHISRQRHAVELQHLSSSVVGTITGPGSPGPMRPCKYGGSSARNGKHSLM
                     SSAAAANRSTAVTTPHGTPTSQKDQAAATVTLGAGRAEDVTDDGVCSALSGADERDDY
                     AENEGGGAGMHTRTNSGVPTYQLYTAASSLAGSLAVEGEMHLSGLGASHNRHHQGASL
                     YSVASATISREEAAHFADHPDDAVVALRQERRRRQRAEQALYFRDLGVTLDMRNASII
                     EKELAAIHQDLNVLVAEILVKAEAARKRQKAPPTLKQLLDLTLTAFESVTCTPSSVPA
                     MALAEPAQREAASSSCCSFM"
     gene            <450608..>458107
                     /locus_tag="LMJF_22_1100"
                     /db_xref="GeneID:5651869"
     mRNA            <450608..>458107
                     /locus_tag="LMJF_22_1100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683209.1"
                     /db_xref="GeneID:5651869"
     CDS             450608..458107
                     /locus_tag="LMJF_22_1100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683261.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651869"
                     /db_xref="GOA:Q4QBN7"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="UniProtKB/TrEMBL:Q4QBN7"
                     /translation="MEFDALLNTLCLTSFVLFGLWIVAHAVQVVELHFMMQAYTHHKT
                     YIFTIPFVPLITRLFHEMAVPQFLASEAIQRGELPPAMRTHGHRTPAAVPVEYVDADG
                     APSLSTLTNFDAVSSASLSPPSPSALSTVLNKSPANTPTDSLRRRAGRTKKERKRKRA
                     GDGVDRESAQHQEELRQQGSVAVSILDPNLAAAGDLEFSSSPSPAWWAPQLEGRCLVF
                     GLRLPFELLPASRSAPPASAFANAEARGVGGSNSTGNRPGSGHGATTRQPTVNLQLKQ
                     YQLIPASLVASAAAPSPALHHHTVLSSNAELQTQVAVAQQLSVAPVRVYTRAAQSRAR
                     INTSVVPSPLQCYSSPAASSPSRCTWPGALPLARTPSPHLDFDSIKYAYTQYYQRLLE
                     TAVAEQAAIAHRARKHRKLAKSAQHIATMLMHYLKYARIDDDVEDDVNDGDAEGRAGG
                     GGGSGSAVDTSRAASSKRRTAATPRARAGHGNASVFPSRIKRRRRARSGKNRGGVGMG
                     AADRPQRSCGPWIPVLGDSAWHHSDKYDAVRRDGDLVSSALSSHSLYHTAAPLSPSQL
                     LPTQQSSLNSRSSPSLMQPSQTAVVPPPLPPVYELRRGISKRRRRAETPSIADSAVEA
                     LEGLVERVRLAQTLRPRYQSLLCTVRFAAERFIVRRGASEPPTWTPLQTVAAAGVACG
                     GLSSSATDGRGAAKPKTRCSSSSSSLSPYRLHLHRRYGSTSSDSATAVRSPLANSNAS
                     ASAFGAQGSWTAFGYSDNSVDRRSSGARVPAALSSQISNDFAGGQFPGDTRSFSLLPL
                     RPSPLTAIPAESRIDSRNNSSFHSHRSDSPSPALALPNAIVTAPTNVSAEIAAALAIP
                     PSIAVSSSSGSTSAANAAIQFLRASRLRENNIRAAIAAGAGISAVSPPSLSSILNPSP
                     ATSLSSSSFYSAVAAPAATRAPREVGSPHRCAVEADLSMSAEGALPLSRDVATTGNEP
                     VSLPVDNGDASGKEVQRIGAAVAAAGAVHAPMDEVMTQQTPSRAKDTASRLLRQQRHP
                     QPASSSSEEAPQRGAASATSPSLQPRSTDLRIVYVIGADRATLLRSLTLDATRSFAAG
                     TRNFLCFFTRKDERRAQRRYMEQLDRQNRAALQLLMLHETPADAPQPREQRDRGNTAI
                     GHVHVNSAAPLCNRAEETLLSAGVTAALRSVPGPPWNVRATSWTDVNPPSGGSRMCGS
                     GSVDGGFGGAGTVNQQPRATRPSKTAFFNVAGADLLALEATPTDSAPATVTAPSAHQC
                     DDSFLSMTQSLEASFRSVRELSHAAHPGTAEVAAASVAPDNRSSSAPVFAATPSLSMA
                     QPMPTAPAPPAPLAACGDGEAARGAEAEGTLAAHSRSPSLLSHDSEKPSNTVSVFERP
                     LLTFPSLEGTNNDRAGSAHVERRSSVGEVDSGALLPHQGAADTTAPPPLPSYTEVAEP
                     LHLKAIIASNPKAGDQGILDHGATDAAATTNPVADADVLPLCLASNSEESAAAGHKHV
                     DVAPPTVSTAASPIPAASAAPKKDSKESEKHAAAATAKTDSEAAVIDSVSAHDVRQYL
                     ATVGVTLPQQVYLLRDAGALTPLQQLQRSLAASSHHASVLTSRKDTSAHSTGTDAPTA
                     AVPPTVGGTAAHHRALLSASAAAVLSRGATRVVEGQVEVAELSLDVLRRQISPFVPLV
                     PPPLSDSDGDDGAGSSMSGSGSDASGARETSESYSRSSGASDDDDGKVVVREDVAGAR
                     RSSPFRRRGKPPQKSRTAAAANHHLGHSSKNRGPAQRSGKASRPQRAHSRRRHQQHSR
                     SSRGHGRTSARSSLKRRRRQHERRRKRHLDRWNRHIQHQRAAANKADSIPVAAGVLFF
                     TAPPKLPTALARQQRQLLLEELESGERGRLLVPDWALSGSEVAAPATGANEDARQDVQ
                     LAPSSSPHNGRSPPRSICVTLIYAATAEQVAQALVRAAEVAATALKSQSAACDAADGW
                     GHRNREAANLVRSRSPTVAARRRKRTCSGRDSHEFLSSNADNGLCLSRPSQQRPEAAF
                     MGENWHGHRDVSLASTEAPSKNSLCHSFVSEKLMPRLSRAAFSTVAPDAFVGGENLRN
                     NRPVDVPPPSLWRILSPNGCSETATFSEESMEDTDFSGRHGGKGDGSTAAPAAAASPL
                     IRIHDRPPSLLLITESSDSAYDYCEGRSGSGGSATAVGGRWDSLGRDAASDGSGAGTS
                     YDGVGHTGTSVYVEELERSSSSARGSSAHFADSGDADDDVEWASSARVSAASVHAAKP
                     PSKSVRFKATEARRGEEDKVDVAHELMNVLRDSACFPDGVPVGVSLAYVRIGNDLYAI
                     TEVVDRTFLQYREERVIQSRKSREEGDSCSAGDGDDDSLTSLSDSAEDAQADSSLSYS
                     SVSNSSVALDTSFKTLDAALKVIQEQHKAAAQQQYRRLHRRRAVSASNFGDLSYSLAG
                     SAPLRPGMRRQEVHMCWRCLSAEAAVIFVPCGHYAVCEACAEVLADCCLCRTPILSSV
                     VLLEHHNSQQAQKPPSEQT"
     gene            <459880..>476787
                     /locus_tag="LMJF_22_1110"
                     /db_xref="GeneID:5651870"
     mRNA            <459880..>476787
                     /locus_tag="LMJF_22_1110"
                     /product="putative dynein heavy chain, cytosolic"
                     /transcript_id="XM_001683210.1"
                     /db_xref="GeneID:5651870"
     CDS             459880..476787
                     /locus_tag="LMJF_22_1110"
                     /codon_start=1
                     /product="putative dynein heavy chain, cytosolic"
                     /protein_id="XP_001683262.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651870"
                     /db_xref="GOA:Q4QBN6"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004273"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="InterPro:IPR013602"
                     /db_xref="InterPro:IPR024317"
                     /db_xref="InterPro:IPR024743"
                     /db_xref="InterPro:IPR026983"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QBN6"
                     /translation="MFPFDDNVVQFIVLLTQHGTVEKVRAAIAQSADAMGFASPPASP
                     ESAMHLAAVQQQNIGERDRGDDRETGVVSKTALLGAHVPLIAICEISDGCAVTDGSQI
                     IATADPATFFRSVSCMEDATPEEAVSLGAPACGGTGARRSTGSGPGDDSVPGARHKAK
                     ALSCILLERRDPHGAGGGTAGGGGARALSVRDLYIQSMDLQRPLHTLQSILRNIYDPM
                     LRSHKTQSALRSHVQDLLSSIRSMHNVLPEIDVTRYVHEDLLQLCDANPLLDVPQLID
                     RLGEVAKDPSFIRRVLQARNRCREALSMEPLLSGKLEEEELAKELQSTNSKAIGAPAV
                     GPTGLPSGWSGVHPQPSAFATPLPGAAAGIAYDGDGGDDSARVVQERIVYWRCVHAWM
                     EDILRQLRGREWRLVHRLLAQRVETDYVGEYVGYLKLVQEYITFLNTIPEKRLVNVQD
                     MKEFNDVTDEIIMAATQPTRFAARLQLSLLTSLVWQISSRWVSVMETQQVLSLDEDPN
                     VAPVAAAGDANATQHSADVTAGAHADPFVHLQTLRIAIHSLRTLQARYVEHSTQLRHQ
                     IRVVRSPREHVEHPRVEALLARCLAVRDLIEEHLLLMRQLGVVFSTKIRLQFARAKRD
                     AVPAMGVVAAQQQPGEEYALVMQDAFNECVRAVGGWVDDAEDLQRSRKGSVGEPAASS
                     GSPHRGCKRCSNYLWQTSPTAVQRFNAAVQEYQHKRSQCDEQIALVVSQLLSNQQYAH
                     SDGRSSMGGAGAVGMAGAGAALKGPQASVNYADNHGLRLFRTFKRFKMLPLERVQRVV
                     HSYQDAVAEKLSAYVGYVQDCYVNVPLTKKEVSYNMARFSVSALVAQIMWEQRLAEAL
                     TKSMMRFDYVSEHGWHQLLYLRNVEHYWRLNASLAEFIGVPLDLLVCDELQLDSEVHG
                     CAVALACLSLHYTEEASEWEQDEHLRIAQDLVATCDPGALAVARDRMLIGGAPRLYKT
                     TARARDIRSSRDIIQQRIESHMASWFEEVDKLIGGSGLDQQTLLLSGPVLWAVNCGPF
                     SGPHNTTGGAVANEADSAVMRLQPSGGAGAMTGGFTANANYFNTGGAGSMPRASSFSP
                     SSLALLRAQGRSASPSVRRASFLVPVGSGDSESLAPAAATAASWMVEVAFPWSFPNIA
                     EDLRYLESSYLTSTLLSAGSGEPAATSRNSSSAAGTTLSPRGRCPAVASDLAFLRDAL
                     RGNELRSRLAHTLVELIHVYYVTVKGEDTSLVLLATDEYQEVNRLFQMGIALRWSDEG
                     LLSYVQQLSDTMQAFTTTVQQLRSKTELVYRKIRAFLVRAFHPEAILQRVKALRRIVD
                     TLALRCVHAHLWTRQIQPLLEQALLTQMKYLMHSFTEDFLSMRSDVRFLEKGAETDVF
                     RLTPLRVRMRVVYKEVRLESCCGAWRQHWISELNRFFSWIDVLPRLYKEEETQADVVG
                     VPAALGSDMTSTAVTHGSNSTDGAGVNAGIGRAGNNGHNAASGRAPDDGYQYLLLRLP
                     ASALAEPLHAIEQCVQDAIDTENEWRRGQQFLSMDVALMQQRFGRDLRRWSHALRLMH
                     TVTSRIMDYTQPNKLLGGIVILAQEAQIELGRKLDQVSQYAHAKFKDLLQGEQERAFS
                     VITQEQMKIDALDVISNAKDAAAFLSEAPRLKSELQKLDGEITLMDNGEVSLQKLGHV
                     FPENWMYAAALREEYTSLAELVDRKLKAVQVRRPFLIEEAKSAASALEVKVAEVDARF
                     HNVDSIAVSKEAPVLAKQMVSDIYDEAVAFSVEAKQVTAIQEALGESPHVFASLQKLL
                     ADVARVKDVWGHVASAYVELNELGAVPFFEMVPRRLHERLQQIDEETDAYQETMQSYQ
                     LYQNLKQKLCRVLSYNRLMQDLRSDAMSPLERSMRHWKTLQHKLRAPWVLASLTVANI
                     WESDPGVNAAVYSEVVETAQGERRIEVQLHNINNYWNMFEFSVVVYKKHVALIRGWDE
                     VFERLTEDLSTFGGMRASPYFVFPQLVSMANDAEARLDRLRQVLEVLLEVQKRWVYLD
                     GILSENAEVRVQLPHDTVKFDRTSRELLHILPRPRSSGNLPELHVSFFLEDEKLKATL
                     ERLLSQLSAVQRALTSYLDTQRSRFPRFFFAGDDDLLEIMGNSKNPLFLNKHLKKMFT
                     ALASLQLDGNVKDATTRLCGFSSAEGEELSFQPGPIAYRQRPIHEWLGEAEQGMVHTL
                     REATLRAYNELVSTKDASPYALLWSMDWMRQKPTQVVCLALQLLWTREQESLLTGAHG
                     GGAGATDARRTSQASSSTLSVVTSSMDDLLTRLAGNVLGNAVAPSSRRQCEQLITVAV
                     YQRDVSRTLAARKVASRDDFNWLSVLRLYVVPIHHQQQHGGKSMSSLSNIGLARGTNV
                     SGLVLSEYRSAETLECRMADASVLHGFEYIGAYERLVQTPLTDKCYLTLMQSLHTRLG
                     GSPVGPAGTGKTETVKALGMQLGRHVLVFNCDDTFDYQAVSRIFLGLCQVGAWGCFDE
                     FNRLEERILSALSLQIQVIQHSLRAWQREVQLNHRAVPLHSNVAIFITMNPGYAGRSK
                     LPGNLKQLFRTVTMTIPDRETIAEVMLFAQGFTTAEALSQKVVPLFRLCEEQFTRQAH
                     YDFGLRALKSVLVAAGDRKRQVAAASRGSPGGHNAAGGAGADTVQETERTLLLESIIA
                     TVAPKLVAQDAALFYPLLHDFFPGCSLPALPMDELREAVECVCAESGLSPAAGWMEKV
                     LQFYHTKMTRHGVMIVGPSGTGKTTAWKVLMAAMVRLQRALHMHAYVLSPKVLSKGEL
                     FGTLDVTTREWRDGVFTSILRKIIDAEEQQQIPADLALAGDDDTGHQVVAAQSVGVDN
                     KKRASLKQNVICDGDASAPGAQSSEARKEHWIIFDGDVDPEWVENLNSVLDDNRLLTL
                     PNGERLPLPRSVRIIFEVQDLLYATPATVSRCGMLWLSEGVVPLSGVLAHTYHQLQEH
                     PIVDARGRHLHWGTDHMIGVTGVRSAFYTECLVTGEYGKVYHELVLSSARTSVEEVMA
                     GSLPRHHGRTSSGDEDITALATPKRSSHLCKDATPQSDKAAELDMGDTLYGTTGHGSH
                     AIFTSTSGGGAASTLRRSHPDAERIQELMVSSWAAAFEKDGAVVRGLQLMKSAAFRDV
                     CVMVPSDQQCIQSMVAFLVQGVWRTFETEQQSNGDVFSDAVVKKIAMQVLSYAIFWGL
                     ASAMSLENRMKLAQQLGLRPTVDGVAQSMLEVEVCYRTGEWRLIRNRVKEISLLAEQV
                     GANDTVITTVDTCRHEDVLSAWLGAGRSAILCGPPGSGKTMSITAVLSSLPEYEVVFL
                     NFSSGTTVKTIVKALEQHCRVQDTARGLVMAPTSGKQLLLFCDEVNLPALDRYGTQVV
                     VQLLRQLIERNGFYRARDNTWITVEDVQVVGACNPPTDPGRVSLSARFLRWAPVLLVD
                     FPSPESLKTIYTTYCRAILAWNERLSGQVATRLAQAMVKMYRVSQAKFTPIQQPHYLY
                     SPRELSRWSRALYEGILTWDDAVRRQLNVSQLVRLAVHEGLRVFADRLVTAEERAWTD
                     TAIVEAFREFFTDVDDHAFHQPLLYSTLLSRSYTDSPREELRAYVQKKLAAFNEEESL
                     GNLVIYDAMIDHVVRIDRVLRQPLGHLLIAGSSGVGKTALTKLVAWMRGFSTFTLMLH
                     RGYDLDDFEHDLRGVLRRAGCKRERICFLFDESNILQPSFLEYMNALLASGEVPGLFD
                     GDEWSKLMQEVRDAVLASQSYYATSRSAGGAGAAGRAGGSAGGGGEAGRDRDSSALRG
                     GGCKGLDGNDNGNGVTGSQRASVVTGVGVAASAAGDDLVDVHNEAELYHWFLRNVHEY
                     LHVVLTINPSSGEFTSRTVASPALVNRCTIDWFGDWDTTTLQQVCQERIRHLALLPAC
                     HGVFAIEVEAKEAVVESLCAIHVATQHINQALRVRYANQGTFVTPRHFTDCVSHFVTI
                     FQEKRKVSSDALVHLHSGLKKLELTAQEVAAQRATLQDNEAEIEASSRRAQAMLERIV
                     SETDVAKREKAAAQDLERQLQDEHAQISEDAQRLSIELAEAEPALREADAALSTVKPE
                     YLREIRAYAMPPPMVKRTLEAVGALMGEKNCEDWDSLKNCIRRDDFLASVRNFRPDDI
                     TEPARERVRGMMRDSKFTVEAAYRASKAAGPLMQWVFFQVKYSAIYQRVAPVRSKIEK
                     LIKARDVKLKGLEVAQEEVREKENSLQQLMGEYQNATAQIAELKQRITAISAKCNRAQ
                     TVLQQLLDERDRWEKEVHSFDSEARTTLGDCVMSAVFLAYTGFYDEHTRERVLMPRWL
                     ACLQRATIPVRKGLSVTEYLSPATQQLAWEEAGLPKDRLNIDNAVIMHRCQRYVLLID
                     PTDVAAHFVLRYYGAQKITKTSFSRPGYVKQLEMAVRFGYPILMEDAEHLDPAVVPLL
                     NGEVRCHGTRHITRIGPHEVDLAPSFHLFLHTRNPNFQSPPDLAGQVCMVNFTVTLSS
                     LQSQCLHYTLLHERPDVDAKRSNLLKAQGEYQLRLRVLEDKLLTRIAEAEGSLLDNNA
                     LIESLTELKEEATCIAGDIADSENSMREIRSVEDMYRPIATVVAQAHFALQRFEELSP
                     YYCYNVRFVLRVLDDALRALPATSTPAADGGLRLQQLTYGIFVLLHRRVVRGMFHEDH
                     LVWALRLAQLRSAMSATGAKSASSAPTAASMVVLPTDSTGGSAVMPEEWEWILSCLRL
                     AGSGVGAAGAGAGLPSTAASRTMTTDSSEDGGASSPITAATTATSLPPVVRQACPALG
                     LQSCQALAFLLTKPAFNEVRETLTTRAPAWEAVLTSATPVATSESALPPECFPRGASR
                     VRRFLLLALILLNTRRDAFIEAVRQLLASYFSPKEMGTAAAAGTDAAAALFTDDLFAP
                     QTNDLADGIMAELSAATPLLMVADTMFDPALRVEELAQRTCTNLSVVAMGSMESIENA
                     DAYLAEATKSGGWVLLKNVHLARGYMDKLEKQLHFQRSEGQLHKEFRLFLTAERDRSA
                     AKPSTTATAAAASSKVLPINLIEASVVVVYEAPPGMQSSLLQTYGEYPVVGAAAFDGT
                     DASSVAPSAGAAAASNNTSLQRLYLAAAWLHSVITERILYKPLGWSEAYEYTEVEYQR
                     VVQAVQAWSSAAPAPAAATASSSNASALKVSWDALRTIVATTVYGGKVSNVFDQHILN
                     VFCRRLLRPEMLQDAAQFVSEAAAAGAPPPPIRGRSRAELLQWIHALPGGSSHPAWLA
                     LPIGADRMTRARSAIEVVERLSLVQSTLDDELTFAEIDSDAQAAASGALRATRWAAKV
                     QSYCTAWYPILRDALGKLEKHPFVLQAVALHKQETVERASAADVGAAKESGVNRSGAS
                     HSGGVSAPLVLAMQREVVAAVELVRHLLTCVRELREVAMEERTPSSVHRGLVEELMKD
                     HVPDVWAAHLRGVHGSAAHSLFVGLWIADVQQRVEHLLELATAAHGGQLAKTPVRLGA
                     LFSPGAFLTAFKQHCARAEQVPLEQLVPQVEVDAATGASAGRAPRTTSSALSTTGIPG
                     APATSAASLAPLRENEVVFTGLTLHSAQVGVAGKCTLRGATTSGAAPALSSAVVLRWR
                     WVRSTDSVATTTALTARLERQTDQQQSILLPFYTTENREALLEVLELPKAPNSGITSG
                     DGDAGVHAWYERGVCVTAWSASE"
     gene            <477835..>479226
                     /locus_tag="LMJF_22_1120"
                     /db_xref="GeneID:5651871"
     mRNA            <477835..>479226
                     /locus_tag="LMJF_22_1120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683211.1"
                     /db_xref="GeneID:5651871"
     CDS             477835..479226
                     /locus_tag="LMJF_22_1120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683263.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651871"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="UniProtKB/TrEMBL:Q4QBN5"
                     /translation="MSSAFAIQHSHIASQPVQAPPPGYMILTVVGSGVSTGVPVIGHL
                     GRGCACEHAVADPSGPNCRNNISLLITLPRRDLPDLPVARTESATTAADTKDAENDGG
                     TSSSSGAAGAVSTTALRPSHSCFAAEHASNYIGPKPVAHILIDCGKTFRDAYFKVMIR
                     CSIRTVDTLLLTHGHADAVAGLDDLRDLQTMHMVSTGDWVIDSFVPTYLSPSTLKTLE
                     KSVDYIIRNSVKSGHAMSTPSEHAAQLAERLQQREAQVMANGTAHKEGGWRNIGIRRS
                     TALDLFCMDEERPLRMHLPITATAATAGGTDAASDLPFYSFPVEHGKGYISMAWVFGR
                     GTAFKSRQTQQQQQGSCVVYISDVSHIPATSMAFLQDLVKIDVLFVDCLSPSGRVSPV
                     HYCEDDMMALVVALKPRHVFGVGMHCALEHFKWMAELQNALDSHVAAGRLQAGEVQCV
                     ELSYDGMQVLLPQ"
     gene            <479784..>481064
                     /locus_tag="LMJF_22_1130"
                     /db_xref="GeneID:5651872"
     mRNA            <479784..>481064
                     /locus_tag="LMJF_22_1130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683212.1"
                     /db_xref="GeneID:5651872"
     CDS             479784..481064
                     /locus_tag="LMJF_22_1130"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683264.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651872"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="UniProtKB/TrEMBL:Q4QBN4"
                     /translation="MTVLRRMRLTFVGTGVSSAVPVIGHLTTDCACRDAIANPSGPNR
                     RNNVSLLISLPFAEGKSGVEWHHVLIDCGKTFRSAYMRVLAPMRVQYVDALLITHGHA
                     DAMHCVEELCGMQAEAAARYAQSVSPSSLPSSAGRTLASAVVPRTLRRVPTFLTAPTL
                     DQIAMVSPELVTQSFHIGAAPTTGTAYHSALAATADMTARSSSSAEVLSTVMDIFYMD
                     DTKPQRMHVPFGPLSLAASAARGVNATDAASDLPFYSFPVEHGKGYISMAWVFGRGTA
                     FKSRQTQQQQQGSCVVYISDVSHIPATSMAFLQDLVKIDVLVLDLLAEHGAPSASHYC
                     ADEAIPLVVALAPRRTYFVGMFCSLEHHRTNEAFARELAELKMRYRDELEVVVPGSSA
                     PAVTDTDREKKLAFVNRVCSMELAYDGQELDMDA"
     gene            <481840..>483141
                     /locus_tag="LMJF_22_1140"
                     /db_xref="GeneID:5651873"
     mRNA            <481840..>483141
                     /locus_tag="LMJF_22_1140"
                     /product="putative adaptor complex AP-1 medium subunit"
                     /transcript_id="XM_001683213.1"
                     /db_xref="GeneID:5651873"
     CDS             481840..483141
                     /locus_tag="LMJF_22_1140"
                     /codon_start=1
                     /product="putative adaptor complex AP-1 medium subunit"
                     /protein_id="XP_001683265.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651873"
                     /db_xref="GOA:Q4QBN3"
                     /db_xref="InterPro:IPR001392"
                     /db_xref="InterPro:IPR008968"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="UniProtKB/TrEMBL:Q4QBN3"
                     /translation="MASVLYILDSKGSPLIYRSYRGDVSQDVPSVFQQRVIDEEESRI
                     TPVFEEQGHTYTFVRENDVYLLMVSTINACSLQQVAFLRRCVSVFNAYFKTVTQETVR
                     DNFVIIYELLDEMCDFGFPQFTEEKALREHILQSTFLTRILGNKTTLAQSELPAAVTG
                     AAGSTPWRLPRNYKYSNNQVFLDVIEQVDMLASQAGETLSSEIVGTVKMQSRLSGMPT
                     CTVGVNDKILFDRTGRSGSTVEMEDITFHQCVKLNQFESERVISFVPPDGEFTLLSYR
                     LNERIQQPVKVSCIFTRHGTTRVKVQCTLQTKYRASLTANEMEVYIPIPSDADCPQSN
                     SQTGHLQYAPQMNALIWNLGKIAGNRHCSCSAEFHLPSIRSSDMKDLSKMPVKVRFVI
                     PYFAASGFQVRYVKVSEKSNYVATPWVRYVTQSGVYEIRTD"
     gene            <484333..>487503
                     /locus_tag="LMJF_22_1150"
                     /db_xref="GeneID:5651874"
     mRNA            <484333..>487503
                     /locus_tag="LMJF_22_1150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683214.1"
                     /db_xref="GeneID:5651874"
     CDS             484333..487503
                     /locus_tag="LMJF_22_1150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683266.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651874"
                     /db_xref="GOA:Q4QBN2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4QBN2"
                     /translation="MTTNMAVSAPVMPPAAAREHRPVRAARATASTTSSAGRRARSAR
                     SVHFALEPVARDVQKHMERQLWHWLEKTHSMLRPLEASARGQVQVMERATAAATATTA
                     DTAAPPVVVKAVAVTLPPYSEHAHDTSEDEDISWSRAQLVPNVSLALWEQRRRQLRHV
                     AGVVDVYTLASMLRDTREGSPRKRHGSSGGAVRFCASFLGSSCDTTASGRVPVPVLDA
                     DEIREQGWALDVVVKQPTQQQYHQSGSRGRCSSGASPLPHPTVFLFARDYIDHAEVLW
                     NLVQERWGRERLPVTVMPTWVNTAAVFGSDDPQVEAAAASALTDDALEKLRRHIGRWL
                     KGASAADKAKKRVASQAAALAIDTYGAAVAAAIASDEQALTAHDAADITWGVCTALAR
                     LHRAGLAHGNLKPNNVLIAQSVDGRSAAQAEQAPREVHVTDHLLPLLPDQLVDPGELL
                     KLPWAAAVTAGGAPAEPKKSRPVTMSGYVCLKQHEEAASMSYLCGGGLPDAVAVPAFS
                     LSGFLLGNAVSGNDDAAVLEGGVDCLSNAAYEAVLLQHLTAPERVLLVAVDSSTANTG
                     VRKDAAEVGAALSTGGTHFRVWVDTQHATPASDIYALGVLLYMMLIGRLPPLPRYRRV
                     SRGTSSPAAVGARPQRMYEAVVNDVVCALYESAARHSFKCDPSPMMDELKAFLQSEAA
                     REHLPLVLALARAGVRPTTMDILVGMLHVNPAKRLSLAQLQHHAFFRTYGRRRHTLRA
                     EFAEAARRVQHAAPVTRKDPLGQSVVAAVRRRMMPQNMGATAKAAAERPRSPPPPSAG
                     RLGTVAPRVPSMACTPSRISERGTPDPVLSPASPNAAAAERSASMASAGSAGEEAPRP
                     ISRSPPPQLLRAPHAMYLPYKRRETTISPPSPSPTLPAQEGEQHQSKEPSCSLLHSRT
                     LQLSAPSYMGRTHYDLPRRRASIQDDMDRPLDQSCRSVITAVSSRSVGAVLTPHAVRR
                     LSPLGREASVLSQTSLDATPAARLGKAGSTLHAPRRPVMRRQSAWMMPHRSSVYVVSL
                     ALLFVVRLRRRRERTWLLGRIRRCHR"
     gene            <488571..>489932
                     /locus_tag="LMJF_22_1160"
                     /db_xref="GeneID:5651875"
     mRNA            <488571..>489932
                     /locus_tag="LMJF_22_1160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683215.1"
                     /db_xref="GeneID:5651875"
     CDS             488571..489932
                     /locus_tag="LMJF_22_1160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683267.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651875"
                     /db_xref="UniProtKB/TrEMBL:Q4QBN1"
                     /translation="MSSQSGAAAATKALVRCTRRIRDPLNYLVMQPTDPDQVTTSIRT
                     ADAAMVTWFVPLHNLQYCLHKRYEAEQFGVMIVPKGVAVPEAKPLTPTEDSVKAAAAR
                     RGPSVVPRFMRMTAPRPSGAADADAGAAGSSPASSPSRLSSSPSLSEGGNQLNNYVNE
                     DGDTVVPLGLVTMIVGNNIPAKQSWVERLIDPAPHPTLSMRVMVVDRIHWQRTSWLAG
                     SICSSLCWGRLPQRIFSINLDYKNPVYISGGNAAAAATAAAKESAPLFSKHARQPLVF
                     DKVAQRYTSPFQIDVPGLNFRLKIEDTGKTLFDTTSRVVDGFLDNESALHRLALSREV
                     NMLGLGGSVYRQTLWSSPSLPNVGRVVECEFGSLFERYFGCSPVGDPVATWLVDAVDK
                     TLIYQMEGEVEDENDPNSATTYGDRSLTERVQKKAMNRYNNFRDDIRHKTYSELAGDE
                     VPR"
     gene            <490909..>493725
                     /locus_tag="LMJF_22_1170"
                     /db_xref="GeneID:5651876"
     mRNA            <490909..>493725
                     /locus_tag="LMJF_22_1170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683216.1"
                     /db_xref="GeneID:5651876"
     CDS             490909..493725
                     /locus_tag="LMJF_22_1170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683268.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651876"
                     /db_xref="GOA:Q4QBN0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4QBN0"
                     /translation="MHASTAGGTAHRQVIGNYELGRVLATGDFDCRTRLCRHITTGVR
                     YVVRVYDKRVLAEAQWMWNRVAESIRVQRTLPKNKYVLEMVECFESNTSVYMLMRLFP
                     SMNITKLFTDAAARAKLLSCLQAMPQAPAHSSAAATSTGSPTTEPEKTAEGTPHRKLS
                     RLRALPAIDPTTPITPQVTSSITPSATSALKSVSSRGLKTNMRTPSASAAESQSSGHG
                     TEEAADANEFFLRGRGKQESTPSTAASTMAIASVNAFLGTAVPSHVPLSLIRDLFEQA
                     VKGVSHLHQYNVVHTGIAPDHLLVGTNGLLRISNMVSCCFCAQGERLHELRGTRHTVA
                     PEVLRGESYDPYLADAWALGVVLYFMLNRGRYPHDGASTLRHILHGRVRPSRPGLPSV
                     ALDLVSRLLQGSPEERLPVDAILTHPFFSAPFPTIAEEAAAEAAELQAQHVRHRLTTG
                     AAAHGGHSVVSYRDDGNGRRLRSNETAVDAGRRKASSPRWESLMTFESGDNITGRDEV
                     DSSGLDPQHDDGDASAEDGSRRSCRDTVCPPRVGLPTHQPSAAPRSPSASVKRAHLAA
                     SSLAKTRPCQSVAGSVSASPRPVWCPQLAPTLDALEDLAGRVIQYHYRQMKHRQRYRA
                     ETRTLVEHSQSMRRAKVEEEGIGGRQQSLLGLVPAVAVVSRPLSLDLVSSSAGTATPK
                     QDEVLHRQRQRQQQPSDLYLKRKPVMAVNVLDAAAGSQSPSSVRRRAATNNSVATGGH
                     LEDEPLSHWHKPGTASPASTIQSVLLTGASSAVIGIRSGSPGSLDRDDDGTESSLISS
                     LDGALRANVAEDTNVVASLDTIPQESLKLPVPLPLNQRRPGNGVRACSTPANSVFIAP
                     PPVRPSSNSSALPTLASLHGLGGSFGRSADCARVGEGMMVKDDERCPLCHREPYMTRA
                     IGVRPYGGTSYVYANGKFTKVLSE"
     gene            <494614..>496353
                     /locus_tag="LMJF_22_1180"
                     /db_xref="GeneID:5651877"
     mRNA            <494614..>496353
                     /locus_tag="LMJF_22_1180"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683217.1"
                     /db_xref="GeneID:5651877"
     CDS             494614..496353
                     /locus_tag="LMJF_22_1180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683269.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651877"
                     /db_xref="UniProtKB/TrEMBL:Q4QBM9"
                     /translation="MRSVCRYPALFLSLFLTLTVVLVPLRSCTLCTQRVHSKPAKECI
                     LERTHTRTCTCRHRGRRKALIHRYNLYIRRGELVGSADAHMALSYHVVLSLFLLSSFA
                     DVVLISARTLVSRRYHSLTLCYALMAVQESLLVFELLAVLGQVLSTYLVTASMWAHIA
                     SLLGVFTPLWLLRTFLTAFTVVYKDILLPRWSSAAASTGVWGFLSRASRAWRATGYGA
                     VVSLDVACFCCYYLSAVYVLAYLSEKRLYVPYHRRRWRHLQRRRALTATAATVVAGEE
                     NREAARQKRWREERQGGARRAGGDGGGKVVVSYPTVQPLTRTPSFRQWEAVLRQRQPE
                     TGHGKNSTAGDGLAPLRACEGGSPGDKSLSNTTGAAWTNANALQLPSYPAARARRGEE
                     ASDSGADASGLISNTVTAVPDGSTQPPSAAHLSSPEAATAAATVTETPAAKPQRAVQQ
                     HHRKPAAQAPRGAVTATATAGAGSPGQPRPVSLVANLPPLQLQRRFTISNSPEEERRL
                     HQFATALAEHGYTSVPSQTRKLTPDLPSSKSHVKMKDGVAAKSGTSSTTEMPTAHEGG
                     EADKEPDPGNLLS"
     gene            <497041..>497754
                     /locus_tag="LMJF_22_1190"
                     /db_xref="GeneID:5651878"
     mRNA            <497041..>497754
                     /locus_tag="LMJF_22_1190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683218.1"
                     /db_xref="GeneID:5651878"
     CDS             497041..497754
                     /locus_tag="LMJF_22_1190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683270.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651878"
                     /db_xref="InterPro:IPR006840"
                     /db_xref="InterPro:IPR013024"
                     /db_xref="UniProtKB/TrEMBL:Q4QBM8"
                     /translation="MSSSSELVTRATHYHEQFGLPSFDDRVFVVFGYGSILWKQNFEF
                     DAEYEAYIKGYKRVFYQGSRDHRGVPDKPGRVVTLLPSEDKEQRVYGKAYQLPADPEK
                     LNRIFQALDVREKGGYERLFVTIYDAHPSFATDGEDRPLRLADKGTGTPGKAMVCLCY
                     NATEDNADYLGPATMEAMARQILSSTGLSGPNREYLYNLDRALRDMGAADPHVFELAA
                     LARQLEVECPAVICSEKKI"
     gene            <498679..>499650
                     /locus_tag="LMJF_22_1200"
                     /db_xref="GeneID:5651879"
     mRNA            <498679..>499650
                     /locus_tag="LMJF_22_1200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683219.1"
                     /db_xref="GeneID:5651879"
     CDS             498679..499650
                     /locus_tag="LMJF_22_1200"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683271.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651879"
                     /db_xref="InterPro:IPR006840"
                     /db_xref="InterPro:IPR013024"
                     /db_xref="UniProtKB/TrEMBL:Q4QBM7"
                     /translation="MPKTDTDVSAHHHYGTHQPPTGGSTPASHVAASLPKLLPAQPEL
                     PHQHSTETASTRYHEQFGLPSFDDHVFVVFGYGSILWKQNFEFDAEYEAYIKGYKRVF
                     YQGSRHHRGVPDKPGRVVTLLPSEDKEQRVYGKAYQLPADPEKLNRIFQALDVREGGY
                     DRVQLTLFNAHPTTGNLTTTPMLPAPMSKSFKIESSTQYVPPPRQNSSDVEAGVAEKV
                     LDIFSHPNAPAVQPRKNVVYLCYIATEQNEGYVGEASMEEMAAEILSCAGVSGSNREY
                     LFFLADCLRAMGATDPHVFELDAVAKRILRGREAEFAAGAKRVATMA"
     gene            <502165..>507216
                     /locus_tag="LMJF_22_1210"
                     /db_xref="GeneID:5651880"
     mRNA            <502165..>507216
                     /locus_tag="LMJF_22_1210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683220.1"
                     /db_xref="GeneID:5651880"
     CDS             502165..507216
                     /locus_tag="LMJF_22_1210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683272.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651880"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4QBM6"
                     /translation="MHRAALIPCLLSLAFLPVRAHRDLFFFYRRVCRYECTFLRPPEH
                     CNPPPPRQLRPLLILCAVDCFNVLPFPLLPFSRACSAAHTHTRTHPDLIVKMHYGIPS
                     AATPPQQLPSPTEAARARAFRAEARLRTVLRQVSALRCAQQQGGGDHVSQHRDPVAVA
                     AEATSELPPTSSSPPVHRNDAPTAAAAAASSSPPRPLVLELPLAPLEQRVKQKKARDA
                     TRQQRRDARQAAAAAAAPTTTTSATAADMVRNALSQPLGVVAARFLSAAASGAPSIFP
                     GVAITSTSAADGHMSDWLASTPPPPAAQMSHAAPSTTITSGPCPGIPPHRAGSDKHIA
                     PPSPASSMPKIPYQSPPPRERGQRCRCRHSRHSRDSADDSPSPLALLLQTPPSASGSQ
                     GSPHRYQPSLHHPEQEDRHRHHHWWRCGAREAVSSAPAPAGSATINAMSKHKQVRSSL
                     RHQGSTPTAKTSNPVGVFGNSSISFLARTLREAGTAALAASPLTRSEMRHTPAADHRH
                     AGHYRASRLRETLERSSEGVNVSIAASSPTRARLPASPGPSRSGSGSHAADGCLPHSS
                     CNSSCVCSKSGCDSWRGSEVSWSASSSRTSFVRGVRSPPSEPFTPLTIPRDGRYDPHA
                     PLLPLMECYGDTPTREVFCRVPSTSTQHTAGRSSTPMSSEWSRESSSAAQSAVGAAEA
                     APVAGLCALDAPEEAVKRQREQQLESQHRRRSMLSSTTNTQLSYMAEMDAIERGVVAP
                     YVSYLFSPEARVIDLRQLKGRVSLCDPAPALEATCLGFSRAADEYLVGTSSGLLWRVP
                     AGGGAEATRATPLGSLWPPHTPTRANPTAAAASGTIAGAGGDAPGGGLSKLLPVPLPG
                     HTAAILSIAFNDDGALFATTGMDGCVIVWNASTSAKLRRISAVWASSTSAAASTSMYA
                     GVDDAAGRRAPHLVHFMPQNNNYLLVSYLGSSELHLYNSSTGLPVTNVAGAALARAAA
                     STVKDHHKSAVGPHGSGRASAGSAASSGAITALAVDPVASPFFFSGDASGTVVMWTYR
                     AGDVVAMATLRPTTAASSSTALAGSGAGKHARTPSYVVDPLLHGTHGTVGSSGDGTAA
                     FSTPLYQLPELRRVTTLALPEQMSGIAALGVSTLHVSQLHSLFRRCGPRRGAASAQRT
                     SDGGAVGPRPAPRHPFESTAEVFRAVAQQNRAFWAAALPGAAAADGVARNQRDSHGRS
                     GAHPQAALHGGPAASTAVAATSGDKSSLPQVLARWPSRLSETFSALWGGGDGAPSSAA
                     HSGLAPARHKGKLATAAAKGSMATASTAGAAAPVTALSEGDLLHQLRNDALDAVCPLL
                     VLVTLPCDTIYALGVLLQLQPSGRRGSAGGRGGVVGAGTPEASYCLYPLLKTTSPSRL
                     RHLGVGAVQSPDNPRLIVVATPCEEGFVRVEPLLHVATPSPSVQRTPPAGVSAIPTPG
                     VGSLQPGNKAAVNDDGRHRSHSRVLATLPMPYGGRCTGVAWSPNGRFLVAITAEGVIY
                     QWARVYLLGPSSPSANAAAAAAAITRKGDVAQVGGRDGVTPAHGMPPAEGEVEVRSSP
                     AVGAASAAAARRRGCATERSDTVNGEALPAAHFTGLLGAPMASAAASPPGLAAGANAA
                     ARAAFSEEDAWRESLHRELERQRRAQAALKLVAHVRAGRQDGAVSSSGYWLDDDDAAN
                     SAVTEDSLEGDETES"
     gene            <507673..>508164
                     /locus_tag="LMJF_22_1220"
                     /db_xref="GeneID:5651881"
     mRNA            <507673..>508164
                     /locus_tag="LMJF_22_1220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683221.1"
                     /db_xref="GeneID:5651881"
     CDS             507673..508164
                     /locus_tag="LMJF_22_1220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683273.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651881"
                     /db_xref="UniProtKB/TrEMBL:Q4QBM5"
                     /translation="MLRQTAARLNTYLTRSVATPPISVIRTGPKWWAEPERMVKHKVM
                     YFTMGIDQLPLRRTAVIQKDLKRFHMCKPPPRVGDATGYKRSRGAQLTTWYRRIQYQE
                     YHLQHLFVRHMWGLLRMYPGNTTKIQGKADDGYVGYDSVHFHRYNRSPLPFPAREIYE
                     RRK"
     gene            complement(<509102..>511900)
                     /locus_tag="LMJF_22_1230"
                     /db_xref="GeneID:5651882"
     mRNA            complement(<509102..>511900)
                     /locus_tag="LMJF_22_1230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683222.1"
                     /db_xref="GeneID:5651882"
     CDS             complement(509102..511900)
                     /locus_tag="LMJF_22_1230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683274.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651882"
                     /db_xref="UniProtKB/TrEMBL:Q4QBM4"
                     /translation="MGAPESVATAAPLLNPSIHSSDSSRRPPRTTTVVTPLRVFQCIC
                     TRPHRDGVSRTALSCFHAQQRCCATIATTTDGDSAGPSATSAEEFEKVFFDYPVAERL
                     AALTVARHEVGHCTESTAATGMSATSTSWLYMPIKDFVKKMSPLTREDMFRRQLDALE
                     WITESKLLQLVNEGGEAIRLESLRAYPTAAGPASQSKDAHPALYNGLVHVRTTVPAAW
                     LLQAGGGAGSVPEVKRPCSQLTHSTPSGCGVAGAASAVTEPPFTPDESHDGKDAAAAL
                     STAERETIIREALLWALRDWDAAMQQRRERAASATSDPAPNLPRYTHLITVYNAILRE
                     AAVTTSASGEGAGVEVAPNLLTPTARYILKRLRMSTLESIVDNIGVVVTIGNTASASA
                     QAPNGYPAMSSRPIWVVRGTARNPVTFVALRYSTDASPPRFRDVQPRVTVATRANNYG
                     GWGSASVVPTKADVYEILKYVPVNWGSISNLNLPPEVKKRHIRTSSTLVWFRRQPFYF
                     EVRDMNGTVELRRSIVLHPEVHGMTREEAWEVLELQMATGEANSLVPLGVDGAPLRPT
                     ERVFDRSVTKFVYRVCPTYFAPLSLTMQRYVKKNLTEPMLMTFVRRFPQDFEVFTSRY
                     SDIPLVRRRAGADSARWMSDFVADLERYPEDVRAILILCNAICAAWDRPEYVYVRLSP
                     TEQEVVGGYAGMQVVLSRHPAIFRVGRHFVCRADPSNPLAQREAEPAVDDVTTISPIH
                     EENPYHSPKELALVFHYVMPEDEACTAAYLVDCSSPAMRAVLPPRLVTIVQLFPKMFA
                     CTETSPGVYSIRKVKQPVRRAARGAAGAARDGRSTGNDAPALEDSCHSAEKDTIQMLE
                     DELADEDHMTREEVVQAVRMLIPESGVEVPQLLLWASMSVQRAANEYFGGLLRLVEAH
                     PGQFRVTTNEHTKKVYKK"
     gene            complement(<513265..>515592)
                     /locus_tag="LMJF_22_1240"
                     /db_xref="GeneID:5651883"
     mRNA            complement(<513265..>515592)
                     /locus_tag="LMJF_22_1240"
                     /product="putative translation initiation factor IF-2"
                     /transcript_id="XM_001683223.1"
                     /db_xref="GeneID:5651883"
     CDS             complement(513265..515592)
                     /locus_tag="LMJF_22_1240"
                     /codon_start=1
                     /product="putative translation initiation factor IF-2"
                     /protein_id="XP_001683275.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651883"
                     /db_xref="GOA:Q4QBM3"
                     /db_xref="InterPro:IPR000178"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR015760"
                     /db_xref="InterPro:IPR023115"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QBM3"
                     /translation="MASAAMATSALRTARRYQSQSSRVRPSLQWQDGQVDPRFSSEGN
                     MRRLNPETMPHFVKATIQKDRREMGLGEVFDWVEFAKDAIYIPTRSGPLWVGSDDPRA
                     SKFVRRREKMKRQPLQRTRQKPGTDQAKALEDHPLREYFTTPSNLHDPMSVATGLHRA
                     GMIREYDIKHTASKIEYLPRSPIVSIMGHVDHGKTTLLDHLRHTNVAAGEAGGITQNV
                     GAFQVKTPDGHIITFIDTPGHAAFTAMREVGATTNDLIVLIVSAVDGVQPQTREVIEL
                     AQRKGTPMVVAVTKIDRQPDCDYVKDQLAANGVDLEEKGGDVQLVKICAKDGRGIPEL
                     LEALHLQAELCEVATPTPSRAEMYVLESRNLGVSEVAAVVRCGTVKPGQVFVTGTVYG
                     TVKRILDDHGATLDEARPSMPVVLHGFRVPPKPGSVMMQVSSEKHAEKFSYFMREVYT
                     VEGNRENYLQILNQERQGLIHGRKPDNNIVRAYSTQAFILSCKAATFGMLQALLKTIY
                     ELPRLEGVSLDIRITEVGGLKDSDLILTGSSGQPGCVLLFGDCKDSFSLDVPANVRVL
                     RFNVLYHGIDELKQVLVDSLPKVKKTRILATAECLQTFKASQAGRTGNAGGMKVTRGT
                     LDAAHLTFRVLRRPQDLKARLAAAASGTKMSPFGGGAAAAADDEAREVVYEGQLKELR
                     RFKDLVPTVETGLECGVVLHDDFSFRVGDVLEQVEEYEENRDVDEEYEAAERREKILR
                     ETAEMQTRMEEAERKAAEEAAGSTELHEKLKAVTD"
     gene            complement(<517754..>519112)
                     /locus_tag="LMJF_22_1250"
                     /db_xref="GeneID:5651884"
     mRNA            complement(<517754..>519112)
                     /locus_tag="LMJF_22_1250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683224.1"
                     /db_xref="GeneID:5651884"
     CDS             complement(517754..519112)
                     /locus_tag="LMJF_22_1250"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683276.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651884"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q4QBM2"
                     /translation="MFTQISNAHTEVVTSLVFSPHVVTTCEGGLLCSTSGDDTTALWD
                     LRAGPGVSQRAAHLTGHHVGPVNHALFHPSNAHTLLTASDDRSIGCWDLRRPDRVVGA
                     VSGFQEGVNKMLWLPVTSDGCRGTGGSSSGGGGSVVSACDDGHVYVHALALPDSGSES
                     ATVAGAAPVPQVGALVDKFRVSTSTVNDIVLAPNSTSILITASEDCALRSWSLRHAQQ
                     MTNTSVGLMEDRLLATLDEFENPVNHVVVVPSGLMAPVESRAAGEDPESSSSRSPAGA
                     AGDAEESADAAAASTGFPRAYQQVHGGDDVEDAEVGSDAGSSAGARQPRRATDISEAA
                     GTACWLLAACSECVFGVDFALRVGEFGTGARAFVGHQDYVRGLEFTSEGKLLTVSDDS
                     TAIEWDLATTDPIRQVKLHEGLVMSSAVSPSRNLLATGTDRGELRVWRLPFATERIGG
                     SP"
     gene            complement(<520244..>523507)
                     /locus_tag="LMJF_22_1260"
                     /db_xref="GeneID:5651885"
     mRNA            complement(<520244..>523507)
                     /locus_tag="LMJF_22_1260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683225.2"
                     /db_xref="GeneID:5651885"
     CDS             complement(520244..523507)
                     /locus_tag="LMJF_22_1260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683277.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651885"
                     /db_xref="UniProtKB/TrEMBL:Q4QBM1"
                     /translation="MMSQSLSTYSLVQCVVSAAQFTSGEISFYDTYAELTAADADGNS
                     TSPLRVVYDVLEHFRIVRAQGVMRLTLPRGVVRRWAAQNTFETQLDEYEGEQTGVDDG
                     NGAEAGAVSGQMTTSTVVLLLQLGVEDMAAFMRSIAPLIAASRRTRSVSRISVTEPLP
                     VYGVPLVDPAASVPTDAATSPRAVSTSSASSQEEVAEIDSAGGENSAAPVCGRRHHRR
                     QWQRRGERDTAHCTPSCTGGGGVEERRGCASAKHSEARRTTAAARDAALCSPETVAEL
                     LGDDSDDSPAGVAEAEVHGDAVQTPSGSPASPAGGEEEGGGTANQTPRVAGALAITAT
                     ATTGAAAQVDRRLSSPKHRQSQQATPSRLANTLEGVAEELAELMEEAEQHDHCLGGRG
                     GPLHRRRLTVAAVMTAVRPVGQQQASRCTHRQPLPIVALSAAPSVCPSLKSTISEAHV
                     LSCPHRQQSPSAAAVKLQCEVNGVHAAAAAYGGPVVENRRSTQRPMGMAAHVQGRCSA
                     RVVRNGGGGAHLCASEVTFTAAAELPRLATHDACDDRAATQEGHAMPSPEPEETRDDV
                     SKAAAASGSAICDVRGVRHAGDGWAGPETQWAALCASTATHVFSNAGKEGCRGDACTA
                     PAATPTRKSSRSSSAASSVKLGDMLAVPSAVHEPGSAAEGVIEPSRRTVQFRVDGADA
                     LLLKPSLPYARNSGAADVVAYLRELFPVEDTVPKPMRQRRKVQTAPAAGSVRGLSAFQ
                     RCRRAPARSAVTHTASATGAVASNLVFTGAADKAADGATAPPLPVKAAPSPPLSLPTK
                     LSDKIGAAAATRATTSRRRRSSTVGALGTAKKRAKVSTATAADPSDNSMDAAEDAEKN
                     TEATAGGGACGNGATACLTTPPHPGACSTVSVPRRVTVSVRDADALGLVQAPLPLRSA
                     ASAAKPSAVMTAFAAAAEGEAAAYAAVEEGAAAAALAGDAAKVTGGLIRGPSTEAGSR
                     EVPRDAEHRRGTQLPPSQLVVHEVAPPAECADGTSRHYTAGVAADHCDKNGGRSSISI
                     SSSQATCPLLYCRESRKERSRRVLRYMNLISQSIAAVHETHDALRGLLLLMMEQDQL"
     gene            complement(<525150..>526496)
                     /locus_tag="LMJF_22_1270"
                     /db_xref="GeneID:5651886"
     mRNA            complement(<525150..>526496)
                     /locus_tag="LMJF_22_1270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683226.1"
                     /db_xref="GeneID:5651886"
     CDS             complement(525150..526496)
                     /locus_tag="LMJF_22_1270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683278.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651886"
                     /db_xref="InterPro:IPR003409"
                     /db_xref="UniProtKB/TrEMBL:Q4QBM0"
                     /translation="MLDSQHAHPLLGPPFTSLTVFRPPSFPPNSSDHHISPMEFIQCA
                     YLGQHSTDGRRYDGLGRYTFPNGDVYLGGMQDGQFHGHGVVFFRNPPGSDGGNGGLSA
                     RANPAPPRHLPPPEAGGDRGSVDDVEDHALQAFLNPDQTSTLSTAGAGESPVAVQDFA
                     ALVGSSGGGGGGQYRGVWEHGRHVEGHYVFQDGLVYGSSGTEDMSAYAQRKRGTLWTY
                     CHGSDRRLWQEYLQNVAPVLPHEALLGGARLLHIRKDAVAKKESTSESPATSADGTGE
                     GLPMVLPRAFVHARTAPAFAKGQLTSIDDPRVARWAEAAAAADERKAAFHHQQKQGQA
                     GSPPARSSRRPTMVGGGDGVDASSEAPLELIESAIALQFAMAVPTEGLRADGRLEDTE
                     ADVCGAKDGVVGEDGAAVAALVTAPAAPQPALNLAVCRVLDVEDVNRALVQIVAAP"
     gene            complement(<527765..>528940)
                     /locus_tag="LMJF_22_1280"
                     /db_xref="GeneID:5651887"
     mRNA            complement(<527765..>528940)
                     /locus_tag="LMJF_22_1280"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683227.1"
                     /db_xref="GeneID:5651887"
     CDS             complement(527765..528940)
                     /locus_tag="LMJF_22_1280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683279.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651887"
                     /db_xref="UniProtKB/TrEMBL:Q4QBL9"
                     /translation="MERWCTTHQIRELLDEFVVEFLRAEAASVPVASHPALQGVDASG
                     TPATASAASPSAQVYGELYKRAGGQPYAYHAGELLEKSSPQPTIAALRAFLKGKKDTK
                     AMWQSAHPYIVVLVEGGLTARVPREASASSLSLPPQLQPAEQPPMEASLSSTVPSAQG
                     AAFSAIVAVAAQCVARGIGGLVHSSMAALLPEPDAVARQLHRPLQQQQQKKLLQQLEQ
                     DVASRSGAPVVGTASFAGGGDAAAAAAQSTQEAAYASAAALRTPVVLVGERWPYTIAD
                     GLAVEGLLGSPLAVFSVSMDEKGTTEENSAGNSGCDSSSCGVPSALLQLASRCGSSAH
                     AALLEYYAAKKKLTALTVPASVCRAVAQEASPHNVEPGTAARAAAESLAEQIVRHLR"
     gene            complement(<531615..>532793)
                     /locus_tag="LMJF_22_1290"
                     /db_xref="GeneID:5651888"
     mRNA            complement(<531615..>532793)
                     /locus_tag="LMJF_22_1290"
                     /product="putative ribonucleoside-diphosphate reductase
                     small chain"
                     /transcript_id="XM_001683228.1"
                     /db_xref="GeneID:5651888"
     CDS             complement(531615..532793)
                     /locus_tag="LMJF_22_1290"
                     /codon_start=1
                     /product="putative ribonucleoside-diphosphate reductase
                     small chain"
                     /protein_id="XP_001683280.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651888"
                     /db_xref="GOA:Q4QBL8"
                     /db_xref="InterPro:IPR000358"
                     /db_xref="InterPro:IPR009078"
                     /db_xref="InterPro:IPR012348"
                     /db_xref="UniProtKB/TrEMBL:Q4QBL8"
                     /translation="MSSEPKAMDTCAAPAKRARTEEAETEVARPSGEAAGVSNPSTAE
                     DLVTKPVAAGAEVLPADKVAEGTNAEEEPLQQENPFRYVLFPIQYHDIWRKYKEQESC
                     IWTVEEIDLGNDMKDWATLNDGERHFIKHVLAFFAGSDGIVIENLAQRFMSDVKVPEA
                     RAFYGFQLMMENIHSETYSVLLDTYITDSEEKLRLLHAIQTIPCIQKKAEWAVRWIGS
                     SASFQERLIGFAAVEGIFFSGSFCALFWLKKRGLMPGLTFSNELISRDEGLHTDFACL
                     LYNSHIKHKLPRERVLEIIVDAVNIEREFICDALPVRLIGMNAELMAQYIEFVADRLL
                     VSLGEEKHYHSTQPFEFMEMISLQGKTNFFERKVGEYQKAGVMSTEGTSKKFSLSEDF
                     "
     gene            complement(<534347..>534958)
                     /gene="ATG12"
                     /locus_tag="LMJF_22_1300"
                     /db_xref="GeneID:5651889"
     mRNA            complement(<534347..>534958)
                     /gene="ATG12"
                     /locus_tag="LMJF_22_1300"
                     /product="putative ATG12/APG12"
                     /transcript_id="XM_001683229.1"
                     /db_xref="GeneID:5651889"
     CDS             complement(534347..534958)
                     /gene="ATG12"
                     /locus_tag="LMJF_22_1300"
                     /codon_start=1
                     /product="putative ATG12/APG12"
                     /protein_id="XP_001683281.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651889"
                     /db_xref="GOA:Q4QBL7"
                     /db_xref="InterPro:IPR004241"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4QBL7"
                     /translation="MHAPPQPPPPPRTHYQYMHSFEHRCLLSKKMLRLYGASTVPVIV
                     EPTESHLRLSPSPPSLHGESKSSAGSAGGFGGYARHGQLSSSGRAGAGVTASSLASAF
                     TSPSAKSTLKCILLRSKSVAEVILTLRGRLALDSCQSLFLSVGENDVLVPGNSLLGDL
                     YERYRNADGFLYLGYLLENTFGGDVRSAAGEAASHTVRRPVQR"
     gene            complement(<541003..>544428)
                     /locus_tag="LMJF_22_1310"
                     /db_xref="GeneID:5651890"
     mRNA            complement(<541003..>544428)
                     /locus_tag="LMJF_22_1310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683230.1"
                     /db_xref="GeneID:5651890"
     CDS             complement(541003..544428)
                     /locus_tag="LMJF_22_1310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683282.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651890"
                     /db_xref="UniProtKB/TrEMBL:Q4QBL6"
                     /translation="MVGSISGSSMSHGSCSHTRSAEMVRSRELNASGRTRRACPSAPQ
                     LRRWGQAPFSVDTPIANQNVSLHASASDASARCPSSPNTTSMSPLVRGDAMRRPRAAV
                     VRAPASEGPLEGRSFTNLPASQPESFGPTSHTVDDAHLVNNKSAGTGELSCDAVTHAQ
                     HLASASPVAQMPAEALPGAATVPVEAEARTYHVSEPEAVGRGDDESTRTHIREPWMPS
                     STLRSPAAAVPLQPVAPPPPTPLPVASRSSAPSPSALVLLPQHPREGSNAASREPPSS
                     SSSSQSRLRQVAQATPVRGHSGSQVAEVVQDTSDRSPPIVVCTSSGTPSALIASVSTV
                     AAEEGGRQICEGGARRAASTSGDVVGERDGDLPTVQSNAPLPTRELLDCTNDGRLVTT
                     VADVSAVSPTTRDKRRRRLADAQQSRASVFSSSLPSSPIVSSSCSIARILQLQAQEGW
                     KDGLRAALQQDAEVWVRQVCEEQQLLRAQLSVTQARAAALAKGLQELRDCGSSSASAL
                     QSQSQPADTAGVAVCGAAEESCQERTAAERPCNDEGSGKACLSHLEEASPERPAAQEG
                     GGRGAYTSSAADGDTAAAFCTAYTHELEAYAHLLEQHTHALHAEKYQLQLRLDRRTSQ
                     LASSQQRYLQRYTRLLQEQSVLERDCRKATEDVEQLVGMLVVARAAERAAMRRVQEIE
                     SALGESELRAEALAAALHPQAKENGGGDIEGGTGSVNLISDSIAVGSNGSESLRCPSG
                     YASALPPSSAFASFTEHNETDRSIMLIDALAAASGRPSVERPRVLAWRSMSASSSMYP
                     PLSPSASSLTAESTSWTPVRAQTTAVGREWGGEAEPPWVLSAYSFHAVPLSAEPSPMR
                     TAADVERSGAVGGCSPEVCVAARLAMREAGIPSLPQRAPSQAATAPPALTSLLIADAI
                     ASAGTATVASCRPASSQKLSCEDDSDGVSGVTALTVAPVSVEHAGVQKTSISASTNLT
                     SANTCVCTPLISTITTALTPRTLARQRRHVQNQIRELCGGAAEGGDHSTVDEHQLLQL
                     RCTLLELELQAKETAHKAEKEAWEAAVHNAEGIAGAMGEVEARVKQAVAASEKAEYLL
                     HEMSRLWSHSLALDEDDISDDGGEAAASATRLDVMDEEQIFYPRRSRDETPLY"
     gene            complement(<545645..>551785)
                     /locus_tag="LMJF_22_1320"
                     /db_xref="GeneID:5651891"
     mRNA            complement(<545645..>551785)
                     /locus_tag="LMJF_22_1320"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683231.1"
                     /db_xref="GeneID:5651891"
     CDS             complement(545645..551785)
                     /locus_tag="LMJF_22_1320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683283.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651891"
                     /db_xref="UniProtKB/TrEMBL:Q4QBL5"
                     /translation="MLYAASTTAARRPRLAEPRPMPTATSPSGGTPAGSRGESAPRGA
                     GGPSEPHHRAHRSRPRRSVSPILSRQDVLKAVCDRLEHTAQFIYPGSVVVYEFLNDAQ
                     EWHWALGTVQEVHTHTVTLAEWSCQQGGANDGVMRALKNERSRVQQELEDHQASILAL
                     RAELGAVRTRNEADMNATREAIEARRRELEAREGALLVCRQRGVPLQRTHKDGYGAAD
                     ESDSADDVFLAVLRAALSIVEDYFPSTQLPWPQVWATVSDPLFLHRCIDYDVGYDMSF
                     QQYDEIEAHFFGSGAITEAKVRRAMASMEQRMPDAAEFLCTVANWLFTQLAAFRVYQQ
                     CASTQSHADMLQQRLTHHVNALKATARKLRQVQAQLRVFSGAPDTLSSATRSEVQFTF
                     VPAQGIATDVLRCAIICPVPLHSRRHPGTRVTAAPTATASGESKSPSSMNKGAAVMTA
                     TTSSSGHPSLNLDALSNRDRVGSAAAPSDSARSPHHHREQVRSTPCSPSASIIPVPNA
                     ETEVVLLGHKELEEIAVRAVHSRPELYQAVDDLLQECGHHKRDAHHARALASDRADRC
                     RGRRETAKSHAEGFATATAWDAAPGPTAVSSGPSTSVTLPTSHTSPAAAARNMPTMLS
                     LPGSKDAASQSDDGGGVYEEETDARAFQAALLVLQQQLQEARRENEQLQRMLVRETDR
                     HESVEAELQRQMRDARADHEDARNRLADATIRAEALQVECEDLDRDRDRATRRISALE
                     DEIRALESKLPSAASAVPASPTKTSAKADEGTAEVDNRVAHLEAELAWLRSSRERWMP
                     HSSQHSDPADGVVTTHHHKCLNGSGWNDALQRHPAELRRAAATDAAAVCHVVAAAVTG
                     VHFSDDGSRVEFYVDHPSQVPKPQLDDRIHDTPFYECEYILRHCSSPKTGEDLLAQQL
                     ADNNATIADLETRLAKASSTPAPHQLPPAELAQQENLLHLQKQLRRAAEEIKELNFYD
                     QRRKKSGNGQAVATMHSVRLPGEDWSVVVQEHPEALREAFIADVSHACHVTRGDVEHV
                     AFEMGSLLATVRVQHDADATIMEMDRRLQEYDYPLTMELYRLRQGPKRGADAALATVA
                     HRDTEIADLREQLREAEERARDVEAQQSDRDAEIDRVKELLSSSMREAASSGEMLGAL
                     EEQREEAAREMRGLREQLAVAQVRREALDAEVADLREQLREAEEHARDVEAQQSDRDA
                     EVADLREQLREAEERARDVEAQQSDRDAEVADLREQLREAEEHARDVEAQQSDRDAEV
                     ADLREQLREAEERARDVEAQQSDRDAEVADLREQLREAEEHARDVEAQQSDRDAEVAD
                     LREQLREAEEHARDVEAQQSDRDAEVADLREQLREAEEHARDVEAQQSDRDAEIDRVK
                     ELLSSSMREAASSGEMLGALEEQREEAAREMRGLREQLAVAQVRREALDAEVADLREQ
                     LREAEEHARDVEAQQSDRDAEVADLREQLREAEERARDVEAQQSDRDAEVADLREQLR
                     EAEEHARDVEAQQSDRDAEVADLREQLREAEEHARDVEAQQSDRDAEVADLREQLREA
                     EEHARDVEAQQSDRDAEVADLREQLREAEERARDVEAQQSDRDAEVADLREQLREAEE
                     RARDVEAQQSDRDAEVADLREQLREAEEHARDVEAQQSDRDAEVADLREQLREAEEHA
                     RDVEAQQSDRDAEIDRVKELLSSSMREAASSGEMLGALEEQREEAAREMRGLREQLAV
                     AQVRQEALDAEVADLREQLREAEADVARGEGVILLTTSEELQRADLWRRMLEEALCLS
                     ETWTGLLVVSYGERLSSVEQDHELASMECTDMLERLEEFVNLLEAARAAEMAAVESRD
                     DCERELRALQDRYDREVVAKQRLFLQREGRAAEGVSGIPAWAAYDEDSGAQRGSSIGD
                     SLSHPDHGGDGGGRSLPVSRTARDTTSEGLRKQLEQLKREKEALMEELEAKGMRYRDA
                     LTLLNQHISQLMEELSLHLRDGVTSANNARSLLLEIAELRAAQERTGASAKGGNANLS
                     SGEPSVGGRGSVLWGGGGGDGSSGALAPLR"
     gene            complement(<555526..>561555)
                     /locus_tag="LMJF_22_1330"
                     /db_xref="GeneID:5651892"
     mRNA            complement(<555526..>561555)
                     /locus_tag="LMJF_22_1330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683232.1"
                     /db_xref="GeneID:5651892"
     CDS             complement(555526..561555)
                     /locus_tag="LMJF_22_1330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683284.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651892"
                     /db_xref="UniProtKB/TrEMBL:Q4QBL4"
                     /translation="MSTSRARPRAQPLRQQQQPVLYRSDSSPQLTVSGTCPITSSSVR
                     FKEDTSRDRCSSKSAAARVEQRSMVLQTAGGRRVENTPLVSLRGSREKRVNFMETEKE
                     LATASSSPLSLAHELAKTQRELERLRMQLRSSNEHEQKTEEYVSGLEATVAAQRHDNL
                     LLRHHLANRQLLAEVLEEENRDLVETQQQMHLQQHPIACPQSLITHASTGTMTVVSPA
                     NAFGDGNAQPSSFSAFCAQLPDRQSNFAGPSPPLSPTQSMPTSYHHVYGAAGGPHMHE
                     LPLHSPTVTALHDRWAQTQIAHEALPHGYADQQEALQRRPSLQQQGNNGANSTPIPIR
                     GTTDNRFASPPQHISVSEETLFSSSTTSSSLHNTCAITHTLGTPQQVAATQHQLQSLG
                     IRSRETEHAIANALDTPNCIHQNALRGYPHSDASLSATSEAAPLLEPRRGEELFTDQQ
                     RCGHVALKALQDQVAEQEAEIAELRRQVAERQAEIAELRQLLAEAQREAQAAGARQRD
                     SSATVQALRDQMAEQEAEMIALRQLLGKAQREAPVDVARPLESGAAVQALRDQMAEQE
                     AEVAELRQLLAEAQREAQAAGARQRDSGATVQALRDQMAEQEAEVTALRQLLGKAQRE
                     APVDVARPLESGATVQALRDQMAEQEAEVAELRQLLAEAQREAQAAGARQRDSGATVQ
                     ALRDQMAEQEAEMIALRQLLGKAQREAPVDVARPLESGAAVQALRDQMAEQEAEVAEL
                     RQLLAEAQREAQAAGARQRDSGATVQALRDQMAEQEAEVAELRQLLAEAQREAQAAGA
                     RQRDSGATVQALRDQMAEQEAEMIALRQLLGKAQREAPVDVARPLESGAAVQALRDQM
                     AEQEAEVAELRQLLGKAQREAQAAGARQRDSGATVQALRDQMAEQEAEMIALRQLLGK
                     AQREAPVDVARPLESGAAVQALRDQMAEQEAEVAELRQLLAEAQREAQAAGARQRDSG
                     ATVQALRDQMAEQEAEVAELRQLLGKAQREAPVDVARPLESGATVQALRDQMAEQEAE
                     VAELRQLLGKAQREAPVDVARPLESGATVQALRDQMAEQEAEVAELRQLLGKAQREAP
                     VDVARPLESGAAVQALRDQMAEQEAEVAELRQLLAEAQREAQAAGARQRDSGATVQAL
                     RDQMAEQEAEVAELRQLLAEAQREAQAAGARQRDSGATVQALRDQMAEQEAEMIALRQ
                     LLGKAQREAPVDVARPLESGAAVQALRDQMAEQEAEVAELRQLLAEAQREAQAAGARQ
                     RDSGATVQALRDQMAEQEAEVAELRQLLGKAQREAPVDVARPLESGATVQALRDQMAE
                     QEAEVAELRQLLAEAQREAQAAGARQRDGVSVIASVGQEEGVRLAAGCVVAGKVDGGA
                     GRGVLTDSVCEGSEGKGDSSGWCRDRGLVEVGAADYERGLASTGDNGERKLVAGAVDR
                     GRSVSDTEELRSALAGCREKLTALEVELMAAKEAVEELRWYDERRDNCVEGRPLRQTY
                     VRRSMEGVEWALVASACEEELIWRLRVDCSRACHVNVDCVRRVEYVLGSLHAEFCVEH
                     NVDVEGSELKDRVAEYPFPATWALFRRIVEGRTVSGPMQWSVPSRAEEKLLAEEALAR
                     IFAQLEEACARQAFTSDWSEQRTELLHAAKLALAEVVAASRRECTDSLERLEELAALL
                     LEARESERELRDRLFAAEEDMYEVRRQHDDDLDGLVGAEAEARRSLDLYAARVAAQDE
                     AMRVQVEQIVDLQEEVQALASALSDKNADLTNAHAQAAALSRQVDETAAAYADTLEKL
                     EKSVEMLDASRTNELVLSQTLYEAEYRCTQLRNAIEMDAAAHRAELVSATAERDRFKE
                     GMEVFREVLPSLLAAAQPQPRKDNGDAGAGVEERISTSALDAAFSEEGYAVAQGLREV
                     LLRHLGCVEQLRRDKEGLADELDEAEKARGGYMAVLEDALRSLVEERELRMRAHESQL
                     QFSEQMMRELTMMRNAEEDEMVDDKADMEVNSNYGLLSTCSSSSPAVQTSV"
     gene            complement(<564381..>565916)
                     /locus_tag="LMJF_22_1340"
                     /db_xref="GeneID:5651893"
     mRNA            complement(<564381..>565916)
                     /locus_tag="LMJF_22_1340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683233.1"
                     /db_xref="GeneID:5651893"
     CDS             complement(564381..565916)
                     /locus_tag="LMJF_22_1340"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683285.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651893"
                     /db_xref="InterPro:IPR003788"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4QBL3"
                     /translation="MVHPAEGGVEVGSTGAGAAAAVFCGGRSGAPSVVSSQNDITSEA
                     RLDQIVAVLEERRVERQRKMFEDMIVFEGGAVSDHPSLGTRLIMRDFVHFALYNNKWG
                     YYPKLFRKYRQLMTTGYFDPIPFASLRNQHDYERYVAKLHESTPGFVTPTQLFQPYYG
                     WVLAEYLVTTHRAKFDPREPLIVYDIGAGTGALALSVLDYLAEHFPDLYVTCEYHAVE
                     QNPHLIQVLRNKLIHHYHHVNIHHLSVLNWRQLEKRRCVVLAVELFSGMPHDCVLWDQ
                     EAAVSEHWFGFQQHDNLATAHERYYALQDPIILRYLRYLNWMQEESFHNLKVLCLTEG
                     RETLDAPKRRSIEPDMADSTIAIFTKMAYIMSPFHTAWLPTVQMVFLEMLAQYFPRHH
                     LFAADWSSVRQALPGVNGPVLQVKLRVAKDMYLRKPVDALHANAGMVDMCFPTDFDHL
                     SIVYARICGTQKEVESMRHPVFWQTHGGDKTALFTTRSGYNPLLEDFQQFHVFTSHHS
                     PEL"
     gene            complement(<567913..>569100)
                     /locus_tag="LMJF_22_1350"
                     /db_xref="GeneID:5651894"
     mRNA            complement(<567913..>569100)
                     /locus_tag="LMJF_22_1350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683234.1"
                     /db_xref="GeneID:5651894"
     CDS             complement(567913..569100)
                     /locus_tag="LMJF_22_1350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683286.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651894"
                     /db_xref="GOA:Q4QBL2"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="UniProtKB/TrEMBL:Q4QBL2"
                     /translation="MLFRCCRPQTEEGEWKDIYGDPVRPRRSGYEYPLDALQISAWAA
                     IAVLAVLHFMIQIPFFDGARFVVVLVISSVLMTSVVLTKVALELYPQQDPAVFRTDLP
                     RLNQDELVPESAEPSTEPCVFCRRFVQVGCKHCSVCDKCVPGFDHHCRWLNSCVGAKN
                     YRLFATFMGVAWVGMAWVTALSLYTIQLMLRDVDAFKRHMHTQAYHSPPRAFPALLVF
                     NFVCLLIAVAGIGSLGKLICFHVYLDITHQSTYEHIVKRREEKRALGEYRSQHGEPES
                     KGSLACFELRKRRNFKRNGADHANGPDMNEEEANRDGEADSSVPPPPTRNDASGTGAV
                     CEEGSQESSGSKAEDIRRRAAHSSAGRQQYLPLPEGGEGQSNAPVSDSASSYTFEPVQ
                     RSE"
     gene            complement(<572571..>573659)
                     /gene="FPPS"
                     /locus_tag="LMJF_22_1360"
                     /db_xref="GeneID:5651895"
     mRNA            complement(<572571..>573659)
                     /gene="FPPS"
                     /locus_tag="LMJF_22_1360"
                     /product="farnesyl pyrophosphate synthase"
                     /transcript_id="XM_001683235.1"
                     /db_xref="GeneID:5651895"
     CDS             complement(572571..573659)
                     /gene="FPPS"
                     /locus_tag="LMJF_22_1360"
                     /EC_number="2.5.1.10"
                     /EC_number="2.5.1.1"
                     /codon_start=1
                     /product="farnesyl pyrophosphate synthase"
                     /protein_id="XP_001683287.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651895"
                     /db_xref="GOA:Q4QBL1"
                     /db_xref="InterPro:IPR000092"
                     /db_xref="InterPro:IPR008949"
                     /db_xref="PDB:4JZB"
                     /db_xref="PDB:4JZX"
                     /db_xref="PDB:4K10"
                     /db_xref="UniProtKB/TrEMBL:Q4QBL1"
                     /translation="MAHMERFQKVYEEVQEFLLGDAEKRFEMDVHRKGYLKSMMDTTC
                     LGGKYNRGLCVVDVAEAMAKDTQMDAAAMERVLHDACVCGWMIEMLQAHFLVEDDIMD
                     HSKTRRGKPCWYLHPGVTAQVAINDGLILLAWATQMALHYFADRPFLAEVLRVFHDVD
                     LTTTIGQLYDVTSMVDSAKLDAKVAHANTTDYVEYTPFNHRRIVVYKTAYYTYWLPLV
                     MGLLVSGTLEKVDKKATHKVAMVMGEYFQVQDDVMDCFTPPEKLGKIGTDIEDAKCSW
                     LAVTFLTTAPAEKVAEFKANYGSTDPAAVAVIKQLYTEQNLLARFEEYEKAVVAEVEQ
                     LIAALEAQNAAFAASVKVLWSKTYKRQK"
     gene            complement(<574964..>576574)
                     /locus_tag="LMJF_22_1370"
                     /db_xref="GeneID:5651896"
     mRNA            complement(<574964..>576574)
                     /locus_tag="LMJF_22_1370"
                     /product="intraflagellar transport protein-like protein"
                     /transcript_id="XM_001683236.1"
                     /db_xref="GeneID:5651896"
     CDS             complement(574964..576574)
                     /locus_tag="LMJF_22_1370"
                     /codon_start=1
                     /product="intraflagellar transport protein-like protein"
                     /protein_id="XP_001683288.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651896"
                     /db_xref="GOA:Q4QBL0"
                     /db_xref="InterPro:IPR029602"
                     /db_xref="UniProtKB/TrEMBL:Q4QBL0"
                     /translation="MRAASRSGVGTSAGPGRQVGDRSYYIGLIRPKIAELSAEIERLQ
                     EQEQLIDRNSSVLTQLQQKSKTLQDGIAKLKDTLADVNVAVENSSSLDLAAVKEESAR
                     LEKQNIDRRKKVDDLFLAVKDTDAKTKATLQSLEEEIQQLDRRILNENQDYNSYKAIR
                     DEAFAVSDMVLDRQHELRTLQAKQELLMANLAGDPDKKRAAEMLRGILRKRRESKELQ
                     NQCSLSVKEEQEKLIGQLKATRSDIEVLERQVNDIRDTLQESRARQSALEEEVKNFSG
                     ENVQAFQELQEKDREMQTFIDEYPDKERAELDKIAETQRHIADLLSRISQALEMQRQM
                     PSENNTDTLHDLTTQVDAKRDQIQNDVKTHQRLEKELLERKVELDKVAHLDKKIKEEL
                     ASHSAKMAEQKAEMEKFSDLDRLRAEVEDTRKVLSAQLAYYTRLRDGSKAQLNALTAE
                     YEARKKELHAGDVFTTLSTQEQRIRMLWQSTFSLEDYVRLREKETQYLGTKAECLRIV
                     DEVNLLLQNPSRIAGMGTAPLFSATSTH"
     gene            complement(<578697..>579500)
                     /locus_tag="LMJF_22_1380"
                     /db_xref="GeneID:5651897"
     mRNA            complement(<578697..>579500)
                     /locus_tag="LMJF_22_1380"
                     /product="putative mak-16-like RNA binding protein"
                     /transcript_id="XM_001683237.1"
                     /db_xref="GeneID:5651897"
     CDS             complement(578697..579500)
                     /locus_tag="LMJF_22_1380"
                     /codon_start=1
                     /product="putative mak-16-like RNA binding protein"
                     /protein_id="XP_001683289.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651897"
                     /db_xref="InterPro:IPR006958"
                     /db_xref="InterPro:IPR029004"
                     /db_xref="UniProtKB/TrEMBL:Q4QBK9"
                     /translation="MNHDDAMWNIMGQTFCSFKVKTNDDKVRFCRNPYNVTGLCQRGV
                     CPLSNAQYATVIEHEDELYLYVKTAERAHLPRRQWEKVKLDVSFPKALAQIDEELQWW
                     DQKLVIKIKARLLRLKQYLMRKRKMLMEPQDEYVSVNKRQEDKLRRREEKAEAAARIE
                     MEIEKELLDRLRKGTYDSVINYNKEAFEKLLDDEENREDFEALEQDEDEEFPDFVMDE
                     EDEEEEDGETVRGGRNKSKSRKRDKLVIEEEVERELAPRQRARLEDLEW"
     gene            complement(<580329..>581105)
                     /locus_tag="LMJF_22_1390"
                     /db_xref="GeneID:5651898"
     mRNA            complement(<580329..>581105)
                     /locus_tag="LMJF_22_1390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683238.1"
                     /db_xref="GeneID:5651898"
     CDS             complement(580329..581105)
                     /locus_tag="LMJF_22_1390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683290.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651898"
                     /db_xref="UniProtKB/TrEMBL:Q4QBK8"
                     /translation="MPLTEMSATEVPRVCSRLASFQSSAKPARVFTIATATTTAESSG
                     AASSPQEEAEQHLSVDVAKMVGMGKRLMAERQPFYAEKFFVKALRTLDAVAADVDRLV
                     ASREDYDHSVALCLAWAGLAQLVQGKQTVENAYLERLDREAALQPFRDAPLNDANRAL
                     TTWRLMQGAPRPWSETRDSEAKLQAALSSNAHDTVARSLFVITLFLKGDLERAMTEAL
                     KLHVYGDGFGCVALKHMSRFLGKDHVLVERLGMPSVVESI"
     gene            complement(<582510..>583763)
                     /locus_tag="LMJF_22_1400"
                     /db_xref="GeneID:5651899"
     mRNA            complement(<582510..>583763)
                     /locus_tag="LMJF_22_1400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683239.1"
                     /db_xref="GeneID:5651899"
     CDS             complement(582510..583763)
                     /locus_tag="LMJF_22_1400"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683291.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651899"
                     /db_xref="InterPro:IPR003409"
                     /db_xref="UniProtKB/TrEMBL:Q4QBK7"
                     /translation="MEIPKDASRLLLHPLDAQRQQTVAFALGQKEWAQEVCDRQGRLE
                     MLGHQQARRAAWAQASAAAVSDTLAVWESVGLAVRDRLTSLQPEGYQTFAFPDGTALY
                     EGHWKNCHPHGKGCLRRSQPMNDLYEGQWFAGQRCGTGTYHSAEYHLLYQGSWLDDKL
                     HGKGELVEPEGVYTGEFVENALHGYGEYVYNDGHVYKGDWVSGLYEGNGTYFYPSGAK
                     YEGGWLRGREHGRGTRWFSNGDVYIGEWMHGMPHGHGSFNSTCSTAARVTGQWRYGSL
                     HGAATCVFADGSHYVGEWQRGRFHGRGTYEVPCANGELQRYTGVYANGKRHGYGEYTS
                     STVSYTGEWVHDKKDGEGSLQVRGGGTYYGRWKADVPEGEGVYVSTYRKGYHDEIRCE
                     ARDGTFTLCADQGIQQRVDMRLLGR"
     STS             582672..583329
                     /standard_name="ha2178"
                     /db_xref="UniSTS:515500"
     gene            complement(<585786..>586235)
                     /locus_tag="LMJF_22_1410"
                     /db_xref="GeneID:5651900"
     mRNA            complement(<585786..>586235)
                     /locus_tag="LMJF_22_1410"
                     /product="Ca2+-binding EF-hand protein"
                     /transcript_id="XM_001683240.1"
                     /db_xref="GeneID:5651900"
     CDS             complement(585786..586235)
                     /locus_tag="LMJF_22_1410"
                     /codon_start=1
                     /product="Ca2+-binding EF-hand protein"
                     /protein_id="XP_001683292.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651900"
                     /db_xref="GOA:Q4QBK6"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:Q4QBK6"
                     /translation="MAALTDEQIREAFNLFDADGSGAIDAEEMALAMKGLGFGDLSRD
                     EVERIIRSMHTDSNGLVAYGEFEAMVKSRMAQKDSPEEILKAFQLFDLDKKGKISFAN
                     LKEVAKLLGENPGDDVLKEMIAEADEDGDGEVSFEEFKSVMLQMRGK"
     gene            complement(586832..586930)
                     /gene="LM22Cs1C2.1"
                     /locus_tag="LMJF_22_snoRNA0001"
                     /old_locus_tag="LMJF_22_snoRNA0028"
                     /db_xref="GeneID:12980794"
     ncRNA           complement(586832..586930)
                     /ncRNA_class="snoRNA"
                     /gene="LM22Cs1C2.1"
                     /locus_tag="LMJF_22_snoRNA0001"
                     /old_locus_tag="LMJF_22_snoRNA0028"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460408.1"
                     /db_xref="GeneID:12980794"
     ncRNA           complement(586832..586928)
                     /ncRNA_class="snoRNA"
                     /gene="LM22Cs1C2.1"
                     /locus_tag="LMJF_22_snoRNA0001"
                     /old_locus_tag="LMJF_22_snoRNA0028"
                     /transcript_id="XR_002460409.1"
                     /db_xref="GeneID:12980794"
     gene            complement(587022..587125)
                     /gene="LM22Cs1C1.1"
                     /locus_tag="LMJF_22_snoRNA0002"
                     /old_locus_tag="LMJF_22_snoRNA0035"
                     /db_xref="GeneID:12980795"
     ncRNA           complement(587022..587125)
                     /ncRNA_class="snoRNA"
                     /gene="LM22Cs1C1.1"
                     /locus_tag="LMJF_22_snoRNA0002"
                     /old_locus_tag="LMJF_22_snoRNA0035"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460410.1"
                     /db_xref="GeneID:12980795"
     ncRNA           complement(587023..587125)
                     /ncRNA_class="snoRNA"
                     /gene="LM22Cs1C1.1"
                     /locus_tag="LMJF_22_snoRNA0002"
                     /old_locus_tag="LMJF_22_snoRNA0035"
                     /transcript_id="XR_002460411.1"
                     /db_xref="GeneID:12980795"
     gene            complement(587175..587273)
                     /gene="LM22Cs1C2.2"
                     /locus_tag="LMJF_22_snoRNA0003"
                     /old_locus_tag="LMJF_22_snoRNA0029"
                     /db_xref="GeneID:12980796"
     ncRNA           complement(587175..587273)
                     /ncRNA_class="snoRNA"
                     /gene="LM22Cs1C2.2"
                     /locus_tag="LMJF_22_snoRNA0003"
                     /old_locus_tag="LMJF_22_snoRNA0029"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460412.1"
                     /db_xref="GeneID:12980796"
     ncRNA           complement(587175..587271)
                     /ncRNA_class="snoRNA"
                     /gene="LM22Cs1C2.2"
                     /locus_tag="LMJF_22_snoRNA0003"
                     /old_locus_tag="LMJF_22_snoRNA0029"
                     /transcript_id="XR_002460413.1"
                     /db_xref="GeneID:12980796"
     gene            complement(587365..587468)
                     /gene="LM22Cs1C1.2"
                     /locus_tag="LMJF_22_snoRNA0004"
                     /old_locus_tag="LMJF_22_snoRNA0036"
                     /db_xref="GeneID:12980797"
     ncRNA           complement(587365..587468)
                     /ncRNA_class="snoRNA"
                     /gene="LM22Cs1C1.2"
                     /locus_tag="LMJF_22_snoRNA0004"
                     /old_locus_tag="LMJF_22_snoRNA0036"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460414.1"
                     /db_xref="GeneID:12980797"
     ncRNA           complement(587366..587468)
                     /ncRNA_class="snoRNA"
                     /gene="LM22Cs1C1.2"
                     /locus_tag="LMJF_22_snoRNA0004"
                     /old_locus_tag="LMJF_22_snoRNA0036"
                     /transcript_id="XR_002460415.1"
                     /db_xref="GeneID:12980797"
     gene            complement(587518..587616)
                     /gene="LM22Cs1C2.3"
                     /locus_tag="LMJF_22_snoRNA0005"
                     /old_locus_tag="LMJF_22_snoRNA0030"
                     /db_xref="GeneID:12980798"
     ncRNA           complement(587518..587616)
                     /ncRNA_class="snoRNA"
                     /gene="LM22Cs1C2.3"
                     /locus_tag="LMJF_22_snoRNA0005"
                     /old_locus_tag="LMJF_22_snoRNA0030"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460416.1"
                     /db_xref="GeneID:12980798"
     ncRNA           complement(587518..587614)
                     /ncRNA_class="snoRNA"
                     /gene="LM22Cs1C2.3"
                     /locus_tag="LMJF_22_snoRNA0005"
                     /old_locus_tag="LMJF_22_snoRNA0030"
                     /transcript_id="XR_002460417.1"
                     /db_xref="GeneID:12980798"
     gene            complement(587708..587811)
                     /gene="LM22Cs1C1.6"
                     /locus_tag="LMJF_22_snoRNA0006"
                     /old_locus_tag="LMJF_22_snoRNA0040"
                     /db_xref="GeneID:12980799"
     ncRNA           complement(587708..587811)
                     /ncRNA_class="snoRNA"
                     /gene="LM22Cs1C1.6"
                     /locus_tag="LMJF_22_snoRNA0006"
                     /old_locus_tag="LMJF_22_snoRNA0040"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460418.1"
                     /db_xref="GeneID:12980799"
     ncRNA           complement(587709..587811)
                     /ncRNA_class="snoRNA"
                     /gene="LM22Cs1C1.6"
                     /locus_tag="LMJF_22_snoRNA0006"
                     /old_locus_tag="LMJF_22_snoRNA0040"
                     /transcript_id="XR_002460419.1"
                     /db_xref="GeneID:12980799"
     gene            complement(587861..587959)
                     /gene="LM22Cs1C2.4"
                     /locus_tag="LMJF_22_snoRNA0007"
                     /old_locus_tag="LMJF_22_snoRNA0031"
                     /db_xref="GeneID:12980800"
     ncRNA           complement(587861..587959)
                     /ncRNA_class="snoRNA"
                     /gene="LM22Cs1C2.4"
                     /locus_tag="LMJF_22_snoRNA0007"
                     /old_locus_tag="LMJF_22_snoRNA0031"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460420.1"
                     /db_xref="GeneID:12980800"
     ncRNA           complement(587861..587957)
                     /ncRNA_class="snoRNA"
                     /gene="LM22Cs1C2.4"
                     /locus_tag="LMJF_22_snoRNA0007"
                     /old_locus_tag="LMJF_22_snoRNA0031"
                     /transcript_id="XR_002460421.1"
                     /db_xref="GeneID:12980800"
     gene            complement(588051..588154)
                     /gene="LM22Cs1C1.3"
                     /locus_tag="LMJF_22_snoRNA0008"
                     /old_locus_tag="LMJF_22_snoRNA0037"
                     /db_xref="GeneID:12980801"
     ncRNA           complement(588051..588154)
                     /ncRNA_class="snoRNA"
                     /gene="LM22Cs1C1.3"
                     /locus_tag="LMJF_22_snoRNA0008"
                     /old_locus_tag="LMJF_22_snoRNA0037"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460422.1"
                     /db_xref="GeneID:12980801"
     ncRNA           complement(588052..588154)
                     /ncRNA_class="snoRNA"
                     /gene="LM22Cs1C1.3"
                     /locus_tag="LMJF_22_snoRNA0008"
                     /old_locus_tag="LMJF_22_snoRNA0037"
                     /transcript_id="XR_002460423.1"
                     /db_xref="GeneID:12980801"
     gene            complement(588204..588302)
                     /gene="LM22Cs1C2.5"
                     /locus_tag="LMJF_22_snoRNA0009"
                     /old_locus_tag="LMJF_22_snoRNA0032"
                     /db_xref="GeneID:12980802"
     ncRNA           complement(588204..588302)
                     /ncRNA_class="snoRNA"
                     /gene="LM22Cs1C2.5"
                     /locus_tag="LMJF_22_snoRNA0009"
                     /old_locus_tag="LMJF_22_snoRNA0032"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460424.1"
                     /db_xref="GeneID:12980802"
     ncRNA           complement(588204..588300)
                     /ncRNA_class="snoRNA"
                     /gene="LM22Cs1C2.5"
                     /locus_tag="LMJF_22_snoRNA0009"
                     /old_locus_tag="LMJF_22_snoRNA0032"
                     /transcript_id="XR_002460425.1"
                     /db_xref="GeneID:12980802"
     gene            complement(588394..588497)
                     /gene="LM22Cs1C1.4"
                     /locus_tag="LMJF_22_snoRNA0010"
                     /old_locus_tag="LMJF_22_snoRNA0038"
                     /db_xref="GeneID:12980803"
     ncRNA           complement(588394..588497)
                     /ncRNA_class="snoRNA"
                     /gene="LM22Cs1C1.4"
                     /locus_tag="LMJF_22_snoRNA0010"
                     /old_locus_tag="LMJF_22_snoRNA0038"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460426.1"
                     /db_xref="GeneID:12980803"
     ncRNA           complement(588395..588497)
                     /ncRNA_class="snoRNA"
                     /gene="LM22Cs1C1.4"
                     /locus_tag="LMJF_22_snoRNA0010"
                     /old_locus_tag="LMJF_22_snoRNA0038"
                     /transcript_id="XR_002460427.1"
                     /db_xref="GeneID:12980803"
     gene            complement(588547..588645)
                     /gene="LM22Cs1C2.6"
                     /locus_tag="LMJF_22_snoRNA0011"
                     /old_locus_tag="LMJF_22_snoRNA0033"
                     /db_xref="GeneID:12980804"
     ncRNA           complement(588547..588645)
                     /ncRNA_class="snoRNA"
                     /gene="LM22Cs1C2.6"
                     /locus_tag="LMJF_22_snoRNA0011"
                     /old_locus_tag="LMJF_22_snoRNA0033"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460428.1"
                     /db_xref="GeneID:12980804"
     ncRNA           complement(588547..588643)
                     /ncRNA_class="snoRNA"
                     /gene="LM22Cs1C2.6"
                     /locus_tag="LMJF_22_snoRNA0011"
                     /old_locus_tag="LMJF_22_snoRNA0033"
                     /transcript_id="XR_002460429.1"
                     /db_xref="GeneID:12980804"
     gene            complement(588737..588840)
                     /gene="LM22Cs1C1.5"
                     /locus_tag="LMJF_22_snoRNA0012"
                     /old_locus_tag="LMJF_22_snoRNA0039"
                     /db_xref="GeneID:12980808"
     ncRNA           complement(588737..588840)
                     /ncRNA_class="snoRNA"
                     /gene="LM22Cs1C1.5"
                     /locus_tag="LMJF_22_snoRNA0012"
                     /old_locus_tag="LMJF_22_snoRNA0039"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460430.1"
                     /db_xref="GeneID:12980808"
     ncRNA           complement(588738..588840)
                     /ncRNA_class="snoRNA"
                     /gene="LM22Cs1C1.5"
                     /locus_tag="LMJF_22_snoRNA0012"
                     /old_locus_tag="LMJF_22_snoRNA0039"
                     /transcript_id="XR_002460431.1"
                     /db_xref="GeneID:12980808"
     gene            complement(588890..588988)
                     /gene="LM22Cs1C2.7"
                     /locus_tag="LMJF_22_snoRNA0013"
                     /old_locus_tag="LMJF_22_snoRNA0034"
                     /db_xref="GeneID:12980809"
     ncRNA           complement(588890..588988)
                     /ncRNA_class="snoRNA"
                     /gene="LM22Cs1C2.7"
                     /locus_tag="LMJF_22_snoRNA0013"
                     /old_locus_tag="LMJF_22_snoRNA0034"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460432.1"
                     /db_xref="GeneID:12980809"
     ncRNA           complement(588890..588986)
                     /ncRNA_class="snoRNA"
                     /gene="LM22Cs1C2.7"
                     /locus_tag="LMJF_22_snoRNA0013"
                     /old_locus_tag="LMJF_22_snoRNA0034"
                     /transcript_id="XR_002460433.1"
                     /db_xref="GeneID:12980809"
     gene            complement(589081..589136)
                     /locus_tag="LMJF_22_snoRNA0014"
                     /db_xref="GeneID:12980810"
     ncRNA           complement(589081..589136)
                     /ncRNA_class="snoRNA"
                     /locus_tag="LMJF_22_snoRNA0014"
                     /transcript_id="XR_002460434.1"
                     /db_xref="GeneID:12980810"
     gene            complement(<590680..>591585)
                     /locus_tag="LMJF_22_1420"
                     /db_xref="GeneID:5651915"
     mRNA            complement(<590680..>591585)
                     /locus_tag="LMJF_22_1420"
                     /product="putative aquaporin"
                     /transcript_id="XM_001683241.1"
                     /db_xref="GeneID:5651915"
     CDS             complement(590680..591585)
                     /locus_tag="LMJF_22_1420"
                     /codon_start=1
                     /product="putative aquaporin"
                     /protein_id="XP_001683293.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651915"
                     /db_xref="GOA:Q4QBK5"
                     /db_xref="InterPro:IPR000425"
                     /db_xref="InterPro:IPR023271"
                     /db_xref="UniProtKB/TrEMBL:Q4QBK5"
                     /translation="MATKANQMLTGANDDQVEPPMSAGNPRSAPTVSMVVLPSVADAT
                     SAPAAPAPVLNTNTVIQKFSCLQSLRFDALMSAAVVEFIGTFLLVLTVPLSIIQNAEM
                     APISIGFLLMSLVFSFGYLSGGHINPMVTFSVWLATSNGEGYATFNKRRLIMYVVAQM
                     AGGVAAAFYCMMINGRDFPVPNMGRSFNRMLRGFLAESVFTFVLCSVVLHVAISQQRN
                     NNFYGFAIGFSMLCGGLTCGSISGGVFNPAVATPLIVVRCLFSFNEAACTPMASLWVY
                     WASEAVGAVCASIMYLALQNLGDEV"
     gene            complement(<592590..>592925)
                     /locus_tag="LMJF_22_1430"
                     /db_xref="GeneID:5651916"
     mRNA            complement(<592590..>592925)
                     /locus_tag="LMJF_22_1430"
                     /product="fk506-binding protein 1-like protein"
                     /transcript_id="XM_001683242.1"
                     /db_xref="GeneID:5651916"
     CDS             complement(592590..592925)
                     /locus_tag="LMJF_22_1430"
                     /codon_start=1
                     /product="fk506-binding protein 1-like protein"
                     /protein_id="XP_001683294.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651916"
                     /db_xref="GOA:Q4QBK4"
                     /db_xref="InterPro:IPR001179"
                     /db_xref="InterPro:IPR023566"
                     /db_xref="UniProtKB/TrEMBL:Q4QBK4"
                     /translation="MPSDAVVMDKIIEGDGKTIPRSGSVVTLDYIGYLEDGSKFDSTL
                     ERGKPFVFRVGCGEVIKGWDAGIIQMSKGERSKLTMPPTLAYGGTGFPGLIPPNATIV
                     FEVTLLDVA"
     gene            complement(<597757..>599280)
                     /locus_tag="LMJF_22_1440"
                     /db_xref="GeneID:5651917"
     mRNA            complement(<597757..>599280)
                     /locus_tag="LMJF_22_1440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683243.1"
                     /db_xref="GeneID:5651917"
     CDS             complement(597757..599280)
                     /locus_tag="LMJF_22_1440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683295.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651917"
                     /db_xref="UniProtKB/TrEMBL:Q4QBK3"
                     /translation="MPQKTMKKANATVMEDSPCKGVSGGSPYRNAEALPTVGARGCMP
                     AQRPSKRMLNQEISLLMLILAAQTITGMVNIQDSVLSTELVADSHSFRGRPSLKNESH
                     SSSSYYSSASSDKHVPFMDMSEGISSSTAGSHVSENFNDDGEEEEEVVAYRFASQLTA
                     PLRTKTYFTHNEDVWENIFSFLPWQAAMQVRGVSRFHFRQSLPRVTVARMPQSKVPAI
                     FLPCLEDLDSSEMEIEADLAPQHKTPWSCPHCCLFNAHGAVCGNNRCQKPRPQSGQRL
                     FLGQLRRTGTVPMVRWLVNNVFNASTGALVSVENRRNTHTQRGKGCAWPTINEEATVK
                     RMLDAHHRLFFDSVNGVEGVWLVPEGREKALQSEVSMRYNGGAHQKHMPRGTIVVETP
                     SAPFFAAGPAAAPLSSAKGTDVDATEEIHGDKVRSATSLSYSAATQSSRSDSSYHLTS
                     TPLPPYQSKQEAHPATVDTATEYYGYNDTASFMPYCIPGVDFVRRGVYRLNPYTVLM"
     gene            complement(<600013..>600702)
                     /gene="CYP6"
                     /locus_tag="LMJF_22_1450"
                     /db_xref="GeneID:5651918"
     mRNA            complement(<600013..>600702)
                     /gene="CYP6"
                     /locus_tag="LMJF_22_1450"
                     /product="putative cyclophilin 6"
                     /transcript_id="XM_001683244.1"
                     /db_xref="GeneID:5651918"
     CDS             complement(600013..600702)
                     /gene="CYP6"
                     /locus_tag="LMJF_22_1450"
                     /EC_number="5.2.1.8"
                     /codon_start=1
                     /product="putative cyclophilin 6"
                     /protein_id="XP_001683296.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651918"
                     /db_xref="GOA:Q4QBK2"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR020892"
                     /db_xref="InterPro:IPR024936"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:Q4QBK2"
                     /translation="MWRLSRVALQSNRAALYMPYTPVATNPVVYFDITAEGDALGRVS
                     VELFRDVVPRTSENFRSLCTGERGYGQCLLYYKGTPFHRIIPGFVMQGGDILTKDGRS
                     NVSVFGYPFPDESFEGKAGKHLPGTVGMAHSGPNQNGSQFFFNLGRNEQLDRKFVVVG
                     QVLGGWEIVNQVVKLCGSRCGTPVSRAWISDCGQSGGYMAEETQEALQGERAQHVIPG
                     KEVLDLIQPRY"
     gene            complement(<602485..>603105)
                     /locus_tag="LMJF_22_1460"
                     /db_xref="GeneID:5651919"
     mRNA            complement(<602485..>603105)
                     /locus_tag="LMJF_22_1460"
                     /product="i/6 autoantigen-like protein"
                     /transcript_id="XM_001683245.1"
                     /db_xref="GeneID:5651919"
     CDS             complement(602485..603105)
                     /locus_tag="LMJF_22_1460"
                     /codon_start=1
                     /product="i/6 autoantigen-like protein"
                     /protein_id="XP_001683297.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651919"
                     /db_xref="GOA:Q4QBK1"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:Q4QBK1"
                     /translation="MLISTRDAFEKRHITRSDGVEVLPREMITVAALEAGYCLASPTV
                     GEAVGKTTYPGQMTAYEFAELCEDNRSSFMSAEDMAKCVVVVAPAHVITRRSLEEIMA
                     KGSSKNDALSDEEVDALFSILDAENKGAITDKDFMRALYGNLGLRCLSARRKLDAFEA
                     KRRQQEALDRARAEEERMKEEGKAAAQKGGPTALSKEKKKKAAACC"
     gene            complement(<603543..>604880)
                     /locus_tag="LMJF_22_1470"
                     /db_xref="GeneID:5651920"
     mRNA            complement(<603543..>604880)
                     /locus_tag="LMJF_22_1470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683246.1"
                     /db_xref="GeneID:5651920"
     CDS             complement(603543..604880)
                     /locus_tag="LMJF_22_1470"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683298.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651920"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:Q4QBK0"
                     /translation="MLRRQCVVLSYQRGSWAPGSKHQKHMSLNPTMYLYRFAGPHGPG
                     PYVMKYWWTLGCFPTGIERPFRLPEFLASYQQQHVPIEVEEWLQCFVKNPYEELKDAT
                     SSLLKCLEEVPIRENTRGYRSIESGVSSFAAPLAQFERQLNVRVPSLAVRAALGSPAL
                     RERLKDDLFEYNESLSACGSTPHRRLARLAFDEPLTLPGGINNSDDSENLRGQISVPM
                     SEAIGSYASPNPSTSDDEKKLIRLLTTFSEGCTLKEDYESAFSLLSSSLGFSHDDNTD
                     GVVHSNASAAAILGGLYKEAEFHGRQAALLEPQAMSSRKSGGRGYVLWATATAYQEDF
                     DRASRIVEKGLEVFPDNADLKSIQEKLAGAVPAASSASPLCTRMVRSKGQQARALLHG
                     SGRSFDNEFDWVVFKNKLYPSKMNPSSNEMGSVFRRVGDFGGHISTSRSLEPL"
     gene            complement(<605235..>605984)
                     /locus_tag="LMJF_22_1480"
                     /db_xref="GeneID:5651921"
     mRNA            complement(<605235..>605984)
                     /locus_tag="LMJF_22_1480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683247.1"
                     /db_xref="GeneID:5651921"
     CDS             complement(605235..605984)
                     /locus_tag="LMJF_22_1480"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683299.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651921"
                     /db_xref="GOA:Q4QBJ9"
                     /db_xref="InterPro:IPR003428"
                     /db_xref="UniProtKB/TrEMBL:Q4QBJ9"
                     /translation="MMPGARAVLGASYRNAIASTKELPVRSEPRRHRKLYQLTMREEY
                     EEGLRDFLPPQPLLPVGWRMEHASGSNRFDLFKNVEIRHCGSEELHVITLMETKQYEG
                     TYRMDNGEREEQEYLNFGLFMRKKKYPAGGLEFRLTSIDLELVMDALTIHPSEEAFEN
                     AKACYGRNDAAAAKTDMHGSSGDARRRCAFKYRGPMLSELDDDLSDEILDYLDERGVN
                     NAFAEFIMAQAFFFEQEEYINWLRLLRKFSD"
     gene            <612160..>613245
                     /locus_tag="LMJF_22_1490"
                     /db_xref="GeneID:5651922"
     mRNA            <612160..>613245
                     /locus_tag="LMJF_22_1490"
                     /product="putative Serine-threonin protein phosphatase"
                     /transcript_id="XM_001683248.1"
                     /db_xref="GeneID:5651922"
     CDS             612160..613245
                     /locus_tag="LMJF_22_1490"
                     /codon_start=1
                     /product="putative Serine-threonin protein phosphatase"
                     /protein_id="XP_001683300.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651922"
                     /db_xref="GOA:Q4QBJ8"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q4QBJ8"
                     /translation="MKVCDLQIGRCYGALLLLFYVLLISCFARCERKLVEVHRIIAVG
                     DVHGDADNFLKILRIANLIEDSVTGASGVLDNPPRWKYSSSRTNGTSVRTTLVQVGDL
                     IDRGEQDLEALNIAISLQEQTAQSGSQDEVVLLIGNHELLNIQGHYHYVNKHNYGGFL
                     SKALRAEGMKATGAFGKYIVDNFKAAHMDEGVLFIHAGIETSMNIKDVEALNADVREA
                     LRQGIFRHSFLGSSGPLWTRKMIIESMSDECSDVRAALKQLNATRIVVGHTPQESGHI
                     GQHCDGQVLAIDVGMSRWMYDKVAALELVFSKYMDKITGTGSASFVVRELREGVSGFC
                     HTCLDERSGLDTTVGGDSDENDIFDDL"
     gene            <613976..>617239
                     /locus_tag="LMJF_22_1500"
                     /db_xref="GeneID:5651923"
     mRNA            <613976..>617239
                     /locus_tag="LMJF_22_1500"
                     /product="putative ATP-dependent DEAD/H RNA helicase"
                     /transcript_id="XM_001683249.2"
                     /db_xref="GeneID:5651923"
     CDS             613976..617239
                     /locus_tag="LMJF_22_1500"
                     /codon_start=1
                     /product="putative ATP-dependent DEAD/H RNA helicase"
                     /protein_id="XP_001683301.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651923"
                     /db_xref="GOA:Q4QBJ7"
                     /db_xref="InterPro:IPR001374"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QBJ7"
                     /translation="MVHRIAMSFNLDHKSSGEGASRALKLTKIGGIVDALKRQQDAAE
                     GGVRVKTIDGYQGAQKLEHDHLSESDILSLEDKLKPHKSSMAAEIKAVVNEPALERKC
                     FRVVQGGLSAVPKLSWPVDRAQLNRFRMSLPAYRHGPHIIQSVQENSVVVICGDTGCG
                     KTTQIPQMLYDAGIFDKHHDVICTQPRRISALSVAQRVATERGEACGDSCGYVIRFEN
                     MTSASSHIIYQTTGILLRRLHTEPDLKGVACVVVDEVHERDVETDFCLLLLRDRLRAQ
                     QEYPGRYPLQLKLVVMSATVQVDALVSYFSGYNSGRDIPLITIPGTLFPVREFFLEDV
                     LRKVGASVSAASAMRLLLNQKQEAQRSAETPEAEGNAALYEQLKSVVFDTFDRDVEGL
                     VPYDLVCDLIKKIHDESRSHAESILVFLPGWAAISCIANRLKRSQFARELSILMLHSS
                     LTTSEQQRVFERPPKHYRKIVLATSIAETSITIDDIVYVIDSGLVKGTSYDPMGNTSA
                     LKATLIGKANGVQRRGRAGRCQPGVCYHLLPKAVYDDLPGFLPPEIVRSPLEEVCLQL
                     KAIESNQKCAQVLSRAMSAPPTEAIEHAVQFLTDMGAFTTEEKMTNLGRALAALPTHP
                     LLGKMLFTAACFGVLDTVATIAAGLSVKTPFIRPQAFEKNSAKENLLRIDDNALSDHF
                     CVVTLFSGWIRSGRSLHYATSHFADNNTLRSLERTKLQFIRLVLQSSFAKGIVSPEAH
                     FSRYASNRGLVRLVLLWSLYPRLATIEYRANRGSQNPQVFCWDNKAAVFSMNSVLGFY
                     RRRDFGANSFIVYYDRMNLEAMLSVFDATAVSPIDVVLCLRQLTVRPLLEVPALFLQD
                     TESKLAPPAYLDVNSLPNKENYAAMFFDGDKKLYVAPKKLAGVLQTARDCLDFFLATC
                     IKSVRAKKFPDSLVHALAQIVGYPITGFDAPATGVASATHMDPAIQQIQLASAHLPGF
                     ARRQGQGDIDSDVSDDEAPIIGDEDDDTYMGRLTAEQKASVTAAYGDLAVFRYDGVAE
                     LLHAAKRAEGLSALPEEEMEGGEVNAAGDDEEDEEDEDEEIIVASLNLAEMQALQNA"
     gene            <618143..>619636
                     /locus_tag="LMJF_22_1510"
                     /db_xref="GeneID:5651924"
     mRNA            <618143..>619636
                     /locus_tag="LMJF_22_1510"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683250.1"
                     /db_xref="GeneID:5651924"
     CDS             618143..619636
                     /locus_tag="LMJF_22_1510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683302.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651924"
                     /db_xref="UniProtKB/TrEMBL:Q4QBJ6"
                     /translation="MLCIRKLALVDRAEPGTVWSYDLKKQWYYGDLVAVRVHDSNEKV
                     LGSTIPDVFAPTSEAGQSTVCVSWINEYPAEEPMAPEKAPEESPGEPPAGESRGEAAI
                     DGSDPPEPTASPVTSGSMMNGLDNLATPPGGVAAGAKYAEPCTATISPQPEYPAGGAA
                     ESDQTVTSDKPTAAAKTATKTPEDPSVLPSSLAAAPGSPFSEAPTGEGSGAAWVPVSV
                     APVARKPRFSGCTPISIAQAPRGVLHFQVITVFGTKVAVGGANVQSILEADTSESPHV
                     QHYAVLITPANTNAESASTIHAVLEFSVVVGTTDIATVVSLAASASYAPMPTPLRAGS
                     TCAFSTHTFYFPSKFLSGNGVYIVTNVLCAESLSDNTVYLEFALPEDLKRMHVLPEKK
                     AVLKERGERAYFTCTWDVLSPYVGTANGKDSQLTSAGLHVLIRDGAESRAPFDIEVVG
                     EPPSTKSVDPYMFFLNHAKVTNNSCNAGDEAIFMDILPISLVTREVA"
     gene            <621182..>621709
                     /locus_tag="LMJF_22_1520"
                     /db_xref="GeneID:5651925"
     mRNA            <621182..>621709
                     /locus_tag="LMJF_22_1520"
                     /product="putative 40S ribosomal protein L14"
                     /transcript_id="XM_001683251.1"
                     /db_xref="GeneID:5651925"
     CDS             621182..621709
                     /locus_tag="LMJF_22_1520"
                     /codon_start=1
                     /product="putative 40S ribosomal protein L14"
                     /protein_id="XP_001683303.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1520"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651925"
                     /db_xref="GOA:Q4QBJ1"
                     /db_xref="InterPro:IPR002784"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="UniProtKB/TrEMBL:Q4QBJ1"
                     /translation="MVKSHYICAGRLVRILRGPRQDRVGVIVDIVDANRVLVENPEDA
                     KMWRHVQNLKNVEPLKYCVSVSRNCSAKALKDALASSKALEKYAKTRTAARVEAKKAC
                     AVSTDFERYQLRVARRSRAHWARKVFDEKDAKTPVSWHKVALKKMLKKAAKMDSTEGA
                     KRRMQKAIAARKAKK"
     gene            <622316..>623050
                     /locus_tag="LMJF_22_1530"
                     /db_xref="GeneID:5651926"
     mRNA            <622316..>623050
                     /locus_tag="LMJF_22_1530"
                     /product="putative dephospho-CoA kinase"
                     /transcript_id="XM_001683252.1"
                     /db_xref="GeneID:5651926"
     CDS             622316..623050
                     /locus_tag="LMJF_22_1530"
                     /EC_number="2.7.1.24"
                     /codon_start=1
                     /product="putative dephospho-CoA kinase"
                     /protein_id="XP_001683304.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651926"
                     /db_xref="GOA:Q4QBJ4"
                     /db_xref="InterPro:IPR001977"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QBJ4"
                     /translation="MILIGLTGGIACGKSSVSRILRDEFHIEVIDADLVVRELQAPNS
                     ACTRRIAARWPLCVHPETGELNRAELGKIVFSDAQARRALGEIMNPAIFKAILKRIAA
                     AWWLDLWRSGAASSPSIVVLDAPTLFETKTFTYFVSASVVVSCSEQRQIERLRGRDGF
                     SKEEALQRIGSQMSLEAKRRLADYIIENDYADDLDALRGVLCACVAWMSRQSNKRLTY
                     MFGTVATAAVGVAAAVGYVGYQLLLA"
     gene            <623736..>626624
                     /locus_tag="LMJF_22_1540"
                     /db_xref="GeneID:5651927"
     mRNA            <623736..>626624
                     /locus_tag="LMJF_22_1540"
                     /product="putative alanyl-tRNA synthetase"
                     /transcript_id="XM_001683253.1"
                     /db_xref="GeneID:5651927"
     CDS             623736..626624
                     /locus_tag="LMJF_22_1540"
                     /EC_number="6.1.1.7"
                     /codon_start=1
                     /product="putative alanyl-tRNA synthetase"
                     /protein_id="XP_001683305.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651927"
                     /db_xref="GOA:Q4QBJ3"
                     /db_xref="InterPro:IPR002318"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR012947"
                     /db_xref="InterPro:IPR018162"
                     /db_xref="InterPro:IPR018163"
                     /db_xref="InterPro:IPR018164"
                     /db_xref="InterPro:IPR018165"
                     /db_xref="InterPro:IPR023033"
                     /db_xref="UniProtKB/TrEMBL:Q4QBJ3"
                     /translation="MSFTEWPVSRVRQEFVDYFKKQGHTFVPSSPVCPHDDPTLLFIN
                     AGMNQFKALFLGTADPNTDFGRLKRAANSQMCIRAGGKHNDLEDVGRDTYHHTFFEML
                     GSWSFGDYFKKEAIQWAWELLTEVYKLPKDQLYVTYFEGDESNGLDPDLEAKELWGQL
                     LPESQIVPGNAKDNFWEMGDTGPCGPCSEVHFDRIGRRNAASLVNKDDPMVVEIWNLV
                     FMQFERRAGGFLTPLPQKHIDTGMGLERLTSILQGVKSNYDTDAWIPLFEAIQTATGY
                     PKSYAEIRNDPDSDALVAYRVVADHIRCLTSAVGDGVMPDSVGRGFVLRRIIRRAVRY
                     GVQFLGAKPGFFTQLVDSVCTSLGPFFPHLKEPRNIQRIKAVLADEEQSFAKTWEMGL
                     KHFNHAVNECRANSSKVISGSEAFVLHDRYGFPVDLTCLLAEKDGMTVDLEGFNTEMK
                     ESKVSAGRVAATKTFIDAYQLEELKTRGIPQTNDAAKYVWEDYTGDVLAIFDKKNSKF
                     ISLLEPGNDLGAEGVGIILSTTNFYAESGGQVYDTGRLVAASDSVFEVKKAYNVAGYV
                     VHVGNLSKYSASPIPSSAVVQLQVDYERRLPIAANHTTTHQLNWVLRRVLGEKPDNFT
                     EVQQKGSLVTDEMLRFDFSYNTKLSNEDLVRVEQLLNEKIQAGLLVYREEVPLEAASK
                     INGLRQMFGEKYPDPVSVISIGTPINEMLANPEKEEWRDYAVEFCGGTHLKNLKEAEK
                     AVIISEEALMKGVRRVVVATRLEADKVIKAGAELKRQYDELMKKEATATSVKALSVLN
                     KNVGDSCIPLVLKNEMRENIDAAIKRMNATLKSQAAEARDKAAEAGKCLGASYDAAAA
                     PFLVHQMTEFGAEREALQAFSDGFSSTVSGPVGVFLIGSDNEKALAIVSMPAAFVEKK
                     MSAVAWAKSSIGKGGGKPNAAQSGLPAKDVAAAVAKAMEEAERMKASL"
     gene            <628750..>630600
                     /locus_tag="LMJF_22_1550"
                     /db_xref="GeneID:5651928"
     mRNA            <628750..>630600
                     /locus_tag="LMJF_22_1550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683254.1"
                     /db_xref="GeneID:5651928"
     CDS             628750..630600
                     /locus_tag="LMJF_22_1550"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683306.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651928"
                     /db_xref="UniProtKB/TrEMBL:Q4QBJ2"
                     /translation="MSVSASSSRAAAASSGTLDATVAPHTADAVEETFKLLVWRLVLV
                     DTAEDSSQWSSRAKQQWGGGKPLFVSVSNKFKEHGSTLSKKLVFGNPQQSQQQSWSGI
                     EWREGNIIYVPLDDDPVLMIEVGVLRHGKKSVLGLGIINAQSMLAESRQYTKFTVHVL
                     PTHTSIDAFTVHAVAEVEIRSSLLHEPPDLNFTPLEYNYGTVRVSTADFYYPSFFLTG
                     TGEYIVSNVLCAMNMTEFSSLAMQLVPLHSAASYIATEPSQVITVRPQQRVYFSATWN
                     LTNRACMKTLEMQLRVNGSQKPSAPVLIKVHNQVPQTPGNTDLPFHYWVNTTCITNRQ
                     MLPSQELPLIHAVLPVYRFISRSAPINQTEGMIVAFDKDKGEHVLVRANGVPVTMGKL
                     YGTDHHQQRQSPHRLSSQKSGTSASALSRAESMDLSAVSDLTSPFGFDTNASFVVRDS
                     HVRNPFPSRGPLLNLSQKTCLCTIALGLIRGFPMVYEATTGLSPSFQVSVTLLDQRGW
                     QIVHGETLPSYHSASGSLRWAEQLVLRKWPGATSRQFVRLNLTEVRPRDGDETPIGAG
                     LISLPSMQRLYTQNPLSVAFYVYETYSLYDQLNSSSLLMKDVNVMFSELR"
     gene            <631042..>631569
                     /locus_tag="LMJF_22_1560"
                     /db_xref="GeneID:5651929"
     mRNA            <631042..>631569
                     /locus_tag="LMJF_22_1560"
                     /product="putative 40S ribosomal protein L14"
                     /transcript_id="XM_001683255.1"
                     /db_xref="GeneID:5651929"
     CDS             631042..631569
                     /locus_tag="LMJF_22_1560"
                     /codon_start=1
                     /product="putative 40S ribosomal protein L14"
                     /protein_id="XP_001683307.1"
                     /db_xref="GeneID:5651929"
                     /db_xref="GOA:Q4QBJ1"
                     /db_xref="InterPro:IPR002784"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="UniProtKB/TrEMBL:Q4QBJ1"
                     /translation="MVKSHYICAGRLVRILRGPRQDRVGVIVDIVDANRVLVENPEDA
                     KMWRHVQNLKNVEPLKYCVSVSRNCSAKALKDALASSKALEKYAKTRTAARVEAKKAC
                     AVSTDFERYQLRVARRSRAHWARKVFDEKDAKTPVSWHKVALKKMLKKAAKMDSTEGA
                     KRRMQKAIAARKAKK"
     gene            <640858..>641955
                     /locus_tag="LMJF_22_1570"
                     /db_xref="GeneID:5651930"
     mRNA            <640858..>641955
                     /locus_tag="LMJF_22_1570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683256.1"
                     /db_xref="GeneID:5651930"
     CDS             640858..641955
                     /locus_tag="LMJF_22_1570"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683308.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651930"
                     /db_xref="UniProtKB/TrEMBL:Q4QBJ0"
                     /translation="MCIDLRLLVGCTWSFPQRMTSHSPFHRQSLSLTCSSTLHNLRHA
                     SSRTFRTSASTSTAKRKCKRSPTTSISPSRRAGVAASSKDENAADLFAAEEHRLTEND
                     VRLAMRTLMASHFSLVQHARKPEKMQVAKEREAIEEKHHGRQRRLLEKDENSLRLLGA
                     DGMVIGEGILPLLAAAKRNPFDATSSRRATSSPDNAAWRALNPVGLAASQAVAFASLP
                     GDGDGDDADALSEAEYASFLARTGAASIDGSKAEETETDAWKSATLATLSVPDLSVYD
                     ADHDFRINSEEVVRGAGGDSSRAAPSSAGTTATVQAERLGVPTGLDPLSTRPSASKAA
                     AAAMQLQFDEDEDTDYTVAAFVDDNDDPLDL"
     gene            <642735..>643826
                     /locus_tag="LMJF_22_1580"
                     /db_xref="GeneID:5651931"
     mRNA            <642735..>643826
                     /locus_tag="LMJF_22_1580"
                     /product="putative exosome complex exonuclease RRP45"
                     /transcript_id="XM_001683257.1"
                     /db_xref="GeneID:5651931"
     CDS             642735..643826
                     /locus_tag="LMJF_22_1580"
                     /codon_start=1
                     /product="putative exosome complex exonuclease RRP45"
                     /protein_id="XP_001683309.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651931"
                     /db_xref="GOA:Q4QBI9"
                     /db_xref="InterPro:IPR001247"
                     /db_xref="InterPro:IPR015847"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:Q4QBI9"
                     /translation="MLYRTAVPVPADALVQRNLEFTRTAWKAGLRPDQRDANQLRVVE
                     IDFPLLSRDVVQVKCGNTVATATISCDLVEPSPYRPKHGFFEVHARQLLNERDPLDQS
                     KEIKRISMYLTRLLSGSVLETESLCVIPGRRVWSIDAEVIIVNNDGNAQDVAQWAVMT
                     ALQHVRRPELTIRGEDVIVHPPHERDPVPLPLHHIPLSFTFAVCANPQEVQLAVRAAT
                     LRSAHAPRAGASSGANADEGDGEAEELGWSSDALQVVVDPSLEEATAAACTVSVALNG
                     EGHVCSLEKADGCYVSIAYLEQCMEIATKLTQALLSQMKESMEAHNAKRTEAVRSQFL
                     WAQQRHGIQAIATPGDEGEHARKSAKTEK"
     gene            <644828..>649456
                     /locus_tag="LMJF_22_1590"
                     /db_xref="GeneID:5651932"
     mRNA            <644828..>649456
                     /locus_tag="LMJF_22_1590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683258.1"
                     /db_xref="GeneID:5651932"
     CDS             644828..649456
                     /locus_tag="LMJF_22_1590"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683310.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651932"
                     /db_xref="UniProtKB/TrEMBL:Q4QBI8"
                     /translation="MLAVRKLVEPTAVKALCVLRLESDAATPAPCGNRAVVLAAISES
                     IHVFDLAPASAATVLDSSVLSSALSLQFCPRGHVFNVGCGVSGLLALANQCFIVWTRD
                     QECILVRYQANLASPPAKRASVADACRVYREDGQPSPLHNKEHHWYVVRRMRLWCPDA
                     GELLPAPEMGVNEGMDTVFIRFSEKHVFLVCMKWVASCTPSEKGRLSADTLRTCRWHT
                     GNYMRAYAGTGFHYPTQSCSVATRRPRESSSDHQARLERLWQSCSPFASIPDEDLIAS
                     HSVRELALHKDAETQGAAARYASVSPSSPTDDYCGVSDVWLRREAHTAPSPLMPSPAQ
                     YCGSPLGGFANVRGTGGNTAVHHAPPTLFGSRTVALKDRYASPHKSAIAVVAPRRSGR
                     RGVEWQLLVMVSTDSYTAVYHLQRRHTPLTAHHLVLDGLVHDAAYPRQVLLCSHSGDA
                     INDVWVALSSGVVTRLSVSALRSRWSAGGERAKVGWPRVSVSGLPPSFYCRRMLPADD
                     LIGTDPHLSSPGSVGADTSAYPCAGRYAIFSDGVQDVYVVDLVECRVVAAMAADGPMT
                     DICEAPHGFVASFAKGVLRYLQPGVPLHVCGTATLAAVTDALHAARVRCSTASDSDGV
                     APGVYLMASTRFTSQLFLVEEGGMRATAADGWAYAMDEPTLAFGAGAATLAQCTATRW
                     CVGRVVHTLPGVFSHAAIAELPILGLVCVGAVAAAKHDACERLAVVTGTDVRILRIAE
                     AACGPWSCITVTALEGDMAMHVVMGRWEGGVTMAQLQYAPESSWRCVAACTVHPTFGA
                     GAPVQRLLPLPRAGEHTRWMATHASGEVSILTAAPLNTCAAEAVAAAGMPALLHAWAA
                     AENVRGGNGVSITATAAVPLLRAAGGDALNGFDGALLQPRDGAVLFFSVPLEEADTQT
                     PPLMRRHRESSEADVAWSTRLEYTVRAILEPLDAVQVRASSWREAILFERGTATGNLA
                     YDLLVAHHDKLTLLALDRHVFSRDQRAAGATPPGTRAYALVSAAPTRYVCTHQVRLSQ
                     TKAKARETLLEVASSPDGANGDLMLCVTVGAEAQHTTRLTTVRTTTLMTLDSVVLKDC
                     TAHWMASVPTSARAAGQHAAPLFLLCTLHVSSGGVQLQVVTGNPLRVVSSVTLEDVPA
                     PPDAQDEHVSIDGSVQLVPSRAGEHGELGMSEVLVTVAADYGIHLFALRGHTLYFQHC
                     VAAPECVSAVVLCYPVVTACTLGETNVYLQVYPVHDTTESLAPSYTAAATRLLKEYGK
                     VSWKMRVEAREPSLGACVIAQASLYDRCVRTDLEGDVSVVFASFVAAFSSTKPRTAPH
                     VNREDAYIGSADGPQSFLTHAVRLPSVPTKARFIRRAEAIHRRFPLQLQCNGRHVTLQ
                     SLSQRKDGSARLLLLPCHDGSLYSAYELPFSIAHPLMRLEQVITDTYALDLSATVHPT
                     FPGRLQHTYHLRPFHIAHALQPVVGIQRALKQACIIVDAVNEYFMLREVVRDGWSRSG
                     NTTRESIGDEAAAHRKFIALDDVVQTLLAEEYNGAYTVDDCAEALNLS"
     gene            <652267..>654702
                     /locus_tag="LMJF_22_1600"
                     /db_xref="GeneID:5651933"
     mRNA            <652267..>654702
                     /locus_tag="LMJF_22_1600"
                     /product="putative ser/thr protein phosphatase"
                     /transcript_id="XM_001683259.1"
                     /db_xref="GeneID:5651933"
     CDS             652267..654702
                     /locus_tag="LMJF_22_1600"
                     /codon_start=1
                     /product="putative ser/thr protein phosphatase"
                     /protein_id="XP_001683311.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651933"
                     /db_xref="GOA:Q4QBI7"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q4QBI7"
                     /translation="MEDKNRNLLSQLSGLRLSDGSVVGNRLGSGNTPPTLSAFGSRST
                     PPTTSPSSFPVSALPSHSIDALNGTHGKQQRRGNRAPRADAKKDGESPTSSVTDKINR
                     LLAQNKGSLANSGAATSESSGGNRDTGGASILSSLAAQIVHSPSLSPSNGTASSTHTS
                     TPTAVRTVSMPAASSSTVAVPKPRSVEVATAMSAATPAAMTIPAAAESLNPKVMEFFT
                     KAAGGSRPPPPLVEPTAALKSAIVIEEPKNGKATAGRKEKAVAAAAGAAASSSSASPA
                     PAVAATTSSNARSAHQAPSSTKSQKESTDPTNKFLVDAFGAIDNLDATKPIIRAAPEI
                     PREGRYIIVGDVHGCVDQLEQLVEKVKYVKGKDCLFIIGDYVNKGPDSIGAVRACQRL
                     GAYGVLGNHDYTLLRCCVRMRRRPFTPDDLRDPVKRLAQKLPKDCEYYLRGLPHIVRI
                     PRHNVLLVHAGLNLQHSVENQNVEEVMHLRRLEMVPHKPGMFKAIAKGVEGEPWAKLW
                     KGPEMVIFGHDAYAGFQAHAHACGIDTGCVYGDPLTCVVYGQNSPAGEFFSVPGLPKL
                     ENEMKGLPPPSSDIYEQEDMDLEKLIIRPTTRATPAMMNGSADSRPVFLEAPLGYKEA
                     EESSAVGASTVSSLKASNLTATVTSTNMVMTPISTSPLRLATPTCAVNERLMATNTVN
                     TREVQRATLLALSATRQLSAIAVLLGMPLYDQEIDAMLGSESADKVSQEAFWEPFTRL
                     ILVAAAEMPKDDTATLAGVEATLQLAFDVCEEMEAVGRTLQPELKKFLQAERESPAWS
                     KRIVKCAETLVLA"
     gene            <659273..>661444
                     /locus_tag="LMJF_22_1610"
                     /db_xref="GeneID:5651934"
     mRNA            <659273..>661444
                     /locus_tag="LMJF_22_1610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683260.1"
                     /db_xref="GeneID:5651934"
     CDS             659273..661444
                     /locus_tag="LMJF_22_1610"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683312.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651934"
                     /db_xref="UniProtKB/TrEMBL:Q4QBI6"
                     /translation="MAVIATLPAANYTHLLYICSDVVAACDRKTAYLVQHRGDSKVDE
                     ATCISPYDADSFVPWLPPGAPVARVRALWCMRKGQGYAVFAERAGESGATAATSPEAA
                     SVKIISDLAENIVSLHIFYQSILAVRTLKRVLFYSLDSSPTATSIATRIGTCALPRWV
                     SQPAVVVDIVSPVCRSAAAEKSICVACFTSDRMFVATIVCPSSASAAVVRRTAMSGVL
                     FSSPASDPAPTRVCKWAVRWCRQEMLMLCFSEADRTPRLTGFFLQPTRGCEMSKWMSP
                     EELATSVSGASPAAVRASSDICCDSDGAHVWLCDTTTGPSVVLREVTAALPSELVLTG
                     TSASTRVAMATGASGVFVLAGCTLYSVKRSHMGATSESAAATLTGTSNASSPGRASVA
                     AVGDLSRKQEASMQKESSAAETVAHKAAASERSSLSAHTLSTPLQPAAASISRSAQIK
                     DAVLEYAMGHTSVFSDVVRDTVYVHESGSATSGAAFTHDILSAISERLDADRHQHALA
                     RIRYGGVARSLHPYTVLELLRFRRGPSAEAMPNGLLLAIASTLADKPTLRAGGLWRLP
                     AFAAASAAFFASTGSSGPFTSELEKKRYVADVCDAAKAALASGALGAARLLFAVAARA
                     VSLIYGGTRRRHVEAAQPYGKEEQMCEATIAECISLMRSYVEWSLTASSSLGVMSAHV
                     GAPHTLTKEAALRDGEAHPISTSRQVQIHPMQVSRLPKRSI"
     gene            <663375..>671780
                     /locus_tag="LMJF_22_1620"
                     /db_xref="GeneID:5651935"
     mRNA            <663375..>671780
                     /locus_tag="LMJF_22_1620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683261.1"
                     /db_xref="GeneID:5651935"
     CDS             663375..671780
                     /locus_tag="LMJF_22_1620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683313.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651935"
                     /db_xref="InterPro:IPR008962"
                     /db_xref="UniProtKB/TrEMBL:Q4QBI5"
                     /translation="MPVFSARTQRAALRGARSIGEAKTSLKSFRPASSNRPAAAPPPS
                     KTRMEVTPPAAEFINYDVDTTYVMPLEVRNRTDEILTLRFVKPARHPGTFRLVNGASV
                     RVAPGLAHTVEIEFTTHAPQDYADALVILSSDGGRVEVPLTACRVPLIEFPPTVNFGK
                     VEQQLGCPMRTLTLVNRGRKDAAVTFVLDEGDERGDGTACGVVLSSTAVTAPAEGCTT
                     VTLELKPLPPGWHTWHIPVEMNGQRLPTLLEVSAEVVDCRSRLFDPQTHEDVVSVEFP
                     ETFDGNKASHQLEVVNGGSQAISFAIRSAHDISEGGAVPFRFVPTQGRLPPQGRLTVK
                     ALFTPQLKLRRTGWNTTPRSAPAETAEVHKYEALFTLLFVETEQTQSFRMVGTSRETL
                     VRLSTSVVDFGACVLKRSKESSLTLTNGVTHLPMRYALQCPPHFSVTPARGVVAAGGS
                     ATLRLEFRPRRLEPYVETLTLTANDTVTCAVELRGTPLYREGAEAPVAARPSAPEDEV
                     AVPAAVDLGMIPAEGLAPPSLPKQVPAAVLMAEDTAVQSYCSGHVAPPVFDVHSLAKR
                     RFCAAPTTPQERRDCKRELTPMEVLNVVLPSKSLNFGRVTIHADAVSSLFVYNGTKAS
                     IQVGVPTEAEGPVTVEPASQVVPAQRMAQFDVHIRSGTAQVFQQVMRVTVNQQHYMRF
                     TVQADVVPVEVTLSQTQVLLSLTGQAEEPVCTAQVILTNKGNCAVAYRWRLPAPSCEF
                     EVEPQVGLLNASEQRGATCYFRPAAGTSQASCEARLEVVGATEDKVLLLTGSVAPAKC
                     AWGASSLLTTLPLALASKDAAAVSSTLTLGRIAAGVPAVATLPLTNKGRTNAYFSIGA
                     LPAWLTVSPSQGRVCVGETEELTVRVRHAVAGAAAHMVECHVSGMRRPLVARVEATVV
                     APPLSVELDGKEQAEVHLDFGDVYVGYPQSRSVTLRNGGDVAAAVRVNLESCTYYSLD
                     SPVLEEEGQQDVVDSVMSLAALDDTKRSRLMSRVRSLHSFTVIDRKTSIGVATSTVVV
                     PSLSEYTLRLSFNPLRAAAVQRCPVRWHQLGADDVHPLPPFTVEATALVPPVVLSART
                     VSFPDVVVGQRPPPRVVFVRHGDLRMPPPLTRPRPVAWRLETEEGTPSFLLEPHRGVL
                     GVGEEQAVTITYLPTSAGRLQVCALLKTEEAESPTGAPCACCTISASATDPRVRSDRT
                     SLMFPAVPLGVAVETTVLLHNEGYDAVRVEYPGSCDPPLRVSFPDGDSMGAALRSTLP
                     VTFTFCSPTPISVRSAIRLHTDAGGYIDISISGSAVNSVITTEAFLSYMLRTTPATIT
                     AAAAGEGDDTSHVLQRWARDHESVVDAELPLVCTFPAALDGARDGQHNLVNMIEESVQ
                     WEAERAWLTAWWNAFVCRTPVQDVVEALQATRGGIVGDMIHQFTGKRPRRNEALESSL
                     TTPKRVSKRNGARSAATATVHGRKGTGAGTTRRGTRRQPPLEAAGTPTPSASSNTTPK
                     ELRTLHTLIQYVCSCGGCLTNVELPFLLPFDAFVEHAAAYTPSVLEQLSDIAESEDLE
                     SVFQRRATASWVAVLRECLRLFYVPQVRVTAATPVPPALRDWPSSALSKRSLSRSRIY
                     SEEESVLLRWVAACIAVFATGSNTDLHKSLSATSPRRFEDLRDAQALIIVVLTYVPFL
                     ANQVREAIASAAQQSREGNATVLLNLLQTLGVTGLPLADAFVSASATQLVLLLTHLFV
                     YLPKFINAVPVHFHGRALTTLTETVTVENTSPEPREYCVLLPDAPLFRANTDKLTVAP
                     RSSTQVTLSILPRTRRPVSGQCVLVDCSSQMPPAERVPLVFQLKATPTMEPLQTLYVE
                     TPQYECLQSELHITNPFSKDCVVSLRVAQMRLPDAAKTTDAASTPEASEPWLSGDDAS
                     FWRHKHDAPFTVSTEVLSLRCGEPTRLPFSFAPLSRGVYRLVLTFWEEWEGEFTWAVE
                     ATSGWPKPVDTNLALRVELGESCTSTLNVKSSNASLERCVKFYEDRAHSTQYTDVSRL
                     LSGARYAVHFVNERMEGPNPFFLPSQSSCLASTAPAATWPITFTFKPQCVGVYRTYAL
                     LISEADVRLLLIAGECVPKGDRRELRFSCPARQTIVQQITLCNYSAAEDWLFTATFEG
                     SAQFSGPHDVRVPSGRSKEYAIKYAPPWISAEETATLVLLNGSTGQKHTYTLVGTAEA
                     PLSEGILTLDCRARDHETLEMMVPNICGQDATYFVKTDLACCEGESPSLVIPRASSRR
                     FAVKVSPTVGGDYAGRVTFTGSSGRYVWYAVQLHVAPPEKEGLVELRTNVRTAMVADV
                     SVTNPLDSALMFKVHRYGAGLYGANTFQLAPKAAATYSLLFVPTQAGESTGRLSLVSE
                     AAGEFWYELHMTVTEAEPEPLSFPPTPIGQSQVMQVRLPNRSDASSVLTVESTDAACF
                     GVHQPRVVLPAHSESVVELVFTPRCVGVEQTAVVTLRNPELGCWRYRCVGAGTAPLTE
                     ETLTCTCEVGATSTLLLPFTNVLNRDTAIEVQLSGDTTAFALHTVPTGVVATGTSVSL
                     VVTFRPSLVKRHAAVVEVRPAVRHGDKTYDFTWTYPIEGCCVYRQTQPSLRLRCAART
                     PYDDTMYVHAPGLTPGLASAFSVVFEVDPQKSYAAALAASVSCSVTMPSPYPDGFELN
                     LKFAPLRPLVGSGWVVLRSAEGGAWQYRVQLESTPAPVDDTIVLYGEYKESTSVSFDL
                     YNVFPYRSTFFAYFTADSSKDFTVSPAHGVLLPFVPGQRGAATATNVQISVHPSSRIP
                     QIEGTLVVDTDDMQWTFRVLGKFGHQSRPPN"
     gene            <673554..>674570
                     /locus_tag="LMJF_22_1630"
                     /db_xref="GeneID:5651936"
     mRNA            <673554..>674570
                     /locus_tag="LMJF_22_1630"
                     /product="putative CCR4 associated factor"
                     /transcript_id="XM_001683262.1"
                     /db_xref="GeneID:5651936"
     CDS             673554..674570
                     /locus_tag="LMJF_22_1630"
                     /codon_start=1
                     /product="putative CCR4 associated factor"
                     /protein_id="XP_001683314.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651936"
                     /db_xref="GOA:Q4QBI4"
                     /db_xref="InterPro:IPR006941"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:Q4QBI4"
                     /translation="MTSKHTPQPYTMTANTPAWNPETRLPSLSKSAMIRDVWADNLEE
                     EFATIRSLIKDYPFVSLDTEFPGVVAKPVGSFKTTHEFYYQTLRCNVNLLKIIQLGIT
                     LLNDKGEVPEHCSTWQFNFRFSIKEDVYAQDSIELLRHGGINFDYFNDFGIEVTHFAE
                     LLISSGLVLNSNVRWLAFHAGYDFGYLIKVVCNKDLPEKEEEFLQTLHALFPSMFDLK
                     YLLRFTEVSHSFGLDYLAESLKLRRFGTAHQAGSDSLLTGHCYFKLLRDSFGNTAPVA
                     NNGVLYGLSEDAASSVTPSSAQTVTQVNSNSHNFSSPIAYGNGGASGGTFPAAPINSN
                     MRRP"
     gene            <676143..>676454
                     /locus_tag="LMJF_22_1640"
                     /db_xref="GeneID:5651937"
     mRNA            <676143..>676454
                     /locus_tag="LMJF_22_1640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683263.1"
                     /db_xref="GeneID:5651937"
     CDS             676143..676454
                     /locus_tag="LMJF_22_1640"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683315.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651937"
                     /db_xref="UniProtKB/TrEMBL:Q4QBI3"
                     /translation="MSFEREPVLEVAETSDFWSNPVDHFRPNLKFLSVYVEHQYVVDK
                     WLHIKENWLKPWYLPWWTPMYQVMTWYSQRNRNLMLVENNLNYRPYRYRRNDEDRKNP
                     Y"
     gene            <677592..>678752
                     /locus_tag="LMJF_22_1650"
                     /db_xref="GeneID:5651938"
     mRNA            <677592..>678752
                     /locus_tag="LMJF_22_1650"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683264.1"
                     /db_xref="GeneID:5651938"
     CDS             677592..678752
                     /locus_tag="LMJF_22_1650"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683316.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651938"
                     /db_xref="InterPro:IPR003495"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QBI2"
                     /translation="MIHDTLKVCVFVGFLGSGKTTILQRLLPTLPREEKVRIIVNDIS
                     RDNIDVHAFQPSGATNSTSARGNDVAALSGGCVCCNLLSDLVAELQSAHAQGCGYSLV
                     ECTGVADPVPIVATLHALPELRVCVAVDAVVMVIAASSLLSVTTGDQVALNSLDVLQG
                     DPIKGANVVLINNWEYTDRIDATMMRLWVRRIKEFASESNPHVRVYCTNDGYFAFDSL
                     VYRQGLFAADNVASFFLGAYAAAGQKIGTFGGNAAAEEEAGEMMKLGLRLFTLELRGK
                     VFSTQLLRRALFSPAARQLLKNVWRSKGYFSALDDEGSGGSYPAKEVQFRWQTVERKV
                     DYGEVLPPYVPLVGRESGEPLCCQVVFIGDFDTTAKAQQAAAFFSAVASRSV"
     gene            <679501..>681351
                     /locus_tag="LMJF_22_1660"
                     /db_xref="GeneID:5651939"
     mRNA            <679501..>681351
                     /locus_tag="LMJF_22_1660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683265.1"
                     /db_xref="GeneID:5651939"
     CDS             679501..681351
                     /locus_tag="LMJF_22_1660"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683317.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651939"
                     /db_xref="UniProtKB/TrEMBL:Q4QBI1"
                     /translation="MLCGSSCHEDSFLDAILDELTVNPYSDLPTVLARVERAQTAESN
                     VERMRQRTAEQQEERAARLRNEWASATQHLSPASRAESQHSLSLEALTASSSAYLDSL
                     ARAADGEPVASLRGAPGTLGPPPLCAPAKLAAEALSPLTSALSLSDFRDEHASSVLRS
                     AYVRLLPYILAVAAPPATRSTSLALATSSTTLAVAAGGGSASVLPWYAVHTDDSAVRE
                     LLSPYMSSVVGPLEKELRFHFNAGCDTAAVHEPQHFFSFLIECFQRQQRIVSAQWAAS
                     RPQDSESEAALRLLESVGQIVLSATAVVVFQECYGWRPDSALSRHKEYVVVTVNAVLD
                     FVASAEGRLCRDSVQLLVEHLLAEEVLQLYAQCGAEMAVAALRDGAARLWRRSFLMEG
                     AGHASFPLYTCSLHLVRSLEAFQRRLLNSLLLLRGSWAELVWRRCVEPALVAFLGTVE
                     KEALPAVADAAAASWESVLSLQWCVASAQVVAAAAEDWLGMLRESCAATASTASSPSS
                     LSKSETLDALMLFRDQLARRSAEHAQLLTRQLCTPQPGDAAQAARLLHGAEELLRLMG
                     ELPDSTSAPYVVQDLMQGVLQKNLSPEHKAELLSYTKRCGLQRFTQLLVA"
     gene            <684191..>686950
                     /locus_tag="LMJF_22_1670"
                     /db_xref="GeneID:5651940"
     mRNA            <684191..>686950
                     /locus_tag="LMJF_22_1670"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683266.1"
                     /db_xref="GeneID:5651940"
     CDS             684191..686950
                     /locus_tag="LMJF_22_1670"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683318.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651940"
                     /db_xref="GOA:Q4QBI0"
                     /db_xref="InterPro:IPR001876"
                     /db_xref="UniProtKB/TrEMBL:Q4QBI0"
                     /translation="MRAPVALPRSRRVLVSPHRFSPLHHRSTWGLHNGDSLLWSRELT
                     DRTRVPMSLSASIGNVVSGDPLQVPFRALLLGYGTHPTLLSLATGHTLLFDALSASAD
                     LVQQRAMLNPCRGRLVEMQGRCVDAAWRLVHYYQADVRRVHELPLKHSHLLDDMRLVY
                     LITSASPNTGLLVSKELRHGRELSLDVACTLLSLPCTPDVLRAILVFTLRTHAAVVDA
                     LQFQRCAHALLSNDNFFSERTFAPMHGLLHDVLLPSLRRGATRNDSFDFVAVRWTTLM
                     NKWSRVYAKSGRGFHLHDCLETLLQAVPAAETKLPASFYIRLLGALLDATAAGEGHRS
                     AKAGWERMKTVAGDALRLFGRNPEDLRAVWVLLLKGALTLPPAAEDHWRLLDAYHLCA
                     QRGHAVVVDRQGFRQVIRLVAAAVSALPLPQVTQLVRSFCTFLHEQTSVSFLWLLDGV
                     GTVLTELWQHHRLEAQGEAEQLLRVLRTLLRERCVSGVDLHSNPVIARALDHFRIGGA
                     AAYWWTCGCGEVIPCTSKRCASCLRKSGVSWICPQCHAAHKLPCKTQSCSCECLNPRM
                     AAAVNANVSICDTCGGLVTAEDCICARCKQQRQESGRTVECAHCHGTYKGNGLHCPQC
                     FAPNPDKHLYLWHCVDCDDFNYSIWSSCRSCKTPRRIGALRVSFVPWKCGCGALNHPC
                     RLTCERCGTGEHRHTYTCAGCDARVSLHSLRRTLLTVDGKALSLHLCPQCQCPHPRDD
                     LVLYSPSFPRHCMLCAHTVKPSSISASGSFFHCDTVQRVNEHYLFRCTRCDYTELQTG
                     YHCQRCHFPRPEMEALLQDEEAGAAPLSHVWRCLHEADDGALCGQWNYGWSAHCLACR
                     RGRPDSACECRAKSQMWTCETCGKPNRPIDVLFCAHCKTGLRPVLGCATCGLPHMSYA
                     CRVCL"
     gene            <687755..>689424
                     /locus_tag="LMJF_22_1680"
                     /db_xref="GeneID:5651941"
     mRNA            join(<687755..688471,688474..>689424)
                     /locus_tag="LMJF_22_1680"
                     /product="putative phosphoinositide-specific phospholipase
                     C"
                     /artificial_location="low-quality sequence region"
                     /transcript_id="XM_001683267.1"
                     /db_xref="GeneID:5651941"
     CDS             join(687755..688471,688474..689424)
                     /locus_tag="LMJF_22_1680"
                     /artificial_location="low-quality sequence region"
                     /codon_start=1
                     /product="putative phosphoinositide-specific phospholipase
                     C"
                     /protein_id="XP_001683319.1"
                     /db_xref="GeneID:5651941"
                     /db_xref="GOA:Q4QBH9"
                     /db_xref="InterPro:IPR000909"
                     /db_xref="InterPro:IPR001192"
                     /db_xref="InterPro:IPR001711"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR017946"
                     /db_xref="UniProtKB/TrEMBL:Q4QBH9"
                     /translation="MLHCSREEVGELLIDSCKRSVGTSVELDTLLSNKNTSKVAPDAT
                     AATIMQVRMMYGKDDSGDLSYAEMTRLVEGLSSSKDLTERILKPFEDDNRHTIAFSEF
                     AKVYSNAVSFKELGYVFQDLAGGQQTISRDTFASFVCDIQDEDWDAETLNEKLALMGC
                     VGIDGITENNFVGYIMSPYFDFAMEKKLTGVYQDMDQIMCCYFISSSHNTYLTGDQLT
                     SKSSAQMYKKGASRRVPVREAICRNGPHGEPIVCHGYTRTSCIAFEECVKMIRQYAFT
                     ASAYLVILSLGVHTSVEQQDKMAEILEEGLGSLLFWPPWGSNEKPTMAFSPNNLKNKI
                     LVKAKRGDFPAREPRVDKDDDATETDSMASTNNADYLKMKEARRKAGKDEVRVSAKLS
                     AIVSIESSKYQGVKDLSYLKDKQPHHCSSYSERKGKAIVREAHNALVCINDTCLSRVF
                     PAGSRIDSSNYRPLLYWVSGCQMVAINWQSSDTFGWRLNGCIFLDSGCCGYLLKPDYL
                     RPVTCPDVAVPEYLRSLTVEVIWGFALPSAKQARGCRPVCDSFPRGP"
     gene            <695364..>701963
                     /locus_tag="LMJF_22_1690"
                     /db_xref="GeneID:5651942"
     mRNA            <695364..>701963
                     /locus_tag="LMJF_22_1690"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683268.1"
                     /db_xref="GeneID:5651942"
     CDS             695364..701963
                     /locus_tag="LMJF_22_1690"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683320.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651942"
                     /db_xref="UniProtKB/TrEMBL:Q4QBH8"
                     /translation="MRKGSCIVDVAMPPLTSCAVIFFLLVCVLWRMEDGVELCAVGLV
                     SCFHGRAFRMAMRISLFLLHAFLVFMRAYCPLGYTLLCVAGGLVVQVCVLLSLSLSLG
                     MRALRSSCPAFLCWQALPSTTPLLREIRRHDPPSTRSEQGSPDSSNTEQIQKASHLDS
                     HSTANADHSQALPPAEAVPPLTADTLRVPQVRAECPPDSALLSPGNGLTPTLAECASN
                     AAPQPSEAAPVLAADALPPTPAECAPDAAPQPSEAAPVLAADTLPPTPAECASNAAPQ
                     PSEKTAPKRDASAPLPRKREREGACDSSFWPLKTRRALDAFTHTAARQPSEAALLSAV
                     DALPPTPAECAPDAAPQPSEAAPVSAADALPPTPAECAPDAGPQPSEAALVSAVDALP
                     PTPAECAPDAEPQPSEAAPVSAVDALPPTPAECAPDAAPQPSEAAPVSAADALPPTPA
                     ECAPDAAPQPSEAAPVLAVDALPPTPAECAPDAEPQPSEAAPVLAADALPPTPAECAP
                     DAAPQPSEAAPVLAVDALPPTPAECAPDAEPQPSEAAPVLAVDALPPTPAECAPDAEP
                     QPSEAAPVSAVDALPPTPAECAPDAALQPSEAAGMFAGKASPRMHFARNQREEVGSVF
                     PMRWRSAGCKADAERAAAFLAAAFGEWPTRAVSLHSCSGKVGSPAWNNVSQPSEAAPV
                     LAADALPPTPAECAPDAAPQPSEAAGMFGGKASPRMHFARNQREEGGTVMATRPLSTS
                     CRVDGPRAAARFAAVFGGLPTLELSPAFRCPKVGSPASNNVPRPSEAAPVLAVDALPP
                     TPAECAPDAAPELGDSAPVSVSHTRPPTPAECAPDAAPELGDSAPVSVSHTRPPTPAE
                     CAPDAGPELGDSAPVSVSHTRPPTPAECAPDAGPELGDSAPVSVSHTRPPTPAECAPD
                     AGPELGDSAPVSVSHTRPPTPAECAPDAGPELGDSAPVSVSHTRPPTPAECAPDAGPE
                     LGDSAPVSVSHTRPPTPAECGHDFVPVSTESVRPMLSRGVSAEAWSAASSVEVAARRA
                     VTPDPDYSSCHTSMYAELRAALDGGRAVTTSVDRLRSQAYGSPVPYAALHESMTVPPT
                     QFDDRFPGFAHPALYHPLDAYTAVEPDPDYSSCHTSMYAELRAALDGGRAVTTSVDRL
                     RSQAYGSPVPYAALHESMTVPPTQFDDRFPGFAHPALYHPLDAYIAVEPAPAYSSRHT
                     PMHAELRAALDGGRSVRHVSYPLRPSKRFAPALGAAPQPSEAAPVLAVDALPPMPAEC
                     ASDAAPELGDSAPVSVSHTRPPTPAECAPDAGPELGDSAPVSVSHTRPPTPAECAPDA
                     APELGDSAPVSVSHTRPPTPAECAPDAAPQPSEAARPLDETASLRRKRPRDDASDYSF
                     WPRRRRFSRPLRWEPVTVPPVKLPQDTRRALRASAQTAVRRPSEAAPVSAADALPPTP
                     AECASDAAPELGDSAPVSLSHTRPPTPAECAPDAGPQPSEAVPVLAVDALPPTPAECA
                     SDAAPELGDSAPVSLSHTRPPTPAECAPDAAPQPSEAVPVLAVDALPPTPAECAPDAA
                     PQPSEAARPLDETASLRRKRPRDDASDYSFWPRRRRFSRPLRWEPVTVPPVKLPHDTR
                     RALRASAQTAVRRPSEAAPVLAVDALPPTPAECAPDAGPQPSEAALVSVVDVLPPTPA
                     ECAPDAAPQPSEAAPVLAADALPPTPAECAPDAGPQPSEAALVSVVDALPPTPAECAP
                     DAAPQPSEAALVSVVDVLPPTPAECAPDAGPQPSEAAPVLAADALPPTPAECASDAAP
                     ELGDSAPVSLSHTRPPTPAECAPDAAPQPSEAVPVLAVYALPPTPAECAPDAGPQPSE
                     AALVSVVDALPPTPAECAPDAAPQPSEAALVSVVDALPPTPAECAPDAAPQPSEAALV
                     SVVDALPPTPAECAPDAGPQPSEAAPVLAVEAPCCMWRRSVRDLASDHMVARRRRSVL
                     RRVKTSRRSNRRSLGARPLAGPSRSHVRDGWQSVLGVIRRWKSKAFGLDRGDIVGSVR
                     GSEPAAGPQPSEAAPVLAADALPLTPAECAPDAAPQPSEAAPVLAVEAPCCMWRRSVR
                     DLASDHMVARRRRCVLRRVKTSRRSNRRGLSPCASAAGWRSRLRGGWHSLVRMLRRFY
                     RGAVCFGHRLISRRSRAHARDAAPQLSEVLMLPAQNDLPAVVPPAPRVVLDPGRAPLP
                     VSAHWMADS"
     gene            complement(<704786..>713482)
                     /locus_tag="LMJF_22_1700"
                     /db_xref="GeneID:5651943"
     mRNA            complement(<704786..>713482)
                     /locus_tag="LMJF_22_1700"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683269.1"
                     /db_xref="GeneID:5651943"
     CDS             complement(704786..713482)
                     /locus_tag="LMJF_22_1700"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683321.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651943"
                     /db_xref="UniProtKB/TrEMBL:Q4QBH7"
                     /translation="MHLQHTRTFIFTAHTYMYLQHTCIFIFTAHTYMHLQHTRICIFT
                     AHTYMYLQHTCIFIFTAHTYMHLQHTCIFIFTAHTYMHLQHTCTFIFTAHTYMHLQHT
                     CIFIFTAHTYMHLQHTCTFIFTAHTYMHLQHTCIFIFTAHTYMHLQHTCIFIFTAHTY
                     MYLQHTCIFIFTAHTYMHLQHTCIFIFTAHTYMHLQHTCIFIFTAHTYMHLQHTCIFI
                     FTAHTYMHLQHTCTFIFTAHTYMHLQHTCTFIFTAHTYMHLQHTCIFIFTAHTYMHLQ
                     HTCIFIFTAHTYMHLQHTCIFIFTAHTYMHLQHTCIFIFTAHTYMHLQHTCIFIFTAH
                     TYMHLQHTCIFIFTAHTYMHLQHTCIFIFTAHTYMHLQHTCTFIFTAHTYMHLQHTCI
                     FIFTAHTYMYLQHTCIFIFTAHTYMHLQHTCIFIFTAHTYMHLQHTCIFIFTAHTYMH
                     LQHTCIFIFTAHTYMYLQHTCIFIFTAHTYMHLQHTCIFIFTAHTYMHLQHTCIFIFT
                     AHTYMHLQHTCIFIFTAHTYMHLQHTCTFIFTAHTYMHLQHTCIFIFTAHTYMHLQHT
                     CIFIFTAHTYMHLQHTCIFIFTAHTYMHLQHTCIFIFTAHTYMHLQHTCIFIFTAHTY
                     MHLQHTCIFIFTAHTYMHLQHTCIFIFTAHTYMHLQHTCIFIFTAHTYMHLQHTCIFI
                     FTAHTYMHLQHTCIFIFTAHTYMHLQHTCTFIFTAHTYMHLQHTCIFIFTAHTYMHLQ
                     HTCTFIFTAHTYMHLQHTCIFIFTAHTYMYLQHTCIFIFTAHTYMHLQHTCIFIFTAH
                     TYMHLQHTCIFIFTAHTYMHLQHTCIFIFTAHTYMYLQHTCIFIFTAHTYMHLQHTCT
                     FIFTAHTYMHLQHTCIFIFTAHTYMHLQHTCIFIFTAHTYMHLQHTCIFIFTAHTYMH
                     LQHTCTFIFTAHTYMYLQHTCIFIFTAHTYMHLQHTCIFIFTAHTYFYIYSTHVYVFT
                     THMYFYIYSTHVYVFTTHMYFYIYSTHVYEFTTHMYFYIYSTHVYAFTTHMYFYIYST
                     HVYAFTTHTYFYIYSTHVYVFTTHMYFYIYSTHVYAFTTHMYFYIYSTHVYAFTTHTY
                     FYIYSTHVYVFTTHMYFYIYSTHVYAFTTHMYFYIYSTHVYAFTTHTYFYIYSTHVYE
                     FTTHMYFYIYSTHVYAFTTHMYFYIYSTHVYAFTTHTYFYIYSTHVYVFTTHMYFYIY
                     STHVYAFTTHTYFYIYSTHVYVFTTHMYFYIYSTHVLLYLQHTRICIYNTHVLLYLQH
                     TRICIYNTHVFLYLQHTRICIYNTHVLLYLQHTRICIYNTHVLLYLQHTRICIYNTHV
                     FLYLQHTRICIYNTHVFLYLQHTRICIYNTHVFLYLQHTPICIYNTHVFLYLQHTRIC
                     IYNTHVFLYLQHTRICIYNTHVLLYLQHTRICIYNTHVFLYLQHTRICIYNTHVFLYL
                     QHTRICIYNTHVLLYLQHTRICIYNTHVFLYLQHTRICIYNTCIFIFTAHTYMHLQHT
                     CIFIFTAHTYMHLQHTCIFIFTAHTYMYLQHTCIFIFTAHTYMHLQHTCIFIFTAHTY
                     MHLQHTCIFIFTAHTYMHLQHTCIFIFTAHTYMHLQHTCTFIFTAHTYMHLQHTCIFI
                     FTAHTYMYLQHTCIFIFTAHTYMHLQHTCIFIFTAHTYFYIYSTHVYAFTTHMYFYIY
                     STHVYAFTTHMYFYIYSTHVYAFTTHMYFYIYSTHVYAFTTHMYFYIYSTHVYAFTTH
                     MYFYIYSTHLYVFTTHMYFYIYSTHVYAFTTHMYFYIYSTHVYAFTTHMYFYIYSTHV
                     YAFTTHMYFYIYSTHVYAFTTHMYFYIYSTHVYAFTTHMYFYIYSTHVYAFTTHMYFY
                     IYSTHVYAFTTHMYFYIYSTHVYAFTTHMYFYIYSTHVYAFTTHMYFYIYSTHVYAFT
                     THMYFYIYSTHVYAFTTHMYFYIYSTHVYAFTTHMYFYIYSTHVYAFTTHMYFYIYST
                     HVYAFTTHMYFYIYSTHVYAFTTHMYFYIYSTHVYAFTTHMYFYIYSTHVYAFTTHMY
                     FYIYSTHVYAFTTHMYFYIYSTHVYAFTTHMYFYIYSTHVYAFTTHMYFYIYSTHVYA
                     FTTHMYFYIYSTHVYAFTTHMYFYIYSTHVYAFTTHMYFYIYSTHVYAFTTHMYFYIY
                     STHVYAFTTHMYFYIYSTHVYAFTTHMYFYIYSTHVYAFTTHMYFYIYSTHVYAFTTH
                     MYFYIYSTHVYAFTTHMYFYIYSTHVYAFTTHMYFYIYSTHVYAFTTHMYFYIYSTHL
                     YVFTTHMYFYIYSTHVYAFTTHMYFYIYSTHVYAFTTHMYFYIYSTHVYAFTTHMYFY
                     IYSTHVYVFTTHMYFYIYSTHVYAFTTHMYFYIYSTHLYAFTTHMYFYIYSTHVYAFT
                     THMYFYIYSTHVYAFTTHMYFYIYSTHVYAFTTHMYFYIYSTHLYVFTTHMYFYIYST
                     HVYAFTTHMYFYIYSTHVYAFTTHMYFYIYSTHVYAFTTHMYFYIYSTHVYVFTTHMY
                     FYIYSTHVYAFTTHMYFYIYSTHLYAFTTHMYFYIYSTHVYAFTTHMYFYIYSTHVYA
                     FTTHMYFYIYSTHVYAFTTHMYFYIYSTHVYAFTTHMYFYIYSTHVYAFTTHMYFYIY
                     STHVYAFTTHMYFYIYSTHVYAFTTHMYFYIYSTHVYAFTTHMYFYIYSTHVYAFTTH
                     MYFYIYSTHVYAFTTHMYFYIYSTHVYVFTTHMYFYIYSTHLYAFTTHTYFYIYSTHV
                     YAFTTHMYFYIYSTHLYVFTTHTDLYNTHRHLQHRQTFTTHTDIYNTHRPLQHAPTFT
                     THTDIYNTHRHLQHTQTFTTRTDIYNTHRHLQHTQTFTTRTDIYNTHRPLQHYRHLQH
                     TQTFTTHTDIYNTHRPLQHAPTFTTHTDLYNTHRHLQHAPTFTTRIYFYNIYIYLFIY
                     LFTAYIYEKRGV"
CONTIG      join(FR796418.1:1..716602)
//
DBGET integrated database retrieval system