GenomeNet

Database: RefSeq
Entry: NC_007264
LinkDB: NC_007264
Original site: NC_007264 
LOCUS       NC_007264             772565 bp    DNA     linear   CON 18-JUN-2017
DEFINITION  Leishmania major strain Friedlin complete genome, chromosome 23.
ACCESSION   NC_007264 CT005262
VERSION     NC_007264.2
DBLINK      BioProject: PRJNA15564
            BioSample: SAMEA3138173
            Assembly: GCF_000002725.2
KEYWORDS    RefSeq; complete genome.
SOURCE      Leishmania major strain Friedlin
  ORGANISM  Leishmania major strain Friedlin
            Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae;
            Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Rogers,M.B., Hilley,J.D., Dickens,N.J., Wilkes,J., Bates,P.A.,
            Depledge,D.P., Harris,D., Her,Y., Herzyk,P., Imamura,H., Otto,T.D.,
            Sanders,M., Seeger,K., Dujardin,J.C., Berriman,M., Smith,D.F.,
            Hertz-Fowler,C. and Mottram,J.C.
  TITLE     Chromosome and gene copy number variation allow major structural
            change between species and strains of Leishmania
  JOURNAL   Genome Res. 21 (12), 2129-2142 (2011)
   PUBMED   22038252
REFERENCE   2
  AUTHORS   Ivens,A.C., Peacock,C.S., Worthey,E.A., Murphy,L., Aggarwal,G.,
            Berriman,M., Sisk,E., Rajandream,M.A., Adlem,E., Aert,R.,
            Anupama,A., Apostolou,Z., Attipoe,P., Bason,N., Bauser,C., Beck,A.,
            Beverley,S.M., Bianchettin,G., Borzym,K., Bothe,G., Bruschi,C.V.,
            Collins,M., Cadag,E., Ciarloni,L., Clayton,C., Coulson,R.M.,
            Cronin,A., Cruz,A.K., Davies,R.M., De Gaudenzi,J., Dobson,D.E.,
            Duesterhoeft,A., Fazelina,G., Fosker,N., Frasch,A.C., Fraser,A.,
            Fuchs,M., Gabel,C., Goble,A., Goffeau,A., Harris,D.,
            Hertz-Fowler,C., Hilbert,H., Horn,D., Huang,Y., Klages,S.,
            Knights,A., Kube,M., Larke,N., Litvin,L., Lord,A., Louie,T.,
            Marra,M., Masuy,D., Matthews,K., Michaeli,S., Mottram,J.C.,
            Muller-Auer,S., Munden,H., Nelson,S., Norbertczak,H., Oliver,K.,
            O'neil,S., Pentony,M., Pohl,T.M., Price,C., Purnelle,B.,
            Quail,M.A., Rabbinowitsch,E., Reinhardt,R., Rieger,M., Rinta,J.,
            Robben,J., Robertson,L., Ruiz,J.C., Rutter,S., Saunders,D.,
            Schafer,M., Schein,J., Schwartz,D.C., Seeger,K., Seyler,A.,
            Sharp,S., Shin,H., Sivam,D., Squares,R., Squares,S., Tosato,V.,
            Vogt,C., Volckaert,G., Wambutt,R., Warren,T., Wedler,H.,
            Woodward,J., Zhou,S., Zimmermann,W., Smith,D.F., Blackwell,J.M.,
            Stuart,K.D., Barrell,B. and Myler,P.J.
  TITLE     The genome of the kinetoplastid parasite, Leishmania major
  JOURNAL   Science 309 (5733), 436-442 (2005)
   PUBMED   16020728
REFERENCE   3  (bases 1 to 772565)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 772565)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire, CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR796419.
            On Jun 1, 2012 this sequence version replaced NC_007264.1.
            Data release policy www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..772565
                     /organism="Leishmania major strain Friedlin"
                     /mol_type="genomic DNA"
                     /strain="Friedlin"
                     /db_xref="taxon:347515"
                     /chromosome="23"
     gene            <2243..>4084
                     /locus_tag="LMJF_23_0010"
                     /db_xref="GeneID:5652168"
     mRNA            <2243..>4084
                     /locus_tag="LMJF_23_0010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683270.1"
                     /db_xref="GeneID:5652168"
     CDS             2243..4084
                     /locus_tag="LMJF_23_0010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683322.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652168"
                     /db_xref="UniProtKB/TrEMBL:Q4QBH6"
                     /translation="MWDPLSYIYQAVGSKHTESSSATLPSFYEYTTRPFLLKKEEEQL
                     HSKMAAERVAWKSLSLSFCGKDYAAHYSSDRGSEEFVQDLRVVVKSIEDDLMRGESIY
                     SGFLEQVDKLQKEIRGAAVDVVFDNDLSVDTLYIREGFLCCELRKRLRVPATVSTLLL
                     ERGSFHFLIKGEGCTVCMTAMIDNDGAPVHYEGVVLESDTLCCSNGICRSGRGSKDRC
                     FVTVFSGDEMGCAAGLLLAEGVVGGEHVEKTLRTLVDAGVLVCFSSVYNDGSVCQYEQ
                     HAQESDISAVPAAAQHYAAARRTRVVRCSRNADAMHLLNADVSKGMPPDVAALDLALR
                     SPPLVATMQTVPGPSYFEVVRCVGPLGVLDGPLALSIAHDSPLHNNVLKHGDTIVLFH
                     VADQDVWKKGPSRQWLVPARCDAAKTKAGCFSVPRCCSVAGVLLFTTERSFSAGDSAV
                     VIGKLADANRTEQPLCAPFSRFSSLFHYTPFVCKFLHRQHGPIGFVGFSFAFCSTAPL
                     LAMALLPLHVTDFISSETDVDPTITLFFFRREYGGFSVRNYPYFTDALPCPLHRLIDE
                     KTSLVAGTATCRLLQVESLLGESSTFMMLSVSRVAFDGSDILQFGEC"
     gene            <5820..>6971
                     /locus_tag="LMJF_23_0020"
                     /db_xref="GeneID:5651945"
     mRNA            <5820..>6971
                     /locus_tag="LMJF_23_0020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683271.1"
                     /db_xref="GeneID:5651945"
     CDS             5820..6971
                     /locus_tag="LMJF_23_0020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683323.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651945"
                     /db_xref="UniProtKB/TrEMBL:Q4QBH5"
                     /translation="MCKEFVASAEGTGLIASLYVVDYMRKQDNVAAKSTFYDVLIELE
                     HAIRRDVFIVEQIKYTTKESKESKKSLEATRAEIFRIHCAAKVFAFQLLGDTVAEDEK
                     VVSYASKKQDSIDEALNAWEKASIKIKEPMADIEHCWVAKHEKQQCGSLYETAAVFDE
                     QPNKLFALLLPSVRAKLPMLPMQEGEVQYLLPGKSAMLLLDSAPPSEGWMISKRLLVE
                     ARKSKLSREDEQTLLGLLNESLVSRLGVSPQQLSELATHSPEVCASVLLKVPPGSAGA
                     FIQFLLKGNIPEDNMQTILLRASSVLHQVNVRTYISTMLHRLKDRGVSSSAAESLKSF
                     ALTLHQLVIKAAKENREIFIADTFRADLEQLFQSSSNPEVKNRWEEMKR"
     gene            <7613..>8491
                     /locus_tag="LMJF_23_0025"
                     /db_xref="GeneID:5651946"
     mRNA            <7613..>8491
                     /locus_tag="LMJF_23_0025"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683272.1"
                     /db_xref="GeneID:5651946"
     CDS             7613..8491
                     /locus_tag="LMJF_23_0025"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683324.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0025"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0025"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651946"
                     /db_xref="UniProtKB/TrEMBL:Q4QBH4"
                     /translation="MDDVKVTFAFVTSSSIKCCAAAQCNDESTVDVSETLSGAPQHEL
                     RAAIIKVLDYDAGCSRVFCMTYPHGTRMRSVCESLADAMAANASEMVCFTPPPMPADR
                     VLRLCAMRVLEPGDDVPDVLFCQKAATPRRGAVALSSWLLVNVLLCGNDGALSVGHLP
                     CVVQVPGASITRDGICSSLCALLRMGVECERHLRSCALFCCTAERKSIVLRDPFHDGG
                     CPSQVAIIYGVVDVGDVVLVSAAFPSAAAEARPSVLQAVVVRRFTEDGVTLYDVKEVD
                     TAVVLERLTCTQLVPL"
     gene            <8699..>10300
                     /locus_tag="LMJF_23_0030"
                     /db_xref="GeneID:5651952"
     mRNA            <8699..>10300
                     /locus_tag="LMJF_23_0030"
                     /product="putative beta propeller protein"
                     /transcript_id="XM_001683273.1"
                     /db_xref="GeneID:5651952"
     CDS             8699..10300
                     /locus_tag="LMJF_23_0030"
                     /codon_start=1
                     /product="putative beta propeller protein"
                     /protein_id="XP_001683325.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651952"
                     /db_xref="GOA:Q4QBH3"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR018983"
                     /db_xref="UniProtKB/TrEMBL:Q4QBH3"
                     /translation="MLLCSSTSVFLYAFPLLLLPVFFCLFLCLIAGTTGIVLVSLRSV
                     DRTTFCCSAHTMSADWTLPLRKVPVHATKDPSVAWNTVHLCYEQTFFGQITSLRYNHA
                     GSLLGGTSTNQFALLRVPQTDGVVVNEQTERKNYSVRFREDDKLYIQAVDQRVVLRSS
                     ETAFERQYLGHSRDVRSAIFIGRHNFASASDDTTVKLWDLMSDDDLGTARIHTDYVRC
                     LEPYAGGSFFSGSYDHRVNLWDPRTGMLAPLQTSGDSITQAVEALCFVPSEEIVAVGA
                     GDRVVVFDPRKGLSTPLFQGSFHTKSVVAVAYSQKLRSLLTGSLDCRVKMFSLEGSEL
                     RCISNKRFENGVTSLAVHPGSTEYAVGSTTGELNVYRFREAGIEEDDAPEELVLDKEK
                     TRSKEQVLQDKMKEVQFQLRSYQYGKALKTALYSRHPDVLVSTFEELVRRGALHVALN
                     NQNDRTIVRVLRFATHYVEKPQFTDTMLVVFETIFDIYSAYVGKSAFFHREILNAQKK
                     IGASLAVIQRMERSMGIMEMIVHSE"
     gene            <11076..>11756
                     /locus_tag="LMJF_23_0040"
                     /db_xref="GeneID:5651953"
     mRNA            <11076..>11756
                     /locus_tag="LMJF_23_0040"
                     /product="peroxidoxin"
                     /transcript_id="XM_001683274.1"
                     /db_xref="GeneID:5651953"
     CDS             11076..11756
                     /locus_tag="LMJF_23_0040"
                     /EC_number="1.11.1.-"
                     /codon_start=1
                     /product="peroxidoxin"
                     /protein_id="XP_001683326.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651953"
                     /db_xref="GOA:Q4QBH2"
                     /db_xref="InterPro:IPR000866"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR019479"
                     /db_xref="InterPro:IPR024706"
                     /db_xref="UniProtKB/TrEMBL:Q4QBH2"
                     /translation="MLRRLSTSSFLKRAQFRGFAATSPLLNLDYQMYRTATVREAAPQ
                     FSGQAVVNGAIKDINMNDYKGKYIVLFFYPMDFTFVCPTEIIAFSDRHADFEKLNTQV
                     VAVSCDSVYSHLAWVNTPRKKGGLGEMHIPVLADKSMEIARDYGVLIEESGIALRGLF
                     IIDKKGILRHSTINDLPVGRNVDEALRVLEAFQYADENGDAIPCGWKPGQPTLDTTKA
                     AEFFEKNM"
     gene            <12570..>13457
                     /gene="CYP11"
                     /locus_tag="LMJF_23_0050"
                     /db_xref="GeneID:5651954"
     mRNA            <12570..>13457
                     /gene="CYP11"
                     /locus_tag="LMJF_23_0050"
                     /product="putative cyclophilin 11"
                     /transcript_id="XM_001683275.1"
                     /db_xref="GeneID:5651954"
     CDS             12570..13457
                     /gene="CYP11"
                     /locus_tag="LMJF_23_0050"
                     /EC_number="5.2.1.8"
                     /codon_start=1
                     /product="putative cyclophilin 11"
                     /protein_id="XP_001683327.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651954"
                     /db_xref="GOA:Q4QBH1"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR020892"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="PDB:2HQJ"
                     /db_xref="UniProtKB/TrEMBL:Q4QBH1"
                     /translation="MSRTSVPPKVGQRPGIGVEKTTNPKVFFDISIDNKAAGRIVMEL
                     YADTVPKTAENFRALCTGEKGKGRSGKPLHYKSSVFHRVIPNFMIQGGDFTRGNGTGG
                     ESIYGTTFRDESFSGKAGRHTGLGCLSMANAGPNTNGSQFFICTAATPWLDGKHVVFG
                     RVIDGLDVVKKVERLGSSSGKTRSRIVVSDCGEVAADKSKGQRPPQQQHQPAKASADM
                     KRAADKKAVAEKLLASSPAAEGQKALSAKKETPPQVAAPSEAKKRMRAVDEEETRLAR
                     LREKKAKLAALRSSAAGNE"
     gene            <14037..>14558
                     /locus_tag="LMJF_23_0060"
                     /db_xref="GeneID:5651947"
     mRNA            <14037..>14558
                     /locus_tag="LMJF_23_0060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683276.1"
                     /db_xref="GeneID:5651947"
     CDS             14037..14558
                     /locus_tag="LMJF_23_0060"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683328.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651947"
                     /db_xref="UniProtKB/TrEMBL:Q4QBH0"
                     /translation="MLRCVSRRLWYQFKDLKSKVILEKLRNSKLQEGVHPSDMDMEDL
                     ARESGIAPPSSVNVQDFVHEKEAVLEMLQEQRLRRIARREAFLEWQAGQREKGAAHRL
                     VRQSRKAEKYKRRHYHATSGRMLPISLSPGQAPPDHRAPMSMPKACVSSTEFLRGGPA
                     ENRHAIHLSLEKK"
     gene            <15070..>16068
                     /locus_tag="LMJF_23_0070"
                     /db_xref="GeneID:5651948"
     mRNA            <15070..>16068
                     /locus_tag="LMJF_23_0070"
                     /product="agmatinase-like protein"
                     /transcript_id="XM_001683277.1"
                     /db_xref="GeneID:5651948"
     CDS             15070..16068
                     /locus_tag="LMJF_23_0070"
                     /EC_number="3.5.3.11"
                     /codon_start=1
                     /product="agmatinase-like protein"
                     /protein_id="XP_001683329.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651948"
                     /db_xref="GOA:Q4QBG9"
                     /db_xref="InterPro:IPR006035"
                     /db_xref="InterPro:IPR023696"
                     /db_xref="UniProtKB/TrEMBL:Q4QBG9"
                     /translation="MFTKFLSRVKAMPPRSGDWANKLGPVALMGCSVGAHMSSTKLLN
                     HFYTSSRDCDMYAELTFHEPGPVECPPETVIFFPVIQCGEMLDEKGEPSEATKDDWYL
                     AMTESTTELLEKGYVPVSVGGDGSATLAMVEAYKRLFRSSEVVLIHCSARPSLEKAEQ
                     PIRVLLEKDLLKGVVEIGNRCVSSGDRKIRKQHKVMYMDMQAIYAKGLFCIRDIRNDY
                     PVFLSIDADVLDPAFAPGVESPVPGGFSTRDLLHIMTGIRGPKVAGIDIHGYHPSLDM
                     CRSDGVGLTQMALTKVLKESIVKAYTISTQTAEEGLERVRLMQRQGTLSDNPYPDH"
     gene            <16642..>17901
                     /locus_tag="LMJF_23_0080"
                     /db_xref="GeneID:5651949"
     mRNA            <16642..>17901
                     /locus_tag="LMJF_23_0080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683278.1"
                     /db_xref="GeneID:5651949"
     CDS             16642..17901
                     /locus_tag="LMJF_23_0080"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683330.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651949"
                     /db_xref="UniProtKB/TrEMBL:Q4QBG8"
                     /translation="MSDGAIVPREGSPQSISEELERRRSEARNLELRVSRKEAELQRA
                     KEEQELLKEMRTVNEMIIRKKERQLSEGVANGVKISPESLAELNALGDALRLENLKTV
                     ELQREADVTSHQMEEVERSLENTEKQLLEAKRSTGWDVDRNSARTETAMESAFKEKKR
                     LLSSLTSEQRTLSELSERLKQHAEECQAKVDAAEGMDERFAEAEEQLRQANARYRELI
                     EEVMSNERIQKKTERVLTVANTQDKYKCIRQLEGEKRALHNDLSKLRETNVSNSRSIL
                     SLEVRLRQLETRLEAVNGFLREVFAEVEDDEPMDNVPEGAVEVPLALFEELSAALELS
                     RETVVQRDDQLDEHDCKIEQMERKVVILQNAIASRAVSAQVQARGRDTQQRSMYANHS
                     RRRSQLRTERDQLAVENTVLRNRLALL"
     gene            <19452..>20492
                     /locus_tag="LMJF_23_0090"
                     /db_xref="GeneID:5651950"
     mRNA            <19452..>20492
                     /locus_tag="LMJF_23_0090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683279.1"
                     /db_xref="GeneID:5651950"
     CDS             19452..20492
                     /locus_tag="LMJF_23_0090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683331.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651950"
                     /db_xref="InterPro:IPR013894"
                     /db_xref="UniProtKB/TrEMBL:Q4QBG7"
                     /translation="MTALADEVREKYSLSLSSDYVERCVQAKASLTSLELYQKSLWEN
                     LRDICGTSLLPYGIGAQVSATLPNAVVMQINASRDATQPLRPCADASDEEAFLNAAFQ
                     RNSSKRLLRLQLTDGNVEISALELSTLCVFQGIPTPGEKLLIHKGAEVRNGCIILSEG
                     SVSVLGGEVRQLKQDFLANRRRLEVGYQTSNGLDGAPRFAPLQVGHHYRSSVANSGAP
                     VDIGHQGGASPYHANERGGRRSNYSRNGGGGGRAQQAGDNYEGRVSAGDHGRGGRGGR
                     GGRGWDSSYGGDGWRGHGRRGGGYVRRGDGGRVDSRGCVGGASYHVDTANFQPPAEKF
                     PEINEANFPRLV"
     gene            <21347..>22129
                     /locus_tag="LMJF_23_0100"
                     /db_xref="GeneID:5651951"
     mRNA            <21347..>22129
                     /locus_tag="LMJF_23_0100"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683280.1"
                     /db_xref="GeneID:5651951"
     CDS             21347..22129
                     /locus_tag="LMJF_23_0100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683332.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651951"
                     /db_xref="InterPro:IPR019410"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4QBG6"
                     /translation="MRTGGGERNALVGACNDHKYANVEALRKLVRLDCRYAWVDVPFS
                     TPSGRHQLLARQRGATGGPSAPENADLVALLNSDSIPQYIWPAAYPMCEWIHSHSSMF
                     QGKCVLELGCGAGALGFTVAQHARQVVLTDCSPVSLALVLESVARNGYCNCGVAVLQW
                     GREDQLVQIKLECDVDSFDIVMGSDVFYFSSTLKAGLATARSALMPRHDNDAVFLCGS
                     VARSDRMEVDLEEMPLQEGFVLADSIVMDPFRLYVWKVSSSQ"
     gene            <23497..>24636
                     /gene="GDPMP"
                     /locus_tag="LMJF_23_0110"
                     /db_xref="GeneID:5651955"
     mRNA            <23497..>24636
                     /gene="GDPMP"
                     /locus_tag="LMJF_23_0110"
                     /product="mannose-1-phosphate guanyltransferase"
                     /transcript_id="XM_001683281.1"
                     /db_xref="GeneID:5651955"
     CDS             23497..24636
                     /gene="GDPMP"
                     /locus_tag="LMJF_23_0110"
                     /EC_number="2.7.7.13"
                     /codon_start=1
                     /product="mannose-1-phosphate guanyltransferase"
                     /protein_id="XP_001683333.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651955"
                     /db_xref="GOA:Q4QBG5"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR005835"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q4QBG5"
                     /translation="MSSSDGQGMRAVILVGGFGTRLRPLTLTTPKPLVPFCNKPMIIH
                     QIEALKAVGVTEVILAVAYRPEAMKEQMDEWSRKLGVLFVFSVEEEPLGTAGPLALAR
                     DILMQDDKPFFVLNSDVTCPFPMQELLDFHKAHGGEGTIMVSQVTQWEKYGVVVYSPQ
                     NYQIERFVEKPSSFLGDRINAGIYIFNKSILDRIPPCRTSIEKEIFPSMAAEGQLYAF
                     NLEGFWMDIGQPKDYILGMTKYIPFLVHSNRETEKLHTEATKHQRGGRFTVIGASLID
                     PSAKIGDGAVIGPYASIGANCVIGESCRIDNAAILENSKVGKGSMVSRSIVGWNNRIG
                     SWCHIKDISVLGDDVEVEDGVVLIGTKVLPNKDVGEHHFEPGIIM"
     gene            <28465..>37050
                     /locus_tag="LMJF_23_0120"
                     /db_xref="GeneID:5651956"
     mRNA            <28465..>37050
                     /locus_tag="LMJF_23_0120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683282.1"
                     /db_xref="GeneID:5651956"
     CDS             28465..37050
                     /locus_tag="LMJF_23_0120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683334.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651956"
                     /db_xref="InterPro:IPR000409"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:Q4QBG4"
                     /translation="MLEAILPERVASVARTAVTYFSAPEEAGVEAAEASSSILHQQLP
                     NVLDADTVVETLRMMEGALVSSHRRPSSSAAAVWSFNCFACVLENIIYAKQLIGFSPA
                     ESVNFEVITATVLNFGKEVGEDGMPALRRVVGSLRVLALAERPDVSSRQPSNMSSLGS
                     SFLRILPATVGRMQQRIAGSWGTAERHETPLGVHCDGAVESLARLFVLSTQSQMTELC
                     EQQLFQLLLMRGVSAAVLGFVLSICAESAPRFGASKLCSLMAFVGKLPCKGEVGEFLK
                     AILDHLRCGRFCLPEQRIAVVGFFIEWCTKASTHAAMSLALGVVQACVHCLSQLAVDP
                     RSSGLETFAEHFSVLTKVVLGSKEAADSLISDNCCASLLQVMLASLESGQLHTAVLLR
                     DAFVGLVMKTNLFCDVLLEQIASATDADAWTSMATPLLSTLVLLLHSCGRYNRASLPH
                     NCIELCLSLMQDVESHSQHQLVDRHLLGCCLSLLLTLVNYSDVWELVEHTVGTLPVNC
                     DHVQSMIDLCTGVLRSSESLAMAERYFTEPAALKERWSAPCFVHFGPFAVMGEPYIEM
                     LYPVKLLVHMVDTMLTDQHTDAASGTEAMEYLMLRSGVTVPNSYVADFIARWERFRWI
                     RCVSNVYDPQLLPLFFTRATALATVQKCQRVWLEALTESVTAGEVPRHYNDYIHLGEG
                     GGAKGLVTSSGVVWPPLDAYTAAMWVYMDPMSFSDRHEGRVVLWQLEWDAMGRHVCLS
                     LVAHTQRKCCLYRCDLDGDVTVVEMPALPEQRWVHVVTSHARGKMFASQLKMYFDGVE
                     VACNGCPYPAGGLETAAAVATSLPSLLSREVEVTIGSPQNTPSTEATLRLISFQLYGC
                     GASLRQISSLYAMGPYPSSQVWDSAGQQVYDLNAPCLGDQVVRTVEASLQSASRESML
                     REQCVVLDFPPTMALVQVHAFAMEQIDTSFGYLNNKQWALRNLAAPAMSVLCLHGYYR
                     PPRDSRTTTVDALLCNGAFYEWMRWMRCVSAGVLAAERERDSAAETGSSAAAPEGTGA
                     GLAAVQQTACTMLRVLNLIKKTDMLPLSWHRFMVQFAEHVTCHPQIYLHHTTAVTQLL
                     QLCMQTVRYRDKHGHAVDGQLLSNLLPLEHIFFNWRLLSNLPDDSWMTVMTALRQLVS
                     PSNALAGFNTARLLMADFVNGFVFGLLREYVAFPRLVMAIELVKYVLLSSQATEELME
                     RVLMAAVLTVPGPSQDGGSSTVESHLGSKLATTSCVYLALARNMLLRCLNEVLEMTLN
                     DGNGAFLATFVSVVPDWWFTAMLSGSSHPVTATLTLRLFVLCFLNAKPFREACSATKA
                     ECISRAMEPHCHQRELMDVLVQGYMGHLWAPSSSHAGYSTAGWSGETEMEGLLVLILH
                     LLKAQCQLLLRGTPVTWEGVTVRGYFSAAAAEATSAVAGNTSPSAGRWRRVRLALAAV
                     RRLKKAAGDKKGAKAGGSVAGSEAVAQYTASIDALKSLVCEVLDWLTQSYHLSRALSK
                     SLYQSSNSANLCDFLMWPVLVALCSKEPISAQPRASVELPIRARAKEDDNTAASSSGA
                     STDVDEDEEEEQWEVLPDPTTYEARSFGLDSMSPAEGMEKVYDACMMFFLTYAGSRAS
                     NASFLTVAGGRTTMGKYVLSLHRALSAEVKGAGNHAEDARKAFLCFLWLKASEQAVGD
                     ASDGSAAAVKRNAIELGKYMLDRLVGGGAVPPAAIAAFYRFLLARLECDTMVVKSART
                     ALFEWFMYVTSASFYKLDASKVGVVVDMTYSCADMLFSYPMPAMELLKVVVGRLLQVT
                     VCLWNSVVDDSHPAIRKMAVVWKAVLCANEKNTFVASLFVYGSPAVDTFHGGFDLLLS
                     PIASPEAFTIWMRQHRAEVAQLLQSYMGLSYAFVMANGGEHLRLITRHTTSSLAEWDR
                     RRRNVAAMVAAHWQLWKDTFLTTTFVDPALLACTVSRYPHYCVFNGGGAAVDAEDAVC
                     CEWSMDGNGAVGRTCRYVTENVDEVASDPLSFYIRYAPPVCLPLQRQEAQDPTLMLRP
                     NAREVVAKVAGHGPSGSVVFVSNAYLVLGTESYISTCILTRQELLVVTCSVVTPAGDF
                     FAEQVRVHTASQHSHAKPSLLQQAFRLFISGQGKGSGSTSSQAAFRYSQYYRQLQTES
                     AKGSSALVWRFPLGSITSVHQRLFQHLSAGLEVVLESGKCVFLVLLDDELSFSKASRD
                     RLFAYFDSDSDPLMSGIAAHSMSEKLAKLGIWTRRWVRRECSNYVYLRVLNDAASRTT
                     ANLGQYPVMPWVLSRYTESTLDLGDASAYRDLTKPVGALNESKAKQLQARYAEWIACD
                     PAADPPYHYGTHYSTAAIVLYYLIRLQPFTSRAIRFQGGRLDIADRLFHSVAEAWANG
                     SGRSRGDVKELIPEFFRVSDFLENRNGACLGTRSDGAALGDVVLPPWCGGSAARFVYM
                     NALSLESEAVSRQLHHWIDLIFGCKQVGQGAVEAINVFSPLSYKEGVVRAINHAATEE
                     ERKSIVASADNFGQTPLQLFSKDAHPARKDAQRVSTTQAYMLEAVTDITSRPCWSAQV
                     VGKAKGGISTTFVADDTLFLCDRLSAVGSAKPLLLFTYDRDVDSIVCTAARGDRVLAT
                     IQQVRSSGSGCVRCLCASVRGSVVCVGTDSGKVIVYSRESCRHRFFIVAVLDCTIAAV
                     LQEAGPVSSLHLFDEGNLLVAYERVSAVSGWHLSILSTTFTFAASFATQADSTAVKAI
                     SVDRHTGLYYAAKANSLVIFSASGVMLTQLKVDTLLMSAAPEYAARIADSCITALLFA
                     NCSSFAFTNLILMGHLNGTVSLWRVAASQTITGESPSSEAPLWSFRFLHEVVFDAPVT
                     CLAASAEELSFVVGLANHTAHYISFPTSQLDSS"
     gene            37905..37969
                     /gene="LM23Cs1H1.1"
                     /locus_tag="LMJF_23_snoRNA0032"
                     /db_xref="GeneID:12980824"
     ncRNA           37905..37969
                     /ncRNA_class="snoRNA"
                     /gene="LM23Cs1H1.1"
                     /locus_tag="LMJF_23_snoRNA0032"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460460.1"
                     /db_xref="GeneID:12980824"
     gene            38021..38121
                     /gene="LM23Cs1C3.1"
                     /locus_tag="LMJF_23_snoRNA0002"
                     /old_locus_tag="LMJF_23_snoRNA0036"
                     /db_xref="GeneID:12981224"
     ncRNA           38021..38121
                     /ncRNA_class="snoRNA"
                     /gene="LM23Cs1C3.1"
                     /locus_tag="LMJF_23_snoRNA0002"
                     /old_locus_tag="LMJF_23_snoRNA0036"
                     /transcript_id="XR_002460440.1"
                     /db_xref="GeneID:12981224"
     ncRNA           38029..38121
                     /ncRNA_class="snoRNA"
                     /gene="LM23Cs1C3.1"
                     /locus_tag="LMJF_23_snoRNA0002"
                     /old_locus_tag="LMJF_23_snoRNA0036"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460441.1"
                     /db_xref="GeneID:12981224"
     gene            38240..38330
                     /gene="LM23Cs1C1.1"
                     /locus_tag="LMJF_23_snoRNA0003"
                     /old_locus_tag="LMJF_23_snoRNA0040"
                     /db_xref="GeneID:12981221"
     ncRNA           38240..38329
                     /ncRNA_class="snoRNA"
                     /gene="LM23Cs1C1.1"
                     /locus_tag="LMJF_23_snoRNA0003"
                     /old_locus_tag="LMJF_23_snoRNA0040"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460442.1"
                     /db_xref="GeneID:12981221"
     ncRNA           38242..38330
                     /ncRNA_class="snoRNA"
                     /gene="LM23Cs1C1.1"
                     /locus_tag="LMJF_23_snoRNA0003"
                     /old_locus_tag="LMJF_23_snoRNA0040"
                     /transcript_id="XR_002460443.1"
                     /db_xref="GeneID:12981221"
     gene            38400..38483
                     /gene="LM23Cs1C2.1"
                     /locus_tag="LMJF_23_snoRNA0004"
                     /old_locus_tag="LMJF_23_snoRNA0029"
                     /db_xref="GeneID:12981181"
     ncRNA           38400..38482
                     /ncRNA_class="snoRNA"
                     /gene="LM23Cs1C2.1"
                     /locus_tag="LMJF_23_snoRNA0004"
                     /old_locus_tag="LMJF_23_snoRNA0029"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460444.1"
                     /db_xref="GeneID:12981181"
     ncRNA           38402..38483
                     /ncRNA_class="snoRNA"
                     /gene="LM23Cs1C2.1"
                     /locus_tag="LMJF_23_snoRNA0004"
                     /old_locus_tag="LMJF_23_snoRNA0029"
                     /transcript_id="XR_002460445.1"
                     /db_xref="GeneID:12981181"
     gene            38654..38718
                     /gene="LM23Cs1H1.2"
                     /locus_tag="LMJF_23_snoRNA0033"
                     /db_xref="GeneID:12981182"
     ncRNA           38654..38718
                     /ncRNA_class="snoRNA"
                     /gene="LM23Cs1H1.2"
                     /locus_tag="LMJF_23_snoRNA0033"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460461.1"
                     /db_xref="GeneID:12981182"
     gene            38770..38870
                     /gene="LM23Cs1C3.2"
                     /locus_tag="LMJF_23_snoRNA0006"
                     /old_locus_tag="LMJF_23_snoRNA0037"
                     /db_xref="GeneID:12981225"
     ncRNA           38770..38870
                     /ncRNA_class="snoRNA"
                     /gene="LM23Cs1C3.2"
                     /locus_tag="LMJF_23_snoRNA0006"
                     /old_locus_tag="LMJF_23_snoRNA0037"
                     /transcript_id="XR_002460446.1"
                     /db_xref="GeneID:12981225"
     ncRNA           38778..38870
                     /ncRNA_class="snoRNA"
                     /gene="LM23Cs1C3.2"
                     /locus_tag="LMJF_23_snoRNA0006"
                     /old_locus_tag="LMJF_23_snoRNA0037"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460447.1"
                     /db_xref="GeneID:12981225"
     gene            38989..39079
                     /gene="LM23Cs1C1.2"
                     /locus_tag="LMJF_23_snoRNA0007"
                     /old_locus_tag="LMJF_23_snoRNA0041"
                     /db_xref="GeneID:12981222"
     ncRNA           38989..39078
                     /ncRNA_class="snoRNA"
                     /gene="LM23Cs1C1.2"
                     /locus_tag="LMJF_23_snoRNA0007"
                     /old_locus_tag="LMJF_23_snoRNA0041"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460448.1"
                     /db_xref="GeneID:12981222"
     ncRNA           38991..39079
                     /ncRNA_class="snoRNA"
                     /gene="LM23Cs1C1.2"
                     /locus_tag="LMJF_23_snoRNA0007"
                     /old_locus_tag="LMJF_23_snoRNA0041"
                     /transcript_id="XR_002460449.1"
                     /db_xref="GeneID:12981222"
     gene            39149..39232
                     /gene="LM23Cs1C2.2"
                     /locus_tag="LMJF_23_snoRNA0008"
                     /old_locus_tag="LMJF_23_snoRNA0030"
                     /db_xref="GeneID:12981184"
     ncRNA           39149..39231
                     /ncRNA_class="snoRNA"
                     /gene="LM23Cs1C2.2"
                     /locus_tag="LMJF_23_snoRNA0008"
                     /old_locus_tag="LMJF_23_snoRNA0030"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460450.1"
                     /db_xref="GeneID:12981184"
     ncRNA           39151..39232
                     /ncRNA_class="snoRNA"
                     /gene="LM23Cs1C2.2"
                     /locus_tag="LMJF_23_snoRNA0008"
                     /old_locus_tag="LMJF_23_snoRNA0030"
                     /transcript_id="XR_002460451.1"
                     /db_xref="GeneID:12981184"
     gene            39403..39467
                     /gene="LM23Cs1H1.3"
                     /locus_tag="LMJF_23_snoRNA0034"
                     /db_xref="GeneID:12981185"
     ncRNA           39403..39467
                     /ncRNA_class="snoRNA"
                     /gene="LM23Cs1H1.3"
                     /locus_tag="LMJF_23_snoRNA0034"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460462.1"
                     /db_xref="GeneID:12981185"
     gene            39519..39619
                     /gene="LM23Cs1C3.3"
                     /locus_tag="LMJF_23_snoRNA0010"
                     /old_locus_tag="LMJF_23_snoRNA0038"
                     /db_xref="GeneID:12981226"
     ncRNA           39519..39619
                     /ncRNA_class="snoRNA"
                     /gene="LM23Cs1C3.3"
                     /locus_tag="LMJF_23_snoRNA0010"
                     /old_locus_tag="LMJF_23_snoRNA0038"
                     /transcript_id="XR_002460452.1"
                     /db_xref="GeneID:12981226"
     ncRNA           39527..39619
                     /ncRNA_class="snoRNA"
                     /gene="LM23Cs1C3.3"
                     /locus_tag="LMJF_23_snoRNA0010"
                     /old_locus_tag="LMJF_23_snoRNA0038"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460453.1"
                     /db_xref="GeneID:12981226"
     gene            39738..39828
                     /gene="LM23Cs1C1.3"
                     /locus_tag="LMJF_23_snoRNA0011"
                     /old_locus_tag="LMJF_23_snoRNA0042"
                     /db_xref="GeneID:12981223"
     ncRNA           39738..39827
                     /ncRNA_class="snoRNA"
                     /gene="LM23Cs1C1.3"
                     /locus_tag="LMJF_23_snoRNA0011"
                     /old_locus_tag="LMJF_23_snoRNA0042"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460454.1"
                     /db_xref="GeneID:12981223"
     ncRNA           39740..39828
                     /ncRNA_class="snoRNA"
                     /gene="LM23Cs1C1.3"
                     /locus_tag="LMJF_23_snoRNA0011"
                     /old_locus_tag="LMJF_23_snoRNA0042"
                     /transcript_id="XR_002460455.1"
                     /db_xref="GeneID:12981223"
     gene            39898..39981
                     /gene="LM23Cs1C2.3"
                     /locus_tag="LMJF_23_snoRNA0012"
                     /old_locus_tag="LMJF_23_snoRNA0031"
                     /db_xref="GeneID:12981187"
     ncRNA           39898..39980
                     /ncRNA_class="snoRNA"
                     /gene="LM23Cs1C2.3"
                     /locus_tag="LMJF_23_snoRNA0012"
                     /old_locus_tag="LMJF_23_snoRNA0031"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460456.1"
                     /db_xref="GeneID:12981187"
     ncRNA           39900..39981
                     /ncRNA_class="snoRNA"
                     /gene="LM23Cs1C2.3"
                     /locus_tag="LMJF_23_snoRNA0012"
                     /old_locus_tag="LMJF_23_snoRNA0031"
                     /transcript_id="XR_002460457.1"
                     /db_xref="GeneID:12981187"
     gene            40152..40216
                     /gene="LM23Cs1H1.4"
                     /locus_tag="LMJF_23_snoRNA0035"
                     /db_xref="GeneID:12981188"
     ncRNA           40152..40216
                     /ncRNA_class="snoRNA"
                     /gene="LM23Cs1H1.4"
                     /locus_tag="LMJF_23_snoRNA0035"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460463.1"
                     /db_xref="GeneID:12981188"
     gene            40268..40368
                     /gene="LM23Cs1C3.4"
                     /locus_tag="LMJF_23_snoRNA0014"
                     /old_locus_tag="LMJF_23_snoRNA0039"
                     /db_xref="GeneID:12981227"
     ncRNA           40268..40368
                     /ncRNA_class="snoRNA"
                     /gene="LM23Cs1C3.4"
                     /locus_tag="LMJF_23_snoRNA0014"
                     /old_locus_tag="LMJF_23_snoRNA0039"
                     /transcript_id="XR_002460458.1"
                     /db_xref="GeneID:12981227"
     ncRNA           40276..40368
                     /ncRNA_class="snoRNA"
                     /gene="LM23Cs1C3.4"
                     /locus_tag="LMJF_23_snoRNA0014"
                     /old_locus_tag="LMJF_23_snoRNA0039"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460459.1"
                     /db_xref="GeneID:12981227"
     gene            <41061..>41639
                     /gene="CyP3"
                     /locus_tag="LMJF_23_0125"
                     /db_xref="GeneID:5651971"
     mRNA            <41061..>41639
                     /gene="CyP3"
                     /locus_tag="LMJF_23_0125"
                     /product="putative cyclophilin type peptidyl-prolyl
                     cis-trans isomerase"
                     /transcript_id="XM_001683283.1"
                     /db_xref="GeneID:5651971"
     CDS             41061..41639
                     /gene="CyP3"
                     /locus_tag="LMJF_23_0125"
                     /EC_number="5.2.1.8"
                     /codon_start=1
                     /product="putative cyclophilin type peptidyl-prolyl
                     cis-trans isomerase"
                     /protein_id="XP_001683335.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0125"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0125"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651971"
                     /db_xref="GOA:Q4QBG3"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:Q4QBG3"
                     /translation="MGQVARVVQVQSSAGALSIELYNNFCADSFWQLARSDQLRRLTF
                     RKLLGGFALLGEVEAVQGHSTTASEVDAAAQSPDDVPLLHVGAGLLSCRPTVGAVTAS
                     RLLITLSPQPQLDKTHVVFGRVYSGIHTLEQISHMQVDADFVLYSPVTVMKCSTALLS
                     RGTAPQSATARAAPASCVVTSQYPSSILATLE"
     gene            <42269..>42772
                     /locus_tag="LMJF_23_0130"
                     /db_xref="GeneID:5651972"
     mRNA            <42269..>42772
                     /locus_tag="LMJF_23_0130"
                     /product="putative vacuolar type h+ ATPase subunit"
                     /transcript_id="XM_001683284.1"
                     /db_xref="GeneID:5651972"
     CDS             42269..42772
                     /locus_tag="LMJF_23_0130"
                     /EC_number="3.6.3.14"
                     /codon_start=1
                     /product="putative vacuolar type h+ ATPase subunit"
                     /protein_id="XP_001683336.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651972"
                     /db_xref="GOA:Q4QBG2"
                     /db_xref="InterPro:IPR000245"
                     /db_xref="InterPro:IPR002379"
                     /db_xref="InterPro:IPR011555"
                     /db_xref="UniProtKB/TrEMBL:Q4QBG2"
                     /translation="MSSAKVCDPEAFLFGMMGAALSLALANVGAAFGTAKAGVAVAQL
                     GIVQPSRVMRGIVPVVMAGILGIYGLIVSVIICNNMKLSGYPLFSGYMHLGAGLAAGF
                     ASLAAGYAIGIVGDICCYAYAKTERIFVPMILMLIFAEALGLFGLITALLMSNKATSA
                     MGSCTVS"
     gene            <44821..>45693
                     /locus_tag="LMJF_23_0140"
                     /db_xref="GeneID:5651973"
     mRNA            <44821..>45693
                     /locus_tag="LMJF_23_0140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683285.1"
                     /db_xref="GeneID:5651973"
     CDS             44821..45693
                     /locus_tag="LMJF_23_0140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683337.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651973"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q4QBG1"
                     /translation="MCVARKRCKNSPSSQHVPEDTFRRQPPRRKHFYSWVATDKTQLQ
                     KKEKLVLQGLLYYYSKIAGLNIISTDDIRELDDNAVCVCVCVADLSGIAKSEATRDGA
                     AEHPTTTPLSPLPARNAAAKVEKDVIVFIHGFAGGVAGWAQSWCFLSENYRVHAFDLP
                     WFARSERRASTATSLPEAMNYFGDYIHGWLERLDFGQPVIVLAHSFGWFVAAHYAMRH
                     GAESIKLLLLSEPWGLVRANANRMKKCPLQVRVLLALFYNIGFLELLRAVGPVGPWLL
                     RRLRPDLEVVHLSW"
     gene            <49378..>50478
                     /locus_tag="LMJF_23_0150"
                     /db_xref="GeneID:5651974"
     mRNA            <49378..>50478
                     /locus_tag="LMJF_23_0150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683286.1"
                     /db_xref="GeneID:5651974"
     CDS             49378..50478
                     /locus_tag="LMJF_23_0150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683338.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651974"
                     /db_xref="UniProtKB/TrEMBL:Q4QBG0"
                     /translation="MWVEAYRAGCAEVSADVREDVSSSGATGELIVRGNTFDNFKNRV
                     TDTDVQAILAALRVCPGMSALYLPYNNITSEGGVLLGKALGHQLDSIITLDVQYNSLG
                     AEAGVAIAQGLQRNDSLCHVTLAGNPLGGCCGAALGEALRQNMNLAVLDLFNTDLGME
                     ALVHICRSLEGNKGLSSLNIGRPLLHGVDELESVVNHLSIALQRNSTLEELHMAYFGL
                     VDDCLQTLVLALCGSAVTTLCIKGNKVSQDAGQLLARLLDRRQDFRNLDVSCNRLRDA
                     GAAALAKGVAHHPQLESLGLESCTISERGLVVLVESLKSCATVRRLTLWGNDVTPAVA
                     SSLTATFCDLRELDYIDVGVMEQDGQLVAYRA"
     gene            <51199..>52779
                     /locus_tag="LMJF_23_0160"
                     /db_xref="GeneID:5651975"
     mRNA            <51199..>52779
                     /locus_tag="LMJF_23_0160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683287.1"
                     /db_xref="GeneID:5651975"
     CDS             51199..52779
                     /locus_tag="LMJF_23_0160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683339.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651975"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018488"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="UniProtKB/TrEMBL:Q4QBF9"
                     /translation="MPLPSQSQLHGYYVARCGYHEVLRPHRAALTLLAEDTASHAERL
                     TSEAAERCVAVADLEQIEDRAEGAARARERAAVTPLAAQRAFRLAEPGGKAALSPLYI
                     GARGLLPILDLIAELPLLETVDLSNVASWYDNDTFAGSSQGSVSGNDVVAHLCTILPR
                     LRFLHTLDLGGQPLGSIAVAHLLETIRQLPTVVRVNFDTTNVDPYLIRAFQQTLEEHQ
                     LRPRPHMPTTKAVAKAYEIPLYITALPRLDRKTLREQQVLRALLSEDPSFTSAVTGAE
                     MSDMVLTARVMSTAEAVFRCGDKGIRGDGQHLFILKSGTLRVYSDLEGFVLSRGDYFG
                     DSYPSVLLPCSRLEEEERGIVYAIPLCSSTTVLAHWAARLVAAWPWLHQIPIMHAVGA
                     WTCMRACTCSEFVVSEPTDTIVEAGDGGEAIYVVCDGSFSALDSRGGDAARYNARRVR
                     SVFTRLDVFGIEALVARKRQSSVRIKAGKEKDVLYRTSVVRGCGVRVLHRQLRPVFIS
                     LARGYSLHEDLCAGGTTG"
     gene            <53600..>54283
                     /locus_tag="LMJF_23_0170"
                     /db_xref="GeneID:5651976"
     mRNA            <53600..>54283
                     /locus_tag="LMJF_23_0170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683288.1"
                     /db_xref="GeneID:5651976"
     CDS             53600..54283
                     /locus_tag="LMJF_23_0170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683340.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651976"
                     /db_xref="UniProtKB/TrEMBL:Q4QBF8"
                     /translation="MGGKASKAETRLTSEAADALYREAYAAGAVDADMYHTSQREVMR
                     QQDAMAGIGACMFSAWVAYVYGRTTGVQAAEDAAALRLDAQQQMLDKTSRDLALKLEE
                     NRSLITVRQEQDVMIAQQRDELQRAAEQRRAMQRSMNALRRRNASVQRQMRSLKSSLS
                     AIQLQMYVGMAGAALVVFAVVWSTRPLRNGRWSLLPVAASLGEERAIAASAPVPVVEA
                     VEVKEQAES"
     gene            <54935..>55825
                     /locus_tag="LMJF_23_0180"
                     /db_xref="GeneID:5651977"
     mRNA            <54935..>55825
                     /locus_tag="LMJF_23_0180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683289.1"
                     /db_xref="GeneID:5651977"
     CDS             54935..55825
                     /locus_tag="LMJF_23_0180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683341.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651977"
                     /db_xref="UniProtKB/TrEMBL:Q4QBF7"
                     /translation="MCINFASPLHLRSPGARHIDVQDVPMERNTLQVVASAVNAEALS
                     GAEDHACHASPVHRVYRLRDACTTLQLILLAYKYRRCSAHSMTVAMFVEACAYDLVQG
                     VRVLESAPLSSSPGHDSSGDAIATLEAPWFYIGSEAGGDVRVYLLLPTYADYFLDYTM
                     HWARVAYSEMARQYVGHSLIAKLQTVGGGWASLHRADKSLACALQLHAVAQAVFDEDV
                     VRKCRLFIGWAHLWNSEPAKALEVFYAELAAARRHGDTIQERRCLHAIQNAEHNPRLA
                     PGGAHTGHYQLVNLWWRALA"
     gene            <59543..>59920
                     /locus_tag="LMJF_23_0190"
                     /db_xref="GeneID:5651978"
     mRNA            <59543..>59920
                     /locus_tag="LMJF_23_0190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683290.1"
                     /db_xref="GeneID:5651978"
     CDS             59543..59920
                     /locus_tag="LMJF_23_0190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683342.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651978"
                     /db_xref="UniProtKB/TrEMBL:Q4QBF6"
                     /translation="MNSADALEPIPRSIAPDQELSILKLILDLRSLGDVEGSKKVRRR
                     VREALLKSSDDSEAMSKVDDIIRRGKRTQSKLDGSYDERQRLKRKRREEDLAAASRLV
                     DVEAGSGEDSEGSASTEEDGTED"
     gene            <61657..>62148
                     /locus_tag="LMJF_23_0200"
                     /db_xref="GeneID:5651979"
     mRNA            <61657..>62148
                     /locus_tag="LMJF_23_0200"
                     /product="putative endoribonuclease L-PSP (pb5)"
                     /transcript_id="XM_001683291.1"
                     /db_xref="GeneID:5651979"
     CDS             61657..62148
                     /locus_tag="LMJF_23_0200"
                     /codon_start=1
                     /product="putative endoribonuclease L-PSP (pb5)"
                     /protein_id="XP_001683343.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651979"
                     /db_xref="InterPro:IPR006175"
                     /db_xref="InterPro:IPR013813"
                     /db_xref="UniProtKB/TrEMBL:Q4QBF5"
                     /translation="MPGVVEANLQKLGITLPVPAAPAASYAPFCIVGNMVYVSGQLPK
                     DADGKLMVGQLGDSLTAEDGKAAAKSCAVQLIAQIRAAAGGDLDKVKRVVMVRCYVNS
                     ACNFHDHPLVANGCSDLLVSVFGAEVGLHARCAFGVAQLPFNSMVEIEAQFELKDDAK
                     AAS"
     gene            <65505..>70220
                     /gene="ABCC1"
                     /locus_tag="LMJF_23_0210"
                     /db_xref="GeneID:5651980"
     mRNA            <65505..>70220
                     /gene="ABCC1"
                     /locus_tag="LMJF_23_0210"
                     /product="putative ATP-binding cassette protein subfamily
                     C,member 1"
                     /transcript_id="XM_001683292.1"
                     /db_xref="GeneID:5651980"
     CDS             65505..70220
                     /gene="ABCC1"
                     /locus_tag="LMJF_23_0210"
                     /codon_start=1
                     /product="putative ATP-binding cassette protein subfamily
                     C,member 1"
                     /protein_id="XP_001683344.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651980"
                     /db_xref="GOA:Q4QBF4"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QBF4"
                     /translation="MLQETIDEELSMEMTEALPCAPPPGRSRHQSDPLYDYRSEHLAL
                     QARLAEIWGPEAPYTPVPEETSSWFKRYSYGWVYETVVLASKEKLTHEALPPPTRDVR
                     AHECGLRLSRAVQAAMYERNAWNCMVGTEVVSTLDASSRGVLRWVGVPQQGGYTRMMA
                     GVEWSVPPALRTAARSDDSGASPFFDGVAHGEHLFTPEQSGMSTLEETTTLRLDLTSR
                     GGVVEIPTPKRLPLTRLLAFKLPYYLWMQVPFLLVSNICVITLPSILQAFVAFLDDDP
                     GTQTWGRGLGLVAGIFLVQAMQSVCNQRFNYISFRCGLQYRSALNSLIFEKCMIISSK
                     SLAQPDMNAGRVINMMSTDVERVYFFMLFCMFLWSSPVVLLLAIVQLWRLVGWCAIIA
                     VASFLATIPLNAFFMGIQMRARRDIAKAADARVKATSEFFSGIRVAKFMTWEPCFVAN
                     IEEKRAVELFFLNKIQNARVATSFVNNATPMLMIALVFTVYYCTGHELSTTVVFPTIA
                     LLGVLRQPFQQIPWVFTIAVQFLISIGRIRRFLECDDATCSTVQDMEEYWREQREHSA
                     ACQLAAVLEKVDVTAFVPVKLPFAPKVKTSLLSRALRMLCCEQCKPTKRHPPPSVVVE
                     NTGYVSPASASRHIVEGCSGTVHTATPTSTRSAKAPQMKTDEFFELEPKVLLRDVSVS
                     VLRGKLTVVLGATGSGKSTLLQSLLSQFEISEGRVWAERSIAYVPQQAWIMNATVRSN
                     ILFFDEEDAARLADAVRVSQLEADLAQLSGGLETEIGEKGVNLSGGQKARVSLARAVY
                     ANRDVYLLDDPLSALDAHVGERVVEECFLGALAGKTRVLATHQVHIVPRADYVVALGD
                     ERVEFSGSSADFMRTSIYAGMASGLTVNKEEGDAESSESALDAEEEEAEVMVDRSASK
                     GEGPDEEDDAAARDPAARSFVVEEEKASGGVPWRTYLAYFRYCGGAHVAATIVLVFAV
                     TELITVSSSVWLSRWTTKEEGESNALYLTVYLLMVLVGGAGYPFRFVVSYTAMRHGCS
                     ALHRTILRSVTAGTIEFFDRTPLGRLLNRFSRDIDTLDNGLQMSTISLLECLFSISVS
                     MLVTTYSQPFVLIALAPCGYLYYRLMVFYNSANREIRRYTSVMKTPVFTQLTELTNGL
                     ATITAYGKAKKVMAEALERLDVVHSCGNLENNTNRWLAVRVELLSNIVVTAIAFVGVI
                     TTCLRSNRIDIGLISLSLTMAMQTTGELNWLVRMVATMEADMNSVERLQYYIDHVPKE
                     AMPELDAEVDALERRTGMAADVTGTVVIEPASPTGAAPHIVQAGSLVFEGVQMRYREG
                     LPLVLRGVSFRIAPREKVGIVGRTGSGKSTLLLTFMRMVEVCGGEIRVNGREIGSYGL
                     RELRRQFSMIPQDPVLFDGTVRQNVDPFLEASSAEVWAALELVGLRERVASESEGIDS
                     CVLEGGSNYSVGQRQLMCMARALLKKGSGFILMDEATANIDPALDRQIQATVMSAFSA
                     YTVITIAHRLHTVAQYDKIIVMDHGAVAEMGSPRELVMNRQSIFHSMVEAGGPSARRH
                     FLSLVRRRDNESAPYSKCG"
     gene            <73639..>78351
                     /gene="ABCC2"
                     /locus_tag="LMJF_23_0220"
                     /db_xref="GeneID:5651981"
     mRNA            <73639..>78351
                     /gene="ABCC2"
                     /locus_tag="LMJF_23_0220"
                     /product="putative ATP-binding cassette protein subfamily
                     C,member 2"
                     /transcript_id="XM_001683293.1"
                     /db_xref="GeneID:5651981"
     CDS             73639..78351
                     /gene="ABCC2"
                     /locus_tag="LMJF_23_0220"
                     /codon_start=1
                     /product="putative ATP-binding cassette protein subfamily
                     C,member 2"
                     /protein_id="XP_001683345.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651981"
                     /db_xref="GOA:Q4QBF3"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QBF3"
                     /translation="MQYEDPRHHSSGLAERRALPKGGHPNGAGERLATASKATALNRQ
                     AALHERDALKQRVTELWGPPKHYVECDEDRASFIHRMGYFLVYPMVLLASREQISFED
                     MPPPTRDVRAHECGLRLSRAVQAAMYERNAWNCMVGTEVVSTLDASSRGVLRWVGVPQ
                     QGGYTRMMAGVEWSVPPALRTAARSDDSGASPFFDGVAHGEHLFTPEQSGMSTLEEVT
                     CVRLLSLDGKPVDAASVPTPRRLSLMRVLPASLPEYFWWQFPFKLGGDVCTITIPFLL
                     KVFVHFISERNQSWAHGLALAVTFFLTQLIQSVCLHRFYYVSIKCGLQYRSALNGLIF
                     EKVFTISNKALAHPQMNTGRIINMMSTDTEQANQFMQYCMYIWSSPMMFIISISFLSR
                     LVGWCSIMAVVALLMTLPINGWLMKWQMAARRKLVKATDVRVKAANEFFSGVRIAKFM
                     TWEPRFIANIEEKRALEVSYLKQVQTVRVWTSFVSMTTPQVMIAAVFMVYYLLGHDLT
                     PTVVYPTISLVGILRMPFNMLPWVFTVSAQYLVAMTRINKFLECDDATCSTVQDMEEY
                     WREQREHSAACQLAAVLEKVDVTAFVPVKLPFAPKVKTSLLSRALRMLCCEQCKPTKR
                     HPPPSVVVENTGYVSPASASRHIVEGCSGTVHTATPTSTRSAKTPQMKTDEFFELEPK
                     VLLRDVSVSVLRGKLTVVLGATGSGKSTLLQSLLSQFEISEGRVWAERSIAYVPQQAW
                     IMNATVRSNILFFDEEDAARLADAVRVSQLEADLAQLSGGLETEIGEKGVNLSGGQKA
                     RVSLARAVYANRDVYLLDDPLSALDAHVGERVVEECFLGALAGKTRVLATHQVHIVPR
                     ADYVVALGDERVEFSGSSADFMRTSIYASLAAVEADSPTGKGAGANAEAEDGDAACGG
                     LSDPEEGSAKPVRRAAPSAGAAAPTAAAQLMTVEEKASGMVAWGTYRAYLRFCGGRLW
                     SIGVLAMFGVTELFTISSMLCLSMWTARRFDLSDASYLLMYMGCVVMGTLTVPLRFYF
                     SFEVMRRGCVRMHHAVLRSVSRGTMEFFDTTPLGRILNRFSRDVDVTDNTLPMSMLQM
                     MNCLFGILSSLLVTFFTQPLVIFVLAPCGYLYYRIMVFYNSANREIRRTSSVAKSPLF
                     SLLGEALTGSATITAYHRASTVMQEALRRLDLVYSCSILENMANRWLGVRVEFLSNIV
                     VSTIVLIGIGRTVLMETHEEWIALVSLSLTMATQTTAMLNWLLRQVASVEADMNSVER
                     LQYYIDHVPKEAMPELDAEVDALERRTGMAADVTGTVVIEPASPTGAAPHIVQAGSLV
                     FEGVQMRYREGLPLVLRGVSFRIAPREKVGIVGRTGSGKSTLLLTFMRMVEVCGGEIR
                     VNGREIGSYGLRELRRQFSMIPQDPVLFDGTVRQNVDPFLEASSAEVWAALELVGLRE
                     RVASESEGIDSCVLEGGSNYSVGQRQLMCMARALLKKGSGFILMDEATANIDPALDRQ
                     IQATVMSAFSAYTVITIAHRLHTVAQYDKIIVMDHGAVAEMGSPRELVMNRQSIFHSM
                     VEALGRSEAARVIQVAMA"
     gene            <81243..>81701
                     /locus_tag="LMJF_23_0223"
                     /db_xref="GeneID:12981201"
     mRNA            <81243..>81701
                     /locus_tag="LMJF_23_0223"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721746.1"
                     /db_xref="GeneID:12981201"
     CDS             81243..81701
                     /locus_tag="LMJF_23_0223"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721794.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0223"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0223"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981201"
                     /db_xref="UniProtKB/TrEMBL:E9ACS2"
                     /translation="MRRCLAFRHLMGADRSFSGAVHSCRTSSSLQTLVACSGTLCFSC
                     SKAFATSSSITISSARCVSCVVVCTPVRHFGNAPSRVRPAETPAENMWRQSERETSAS
                     VVIVIMFMVPLWLYVLSAHGQEQKRAAVRAWALEQREKHHPSECEGECKA"
     gene            <82441..>83106
                     /locus_tag="LMJF_23_0225"
                     /db_xref="GeneID:5651982"
     mRNA            <82441..>83106
                     /locus_tag="LMJF_23_0225"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683294.1"
                     /db_xref="GeneID:5651982"
     CDS             82441..83106
                     /locus_tag="LMJF_23_0225"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683346.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0225"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0225"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651982"
                     /db_xref="UniProtKB/TrEMBL:Q4QBF2"
                     /translation="MRQGAARGCACVAAHSGGLCGCIASANTTTAVRGYTRGIPYTPQ
                     GTIQDYTSSPRHVRLAEMQRNIDREARRAPTGLYEGPTITTKDGARPLFPPEKARHPN
                     RGPPPRGATPPTYAPQFVAPAATREDMMPPQSDSYQRDLRSDPAYADDPEHIVAARQR
                     IMTMQSDSYGEAMRGMVAPPPPLDPDAPQAYRQPRVQLDDNWWILMWSFAALFVVMAM
                     YGK"
     gene            <86747..>87304
                     /locus_tag="LMJF_23_0230"
                     /db_xref="GeneID:5651983"
     mRNA            <86747..>87304
                     /locus_tag="LMJF_23_0230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683295.1"
                     /db_xref="GeneID:5651983"
     CDS             86747..87304
                     /locus_tag="LMJF_23_0230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683347.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651983"
                     /db_xref="UniProtKB/TrEMBL:Q4QBF1"
                     /translation="MKGQVRNSGRRRIYLWLTTSTRDRRNRTDDVGTHLQAARRERNK
                     VHRVNDLFHASGMWHHPRDTLEGIILQGMGRGLAWSFVIVPACFVLTFIVCITSYRGG
                     DRRARQQHAQEEWQHHLLEAVQKRAAAEKELQSVCNHAMEAKSVLRPIPEEQRWAAQL
                     EANMAFINEKLQSRLGDGESRREGG"
     gene            <88364..>88933
                     /gene="YIP1"
                     /locus_tag="LMJF_23_0240"
                     /db_xref="GeneID:5651984"
     mRNA            <88364..>88933
                     /gene="YIP1"
                     /locus_tag="LMJF_23_0240"
                     /product="terbinafine resistance locus protein (yip1)"
                     /transcript_id="XM_001683296.1"
                     /db_xref="GeneID:5651984"
     CDS             88364..88933
                     /gene="YIP1"
                     /locus_tag="LMJF_23_0240"
                     /codon_start=1
                     /product="terbinafine resistance locus protein (yip1)"
                     /protein_id="XP_001683348.1"
                     /db_xref="GeneID:5651984"
                     /db_xref="GOA:Q86MW5"
                     /db_xref="InterPro:IPR006977"
                     /db_xref="UniProtKB/TrEMBL:Q86MW5"
                     /translation="MLNEVHVNADPNSISTLDEPVLETLLRDAKAIGRKLVVVVCPSL
                     GGDKELRDWDLWGPLFLCLILASILTINASDDQGAAVFSAVFIFVWLGGLVVTVNAKL
                     LGSKIMFFQTYCAMGYCLAPICLGALLCCVLPWFLLNLMLCFMAWAWACWAALRFFRH
                     TVSADREVLVVYPVGLFYVFFTWMVLVGI"
     gene            <90622..>95328
                     /gene="MRPA"
                     /locus_tag="LMJF_23_0250"
                     /db_xref="GeneID:5651985"
     mRNA            <90622..>95328
                     /gene="MRPA"
                     /locus_tag="LMJF_23_0250"
                     /product="ABC-thiol transporter"
                     /transcript_id="XM_001683297.1"
                     /db_xref="GeneID:5651985"
     CDS             90622..95328
                     /gene="MRPA"
                     /locus_tag="LMJF_23_0250"
                     /EC_number="3.6.3.44"
                     /codon_start=1
                     /product="ABC-thiol transporter"
                     /protein_id="XP_001683349.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651985"
                     /db_xref="GOA:Q4QBE9"
                     /db_xref="InterPro:IPR000938"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QBE9"
                     /translation="MATPDFVRLSPTDESSELINHAPSQLRHTQCGADNSHTTIITDL
                     EAVDDAAHVRCQQQVQREFAEQLEELWGGEPTYTPTVEDQASWLQQLHYGWIGDYIYK
                     AAAGSITEADLPPPSRSTRTYHTGRKLSRQAHADIDASRRWDGYVGCEVMYEAEAETS
                     GVLRWVGYLQQSDYPRSLVAGVEWRVPPRYRRQATPGSAAGLHNGVVHGERLFRPYQD
                     NYLCSCEPVDRLYLSSTCGLMRPGPPPSPDLLLTLFKAHWYHVWVQILPKLLADLTAL
                     MLPVLLEYLVKYLDADNATWGWGLGLVLTLFLTSVIQSCAAHKYDHISIRSAALFETS
                     SMALLFEKCFTVSQRSLQRPDMSVGRIMNMVGNDVDNIGSLNWYVMYFWSAPLQLALC
                     MLLLIRLVGWFALPGMAVLLVTLPLQGAISKHIQEVSERMASVVDLRIKRTSELLSGI
                     RIVKFMGWEPVFLARIEDARSRELRCLRDVHLANVIFMFVNDATPTLVIAVVFILYHA
                     SGQALRPEIVFPTIALLNTMRVSFFMIPIIISTVLQCLVSTKRITTFMECPDTRSQVR
                     DIAGIASAGAAAIFKDVSIHTYLPAKLPRCKSRLTTMQRITLWFCRRGVPEAEWYELD
                     GPDAGASSPTGHIPAFEMGSAQAASADGDGAGTGGGDEEANVEEADAQYYQVVSKELL
                     RNVNLVIPQFKLTMVIGATGSGKSTLLGSLMGEYDVQSGEVWAERSIAYVPQQAWIMN
                     ATVRSNILFFDEERAADLQDVIRCCQLEADLAQLSGGLETEIGEKGVNLSGGQKARVS
                     LARAVYANRDVYLLDDPLSALDAHVGQRIVQDVICGRLRGKTRVLATHQIHLLPLADH
                     IVVLQHGRIAFAGDYADFAATSLEETLRGQLRENKDAESSGSEVDAEAARAETAPGLA
                     EAHEPKVEQEANVAGGEAPLTFDVEAGRLMTREEKATGQVPWSTYVAYLRSCGGLAAW
                     GFLLATFVVTETVTAANGVWLSIWSTGSLRWSADTYLHVYLFIVFLNIFCSPLRCFLC
                     YYLMRVGSRNLHRDLLESIGVARMSFFDTTPLGRVLNRFTKDMGILDSTLNDSYLYLL
                     QYFFSMCSKVIILSAAQPFVLVAIVPCVFIYYKLMQIYSASNRETRRIKSIAHSPVFT
                     LLEESLQGQRTIATYGKMHLVLQEALRRLDVVYSALYMQNVSNRWLGVRLEFVSCVIT
                     LVVALIGVIGKMERASSQNIGLISLSLTMAITLTETLNWLVRQVAMVEANMNSVERVM
                     YYTREVEHEHVPEMKELVAQLIRSESGTAADVTGTVVIEPASPTCAAPHIVQAGSLVF
                     EGVQMRYRKGLPLVLRGVSFRIAPREKVGIVGRTGSGKSTLLLTFMRMVEVCGGEIRV
                     NGREIGSYGLRELRRQFSMIPQDPVLFDGTVRQNVDPFLEASSAEVWAALELVGLRER
                     VASESEGIDSCVLEGGSNYSVGQRQLMCMARALLKKGSGFILMDEATANIDPALDRQI
                     QATVMSAFSAYTVITIAHRLHTVAQYDKIIVMDHGAVAEMGSPRELVMNRQSIFHSMV
                     EALGRRVAKDFVELLG"
     gene            <96279..>97538
                     /locus_tag="LMJF_23_0260"
                     /db_xref="GeneID:5651986"
     mRNA            <96279..>97538
                     /locus_tag="LMJF_23_0260"
                     /product="putative argininosuccinate synthase"
                     /transcript_id="XM_001683298.1"
                     /db_xref="GeneID:5651986"
     CDS             96279..97538
                     /locus_tag="LMJF_23_0260"
                     /EC_number="6.3.4.5"
                     /codon_start=1
                     /product="putative argininosuccinate synthase"
                     /protein_id="XP_001683350.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651986"
                     /db_xref="GOA:Q4QBE8"
                     /db_xref="InterPro:IPR001518"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR018223"
                     /db_xref="InterPro:IPR023434"
                     /db_xref="InterPro:IPR024074"
                     /db_xref="UniProtKB/TrEMBL:Q4QBE8"
                     /translation="MLATTTAIVCGQKPSVVLAYSGGLDTSVIIPWLKENYDYEVIAC
                     CANVGQGAGEIDGLEEKAKKAGASKLYLLDLREEYVTDYIFPTLKAGAMYEGKYMLGT
                     SHARPLIAKHLVEVAHKEGAVAICHGATGKGNDQVRFELAIMALDPSLKCVAPWREWN
                     IKSREDAIDYAEAHGVPVPCTKSDLYSRDRNLWHISHEGMDLEDPAKEPAHAKLLRLC
                     NTVEKAPDEAEYVTVQFEKGIPVAVNGRKMASVELVEELNALGGKHAIGIEDIVEDRL
                     VGMKSRGVYETPAGTILYKALDMLESLCLDRDTQSFKRLSAVRFSELVYDGKWFTPLR
                     ESMSAMFDKMAETVTGEATLKLYKGNLMPAGAKSPYSLYDESIASFGDSHHLYNHHDA
                     EGFIRLFGLPLRVRSMMLQAKEMPSSL"
     gene            <101918..>102784
                     /gene="PTR1"
                     /locus_tag="LMJF_23_0270"
                     /db_xref="GeneID:5651987"
     mRNA            <101918..>102784
                     /gene="PTR1"
                     /locus_tag="LMJF_23_0270"
                     /product="pteridine reductase 1"
                     /transcript_id="XM_001683299.1"
                     /db_xref="GeneID:5651987"
     CDS             101918..102784
                     /gene="PTR1"
                     /locus_tag="LMJF_23_0270"
                     /EC_number="1.5.1.33"
                     /EC_number="2.1.1.45"
                     /codon_start=1
                     /product="pteridine reductase 1"
                     /protein_id="XP_001683351.1"
                     /db_xref="GeneID:5651987"
                     /db_xref="GOA:Q01782"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR014058"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="PDB:1E7W"
                     /db_xref="PDB:1E92"
                     /db_xref="PDB:1W0C"
                     /db_xref="PDB:2BF7"
                     /db_xref="PDB:2BFA"
                     /db_xref="PDB:2BFM"
                     /db_xref="PDB:2BFO"
                     /db_xref="PDB:2BFP"
                     /db_xref="PDB:2QHX"
                     /db_xref="PDB:3H4V"
                     /translation="MTAPTVPVALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAEA
                     NALSATLNARRPNSAITVQADLSNVATAPVSGADGSAPVTLFTRCAELVAACYTHWGR
                     CDVLVNNASSFYPTPLLRNDEDGHEPCVGDREAMETATADLFGSNAIAPYFLIKAFAH
                     RVAGTPAKHRGTNYSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIR
                     VNGVGPGLSVLVDDMPPAVWEGHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTC
                     VKVDGGYSLTRA"
     gene            <103838..>107140
                     /locus_tag="LMJF_23_0280"
                     /db_xref="GeneID:5651988"
     mRNA            <103838..>107140
                     /locus_tag="LMJF_23_0280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683300.1"
                     /db_xref="GeneID:5651988"
     CDS             103838..107140
                     /locus_tag="LMJF_23_0280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683352.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651988"
                     /db_xref="GOA:Q4QBE6"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR018957"
                     /db_xref="UniProtKB/TrEMBL:Q4QBE6"
                     /translation="MPCGYRTSPRQPAYARGAGCSFHCVRTPAAHGRAPGAVAAAAAG
                     ASPSMLSSLPEEPVTEAAYRLSPQEVQRRAQQVLTAQVRSLLEARLQERLRQTRVAHA
                     QRNATRSPPTPPAPLPVPPFDTHMANTWPNSASFDATDGASAAPTPAKLESLYEEASP
                     LITAQMSTDGGTAGGATTRPGATAAASAVHSPAEMSITDVNAYSAVELVRVHRLKGVP
                     NHNRGLFAGFSRRYFTTRSGHYTVGRGGEGNRRVRSGVSGFMWNAQRHSGAVSTPPPR
                     LTMRSLFVDNRILFEWTESDSSYGVQKGDESSGQRDDGTVFSDTFDMDDVPLGHALKR
                     MLEHTYGKRMTAEQRAEAARRLRERREGQQGKSGRYRVRKGKGTDGSPNSSADGDAMT
                     DGDDSFLSGVKDGSSNVGRTGQHRRVPADKGSRSGAASQNSKCGVIVVQDLSPVQLVC
                     DHSMFPVVDTPMLSAGATSHNCDDPLLTFAAPGHRYSTSADGGSLRHSGGGDHLNATF
                     LAALSLSSLGHTMTVDEAEAHRRKRHFHVGFESLSTGSRPGGGDGPAGLSEVRRSGSG
                     TIDGRGAYGSVSLPSSGEQHRQLSHTACLYTDEETVVVDKRLSAVAGELQDGAQYASS
                     VAPGARGGSGAAGGLDDGGRYTASRAGEGISSATGQGTDEGLTAEETQQGILASLSGA
                     SISVTVTSEDDLMVPLKDNGDSGNLDEFLTHFPEEENHVRLRRAAKNILDGVENMWDE
                     DDSSRSAFLLPKFLNLNFQFPGLDDVIGGSDGLDDHSEHDQGSADDEHESFTGFGVNE
                     AELNEKFRIEAEEECGDVVAQRDALLAEIEAQRQLLDNMGADAHYLSVGQASTGMTAE
                     QYAIMLTDEVSRYAKSNQLHLNHTLEEMSEQQKDGEAWTTIERAAYGFLDRFGRERTA
                     TADVGCQVCDADLCYVDAAVRSTEEQLEDLFMHEKALVNAVRLATVAVANIMTFHASL
                     EMESTCHECFFVFDKPRTLWPCGHTFCLSCLSNMYNRRGELICSECGSVCEVGYTPNV
                     SVELVANYQTLCKRTESNEDSEPDGSLKKECKPQTVEGVLRSLLNDLLSAQSSWTAMP
                     SEHSPLRLGVGA"
     gene            <108187..>109182
                     /locus_tag="LMJF_23_0290"
                     /db_xref="GeneID:5651989"
     mRNA            <108187..>109182
                     /locus_tag="LMJF_23_0290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683301.1"
                     /db_xref="GeneID:5651989"
     CDS             108187..109182
                     /locus_tag="LMJF_23_0290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683353.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651989"
                     /db_xref="GOA:Q4QBE5"
                     /db_xref="InterPro:IPR007150"
                     /db_xref="UniProtKB/TrEMBL:Q4QBE5"
                     /translation="MRFKATLKDAKGLLGVLQVCRSIQRDCIVRLQSERIRFFSNTNA
                     ADGVQVWMRCQSSFLFYEMVCDSGYDEHSITCEVLDLAQLIHIVKQAEARERSHQGTT
                     SRVQMRLARNGRYPLWRVAMQGLSGQPDVSFDVPLRILGDREIQSLSPPPLERQHLQI
                     LVPDMLELTTFIDKLKNTAADSVTFSARVLMPPTPRRGAEDGEAEDADGGAEVRRGVK
                     RPRDKDALPLASLLIYAEHFMARFSLKYEAVELVEQLEREDGDDDGDDDGGAVDDVRV
                     ATVMVETRKFARFFSAVKELDPMKMSMYLVDRRALVLSVFAVGNTAMVAYIPARA"
     gene            <110163..>111401
                     /locus_tag="LMJF_23_0300"
                     /db_xref="GeneID:5651990"
     mRNA            <110163..>111401
                     /locus_tag="LMJF_23_0300"
                     /product="putative tryptophanyl-tRNA synthetase"
                     /transcript_id="XM_001683302.1"
                     /db_xref="GeneID:5651990"
     CDS             110163..111401
                     /locus_tag="LMJF_23_0300"
                     /EC_number="6.1.1.2"
                     /codon_start=1
                     /product="putative tryptophanyl-tRNA synthetase"
                     /protein_id="XP_001683354.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651990"
                     /db_xref="GOA:Q4QBE4"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002305"
                     /db_xref="InterPro:IPR002306"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:Q4QBE4"
                     /translation="MDDGARQHMRDVMAKCRKRTMTTTPSANAEGVATPVLDAVPAGD
                     AALQAAASPAMQQRQQPPALALHHFFHRDIAFSHRDLHKALVDIEASVKTGERSVFLY
                     TGRGPSAGTMHLGHVLPFMLTKYLQDVFSLPLVIQITDDEKFLFRDVPFEGAKADELI
                     RSNIKDIIAFNFNPRHTFIFRNTHYMGDMYPTVLRLQRSMTGNAVKHTLGITDSDNVG
                     KLAFPATQAAPCFSTAFRRVLRNGDRPMRCLIPCAIDQDPFFVLTRAAALRLKQLPPA
                     LLHTKFLPALKGLEHKMSSSAEEKGVITLHDTDKQVRKKLRRAFSGGCATLEQMQETG
                     ANLELDVAYQYLRFFCPDDTLFADVTQRYRSGTLNSGEVKDLAADCIIREVLHDWRER
                     RATVTDDDVVEFCRIRDILL"
     gene            <112840..>116760
                     /locus_tag="LMJF_23_0310"
                     /db_xref="GeneID:5651991"
     mRNA            <112840..>116760
                     /locus_tag="LMJF_23_0310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683303.1"
                     /db_xref="GeneID:5651991"
     CDS             112840..116760
                     /locus_tag="LMJF_23_0310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683355.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651991"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QBE3"
                     /translation="MPFHIGAVVVASHGSVGSSPADGSFSDLTAADIYGSLQPPPALS
                     LPARSETSPSHRTKDNPAAGVIATAAAASSSPPSQTAAQAKLSITAAGGSNEHSTCKS
                     LVSVLDDEQRRCVNAAYHISFHGNTRVKLKPTAVVLPNGAHFLIVDRFVSGNCDGVYE
                     KNKKMWEHIPIGQARVFARAHAAAPTISLAELVGSAQVNCEGSGPGTATTVAVKCPRR
                     SGSPTSIAASSPPRSPPIAPLPTARAVGSSSQPNRWEYSSPQQHSFHSEWTRVATAVG
                     LRKMGHWREATSVFSIHKEVSKRATALEKVDGEPGRIAAFSWMGERYWIIGCRYQHIV
                     TRLDVPEADLMRYVASSSSSTSTSSSSSSVSDDATVSVKVSSAKQPSLSSRVNSPTQN
                     PQDYVERGSAHSYTVAGGAAALAGAGSSSDAAYLDLAVRMARLWRRVLESLRITAEDA
                     ANALDTASASDAAVAAAHADALIELHTCVAADNRSLCFDAIMSGWERLQSFFVTRDVA
                     GDESMSTASTPVSCTSIRTYRTSSTAFMMASTPVTDGSGATRSTVATVPVATPLWFYA
                     ITWDASLDERGWCMGVEEAFAFFGRFRLPTVTKSAEVQVGSPEYEALRQLVLSRFDTA
                     GAVMYGSNRDEADGAKAAVVVQVWKCRSYPHSLERVVQEYVVTHRLCGEPLRCKVKKK
                     VSSLSRETRLCIKQWELHRLPFLLDFALWLHREKYITPSTDLVALKAIRGHWLSYQER
                     FQKLLEAQLRLRHRGSSCQGTTASTPEAVRRSRGARADTADGVRCSARSDDEDAGVPN
                     GNRDLQQHKQQDEAPSQDTESLDPIMLVGPQGCGKSTMARILYALLEEAGAAPRWLNQ
                     DEVGNRSAYLAAIRRAVTQGSYSHLLLDKMNLDDKSRSDYAAAGLKPVLVVVWTHSAG
                     VEAMVEACYERVVKRGVRHRTFCTEDVTLLHSLPSSISSRSPELGPAVVPLQQSGVTF
                     LSGSADTTAAPSSSASVSMTSVGHYGCSPNVPFLTEGQSPPPSSRLHSILQASAKRYQ
                     VPANVPLVDLDMTWSCETMVAAVWEALRDRGTCVLPPLAELNVMAAMQTAYAYEQLLE
                     TYPSRVVSAVLRGPASGVVLRQLSLVHTPLIIPKTQRLQPHVEILLHNFCLHPSPTAL
                     VRYAGQVGCTRRMTVQAVVSNSKVALLLVLGPTETAAADSAACTEMFVDGEAAVVPLH
                     AGATQPALYAAPLLNNASGEAAAMGKGATGVSAASAADDPNCIEARPMQEHFAVLAKA
                     KVTPDYCEELAQRVRDDPDADPYCAVQWLSPPLEMDFAVTLLLP"
     gene            <118200..>119021
                     /locus_tag="LMJF_23_0320"
                     /db_xref="GeneID:5651992"
     mRNA            <118200..>119021
                     /locus_tag="LMJF_23_0320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683304.1"
                     /db_xref="GeneID:5651992"
     CDS             118200..119021
                     /locus_tag="LMJF_23_0320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683356.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651992"
                     /db_xref="UniProtKB/TrEMBL:Q4QBE2"
                     /translation="MSGVLSTPLTPSYRSSAAPYREAHFGHASGALRPHRAPLNRGIR
                     RTAECPCAVRLYHMTGQDIAARSEYCSVVLGAPSVGISQGAQPGALSPPPGDQAVAAA
                     GAGPSLASTAGASAAERPIAVQLAWADTTVWEVALTALRAVRSKADAAYKSDTKRAAR
                     QANGGITVPASAAPGRRQQVAEEDYSDSKDGEEEAPYSTPLPRYQVELLTGTVSPEGR
                     ASVLPLCMVNCRQVVYGHRALLPVRRGDCVDYNTALYELPYNLGDPVFVTCTRTR"
     gene            <120033..>120695
                     /locus_tag="LMJF_23_0330"
                     /db_xref="GeneID:5651993"
     mRNA            <120033..>120695
                     /locus_tag="LMJF_23_0330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683305.1"
                     /db_xref="GeneID:5651993"
     CDS             120033..120695
                     /locus_tag="LMJF_23_0330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683357.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651993"
                     /db_xref="UniProtKB/TrEMBL:Q4QBE1"
                     /translation="MDSMKSKSAMLMTKGIMDMRSDPPRLICTILRYKHPDTKKEVTL
                     YPIPNIAAPAYFQRVLNGDALQHNFDKILCEDGRLPFQAGSASAGRQQWLRRLLPFFS
                     IRPVVADGEKFDGIIVRDALESRMAYQMVLDGYDPPVDPRARRAVERIDTYPENTRVV
                     VPWGVYHMPYFRYRLEKEGYKALPSEEVVVFGFQQVMGFFFLSGVVVFAMSFVVLRIL
                     FG"
     gene            <121570..>121896
                     /locus_tag="LMJF_23_0340"
                     /db_xref="GeneID:5651994"
     mRNA            <121570..>121896
                     /locus_tag="LMJF_23_0340"
                     /product="putative (H+)-ATPase G subunit"
                     /transcript_id="XM_001683306.1"
                     /db_xref="GeneID:5651994"
     CDS             121570..121896
                     /locus_tag="LMJF_23_0340"
                     /EC_number="3.6.3.14"
                     /codon_start=1
                     /product="putative (H+)-ATPase G subunit"
                     /protein_id="XP_001683358.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651994"
                     /db_xref="GOA:Q4QBE0"
                     /db_xref="InterPro:IPR005124"
                     /db_xref="UniProtKB/TrEMBL:Q4QBE0"
                     /translation="MPPKQDNVQKLLAAEEKRNNLISDAKARKQQKVKQAKADAEREV
                     ASFRADKDREYDRYRAQQNGGADAENAELARETDRELEELKKLTAQRMDAVANMMVRL
                     IVTVKE"
     gene            <125087..>125971
                     /locus_tag="LMJF_23_0350"
                     /db_xref="GeneID:5651995"
     mRNA            <125087..>125971
                     /locus_tag="LMJF_23_0350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683307.1"
                     /db_xref="GeneID:5651995"
     CDS             125087..125971
                     /locus_tag="LMJF_23_0350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683359.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651995"
                     /db_xref="UniProtKB/TrEMBL:Q4QBD9"
                     /translation="MTPNGNGATHESRPGKKGRPPRRRADREAAGAHFDCGSSQTTEK
                     GGDEYQYKHPKPRVLTSSLFMWEHVAVFSMPAQVAELERVSRDVARLLEDSNTGTHPM
                     QRYWNAQWSRMVWREEELPDEKKYLAPTMLTRSDGKRKWKNVFVQEYPLYLKRVYQGK
                     GVCNNAVNAAKVLFNRQVLNAAKTAAELERMELTVEEARVKEQKKRGVDVEFEETPDT
                     APSPPWLGCHHGSYPEKGERERHEKGRPRAVKKASHETYTRSDYKEDYRTGDRKGKHK
                     KGGTGRWSKFDDFGDYDY"
     gene            <126858..>127934
                     /locus_tag="LMJF_23_0355"
                     /db_xref="GeneID:12980825"
     mRNA            <126858..>127934
                     /locus_tag="LMJF_23_0355"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721747.1"
                     /db_xref="GeneID:12980825"
     CDS             126858..127934
                     /locus_tag="LMJF_23_0355"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721795.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0355"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0355"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980825"
                     /db_xref="UniProtKB/TrEMBL:E9ACS3"
                     /translation="MSCVPTQKPLNEIELLVQELQLRMTRAVEASPRLYAALKEPRVL
                     YAILAEFFASQLEQARRSKHVALEAADVRRVWVFCLQELAFLCATHDTNAATSSSALS
                     LYDFVHGAPSLPLEALQRGAPVVEANSVARAPSAAAMSSSPCTARSEASRTSVFSILQ
                     SGFAGMMDLAYVADQRLQRPSSSGAISVVSLAALAASLVPTLDRVQAVRLTAQIADDV
                     VDSRITSSDGSAMPPCSRSAVATLLAGVWHIWGVLDAAHSPTLHSLGQCLFQQFATPA
                     HLRLAPTVSPVSFAAWLQRALRENNGGLHQQLYADAEGSTSAAKTSTGEVDAVVTRAT
                     EDHNTAAVAEDVATVSDFWARLAS"
     gene            <131148..>132206
                     /locus_tag="LMJF_23_0360"
                     /db_xref="GeneID:5651996"
     mRNA            <131148..>132206
                     /locus_tag="LMJF_23_0360"
                     /product="putative NADP-dependent alcohol dehydrogenase"
                     /transcript_id="XM_001683308.1"
                     /db_xref="GeneID:5651996"
     CDS             131148..132206
                     /locus_tag="LMJF_23_0360"
                     /EC_number="1.1.1.1"
                     /codon_start=1
                     /product="putative NADP-dependent alcohol dehydrogenase"
                     /protein_id="XP_001683360.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651996"
                     /db_xref="GOA:Q4QBD8"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR029752"
                     /db_xref="UniProtKB/TrEMBL:Q4QBD8"
                     /translation="MPTEAHGWAALSAKSKLEPFAFQRRDVGPDDVVIAIAYCGVCHS
                     DVHQARDEWDGSTFPMVPGHEIVGHVTKVGSEVTKYKAGDRVGVGCMVDSCMKCRQCE
                     RGLEQYCVNGASFTYNSTQQDKKTPTFGGYSDHVVVREHFVVSIPDNLDLCAAAPLLC
                     AGVTTFSPLRYWGVKKGTRVGVVGLGGLGHMAVKLANAMGAEVTVFTRSSNKVEEAEN
                     LGAHHVVNTNNEQEMNSIQGTLDVIVDTVGMSHDLRPYMMTLDIDGKLALVGMPEHAH
                     PPLDPRRIIASRQCVGGSNIAGMPETQELLNFCGEHNITATVEKIGIEYINEAYERIL
                     ASDVRYRFVIDMASLKKE"
     gene            <135659..>136015
                     /locus_tag="LMJF_23_0370"
                     /db_xref="GeneID:5651997"
     mRNA            <135659..>136015
                     /locus_tag="LMJF_23_0370"
                     /product="putative cytochrome c oxidase subunit 10"
                     /transcript_id="XM_001683309.1"
                     /db_xref="GeneID:5651997"
     CDS             135659..136015
                     /locus_tag="LMJF_23_0370"
                     /EC_number="1.9.3.1"
                     /codon_start=1
                     /product="putative cytochrome c oxidase subunit 10"
                     /protein_id="XP_001683361.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651997"
                     /db_xref="GOA:Q4QBD7"
                     /db_xref="UniProtKB/TrEMBL:Q4QBD7"
                     /translation="MRRFTSRIAAFAAVPAAEQTRQLHFPISPPPIEIDYLDSDPLEF
                     AVRTEARRWGFDDLQYMRELAFVRIKNNPSIGDFRQMTPEERRDLFWGSDRQDFFRYI
                     TLKLTGQPEHLYHRGW"
     gene            <139094..>142819
                     /gene="ABCG5"
                     /locus_tag="LMJF_23_0380"
                     /db_xref="GeneID:5651998"
     mRNA            <139094..>142819
                     /gene="ABCG5"
                     /locus_tag="LMJF_23_0380"
                     /product="putative ATP-binding cassette protein subfamily"
                     /transcript_id="XM_001683310.1"
                     /db_xref="GeneID:5651998"
     CDS             139094..142819
                     /gene="ABCG5"
                     /locus_tag="LMJF_23_0380"
                     /codon_start=1
                     /product="putative ATP-binding cassette protein subfamily"
                     /protein_id="XP_001683362.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651998"
                     /db_xref="GOA:Q4QBD6"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QBD6"
                     /translation="MMAPQRKEARNAVPRSHHASSLSAATTLIAVFLLLVACASVTQA
                     LHVSPASAEAAMWSGTDVFASSDSHSDPITCVNGGIPSGDHCICPLYYTSANCSQRQC
                     PNSVGGEGPHRVLPVNSTNKLCDHCDEKEFTGLSCQICQSNAACRQYAGSAAECDNST
                     FTRGDNKQFQCTLKNEFFVRLMSGNRNITAEVLFNCTTSDGTAFRKGEQGMCNMAIYR
                     IEPNHSYVDPFFRCDAQACSLKYGQKGPDMSDANNNTLRQRFFRAARTAGQVALIVEC
                     ALLALLGGFTALLGPRRTTSITVALASVITVTVLVYISLMMLSMQSISAPEQTVIYEC
                     KKTHCACAEDPPPQYDPICSQKEELSKQILPSIKNSIRVVCGQNTSLCELTLADLSLV
                     FQADCRASECVDTVRFPDDSSSDSNDDGGGGTAVLAKLNLGFLLVLLVLLVVSGIGTH
                     YYYTCSISYERDRDFLVTFHVSTPYSDDGDVHETGDPAVLDDRHVHLNGNADGSAVER
                     EQEPLLYNSPAPRAERRNFLPRGVSSSRHSEGNVSVRASVYEQARALTPAARARIEEL
                     RRLTAAPLELQVSELRYTLNTPLLGAADEGSQRTLLHRINFTVHSGDVLAIMGPSGAG
                     KTTLLDLLSARAKPGEVSGTITLNGTPITTTGSRTAQYRNIIGYVSQEDTLLPSLTVE
                     QTILYAARLKLPKALSHITVRRIVARVIETLKLQHCAQTLIGGETTRGISGGEKRRVS
                     IAVELLANPRILYLDEPTSGLDAVSAKRVVEAVVALAKDSAMSMYAMHYFAFQPIVIF
                     SIHQPSQEIYELFDKVLLLSRGMSIYCGSAASAAATIERRVTAAFGHTREVPRREVHN
                     NQAEYLMKVEEILDDAVRAELQEEDALENTDTAGAPYRSASADGSPLAAARTQVPPCR
                     SPESPAPRAPSQSVGCHDSDDGEQVSGADILSTTFGFRMYYANVYEQLQLLISRSITC
                     LFGSFHLVICHSAVVACLATLMCVLYHEQALDLPGSLNRAGSVSFLLLVTSFLSLSCL
                     EQLIVERKLFNVERENGFYTTCPYLISKIVVDIIPLRIIPAVVLASVIYFPMGFRVDA
                     GLHFFYFILIIVLFSICMTMVILCIGIVSGSFGAAALLSSVLILWNFVFGGALVQAET
                     IPPSLRAFKSISPFFLAFESLMVNELDGQHCVFSPTDETGKKSSASIPIMCVQYLANI
                     GLKPERFNADVMQLAVYCLLFVGLSWVLLSSCSKLVH"
     gene            <144506..>150448
                     /locus_tag="LMJF_23_0390"
                     /db_xref="GeneID:5651999"
     mRNA            <144506..>150448
                     /locus_tag="LMJF_23_0390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683311.1"
                     /db_xref="GeneID:5651999"
     CDS             144506..150448
                     /locus_tag="LMJF_23_0390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683363.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651999"
                     /db_xref="UniProtKB/TrEMBL:Q4QBD5"
                     /translation="MSRQPNEDTFGAALANEFQWRNLYLKEFGCCTYPPPIPKDPSTT
                     AVGVYPMRRQVKLLQQESSSSSEDADNEVEEDDHYEESTNDTDGDDSYQANFSSGLFQ
                     FSFSGGDSDGCHSRKHQSHNVDLADAEPPSTSCSRRDRSTADQFFSLDLSMSVGEDGA
                     STHTSRHPSHHSGGRRCGHGAVLRKDDFFDTNDVFSTKFFSFLWMGSDNDGHDEEYSS
                     ETRTVDHEVRRWGARDPDNGRGIKSSMRSTKNPGRLTLSRPGFSTVTSHAFNTNPQGV
                     PEVVLRLHHQTWILLMDNRLMAWVHRAATDHCQRATQLRQRLLEIIALGPCSADIAGD
                     AALASPTQVRTSLVLPEEDALQRTLESFSPFFVVIAPPPAVQRAKDQFRAAQRGQLRS
                     GNGQQAAAASVADLIGLPLLSQYGSWREAYEHRHRWDKAPFSFFFIHDVSYNYAQVTA
                     LFVQLQLLYTHSHSHSRRCAEAKRESVPLKSASRQFATSSTASRTPEERRHVCPLLLM
                     QEMTENVVLAYEQSSARSALPMLRRVLDFLTDAALDVVTAHRFISRKAVLRQHQFQLP
                     GMTTVRPLPVATRASAATAAVAAAFDMSQATEEDGSADAAEDRRLTSRSLDVSKEGDG
                     APMKDELSGTDGSGIPISGVEPKRVTESDINALFEIAYWFADVTTANASVPLDPAPPA
                     GMTAGQSAARAMPPNTSLEALKKMSRSSPASTPPLDTPTDRAGTNHSAAAAAGGGGAA
                     LPMYKVLSVEESQLSSPPNSNALSMTGAGDSSLSSLTSRSQQYLPGRVQVHNPVESLA
                     EAVALLEAYRKPQQLRDDRPGRGGRRKRHSVSFDPRARSGGAGAKGSALPSLTPIPVS
                     DSFISFISPLVVLTTYLRLHGGTWLKHLCRRVFESLRRPNVLLYVNTLELDAAWASLQ
                     LPSSLSSQETTKASVAAATRGRQRLLNRSISSTPLAPSTAASAEAARSEFLHGLGCLE
                     DLICQDILCALNNFFGFLYGKRAAAARLPQGISILLTQFVSTVHLYMLESVGATRAAA
                     AAAPGNGNRNRSMRPGSHPSPSASGGATAADAPSRIVEDCLRMCKQRYYAGLRQHGSA
                     NEWGEAYVSAFRNLDGPLKSFSDGTAAEATASTASLPRLLHTIEQHRLAKFILFDCWI
                     LPALNNAIALGYLASDSPMHLRWNVDALARYLKILVHAPFVEQDKTNFSSLFPEVPRG
                     SSRRSTGHPRSNDVRDGKGGRGADKQPGSGRPPSQGDGRGAGRPTVLTLPPYLTGIYD
                     VATGSLVRLQTSIPMTATAGDNWSKRMSSAAAAAEHPTALSAPSSTLSSSMSTVAHGE
                     SVHSEALSPRYTDQSGEDVSAVETPTQEGQSKWTLEATALPSSATATHEPPPRAAPQQ
                     HFKVQQAAAANESTVTPQSASSSRLFFIAGESVEAAADMSSPGTHRDTGSFAGSPKDV
                     QGELPMGSRGKISDAPSSSITPALTSPHASPPPPLNRIQSIFSSADQRATGAAVAMTH
                     PYVVMDDAVWLDMSPALQNLNDCIGLTFCDRGTGEAFAGDTGTVAAISRLPTISALSG
                     HADSRTGATTAHGAAGQRASGALRDCSTFVDLALFDVPALEMLNAFTYAACTDDSSYV
                     VVSEFEVLPSMAAGCLERIYELATDTHPMVLHALQKGAFHFAYNDSGSVPSGLTSLYT
                     ACMNGVLLHPRTAAHVLKNVMDNNPPFSHTLLKPVADTTALDLLGHLATHSRDVPMVD
                     VNAVVPLIHSMVPDRNSSGGGGRRVHARTDAANSGMTLPAVGAPNTSTTSSATVSHRW
                     ERESRRLLRELVFLTTGNSDSGPPLPLAPGLRRPVGPPHPIHMLRAGAARIAEDTGGM
                     TPMVFDPWWRAMVVALCVKASNVFAECSGNQPVLFQDMCNAQAEESKRLNRYTIAHFV
                     NTKGRETCEKDAVAMMSGSQQRPTSISGRGSYIGDLPAWPGRKRKRRPKARGVTASVG
                     GKPASIGRKSKKKGRKAAAAAA"
     gene            152739..156654
                     /locus_tag="LMJF_23_0410"
                     /pseudo
                     /db_xref="GeneID:12980826"
     misc_feature    152739..156654
                     /locus_tag="LMJF_23_0410"
                     /pseudo
                     /db_xref="GeneID:12980826"
     gene            <157021..>157443
                     /locus_tag="LMJF_23_0420"
                     /db_xref="GeneID:5652002"
     mRNA            <157021..>157443
                     /locus_tag="LMJF_23_0420"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683314.1"
                     /db_xref="GeneID:5652002"
     CDS             157021..157443
                     /locus_tag="LMJF_23_0420"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683366.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652002"
                     /db_xref="UniProtKB/TrEMBL:Q4QBD2"
                     /translation="MHASILASMYTKRDVSVSSDSALSGPSSCCVSSLSPSSSLSASA
                     HRRGHGAPPPPLQHFFVPEPRGLAQETSCALSFAGIGGLAGALLALLRTTEYDMYHVQ
                     CVATEVMANLQVVRLHLIERTLNATVGMEEACPSQEDS"
     gene            <159098..>160324
                     /locus_tag="LMJF_23_0430"
                     /db_xref="GeneID:5652003"
     mRNA            <159098..>160324
                     /locus_tag="LMJF_23_0430"
                     /product="aldose 1-epimerase-like protein"
                     /transcript_id="XM_001683315.1"
                     /db_xref="GeneID:5652003"
     CDS             159098..160324
                     /locus_tag="LMJF_23_0430"
                     /EC_number="5.1.3.3"
                     /codon_start=1
                     /product="aldose 1-epimerase-like protein"
                     /protein_id="XP_001683367.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652003"
                     /db_xref="GOA:Q4QBD1"
                     /db_xref="InterPro:IPR008183"
                     /db_xref="InterPro:IPR011013"
                     /db_xref="InterPro:IPR014718"
                     /db_xref="InterPro:IPR015443"
                     /db_xref="InterPro:IPR018052"
                     /db_xref="UniProtKB/TrEMBL:Q4QBD1"
                     /translation="MADTQPVPATVTSAHGAHAEAFGESFIVTLSSENLRVQLLSHGA
                     ALNSVQVRKPHPAASATASASATAEQDDEWLEVCLGYTNPEEALSADAVIGHTIGRYA
                     GRIANGEFEIANTTYTLAKNFGPHNLHGGPVGFQHQEWKYLLSDGRDETGVAFHLVSP
                     HMDQGFPGELFVTATYSIIKSAPVPTLKYVLQASLSDNTPVDMTVINLTNHAYWNLNG
                     VPRPAAADAVAPLPRSIANHYLQLQSKYFAVTDELSIPNGDMRPVEGTPHDYSALRCV
                     AEGMEATKEEGRDGGGYDDPVALETWDSTLREAALVYSPATKLRMQVCTTNPAIVVYT
                     ANHLPADASGSKGQRFQQHSAICLECQYFPNSPNVRAFPSTVLKKGEAYNETTIHAFQ
                     FMNADITPEEKLLRRQ"
     gene            <162691..>163644
                     /locus_tag="LMJF_23_0440"
                     /db_xref="GeneID:5652004"
     mRNA            <162691..>163644
                     /locus_tag="LMJF_23_0440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683316.1"
                     /db_xref="GeneID:5652004"
     CDS             162691..163644
                     /locus_tag="LMJF_23_0440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683368.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652004"
                     /db_xref="UniProtKB/TrEMBL:Q4QBD0"
                     /translation="MNIVTSYFLVRKLPGTLAMGGDVLEHQNARQREYMECLRLNQQH
                     PGVASIHLIVEGADAYEHLLKHVLCNPHFQNASTLTTSTAPASARHRRRHAAPIVPVV
                     RFASGMPLYADFFAYANQLLSHRLTMVCNADVYLSPEHFSLSAVEDLFRQSSTLPPPH
                     AAPCGSCQPSTADLAEREAMRPKSAPKRANPLALALTRYESDSPLDAPFLFDYRGSHD
                     AFVLVPPVPPSFVRSVAHPQNCYKAENIVLHELQQSGYLTLNPTLGDGVRLVHRHATD
                     LRQWFPPVDESRYGRAQPNTLAQAASRIREEARVRSLPPSV"
     gene            <166701..>170015
                     /locus_tag="LMJF_23_0450"
                     /db_xref="GeneID:5652005"
     mRNA            <166701..>170015
                     /locus_tag="LMJF_23_0450"
                     /product="permease-like protein"
                     /transcript_id="XM_001683317.1"
                     /db_xref="GeneID:5652005"
     CDS             166701..170015
                     /locus_tag="LMJF_23_0450"
                     /codon_start=1
                     /product="permease-like protein"
                     /protein_id="XP_001683369.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652005"
                     /db_xref="GOA:Q4QBC9"
                     /db_xref="InterPro:IPR003838"
                     /db_xref="UniProtKB/TrEMBL:Q4QBC9"
                     /translation="MSIAVPVKKSEDSDDRTGFFETLKLSWVYTVADARRRPLNIIIG
                     ITAVMLLVFFSAVVFIGIWKTPYILLRLAELTVGEMDIILYGGGSSLLLNYTKLSQSL
                     AKSQVVAGAAPRWIARADLTSEATYRANMHNPASARTANRVTSANILLINSELEQRAG
                     IGRGWPYREIGFDEAQIFFSAASYIGVSGNKGERVHLSINASSLRNAIGIGIPSFNIT
                     RPQKVTGPISFYLAAFFALNNITEDSIPLFDVVSLSMAATMADAVETTAGKYSSALGN
                     VVVMDCRQFLNVLVDQSCLLGPQSISPSEGYYFPTTAELFNISLPSTNSFDIQDYAMM
                     VVVMLEGRYDMYYANTKQRGAMLTEKANKLMEAIGLSFDGNLQFPLDTTIQTLDVFRM
                     LMTAACVVVVIGIVVLGLILMFTLLQINAEERQFELAMIRAQGMSRTQIIGILVMQTL
                     AFTVPGTAVGVLLACATNAILERMLSNFTKVPARLGDVPITAIVIGILMGLLLPLVAT
                     YSPVKRALSSSLRDALDIYRQVYNEAHVKAIRLEAMGLRMWQILLGLFLVFAGFLVYY
                     LMPLSFIFSNMMMFFILLDFVLICMIAGLCMMTYVVQGPAEVFVLYLLLWGRETRLQT
                     LIRKNLRSHRDRNSKAYMMVLLSVACLVASGMMFSMMSTISSQLAELTTGAPVTVVSK
                     SFWNPLDQASLDAFMRGEGSLYAMQWAYTSFALREYPQIASRTQVGSLIGNFRTIDVR
                     AVTEFFMDATYPDFNMVNSYRSGYEYPINTFHQRDVIRSMYEDPPHCNVSKKQDIIVN
                     GFPYGVKIPNVTAKESQVIPMIISSAAQDMIGLDVNSAAQLRFDYFLNNSVQALSTVF
                     YLEPRALVNRISGFLAVSSLPILFSQGTILVPTKHFQSLLNPAVLDFDADQMIFITNH
                     SVLEVRQAVLYVQLRSNVTKHEREIFVNALQAHTNTFYHVIVDTEATVEQLRSVQTLI
                     MGFFYFTSVICITLCAFMMWTTFISNVQLNAWTFGVLRSLGFRTAQLMRCAVYESLCI
                     VISAFTWGLVVGTAVGVTMAIELCQIMVIPFHFNFPYALVIIVFGMALAAAVVGSIAP
                     LLSLRKKPISSVLRGI"
     gene            <174520..>175317
                     /locus_tag="LMJF_23_0460"
                     /db_xref="GeneID:5652006"
     mRNA            <174520..>175317
                     /locus_tag="LMJF_23_0460"
                     /product="putative trypanothione synthetase"
                     /transcript_id="XM_001683318.1"
                     /db_xref="GeneID:5652006"
     CDS             174520..175317
                     /locus_tag="LMJF_23_0460"
                     /EC_number="6.3.1.9"
                     /codon_start=1
                     /product="putative trypanothione synthetase"
                     /protein_id="XP_001683370.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652006"
                     /db_xref="GOA:Q4QBC8"
                     /db_xref="InterPro:IPR007921"
                     /db_xref="UniProtKB/TrEMBL:Q4QBC8"
                     /translation="MGCKSSAEAKPSETRSPSARLSRNSVTTPPDRMDTAHRLHPAAR
                     EEVDLDPENVAGAEHISPSVVTARSSSRVAAVTLHGICGYTHNGVPAYSNGTSNTWPW
                     MKNFCEGIFMGYQWQCVEFARRWLWVTHRLLLPKRSCAYCFSSCTYAYRLKKDSSLIS
                     QRARAAMHKAAAETGAGSPSSSKEVNAATEARHLGPCTSRDTWEKVPAKFVKQGSLVP
                     PVADSLIVYPISWGSPWGHIGVITAVDLDRHRVYVADQNRYFHDWNG"
     gene            <176180..>177229
                     /locus_tag="LMJF_23_0470"
                     /db_xref="GeneID:5652007"
     mRNA            <176180..>177229
                     /locus_tag="LMJF_23_0470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683319.1"
                     /db_xref="GeneID:5652007"
     CDS             176180..177229
                     /locus_tag="LMJF_23_0470"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683371.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652007"
                     /db_xref="UniProtKB/TrEMBL:Q4QBC7"
                     /translation="MSSEPANRHRSQWSLTADPRMPSSAAALTQSSYLHALGATQQLQ
                     SESQHLPKARNTVASGASINPAMATVAQQKARYARGPYVPPPALRRSRLHLGPTADTS
                     GVLGGTQHIYEGRRALTQPATWSLPLQSASAQRRTPAGAGPTTRAAVNGDTTLHPLPP
                     PPPSLHPVPSPPTEWCQALVALQERQLLCWQQLIETQQLMTHHVGRLQEELQYVREVL
                     KHGLGKHSTTEAVVASATDPRKRSRSEGHDHFEAAIVTKSAAAVPTASAATSQRNMTV
                     HAVRLLGESTTSTPAVVQDAAACRGVAQPAEVAQRFSSRPSAERKEGSGGGSGAAHSK
                     STADAADSEADIFML"
     gene            <178210..>182394
                     /locus_tag="LMJF_23_0480"
                     /db_xref="GeneID:5652008"
     mRNA            <178210..>182394
                     /locus_tag="LMJF_23_0480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683320.1"
                     /db_xref="GeneID:5652008"
     CDS             178210..182394
                     /locus_tag="LMJF_23_0480"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683372.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652008"
                     /db_xref="UniProtKB/TrEMBL:Q4QBC6"
                     /translation="MDATWQSSIDRTLRSTEATLEQLQHRRDSYDRAKRRVDDYLGAT
                     PNRHDGQPALDVFDHDLSLPPPLPQHLRYRAARVAGPSPPTPTSLDPSTPARRSRLLS
                     SAAGCANPRPTGPSSSPLQLVHAQVRGALLELELEKAKRADSVRALAHRTTAELSEMR
                     SLITRLQTENEALTKSVRALEGRLGYGGKSDCQHKSVESSAATAADGATSISVSGAFA
                     RPTHDATMPAGAAASLAARVEALEAGLARQQQQAEDRQTHVASVLRELVKAEVGSEVS
                     QVRALARETARDSAENLLKLRLSALQSSTQADLQKALHIASASETVAQHAQQQCREAE
                     QRLSSHIHKLQAQLSEWQRTYSSDASGSAAVAALVSSQQEQERIATVDRRIAEQLRGV
                     QRQLQEYRADVEAQVDRLAQQHKVLCGVVQGKADAGELLAVREQVEEQERGGSSEWMS
                     RDQVTALLRTQLQPLHDEVRKAQTMAQENLGGADAWRQQAAMRLAAVEASMKAQSVET
                     PQDQQWQSCARDIQQLRTDMSSVQPRVAEAVQQAKAELADVWDAKVRLLEERTQQMHR
                     ERQQQTDTQLRQLQQTLAEQQEALQRARVVGESADERLRRTEAALASVEATLPPAVEG
                     VRARCEALQGLIQQTCVLPLTRVQQDIEEAQRKLQTAEEDRIRLNSSWAQQLAEARQY
                     HEERARHTREVLEQRLTHHKELFEELRTQQTLQRRAAEEQHQQLMDRVRQVQQQQYRA
                     SNVVALTPVREPPAEGGSIPALATAAPITMVGTSGPEEGQHSLQLLASRLQVLDNRLE
                     AVEETCAKVPFTIADAITSVTKRLEGLQNRMHAEADDERKRHDTLKHDMELQLGAVSR
                     TCSEMAASIDAQSARTARQVEELLSPLQLITHLAANESCLQHLARRLRDHLELAPENT
                     AALADVRAHFVGQAKTLEVLQASMQDTQQRLTELSEMRLADQTPAAVPPSSSEMESAA
                     AAREEMLNVVRSLQIALEEQRERQEDLEKGLRHVTAQQLTTITTELAELKRETDSVPL
                     ELAKLAEKCSALQSVQRQQLPTLQTYVQDVVDVVESNQSAQLDPIQRRLRAVEDRHKH
                     LQARVEEVSASHEADATQKVQDLHRKLDQQQMVYKAVEEQLAGLRNDVAATRADVDSL
                     TQRMAATEQVGERATDLHIVASLANADETAAAETDEALVVPDAVAELRLYMEDIDKRL
                     AQLEEQAHSSVSVTAEMLGAFRDQLQHVVGRFAAAAAQFTGSAEGNGASEAEKGDAAA
                     TEAAVAATKGVSCSIQPPIHSLEDVLLFLLHQLHQFQHALRQLQSNTVDTLEILEQHE
                     ESVAPLPMLQHTVDVMAATLLPLAERLGVDAAAVRAVSAQPQHRHHHHVSLFPPSRSS
                     SSSGSSAPEKCEWVRG"
     gene            <185527..>186363
                     /locus_tag="LMJF_23_0490"
                     /db_xref="GeneID:5652009"
     mRNA            <185527..>186363
                     /locus_tag="LMJF_23_0490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683321.1"
                     /db_xref="GeneID:5652009"
     CDS             185527..186363
                     /locus_tag="LMJF_23_0490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683373.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652009"
                     /db_xref="InterPro:IPR006828"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="UniProtKB/TrEMBL:Q4QBC5"
                     /translation="MSRSSLPRLPSGSVGATGGMTGNVPATTFPIVLRYQDQDVRTLI
                     ESRKPVYVAVEAMNWQPLPMTPSADSFYALLELPPGNHNYRFLVNGMEVVDSTQLLTP
                     GMASSDVPVPPQTLQTPVGLAVTQPLPKPVPARDGKPANTIFLNDVLLTTKEDDDIMD
                     NGEGWGQEPIMFEESRKYPPIVPLHLRYTPLNTPPTLVRCSRDGRMAVMDAGAEHSSR
                     VPPEHLPLPLSVTINHVYFQRREDHAVMGVTTRYCNKYTTVVYYSHLPANPVDPLESL
                     KA"
     gene            <187405..>188259
                     /locus_tag="LMJF_23_0500"
                     /db_xref="GeneID:5652010"
     mRNA            <187405..>188259
                     /locus_tag="LMJF_23_0500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683322.1"
                     /db_xref="GeneID:5652010"
     CDS             187405..188259
                     /locus_tag="LMJF_23_0500"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683374.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652010"
                     /db_xref="UniProtKB/TrEMBL:Q4QBC4"
                     /translation="MKAQLVLVIVAAGAVLSCCLSGLVAATSDAGSSISIPAAARPFS
                     ALAARARHTAEDALAPIAAKVLPCVPPPVLELAPIFAHGAASLVMVGRGVRTPPPAVS
                     GAKGNEVLQHTTAKFVYAAGAIVAELALLKLVYREPYRNQRKNHVNRFFATAAGFFLL
                     VLLTALPNDLIDTSLVCVFYFKLSSQVYTPAVVCGQLLSVYLAALLPALPPLSAAYTA
                     FLGYWADSFTDGLSAAQVREAWTELILALVVMGAFAFSVSARRGAGAALPSSPQESES
                     DGDDYYAE"
     gene            <188972..>189268
                     /locus_tag="LMJF_23_0510"
                     /db_xref="GeneID:5652011"
     mRNA            <188972..>189268
                     /locus_tag="LMJF_23_0510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683323.1"
                     /db_xref="GeneID:5652011"
     CDS             188972..189268
                     /locus_tag="LMJF_23_0510"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683375.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652011"
                     /db_xref="UniProtKB/TrEMBL:Q4QBC3"
                     /translation="MPMNKPAFTTNEARVERLQANYDEGLLRESMPSAEREKRDLHLL
                     YVSHDKLMFMFQNAMEGYSRSLKNQKMKEYNEAYIKTTSLPSKDHSCKSRFPFL"
     gene            <191605..>192669
                     /locus_tag="LMJF_23_0520"
                     /db_xref="GeneID:5652012"
     mRNA            <191605..>192669
                     /locus_tag="LMJF_23_0520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683324.1"
                     /db_xref="GeneID:5652012"
     CDS             191605..192669
                     /locus_tag="LMJF_23_0520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683376.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652012"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:Q4QBC2"
                     /translation="MPSYESRHMLRVLDSPEVLAKSFIGYCKRHRVTTRGWCRIGYVH
                     RSPPQRTHSRPGSYLLRGLIANRDIAKDENVVMMPVTACLHPGAAFRCEPFWKLLAPE
                     VQSALSSLTCAYNSRIADRSLIRHNQLLLALYMTYLVLLQNYNAAHLSATPGGDAIEY
                     INFMPRNEGNFEQFAAHLAGWLDAPEICRSAQASLASHFQLTQAEVRPVIIYALCMIY
                     SRMVPVDHRACLQYALQLTPLARAWDDIEATAAPAALPPPSSSGSVGDGSVRSGGANA
                     SLVRDPISFLCPVIDMCNHSDHENVAVMVPDRETASVTGPVICLRTLRPIAKGEELTM
                     TYGAAPHELKLIWGMQEIFP"
     gene            <194310..>195167
                     /locus_tag="LMJF_23_0530"
                     /db_xref="GeneID:5652013"
     mRNA            <194310..>195167
                     /locus_tag="LMJF_23_0530"
                     /product="ribosomal RNA methyltransferase-like protein"
                     /transcript_id="XM_001683325.1"
                     /db_xref="GeneID:5652013"
     CDS             194310..195167
                     /locus_tag="LMJF_23_0530"
                     /EC_number="2.1.1.-"
                     /codon_start=1
                     /product="ribosomal RNA methyltransferase-like protein"
                     /protein_id="XP_001683377.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652013"
                     /db_xref="GOA:Q4QBC1"
                     /db_xref="InterPro:IPR002877"
                     /db_xref="InterPro:IPR015507"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4QBC1"
                     /translation="MRATLVYRQGTSRQWMQRQSQDPFVTKARQDGYVARSAYKLTHI
                     DDRFHLFDRQHTRIAIDLGCSPGGWCQVIRERAGDRCFLLGVDLLPIKAQIPDAVIVQ
                     GDFTDVATQEKLVKYLAHHSATLGRGDATTAVAASSPSCFTKVDVVTSDMCPNRMGGS
                     QDRQRIAQLNLQAINVCAPLLRVGGHFACKVLGSRAAYEELWCRLSRLFLTVHACKPP
                     ASRMHSDEAFLVALDKLSTPRPASSATQSCSSRAVMGTASGDSSGGGRFGLDDWPGFG
                     RPERRQRRG"
     gene            <196816..>198933
                     /locus_tag="LMJF_23_0540"
                     /db_xref="GeneID:5652014"
     mRNA            <196816..>198933
                     /locus_tag="LMJF_23_0540"
                     /product="putative acetyl-CoA synthetase"
                     /transcript_id="XM_001683326.1"
                     /db_xref="GeneID:5652014"
     CDS             196816..198933
                     /locus_tag="LMJF_23_0540"
                     /EC_number="6.2.1.1"
                     /codon_start=1
                     /product="putative acetyl-CoA synthetase"
                     /protein_id="XP_001683378.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652014"
                     /db_xref="GOA:Q4QBC0"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR011904"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="InterPro:IPR025110"
                     /db_xref="UniProtKB/TrEMBL:Q4QBC0"
                     /translation="MSDNPHSLHPLSSGSTSQSLHSSTKPPATQHVGEFNSVRDTNVV
                     EPTEANRTKSHVGPHLGSRMRIYEYSIEHNDVFWAEIARRDFYWKTTWPDDQHVKSYN
                     FDKSKGPIFVKWFEGAVTNICYNALDRHLPAHKDRVCFYFEGNDPSVTEKVTYGSMYT
                     RVVELANVLKHQYGITKGDRVGLYLPMIPFAAVAMLACARIGAVITVIFGGFSAQALS
                     SRLKDAQAKLLITADASARGTKPILLKDMADEALKVCEEEGMSIACLVFENMNRQFCK
                     MKEGRDTWYGDALARLTPEQHEECPVEWMDAEDVLFLLYTSGSTGKPKAIVHTTAGYM
                     VYASTTFMYSFDYHMDDVYFCTADIGWITGHSYVVYGPMIHCATSVLFEGVANYPDYS
                     RWWQLVEKYKVSILYTAPTAIRSLMQAGDDYVKVGNRSTLRVLGSVGEPINVEAWKWL
                     RDVGGEGHCDVSDTWWQTETGGHMITPMPGCTPMKPGSATLPFFGVQPVILDPMKLNE
                     KQGPAEGLLAIRAPWPGMARTIYGDHARFEKTYFDVDGYYMTGDGARRDSDGYYWITG
                     RVDDVLNVSGHRIGTSEIEDAVNTHPAVVESAVVGFPHNIKGEGIYVFLTFRQGTEVT
                     PELLAAVKATVRKVIGPLATPDVMQVARVGLPKTRSGKIVRRILRKVSSGQYTGLGDT
                     STLANPDVVEDLIAEHRRLCPRN"
     gene            <200536..>201459
                     /locus_tag="LMJF_23_0542"
                     /db_xref="GeneID:12980827"
     mRNA            <200536..>201459
                     /locus_tag="LMJF_23_0542"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721748.1"
                     /db_xref="GeneID:12980827"
     CDS             200536..201459
                     /locus_tag="LMJF_23_0542"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721796.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0542"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0542"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980827"
                     /db_xref="GOA:E9ACS4"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:E9ACS4"
                     /translation="MSRTAETVEELARRYYLTTALVEEAGRLFDTYAGRGDALPANSN
                     KEPFITVPGLQQLMVKMGTPMSQHDVGELLRFLGSAAAVAVKDEVELSDGPANGQQSP
                     AGKGTRSPVAATATTSQQPSSRQRKKKGGATAQKTGAKGAFESSTKLGADHSPGCGAI
                     SDTASANSSPLVAPLLVTAPPSAVAAEGMDFSAFVYFLLVYPELSRRASGMAATTSIS
                     AATRSSLHVSIPELFATIDADADGVWSVHDLRHAAEVCVMEDDGLLREDPDLCRLAEM
                     HPAEFAVVLHELDVDGDGVVTLDDVRQALYY"
     gene            <202387..>205593
                     /locus_tag="LMJF_23_0543"
                     /db_xref="GeneID:5652015"
     mRNA            <202387..>205593
                     /locus_tag="LMJF_23_0543"
                     /product="putative 5'-3' exonuclease XRNC"
                     /transcript_id="XM_001683327.1"
                     /db_xref="GeneID:5652015"
     CDS             202387..205593
                     /locus_tag="LMJF_23_0543"
                     /codon_start=1
                     /product="putative 5'-3' exonuclease XRNC"
                     /protein_id="XP_001683379.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0543"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0543"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652015"
                     /db_xref="GOA:Q4QBB9"
                     /db_xref="InterPro:IPR004859"
                     /db_xref="InterPro:IPR027073"
                     /db_xref="UniProtKB/TrEMBL:Q4QBB9"
                     /translation="MGVPLLLTWLRKRFADCFMPADSAVTDYIRESTDNLFIDLNSFL
                     YQAATIITATHRSLRFNSVDEVENAVLRKLFDLLDDLVMNLVQPKALVYIAVDGVSPL
                     GKMSQQRARRRRGARRQPSASPSSPFHHHEPAGNINDLWDSNCISVGTRFMAKVTEAL
                     HFYAVSRTERINAKRLREEQVRIDKADASVDSAASDSAGAPYVFPFISIIVDDVLRPG
                     EGENKIAEFIRRIRADPSYGPNTSHVICSSDTDVTVTSLILHEPRIHVLRYEPPVSLG
                     GKLPMKPQPPPQHHHHHRSHHQHVRFSSHPHRGSGPSSHGLRRVDGRNGHAHHGAPRP
                     SPGHGASAAAQPPPPKDSWLSTFFSIHVFRQRLREILHLSPGSDATSAVAGAAVSPVD
                     AEEAALSFEHSLHDVVFVLLLFGNDFLPTIGGSIQEGTLDALLSLLATDFVPRGRTLV
                     DPATNRIQYASARYLLSCLAELPGNAKKGGSGGRLQVHNGGSDALDWGFTAEKEAKER
                     DPAFIERQQRREKQHERMCYCYWTMLQWALQYSAGIVEHWGCYYPYGRAPPLSKLATY
                     CGVLTYNALGEIARRRVETSTAAGRVTSSIDGEVENATEEEDDDDGMDGLPTLALQAV
                     EAGTAVVDAAERGKPTDVMVQLLILIPPRSVALLPTVFRHNYKEVEASVQAPVEQLNL
                     VSIGAWCEEKKRSLSEEERTRFTAYQFFASDADLGTAAAPFPARDIAFTAYWNGPAVE
                     MELAALRVSKKAATSAAAGITFTAGATSSTSAAGLQSKAASFFSMGRRPTSGTSSNGG
                     AAALLAAINITNARASPPPVPATAEIATPLEETPVSPSTEATPALQQQNQPVKLQHPA
                     GDYVLWVAPCDALQDALMIKALGTMHGNRFCVGSYVPLVEQDAVLSRSGGPRQEVRLQ
                     FRLAVAPMITDTTYGTRLLSGYEEPAEVGMRERIAEARKEEADRADPWKQLDEMQTRR
                     QERKRARDVGNEPASSEGELDGDLALAAPPSAGDDGQVPQEVEPQERRPPQQVTVDTV
                     DSTVQVTDGEALLKLRKEEARRRLTALKAARQAAQQDK"
     gene            <208541..>211111
                     /locus_tag="LMJF_23_0547"
                     /db_xref="GeneID:5652016"
     mRNA            <208541..>211111
                     /locus_tag="LMJF_23_0547"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683328.1"
                     /db_xref="GeneID:5652016"
     CDS             208541..211111
                     /locus_tag="LMJF_23_0547"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683380.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0547"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0547"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652016"
                     /db_xref="UniProtKB/TrEMBL:Q4QBB8"
                     /translation="MPLYSIAICPLKLTAYFCRQGSVYVVVISRKGLEIATSPSVCHA
                     NNEVIFSDAEGLSSARPFELSFNSPKDRRILHFGIYDFTNRKNAAKLTGFEIPLAGIC
                     SVLAGESMCEKKGISFRVSGQSGRLDIIFRMHPVGTPVPQLRKAQTNEVIPGVAADAL
                     GAASHRSAAAVSLGSGGGRNAGAGSARSTRLPEHALQALIREGIISNDLDGVEMDLDL
                     ANEIAVRTSILFPSRNDLVDQIRTLTREIQKLEYDVQYAAKDKVVAGSAASAALRNEV
                     NYWKEKVKEIDDKSAHDAGIAQRTEEPEPQPAISQEYIAGIEAQLAAKQLEMHSLEAQ
                     QSHRDVTEDAMRLLDQIDHLQTMLVELKSEGAAPATLKTKDYDIAENGDRWDKLAAKL
                     YDAESMTEQLKQTVMALNRVQYEPYLAGVEAGFMHTVPKELEFVMQNQRTPGNLPPQI
                     SNPASLAAAPPTGQLAGGDAAGDILDDLFGATPMQAQPAAAPEQTAAFPSVSLSCTAY
                     EPPKAAQVTPVWAPSAGGSAPNSSTAPQPSQSMPAASGAPEASLPQPAAADPAEAHPA
                     PNSLTKPTVSAPPAPPTAAAQLDPTDAVPNASSPGAEGAVPGTRVAHRSSGMTSATAS
                     QAAAPANVAPPSLEVPMQAPPSNSLGVTESSRETPAAPPLQSQPQNAPPAQQQQPLQP
                     SYGAPIPETTSCQGQDAGQRPGFPHQQQPQQQQQQGPPVPPFERRPPSLEEIPYTGFY
                     GIPLIARGCPIDIYLDGKNPTRGTELTFINNADYQIMIGGVELKQEDIFSPDPNSAKT
                     IPTQRWPQHIWVPGGGSRQSCIIALHPSFPRGSSIMALVIVYVFNEGHYTPFTARFTI
                     "
     gene            <213201..>214598
                     /locus_tag="LMJF_23_1590"
                     /db_xref="GeneID:5652017"
     mRNA            <213201..>214598
                     /locus_tag="LMJF_23_1590"
                     /product="oxidoreductase-like protein"
                     /transcript_id="XM_001683329.1"
                     /db_xref="GeneID:5652017"
     CDS             213201..214598
                     /locus_tag="LMJF_23_1590"
                     /codon_start=1
                     /product="oxidoreductase-like protein"
                     /protein_id="XP_001683381.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652017"
                     /db_xref="GOA:Q4QBB7"
                     /db_xref="InterPro:IPR000683"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q4QBB7"
                     /translation="MRKEPLRVGFLGASTAAHKAWLAIHRAGHRVTCIGCRDASKGQE
                     LAERLKKDIEADNKTKKAADAGAQQPFAAPSIGSYMDVVRADNVDVVYISLPSSKRPA
                     WIRVCAEYGKHVVSETPAATSAAELVECLRDMVSNRLLFMDGTALSHSQRLQDVCRAV
                     AQLGGPVHINAHMSYPASPTFMASDIRLQPLLEPHGALGDLGWYCIRWILHIVDFVLP
                     TGVGGRVTECDALRDEEEASNGAAAGTTTSARLAGAPAVAVVAASERRQSKAPVPAAI
                     TGFEGYLEFTIPAPTSSDVAPAAVAEAAATVTASFRCSFHDCHDQTVDIFCRNGTVTV
                     PGAINPTADDRPRFVEQRHKVAAASATAALEQSSAADATEVFQVYERLEDRNDVEYST
                     TPAATDGAQQMEQLWRDVGDSVMRLGKGEPLIADPDLAKKWSTFAYVTQVVMDRALEA
                     AGQHAPAATTSSADA"
     gene            <216384..>217493
                     /locus_tag="LMJF_23_1600"
                     /db_xref="GeneID:5652018"
     mRNA            <216384..>217493
                     /locus_tag="LMJF_23_1600"
                     /product="oxidoreductase-like protein"
                     /transcript_id="XM_001683330.1"
                     /db_xref="GeneID:5652018"
     CDS             216384..217493
                     /locus_tag="LMJF_23_1600"
                     /codon_start=1
                     /product="oxidoreductase-like protein"
                     /protein_id="XP_001683382.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652018"
                     /db_xref="GOA:Q4QBB6"
                     /db_xref="InterPro:IPR000683"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q4QBB6"
                     /translation="MSSDTIRVGFLGASTIAHKVWAAIEAAGNMQVTLVGSRSVEVAQ
                     KFVDECTENLHISEERKAAAATYDEVVGSSNVDVVYMSIPVTTRHEWVMKCAANNKHV
                     VGEKPPASTPEQLQSWIEALSAKGLLYMDGTMFSHGPYVKKVVECLPEIGDIRRMTFI
                     FSFRASPERLQNDIRCNPDLEPLGALGDIGWYGIRSFLHMVDFVMPTTVAGRILEELP
                     NGAVTSFKGELFFPGAKPDTNIYAYFYCSFLSSLQQSFIVSGTKGRIVAEQLTNPLTD
                     AGAACFTIVKPMFSGPDPNTDVTVEQTVTKVQVPEETGHMQETQMWRDVRDCLRKDES
                     GRLIAEEDAVREWARKSWMTHCIAAKLMESARSSL"
     gene            <218785..>219888
                     /locus_tag="LMJF_23_1610"
                     /db_xref="GeneID:5652019"
     mRNA            <218785..>219888
                     /locus_tag="LMJF_23_1610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683331.1"
                     /db_xref="GeneID:5652019"
     CDS             218785..219888
                     /locus_tag="LMJF_23_1610"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683383.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652019"
                     /db_xref="UniProtKB/TrEMBL:Q4QBB5"
                     /translation="MSAPTASAMRLVMDSAASDNGNKSSVMQTPAPPTGTTLFLREEG
                     SRTFVPVYHQSSVTLRDLAEEFNISSVLECDAHGNVQPRAVAFDSPSDVLHSGRHYIA
                     RRDARAEAGNSYVTFRGKILVKEYELEHPTPPASRDIGIPTIAGDGVESASLAHETHS
                     APAATPFPDKRSVRQAMERNEESYAASGLASCAPAPHQDYNEENRSSISRTLALSSER
                     KRPREDASRTGAEGSAASEGSQQRSQAQRTEEPQLSSATLPGNESVLQDCTNGACAPL
                     TLSGKSSTVQSSSETAREDVSIDEPAQRSLRFIPFSETASDGSETYVTLEDLQRLCQE
                     AATQEEEFQKRHKAATGILESARRVLFTTGEMD"
     gene            <220677..>222515
                     /locus_tag="LMJF_23_1620"
                     /db_xref="GeneID:5652020"
     mRNA            <220677..>222515
                     /locus_tag="LMJF_23_1620"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683332.1"
                     /db_xref="GeneID:5652020"
     CDS             220677..222515
                     /locus_tag="LMJF_23_1620"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683384.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652020"
                     /db_xref="UniProtKB/TrEMBL:Q4QBB4"
                     /translation="MDLLHSIVKVTFGPVTAAEEDPANSPFAPSEKMRVVSRQLLTFR
                     LTIAYDNMAKDASKEQAAKSFLSMVGIHSLEAAWSHLFGAVQVVPFLLCKHDSSTSLE
                     SEKASSPMQASSPPMPSSASVEWIRCTGSAFVCGTPRFWSSHRYRWSSSDATAKKSGS
                     TPLHGSTMTELPMPTSLFLSTALHSLPMTTATASPSFANNSGDASAGHDDAYWDASAG
                     VRCEVIGGVSTVAADEGSPRRLPAEASAAGEGVAVGFTGAALPHLLESKYTIELALPD
                     FEVASLHGVDTALAMVLLLPLCAGDGGGAATASAEAGDQPFILRSVLARSVGQTQVEA
                     VAASALVLGSGVVPVQLMEPFLCVSSTSPLSNDRLVLNLSLTNVTSSVAQLYSTSFDL
                     HSSCVLPDAAMTGCNFAGEEQGEPHITASSLWGEMRPGANLSSMRIIDLLTKLVTITP
                     VVVGEERPPVDLYPGETYTFEFVIEVLPQLCYLLNSQSLEYLYERHYAMPHGVVGGRG
                     SDGSLSGKRDQGRPRGGGGGSSSAAATFGHGSVVTDCYDQTVSAAELRRILSHSYVSH
                     LFVYYDLAAGDTASNGSSTKLSPRVSGLAHSTRLCLRYPARWSFGA"
     gene            <223060..>224856
                     /locus_tag="LMJF_23_1630"
                     /db_xref="GeneID:5652021"
     mRNA            <223060..>224856
                     /locus_tag="LMJF_23_1630"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683333.1"
                     /db_xref="GeneID:5652021"
     CDS             223060..224856
                     /locus_tag="LMJF_23_1630"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683385.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652021"
                     /db_xref="GOA:Q4QBB3"
                     /db_xref="InterPro:IPR006941"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:Q4QBB3"
                     /translation="MQVRRDNFPAVFPHFQELLRTCDFYAIDEEMTGIGVPEVTETIT
                     FAPSETYHSKRLAASRYSIIQVGVCLFRRIPVSSGAAAAGFGTLAPPRYAAYPFNFLL
                     FPQFADDYTAEERAGDVVVSPSALAFLRRHGMDFQRWVYDGMAFCDASREAALRARLA
                     AAAASQSETTAVPVFTDAERAWLEEARQTAQALVRRVEAAWAAATAEARRKKAGRVSF
                     LASVAVEGGKEAVLPVQASRAAREQLELELALECPQLSVRSRRTGSSGYVVTLTVLSP
                     EEVSKNAWRAAQKERRQLLDTVGFRLVFTELVKSRKPCVGHNCFADWLFLMSAMDGAL
                     PEQLPQWKARTRELFPCIWDTRYLASRRDLFPSGRFGSISLGGLHEAYLGASSHCTVE
                     LPLGFEEYDPVTLLGRGNSDAAHEAGYDALMTGTVLLNLLGEVGYTLETAPAELSQKL
                     ALFRSLYAVDLRSDTADEYMATEAGVLDLEHASTVKPHHIESCLVTQDVTEVSLYSVT
                     DGRTLGVLPADAPSAEVLARRLNENCSRLLRAAPYVPPHLCHWSPGASGRTAAAAVVS
                     TFPMPAPEALLRGGGDGVMRRTMQRLMRCRRW"
     gene            225170..225243
                     /locus_tag="LMJF_23_TRNAILE_01"
                     /db_xref="GeneID:12981178"
     tRNA            225170..225243
                     /locus_tag="LMJF_23_TRNAILE_01"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:12981178"
     gene            complement(225288..225360)
                     /locus_tag="LMJF_23_TRNAVAL_01"
                     /db_xref="GeneID:12981196"
     tRNA            complement(225288..225360)
                     /locus_tag="LMJF_23_TRNAVAL_01"
                     /product="tRNA-Val"
                     /db_xref="GeneID:12981196"
     gene            complement(225428..225499)
                     /locus_tag="LMJF_23_TRNAGLN_01"
                     /db_xref="GeneID:12981200"
     tRNA            complement(225428..225499)
                     /locus_tag="LMJF_23_TRNAGLN_01"
                     /product="tRNA-Gln"
                     /db_xref="GeneID:12981200"
     gene            complement(225562..225681)
                     /locus_tag="LMJF_23_5SrRNA_01"
                     /db_xref="GeneID:12981194"
     rRNA            complement(225562..225681)
                     /locus_tag="LMJF_23_5SrRNA_01"
                     /product="5S(MS) ribosomal RNA"
                     /transcript_id="XR_002460435.1"
                     /db_xref="GeneID:12981194"
     gene            complement(225747..225818)
                     /locus_tag="LMJF_23_TRNAARG_01"
                     /db_xref="GeneID:12981179"
     tRNA            complement(225747..225818)
                     /locus_tag="LMJF_23_TRNAARG_01"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:12981179"
     gene            225917..225985
                     /locus_tag="LMJF_23_snRNA_01"
                     /db_xref="GeneID:12981192"
     ncRNA           225917..225985
                     /ncRNA_class="snRNA"
                     /locus_tag="LMJF_23_snRNA_01"
                     /product="small nuclear RNA, U1 snRNA"
                     /transcript_id="XR_002460438.1"
                     /db_xref="GeneID:12981192"
     gene            complement(226043..226125)
                     /locus_tag="LMJF_23_TRNALEU_01"
                     /db_xref="GeneID:12981190"
     tRNA            complement(226043..226125)
                     /locus_tag="LMJF_23_TRNALEU_01"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:12981190"
     gene            complement(226186..226257)
                     /locus_tag="LMJF_23_TRNATHR_01"
                     /db_xref="GeneID:12981197"
     tRNA            complement(226186..226257)
                     /locus_tag="LMJF_23_TRNATHR_01"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:12981197"
     gene            226330..226401
                     /locus_tag="LMJF_23_TRNAARG_02"
                     /db_xref="GeneID:12981199"
     tRNA            226330..226401
                     /locus_tag="LMJF_23_TRNAARG_02"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:12981199"
     gene            complement(226476..226618)
                     /locus_tag="LMJF_23_snRNA_02"
                     /db_xref="GeneID:12981193"
     ncRNA           complement(226476..226618)
                     /ncRNA_class="snoRNA"
                     /locus_tag="LMJF_23_snRNA_02"
                     /product="small nuclear RNA, U3 snRNA"
                     /transcript_id="XR_002460439.1"
                     /db_xref="GeneID:12981193"
     gene            226716..226788
                     /locus_tag="LMJF_23_TRNALYS_01"
                     /db_xref="GeneID:12981191"
     tRNA            226716..226788
                     /locus_tag="LMJF_23_TRNALYS_01"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:12981191"
     gene            complement(226827..226898)
                     /locus_tag="LMJF_23_TRNAGLY_01"
                     /db_xref="GeneID:12981198"
     tRNA            complement(226827..226898)
                     /locus_tag="LMJF_23_TRNAGLY_01"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:12981198"
     gene            226974..227045
                     /locus_tag="LMJF_23_TRNATRP_01"
                     /db_xref="GeneID:12981195"
     tRNA            226974..227045
                     /locus_tag="LMJF_23_TRNATRP_01"
                     /product="tRNA-Trp"
                     /db_xref="GeneID:12981195"
     gene            complement(<228093..>238115)
                     /locus_tag="LMJF_23_1640"
                     /db_xref="GeneID:5652035"
     mRNA            complement(<228093..>238115)
                     /locus_tag="LMJF_23_1640"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683334.1"
                     /db_xref="GeneID:5652035"
     CDS             complement(228093..238115)
                     /locus_tag="LMJF_23_1640"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683386.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652035"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="UniProtKB/TrEMBL:Q4QBB2"
                     /translation="MNDTSFLSGLSSIGEAIGETAYGRCISLFVISCEPSLDELAVRL
                     GGPGCPWETVQLPMRQPVVLRRHPDARVARRATELAFATKSYVESLTSDVDDLHPARG
                     MAAMDILTSTAISAAASTLKTSVGPAAAVGGPMMELTAATDTLNATPDAEGSHGASQP
                     LLHVCFHWAIGDVLPAFNPPAADAAKSGEGEDAEGEEKAHGRDDGKSGSDDARKGGEA
                     VHYSSNGVGTNSEAPAATAPAAETAAATAPEEVMTEAQGSHSEEAATGVAERFNTPLC
                     VNFLSTYGDTLVSEVTRTVDDDNGGDVLTPQKDGYSAAISSAPSSPPRSKTPRRQRPQ
                     NYRSSIIHMEMAPVMASPSQEAGERGSTTESLVKMNENNNEDEDNVAPVMMHFPPPPP
                     ATGPARPPVGPSAPQEVALDTNIMTPVRLGNEAERSCNTALTPLSFNHATEATLAHQR
                     RAAPASEEQHNTAAVVKAPAPPQPTANNLFEGADGAALIVMVGVVAIYSTNGTADPHR
                     VVSVEVSATTVDKEEAMHHPDSHTSALSFCTTPALRGLAAVVPQVSSPVLLLSRHPND
                     ASRAAGEDDRGVANAGPAVPPALHATCILTENLASMEGGTAGSCTSTTLWTSVADVAP
                     GRGSLSLSASSPAPAPQMSHEVRFTGANGDVVLTLWTYMTVSAYRDAVLNLRSRVTEK
                     SAQPVLQMLLIDESPSPTTKTKASSCRNPSTATVWVSSPSSSDSARADGIAHRVVTVS
                     PAYDIVQQPVNVPVRDPLVYVAVQPSTSASAASYAQPIFLHMFSDVWTHLAAPSRAGG
                     TRAASSTSATAVLYYRLVDASTAAAAGESLSLPAPLREGPRASSKSNEDAELREVTII
                     VNPPATFFSALPPSTGSHINTDVSTAAGQSDAAFRPASAWNLALCHAVTHAVLAEASP
                     KTGVLVYHGFLPVLSDRRRASGKCGALGAAGTANADTPPVGEEALLPYEVLLVPAAGL
                     PKMGDGASPPPKPAAGAMRPITTTSLARAAPTNRGSSLASQGVAKATSPNAWSGAMWF
                     SSSALYSAPSTGTHWKTSICVSSTSTPLPATTSVLRSPSAALGAQLEVTCAVRSHTLD
                     ADSAVFCLRSLRLVPSSVAGGAQAPPAGASPLPPSQVQLWFTTSGGSAEEVRTAWGAA
                     GAPSAKELQHAWAPAVPASSSCCTPALCVDADGQLASTGPPVLLSTTNARARLCVALI
                     TAAETTAVSNGTADARALRHCVATVRKSVLHRYKAHASSRGEQGSNEADNQRQAQPQL
                     TAEQMAEVFVQCVNAVAMGVDNYAEVDLSPSLVAASEQPGRTRHRLLVSFVSGALRMS
                     HHVVLELQGQWIKVPRRVTVVSENYTPSPRLWALRRSCIVRHPDPLHRAVCSRVGVSG
                     GVRRAQKVLEAYMGYDVAVQSVPLDYTDPSEHAVQTLLPGLLYDKLVVQVKQQEARLQ
                     PYCEVIRIVSSGMLATSLRRGDCAAAALEKTAKDHDDMAFEDTKELLEHIFGPAGLAH
                     AAYVSGASRKVAIVHFFFGDAYTTRTVLNVSCTVSADAMGAVPTVPTQPCGNGHSPLP
                     PSPGGSVPSIQKATSCSTALSSSSLQVLCDSLIRTSTLCSFLPASSLAHRFPGESHHR
                     YPSELTWYHGSLNITSEEEQRRREEGEAAWRRGLTEQRLGVHIKPGPLVVSAVTQHLC
                     DCLPLLVEPSLTRCADGQHYIVFGGLSATTSSASSSVYVFDDIAQTWKPLRVQLSSRG
                     MASSSTPVAVPPPRYGHTAVYRPADAAVYIFGGRDRRGNAAAEPMSDAQARDDAGGGA
                     AALVYSDVWRLSWDANAGTVAATELHCTWSGKPSGGTRSSESCISSMLTGDLEGGLAR
                     WRHAAVLHNDYIVVIGGQSSSGVCCSCAEVLYLDIGTQEWAARRSFGTEVPCPRYGLA
                     ATLVSGGSTLYIFGGWGHEQSKSGKLHSAAHSGSALSSDANGVAARQDEEQSAVALSD
                     FFKLDLITRMWSRVEPNGTVRPPALELADMTSCIIDDCPVILLVGGRTSSAVVTTPTA
                     EQAAASPLMVFLFSTATLFWRIVRMDCTPVATRFGLRAVASASSAKAPGPRNNMKNVQ
                     RAHSSCVRRSLPLRGPRIGSILIVGGLPLEEAEITQTAPAISMLLSAGNGSTATSRCA
                     ASASRGMGGSVPSKQGFLTPGPPPVPRSTAMGRPMTGPARTASRGQHPSPPGHRRVPA
                     IASVWLQTPQSMRASGDGRYEHSRAAGVLALRTTSAVAIRQLTERLHGPASVLGQATT
                     AATPAGPHHPSCYSTLTPSQQRRLVRRLYTQSIEIRAVHRQQLQNEVNQERATPAFRT
                     SRSRRYSPGAGRSSMPAGESAAPLHRPPCGAAATVDEGLSPSATRDTIVANGSGGALI
                     HGGPIEDVSLAGHDLQDAFLVRGSRSSSLATSSSSNSRMSSSGESGQDAEVVGPQPVD
                     ASSTALSGEGGDSDSKYAKHVEKVEAGAEVSESASAAPEPDDTMAGVATTPHCNAPKT
                     SSEAEGSEVTEKESEKSESCKENEDHFEGASSDGSSAVQQWRNAVAPTAANPVPISVP
                     VHVLAADMESEEVKVGDEKDDASVATSGPPQGDEVAPAVEVEEEELHKVEQQAPHEPA
                     TPPPASQSSSSKSLSLPPALLATSENAVAGDGAAASALHLPDDSSAVASPPPSIHSIP
                     GVDHDDKIDQDGASDDPEEDAVTPSTPPPLEVRSEENEAPPKEKNDGYADADDDWESM
                     SNADENDSHAGGVKSTSSAESRFSIGEAAEELMEDLTPPPTPREHATPPSSSSVLSLP
                     PLKEARAVPEVTAVRAEELSEAATASPDSSSVENVAEKPLDVVAEEARFSSQAGEGND
                     VFSSFASSLADAPAAAAPAVEAPAAPVSPLQSTSAGDEDDSNEAAPSMPAVGTSHLAA
                     AEEDDKEEAVLEEPQQDADALVEQLPAVPPTPSSTSFAALDSAAAPPVPTSFSDNRQD
                     SSQWADTEGPHATATPPQEAIEPALAAHADIGDEDASSKAESPIDESEAATPLPVAEQ
                     PEEEAHSSNESVNEAALAANAALATDWQTTLLSDSFAVLSETPEAPAAVPDSHASSVD
                     AEYVCDAGAAAASPPTHDEEVEESQDAERLHGDSDFGGEPGVQDDVEESGVAVAMRPS
                     AADVDEKTLEGSSATLMQSRHEQESMEEEQRGSPAAASAAESSVHNEGDSGLRTPGAS
                     PVEESGCCGREDLDEGPAPAAALSEVEDTADAEQVASVSMSPMYEEASDNWSELSSVE
                     EEAPAQESRFAPVSAESSTDKTDDAVELSTPAAAVSTYSNEETPATQVNASPATQAAM
                     EDAYEEFDTQTSSEEEVKETAMDLNDGRDLLDRRRGVEAAIHDDDFDF"
     gene            complement(<241488..>241961)
                     /locus_tag="LMJF_23_1650"
                     /db_xref="GeneID:5652036"
     mRNA            complement(<241488..>241961)
                     /locus_tag="LMJF_23_1650"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683335.1"
                     /db_xref="GeneID:5652036"
     CDS             complement(241488..241961)
                     /locus_tag="LMJF_23_1650"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683387.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652036"
                     /db_xref="GOA:Q4QBB1"
                     /db_xref="InterPro:IPR001876"
                     /db_xref="InterPro:IPR002547"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:Q4QBB1"
                     /translation="MPSWVCLECEYGNEEGDTACAACEADRPTACQAVAAADDDDAYA
                     HIHVGVVVECEDAPNTKLKRLKVNVGQGEPIPVVTAATNVKQGDHVVVACVGAEVKGE
                     TVTKTTVKGFPSQGMLCDAGMLGWVGGGAGAAVTLPESFAAGARPPSSRPRGNAA"
     gene            complement(<242531..>243673)
                     /locus_tag="LMJF_23_1660"
                     /db_xref="GeneID:5652037"
     mRNA            complement(<242531..>243673)
                     /locus_tag="LMJF_23_1660"
                     /product="metallo-beta-lactamase family protein-like
                     protein"
                     /transcript_id="XM_001683336.1"
                     /db_xref="GeneID:5652037"
     CDS             complement(242531..243673)
                     /locus_tag="LMJF_23_1660"
                     /codon_start=1
                     /product="metallo-beta-lactamase family protein-like
                     protein"
                     /protein_id="XP_001683388.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652037"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="UniProtKB/TrEMBL:Q4QBB0"
                     /translation="MLVLCRPLLLPHRGGGPLRPTDLVRCTFQPNLTSLTNQVNRNEH
                     FLKFGNKNIPVGVPRVSRRDVRSISILHETPHLLVAGRNYANGFAGNQFLLVQKERKE
                     CIFVDAADDWPDDWVSFIATSGLRPTHFFLTHCHVDCIVNLNAFLAVMEHHFHVRLGL
                     MWCPAEQSWVDVFPRACERYGRIEEMRQPLPMLQNSLYSHYTYAHQLGQRQRVLNEAA
                     AAAEGGEDGAGTVAGGRGSASPRAPPRQLVRSSDILLSSATNRSTSFYEFGPHSVLHY
                     VFTPGHSPGHMMLALPRERLLFTGDVLFYNGVGRVDLPWGSGERLAESLLTLEGYPDN
                     TVLLPGHGRLTTLGRERRENRALRALYERRAAGDQQVSVGYNTGYL"
     gene            complement(<246927..>247637)
                     /locus_tag="LMJF_23_1665"
                     /db_xref="GeneID:5652038"
     mRNA            complement(<246927..>247637)
                     /locus_tag="LMJF_23_1665"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683337.1"
                     /db_xref="GeneID:5652038"
     CDS             complement(246927..247637)
                     /locus_tag="LMJF_23_1665"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683389.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1665"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1665"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652038"
                     /db_xref="GOA:Q4QBA9"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="UniProtKB/TrEMBL:Q4QBA9"
                     /translation="MFLSCINYYVDKNCNFSVVSAVLLVNVYVLQYLPGTVVVPFLTL
                     CACITAGVSKGLKRIIKQPRPPGAPKASPGMPSNHATSLSFLSVVTVYVLQRYASSTA
                     IVGGANQTLFHTPPLPSLPLPCVRPLQVLIAVYSVYATVLRVAQGHHTVAQVIAGYLL
                     GFTLAVFSLAANHSGYTGTRFGGRVDELPLPEKVILLFASFAISAMAMRSIVRGSHVS
                     RVAHTSAPVMKGVEKGGK"
     gene            complement(<251018..>254152)
                     /locus_tag="LMJF_23_0550"
                     /db_xref="GeneID:5652039"
     mRNA            complement(<251018..>254152)
                     /locus_tag="LMJF_23_0550"
                     /product="putative ubiquitin-activating enzyme e1"
                     /transcript_id="XM_001683338.1"
                     /db_xref="GeneID:5652039"
     CDS             complement(251018..254152)
                     /locus_tag="LMJF_23_0550"
                     /EC_number="6.3.2.19"
                     /codon_start=1
                     /product="putative ubiquitin-activating enzyme e1"
                     /protein_id="XP_001683390.1"
                     /db_xref="GeneID:5652039"
                     /db_xref="GOA:Q9NF77"
                     /db_xref="InterPro:IPR000011"
                     /db_xref="InterPro:IPR000127"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR018074"
                     /db_xref="InterPro:IPR018075"
                     /db_xref="InterPro:IPR018965"
                     /db_xref="InterPro:IPR019572"
                     /db_xref="InterPro:IPR023280"
                     /db_xref="UniProtKB/TrEMBL:Q9NF77"
                     /translation="MLSEEEQKRQLYSRQEYVVGSETQAKYGSTHVLVVGATGLSAEI
                     IKNVVLTGVKSVKVLDDAVVTIEDLGTNFFLRPDDVGKARGAAVAQAAKELNRFVEVS
                     SVSGDPLLHIPAVHVVIYTNAYTSTLAAANKVARENKVKFISCESRGVCGCIFVDGGE
                     SLDIVDTDGEDTVTCVVTAMSSDGLVTLHEEKNHECEIGSKVYFTGLTELPQANTTEP
                     ATPSAWKLFEVAEVISPHTMRLKGVSELVSAGTIIHVGTSAYLHTTKKGRREHYRTLG
                     ECLDNPECLMIFDKEEKYTAATTLHAMFTAVARHGCAPTSPAEVEAVVKAAQAINPNA
                     EATVMRTLLPVFGGDLNPMACFIGGMAAQEALKVCSGKFTPLHQWVYYDAREVLQVWQ
                     YGAKTVSASTLSSSAAVFPDAPAARSRYAGQEAVLGHAFQEYLRQQKAFIVGAGALGC
                     ELIKNVALMGFGEVSITDMDTIEMSNLSRQFLFRNHHIGRPKSVVAAEAAGHINADVK
                     ITAYEAKMGPETEAIFNEDFWVQQAVILNALDNVMSRKYVDSRCLFYQKPLLESGTLG
                     TKCNMQPAIPFVTESYSSSYDPPEKGIPLCTLKNFPNAIEHTIQWARDLFHLLFVSVP
                     ADVNQYLNDPVAFANSLRNDPAAADAALQNVNDALSRWPQNEQNCVRLARLLYQEHFN
                     DGFRQLLHSIPLDKRNEDGQLFWGGAKKPPTPQEFDVNSEQDTEFVYHCACLFAKVYQ
                     LPAFSLSKEETARLAAAVTVPDFVPRHAVFATSESQTSQQTSSSRGLTVEQLPPVAHF
                     GSRRMRAEEFDKDDITNHHVQFITYCSNLRARAYSIPVADFNQTKRIAGNIIPAMVTT
                     TSLVTGLVGFEMLKYLLIQFHHARKPAVNGTGSSHGNFYLDADEEPEKLVTLFRSAFV
                     NIALPFIAFSDPIIAPSHSYALPSGKKLRWGIWDRIDVSEGRDMLVKELVQLLHDRYE
                     LEVFMIALKNGKMIYTEFGGKAKDKEKRVSEVAQDKGEKVQDGIDYFDLVVTGMIGDN
                     DDVDVPIIRYRYRF"
     gene            complement(<258656..>260626)
                     /locus_tag="LMJF_23_0560"
                     /db_xref="GeneID:5652040"
     mRNA            complement(<258656..>260626)
                     /locus_tag="LMJF_23_0560"
                     /product="putative kinesin"
                     /transcript_id="XM_001683339.1"
                     /db_xref="GeneID:5652040"
     CDS             complement(258656..260626)
                     /locus_tag="LMJF_23_0560"
                     /EC_number="3.6.4.4"
                     /codon_start=1
                     /product="putative kinesin"
                     /protein_id="XP_001683391.1"
                     /db_xref="GeneID:5652040"
                     /db_xref="GOA:Q9NF78"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q9NF78"
                     /translation="MEGQERRSVVEMTNTKTILLDPKDGWAPKAQFDFDASLWSIPPT
                     HRIVHTFQDTKHKTYATQKDVYNLIAKDLVPHVFNGFNSCILTYGQTGSGKTYTMMGL
                     YDPNASCGGDGEEGIIPRVSNDIFIILKERMEEEAKTRPPRDRTKFRVEVSFVEIYME
                     RVRDLLDPALRHTRSNEHLQDARIRQDPYSGPFVEGVTKYEVENWTQCCTLLERGSQH
                     RTTCATAVHNQSSRSHAIFQLTVVQEQVVPGNNKYALPAFKTQAGRINLVDLAGSERG
                     GFQDYVKESAAINTSLLALRRVIDNLTERQNMLMEMAEAEITGKHYQERPLPQVPFRD
                     SVLTWLLSDSIGGNARTTMVATLSPLVKNYADTLATLQWSSRARNLVTLVKMNDQALV
                     HNGMASHAGALDNAVRIQRQNLDSLRQTLRSKQEAAQQLERQTKEHKKSLTKVRGRER
                     AILRDRAALIIQRAFHRFLFYKKYEAYELHHAKLRGGNKRGTGDAADFQKIRKEAEAR
                     EQAAKEALKAEEALTDEKAAAVARYESNYEARALRRREAEERQARIVEVINGNELLRQ
                     YVEKRRQEVEALRSVADNENREREMAVKKLADMIKAIADHKTDQHKRKVEEDQKMLEM
                     LRKKRDEVRSRRYEVLRQLQTLRERHKKVVKK"
     gene            complement(<262965..>266207)
                     /locus_tag="LMJF_23_0570"
                     /db_xref="GeneID:5652041"
     mRNA            complement(<262965..>266207)
                     /locus_tag="LMJF_23_0570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683340.1"
                     /db_xref="GeneID:5652041"
     CDS             complement(262965..266207)
                     /locus_tag="LMJF_23_0570"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683392.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652041"
                     /db_xref="UniProtKB/TrEMBL:Q4QBA6"
                     /translation="MRADMVRRGSAHCGQAAPDLYDERQRQAKALALWERQKAAWARM
                     QAHLTSANTASSSAANNGCRHESSPTVSFSHTFAAAGTGGTATARNFIGATTAARAKR
                     EDFGMLAVAQPQTANDSSHVWEGLLRCTDARLSRRLVPIGRTSFPYQLYSEARDPTTL
                     PEDHMIYTRVVSEEDVAAAQNATARSHRFLDSTMKRVEQRATAQSRVRAAMMEAVADA
                     SGDATESEVTYIGRQGEKGSDAVSYYESQLRRLAPYVQKRLGHFLQPRTFLHVEGHPA
                     PRASSEELEAQKHEWADARPSSAPPVEYFPPPPQTQMWASIPTSTTPSLMTNTLQPAG
                     AARKQKGPNSVASRSTHSYGPSVPEHSKDRSYRADGEKTFAEEINSMTECLPCGSVCT
                     ATPSELPCDTSVGSIDADVHEKRARKTQATPPSPHHPLQVAKRGISQRHQQSPTEAGT
                     EHGDNMQSSGPAMEMSTRSLFFQTRPHELLQGTVALCNTGTTTIYFSWVPVDAVEEQL
                     RQLDQDSGAAAAADNTATKGEEVREEGASEERRQMLSDGDGTAAMRITHSLAVHQRTA
                     RDIFFLSSPTNGVVLPGEEGIFAFSVRANRAGLFQHTYELLTVPPAPERIFVFLRALV
                     QSDGPSLEWLAAPVAEAIEAKVALDAQRRLVQRISMNVDAIEGSALSTHIKTLDGAAE
                     AATAAERKRRRAQKDAWNLANRFTFDHIPYAAAVYDKLVRLYTVVQETCRTLGRTQNA
                     KTGAALENAAVATAAAALDARTKSLTSHAALPAPAPPPQLEPASPTADIVATPSGPAE
                     WDGSLLLLMKQMMAVRDAPTRQTFFEAFLILLRAARASRQCSSCSGSSEDVEEETLPL
                     PVLLARAATALADSVRGRRAAMLERECEDMVAQKLAPTATPFMQAFAAASGTSITREM
                     VGEAAGGSQSVNNRKRNVSTRGRSGETAVGDSVARAGGADASAVCVAETTKAQRVVLD
                     SIPAEELLGFSAIQPTPKAVAALETAEKAAVRAQRESELAAERSAWVELYTAAFLEVV
                     DAACDRGPLSGCTAARLAELEDIQTSVLLPIDLSADPIIPLTTGKGGKRK"
     gene            complement(<267351..>271076)
                     /locus_tag="LMJF_23_0580"
                     /db_xref="GeneID:5652042"
     mRNA            complement(<267351..>271076)
                     /locus_tag="LMJF_23_0580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683341.1"
                     /db_xref="GeneID:5652042"
     CDS             complement(267351..271076)
                     /locus_tag="LMJF_23_0580"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683393.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652042"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4QBA5"
                     /translation="MCVISHHKHHGREKEQALYIDIERGARANERGCAARGLAFGSLP
                     PSPSTSQCNLHSSSWRSCRALRRCSSYSCAIPSSADPYPQHGLRGCGHRSEMNRGAHA
                     CASPPLPAAGAASEAVSPSFRGRSRGDSAHCSGIASPPSPRRNSSCSPHTGTHRHDPA
                     DGFAFSVERPLAMSPLALALQAQWRQLQQDMLSPSALRPEHGDTHTAQMEDDMLRVLR
                     FIAARADMAVKDAVHTVPYLLALGQVPLPSLRTQAVALAALRGVLSSLSGVYGEEAAS
                     AFVHDMLLGEHQALQALSLAALIALEGFQAATGMLNGGSTKADEHRRTSSALDSSLAE
                     VSLGRSGHRSLLSRGQGDAQAEGGALRAPRAHLGVSKAPPASLSHVSTTSRLSKGAGT
                     SLEKQTALRGRMVHATLQLLRDAAEMCGPVADALLSSAALLKACVDGLHRLPLPPPLS
                     AGNVAGLAGGLSAGSSEAIYAVYHHHCEDVVSLLLTLLNAESTRHNEASLVLCSFDAP
                     RAVCALAQRLVRTNLFTSGAVCEGSRAVTEEDASMLLWSALKVLGRLTRGCPAGVRLF
                     LSENASVPAFLVQVLTVPVAEIREAGALWVAALLETQPQASAELASGLLDDASLLTMM
                     SSTVSPPKSTTLSSSAPVPVFVASLMEMLRWRGAQMHVFGVSAILCWRWLLLSDPSRV
                     AALLLRDSSLLATLIELILRGAASTSSSSSAALPTRLTALEALHVFALSYALGSIDTR
                     ARLEAQVVRGRLSHATLRQLRAHAHIILERTHPGYWNAFPAMEVELVEEAAELSEEMR
                     LAGATVRTCETDETSRGACSSGPSTSSLMRRRGGRGRLAVCISTGAAWRQLVLESVWE
                     LTAAVAGEAASTAVRPFSSARSSVTRGRAAASQQQQQPATSPTSAFHPHAGVSTGGSF
                     GASPIRVLTSASSLRAAAATAHLAGSGMAEDMDGDGSGASVLDASAPLILTRAPRTIR
                     EATLLPTRQSTTVFRFRVVQQAENLDGLFVQDSMRVVLHLAQHYTQASTQSRASAQIS
                     PHVIRAAKERQRGGDPLLHSSPGEIPRSRSRSTSPPLPLGPGASAVMTPPSAIFGTAP
                     RFVDTSARIEKERNPFVPVANLVDRRQAQLKRRQWGVKELQREDVLLFLVHYTHLMTE
                     LPDAIAAVEDHLYYLRRQLQLCPTRVVRRRCVLNDLYMNVYPKLHLFLRYVDQQARRS
                     RIVLQLLSTFSGGTIHSGNVLDVYDAVGRCTGLLAAE"
     gene            complement(<272524..>273759)
                     /locus_tag="LMJF_23_0590"
                     /db_xref="GeneID:5652043"
     mRNA            complement(<272524..>273759)
                     /locus_tag="LMJF_23_0590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683342.1"
                     /db_xref="GeneID:5652043"
     CDS             complement(272524..273759)
                     /locus_tag="LMJF_23_0590"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683394.1"
                     /db_xref="GeneID:5652043"
                     /db_xref="GOA:Q9NF81"
                     /db_xref="UniProtKB/TrEMBL:Q9NF81"
                     /translation="MSLASSCVSLCAPFTTVAAVLLFMMSHMLRCGNWTFEVLAAKNG
                     WDREAKANTCLRGGLLYLFTSLALWIAVFLHAPARRLWMQLQWSRREDDGTSREALLR
                     GDDDSVGHAGGRYGRRASKRLQGRTGNGRREEVTEMSALDWGEDVRTTRCAAAAAAAA
                     AAGGFLAESDMRNSAAVGAPMARRFLYLQRNLTDVGGGGSDNSLRVSGDLGSAVATPS
                     SGPTGAGTVSWMQSRGLRSRGTGSAASGCASIGAGGGLRLNSISFNAPSPTPTTGADS
                     MDDIDFMSDVEVDGTRHYTTPQLRASAWGLRRPKTGMEASGGAGSGGWHRAQARGSGN
                     NGVPATERGDHVHSGSTEPSTAAARLSMLTSLWQTSSSGPSPTEAHRASGRRVGYGHG
                     PPAALSGGSVGGGAKSKST"
     gene            complement(<276742..>277527)
                     /locus_tag="LMJF_23_0600"
                     /db_xref="GeneID:5652044"
     mRNA            complement(<276742..>277527)
                     /locus_tag="LMJF_23_0600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683343.1"
                     /db_xref="GeneID:5652044"
     CDS             complement(276742..277527)
                     /locus_tag="LMJF_23_0600"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683395.1"
                     /db_xref="GeneID:5652044"
                     /db_xref="GOA:Q9NF82"
                     /db_xref="UniProtKB/TrEMBL:Q9NF82"
                     /translation="MGTGTGCLYACAPFTLIVSILLFMLSAMLRNGNWTFAVLAAKHS
                     WDAEAKSRCCRNGGFMYLFISIVLWVLVVIDSFLIQLKKLPTSTSKWWRQRRLPSLRE
                     LMRTRHTASETDGVYHATDAILMTTTPVAAVRTAVAKSPQPSALSAFALPSTEAASPP
                     SVIMTGDLVAADDSRRKTSSAGSARAEAGRTGFVLSCLSSSAMVGAPVGAAVNISSAK
                     PLSSAGQAYARFARGEAQGRQPLLVSATTSAATSAQEVEYLLP"
     gene            complement(<280936..>282762)
                     /locus_tag="LMJF_23_0610"
                     /db_xref="GeneID:5652045"
     mRNA            complement(<280936..>282762)
                     /locus_tag="LMJF_23_0610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683344.1"
                     /db_xref="GeneID:5652045"
     CDS             complement(280936..282762)
                     /locus_tag="LMJF_23_0610"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683396.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652045"
                     /db_xref="UniProtKB/TrEMBL:Q4QBA2"
                     /translation="MPLRQHLFNRREVVAVFLDLDDATVHITDMALPAPHPALASSGG
                     AAASAYVPPLTRLDVVREALVAFVRAKVRSVPRTALLTFRLYVVRTGGATGKGHENGE
                     AVVQELSAPGPAGAAGGRAMQAAIKALDPSLWGPNNSCESGAASSSPTVYAGVVRCLK
                     RLLEEAEQAQRQPADQAVMAMSKSASVTVFENSCFAYAKGPPAAMASSDNVGLPLASR
                     TRGGPPATAAAVNEEVCAVVHGIVLRSRQFPLALPSSRAQAKASTTSCSTDCTPTTAA
                     PRCWLDIVSLAPLGSVAQTPLSRSSANAGSAAATAIPHGRAPPISTELSIDDTCACAL
                     LDPVELTGISHRGLALGPALARLISLKERCTGCFVPPPLAVVDLRAFPAASADAGPAS
                     FVSHAALKAGDGATSPKRSSTSYRLYVPAAEAGTGTTAAKNITSQPAPSPKPSAPSAS
                     PRRSEFLPVLAMRAGNGSTSAQSWCVCTPRGTAHHSLLDMPEQRGTASTVQSPQQINP
                     RRPIRNSATAAAASASFPVPLRVLRKEIEIDLAMERHGSTAVDEVPSQSPESSTKAPT
                     LQLSRATIYDVCTQRRRAHAALSPSGRGPEKGPPRPQPQPPR"
     gene            complement(<285646..>287688)
                     /locus_tag="LMJF_23_0620"
                     /db_xref="GeneID:5652046"
     mRNA            complement(<285646..>287688)
                     /locus_tag="LMJF_23_0620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683345.1"
                     /db_xref="GeneID:5652046"
     CDS             complement(285646..287688)
                     /locus_tag="LMJF_23_0620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683397.1"
                     /db_xref="GeneID:5652046"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR012952"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q9NF84"
                     /translation="MPPTTSLTSRSSPPVATAAPRPVGAQRKPSKEVQELIDKRTEEL
                     KQETGQHEKKFIQGRWVTDTAALRNRGTRRREELNRRAPKRLAKVDMYYQMEEDNTGL
                     LLDDHEVADRISQRDIASGVDLQTQQKRYSLVLDKLGPYKIDFSINGTHLLLAGLRGH
                     MANIRWKSFQLEGETQLKDRISDAIFLVDHSMTAVAQKKFVYMYTKEGTEMHLLSKMA
                     HMDRLGYLPKHMLLAATSSTYSTMQYLDISTGQEVGTKVPAVMRDPTSCLAVNPSNGV
                     AATCDLRGVVKFWSPTVVDPLLQLKGHKGVIEDICFHPNGRFFLTLGGDHAMKVWDCR
                     TLRTLEEYAVTYSFHTLDISSSGLVALGGGTNVHIWKDMFTAAKPSSPYMKFGLGYGN
                     IAEQVRFCPFEDVIGIGHSRGFTSLLIPGSGEANPDFYYANPHETERHRKERVVTNLL
                     DKLPPDTISMDIQVPGVNEKRLAEYNENLRLNRKARAIREKKMRRASKSLGEAAPTGL
                     LVGRDEEVDEELGYKEAPKTKEVKSRQELQRERKMAKWDKKDSADKVRSKQTLRASRI
                     VQRNRAQMARDARNGVFDENALDAEETEALAAASRAAKQHKKLARKEALEIANDIRGQ
                     LRQDVDYDLEVPPAQRRRFEKSYHGSDTAGRGTEGRGSSGPEAEARTNAALKRFLR"
     gene            complement(<301245..>304802)
                     /locus_tag="LMJF_23_0630"
                     /db_xref="GeneID:5652047"
     mRNA            complement(<301245..>304802)
                     /locus_tag="LMJF_23_0630"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683346.1"
                     /db_xref="GeneID:5652047"
     CDS             complement(301245..304802)
                     /locus_tag="LMJF_23_0630"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683398.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652047"
                     /db_xref="GOA:Q4QBA0"
                     /db_xref="InterPro:IPR009976"
                     /db_xref="UniProtKB/TrEMBL:Q4QBA0"
                     /translation="MMVDRTLFSTITFSSPLFVNNISQRLLYPVLQRHRAEQKRLLAT
                     GGPGGRDGSSGGAGGARGGGSAVAGTHLDSEAAQLLGSDGTPLFGSSRIPMSMRARAG
                     AILNKSGGTDADRRPGGGGGASDVDFASLAGQLMSTLEEAAEEVRRLLEEEETLLHRE
                     EVRCKRVEIQEKRRLATVRLGLEGTSARLQLYENRVSNAQAATAGIEQHLAHSNARVQ
                     RGKAVSQLLRYFKMMTSISSSELRALLESISATRKTQRAAVTTRWAAGRVSAFRPRFY
                     TTVINTAGSVTTRAVLTSSGSAGVGANSERDDDSSVAKRSASATAVAPVADAPPARTT
                     RRPRVFRSGARRRSPAASSDASPLSQARLLSPQLSPQRSPRAATGRDIPGDDDDNAVR
                     MQGGVGGDAAAEHEEDEREEARNDDEAAAAMEDGGDGTDGDAIVDLTQVRMQRAEAAA
                     VAAGLDRLFALRFCTEAQVEWCQRLTLLANELGDLATNAKNVRIYVDWLRKELVSDLF
                     HVVTCFNDFYNEHPQTAVYQAYGRALLKTLGRISSLYNTLTASNDELLSLFFSRSIND
                     LGVVLFSEWSPKPLPGLPPLPQSSELRAMDHYRQHTDKELQRTFRFLLDRIRRNVVVV
                     ETIFGTTNTARQQLLSRVTDGVVRPFLSQQIKLAETQATSMMQAEGSLTPRTKRRCGV
                     RVADSIAYHHTMETRLYSFYQEYVKELKNIFSANQVDFLGRCVDVIFAQRGAYSAQRT
                     ELELLNRYFTLIEEKYTRSLHAIPDEFFDLREAHMAKMKEVITCLTEVAGRVKTYALP
                     KEVGPYVYDLIKATLVYVGNYLDAELRKVLDSLRNDRDNWRVKPKSEDELLQPLKMEP
                     QQCAIRMLLFAQSSLMTLSDTTDAICVPLLRQYPRLVQDVEEARSSALEAVDERSERV
                     LNMCVHAILLRSLSILQHYQLKSDYLPKADSKHDDADTVAPPCTRACTLFCYYITRQF
                     DMASEFIRLSNGQVHQRQMLSQTAAGGALGAAVQQHQAARAAATDVVSGTGGNTPLLE
                     SVMPSSTNGAFTAASASSVSAVRARARTMNLQQLLYGDGGPSSFVRTLGVCLYRGISA
                     HLKSFVANDRGALVYKQDVTAYKEAMIPLTSTPGLGGAVVEVLFQMLKETSSLLIMPL
                     DHIREVKESGYLKLMSAEEKLRYLRIRQDLRSAMKIIFQ"
     gene            complement(<308424..>310091)
                     /locus_tag="LMJF_23_0640"
                     /db_xref="GeneID:5652048"
     mRNA            complement(<308424..>310091)
                     /locus_tag="LMJF_23_0640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683347.1"
                     /db_xref="GeneID:5652048"
     CDS             complement(308424..310091)
                     /locus_tag="LMJF_23_0640"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683399.1"
                     /db_xref="GeneID:5652048"
                     /db_xref="UniProtKB/TrEMBL:Q9U0V4"
                     /translation="MKLLHAVSRRRTLLCVAVVLLFLAVVMTFVHAQEVAATPTDAAD
                     KPGAQHTSVPTETSEEEARAATAAVQAAETEAAAVRQLEAEEQARREEEEKLAELHRR
                     QQEEERRREEEEKLAELHRRQQEEERRREEEEKLAELRRRQQEEERRREEEEKLAELR
                     RRQQEEERRRQEEERRRQEEQEELERRDEEERAKRRIDSVDMIRYSAEELPQGCAKSI
                     QEYLFRVHEHRQHTAAAVRDARSELNEALVHAPNKVAELEKRLAARQDDLLVYDIQTL
                     RMYGGSVPKTCIAESKAWLDTQPDVSSMSEVKQRLAYFFRLTFTHCKVLYLTARGVMQ
                     YMIDSYTPVVKSYTKSVQYYCDKASAIYAELLPASGKQLDMPMMDLAKKIAVMVGYAA
                     VPVGLVVAAGIFAVAVLPLMVAAVIMYEYVYKVWLELFIAYYTYGAKMPDGAVTAVKS
                     TVAAARAGEWASIGNSLLDALLDLVSDSDADLYNGVVAVYLVCSIAVVCVTFICLWFS
                     CCVSGMRGKKGARPLHAASRSASDDRSGIKKAPATGGAAAAAAKKKN"
     gene            complement(<311620..>312273)
                     /locus_tag="LMJF_23_0650"
                     /db_xref="GeneID:5652049"
     mRNA            complement(<311620..>312273)
                     /locus_tag="LMJF_23_0650"
                     /product="putative spliceosomal U5 snRNP-specific protein"
                     /transcript_id="XM_001683348.1"
                     /db_xref="GeneID:5652049"
     CDS             complement(311620..312273)
                     /locus_tag="LMJF_23_0650"
                     /codon_start=1
                     /product="putative spliceosomal U5 snRNP-specific protein"
                     /protein_id="XP_001683400.1"
                     /db_xref="GeneID:5652049"
                     /db_xref="GOA:Q9U0V5"
                     /db_xref="InterPro:IPR004123"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q9U0V5"
                     /translation="MANIITLKSAWDVDRHIVLDSADKLVLIRFSSYTSAAVEAEEYS
                     RQVKRGTATSTSTVAEGSSNSSSSALPTRKRRHDDADGNSACAVTSAATAALLSANVD
                     EHYLRTRQMDALLSELAPKVRKYCTIYFVDTREVTAFNELYELGHDRDPFAVMFFYRN
                     RHIRVDVGTGNNNKINFFAFEDLYDFLPIVDAAYKAGRQGRSIASCDRKFSTVALRR"
     gene            complement(<314324..>316987)
                     /locus_tag="LMJF_23_0660"
                     /db_xref="GeneID:5652050"
     mRNA            complement(<314324..>316987)
                     /locus_tag="LMJF_23_0660"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683349.1"
                     /db_xref="GeneID:5652050"
     CDS             complement(314324..316987)
                     /locus_tag="LMJF_23_0660"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683401.1"
                     /db_xref="GeneID:5652050"
                     /db_xref="UniProtKB/TrEMBL:Q9U0V6"
                     /translation="MSWAGFSAGGLGNGGPGASTGFSYRGRGTGRVTSQFSAGYSRGG
                     GGLTGYGGYGRGSGIGRPGIGSGGLLHEVSSGVDRGSETPRVAVIGTGPTVFQQWWAV
                     HAGGLRISVVVGTDDAKATHSRNALRGTAVAAAARDAERKASAERACAVALRCVQFYR
                     LPQSNESAAAGADKPLVDVRVCAPGSVADPVAGGGARDESKKTGATSAVVTSSILTSA
                     SAASVPAQEKKDCVMATAWSWFFSLLPSGQSCEPDRNGSSSSVRAPFLSSAAVTGAGS
                     WSARSGAASLSSTPMATDSSAESLVDDVEVIYLVDYGADCDEAGVRAALLWLLERDKQ
                     IVVECALSAETLAACAAAAAAVTRGKPEMKRLFLYRGGGCRRGWSAAAVTQLRKSLGV
                     RRATGKTDCKPSSASSPAKTALGGRSAFTTVSTKTAAPPVDSNGGFSVFDFMDSHIGG
                     ALKDAEGSSGGGMENERSCAAEKSSVTVTPTSTAMATLNPPEATPKAETKHKSSAPAP
                     ASIAVDAAASVVGAVRHICMVVIGHGSPLPIDSAAVASLGIMDSLGWDAVAVVLHLLD
                     WTCPDMVVGRVHRRAPDTLQPLCVQAEMYYGIEETTKESGEEKESVAGRAVSASPSYL
                     CVSLHIATCGSGIRHPTDEDNGDRGVFQQSLRIVGTKAVLTVDHPLLPGASPSTAAPT
                     PSAAMTTAAGPAADGSSLLTGTATLVASPSGASSTATAVSASGNATMPTAPKVSHSYR
                     LATQGVSPASGQCERREEEVTVGSAEPCAEFRTWQHVRSQLNVTATSASPRSGAGLGS
                     YQLYNSRYANRGVGVGFGARNGYYDRGRGTRGRRTDFGGGLGADRAAASGTSVTAEMV
                     DAESAALDVQHAWLVQVVVESILASAAKPSL"
     gene            complement(<318612..>319736)
                     /locus_tag="LMJF_23_0670"
                     /db_xref="GeneID:5652051"
     mRNA            complement(<318612..>319736)
                     /locus_tag="LMJF_23_0670"
                     /product="oxidoreductase-like protein"
                     /transcript_id="XM_001683350.1"
                     /db_xref="GeneID:5652051"
     CDS             complement(318612..319736)
                     /locus_tag="LMJF_23_0670"
                     /codon_start=1
                     /product="oxidoreductase-like protein"
                     /protein_id="XP_001683402.1"
                     /db_xref="GeneID:5652051"
                     /db_xref="GOA:Q9U0V7"
                     /db_xref="InterPro:IPR000683"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q9U0V7"
                     /translation="MSASAPRVGLLGAANIAWRAWTGVRANGMSVTRVGCRDVDRGRN
                     FVKRVCDALKIDEAAVPAVCSYEELVSAADVDVVYIAIPVKARDHWVRECIKYKKHVV
                     GEKPPATDAEMLRSWIEALDQQNLLYMDGTMLSHGKRVKEICAAVKQMGGPVKHIFAN
                     VTLGGDEAFLANNIRTNPELEPHGALGDLGWYCIRYALHLMDFQMPTEVTGRILKQND
                     KGAIISFIGDMTFEVGGEVALVSFFVSFEAAFEQTLHITTTEGMLQLDDMCLPMTSRP
                     ETVYYEVHNSSYDNVCESHNLHTEVKHTVNGDAPNSQCTELWGDVARILYADGEGDAR
                     RLKAKEESSRYWATVSWKTQAVMDKMLESALIGRNAAPTA"
     gene            complement(<321959..>323557)
                     /gene="PRI1"
                     /locus_tag="LMJF_23_0680"
                     /db_xref="GeneID:5652052"
     mRNA            complement(<321959..>323557)
                     /gene="PRI1"
                     /locus_tag="LMJF_23_0680"
                     /product="putative mitochondrial DNA primase"
                     /transcript_id="XM_001683351.1"
                     /db_xref="GeneID:5652052"
     CDS             complement(321959..323557)
                     /gene="PRI1"
                     /locus_tag="LMJF_23_0680"
                     /EC_number="2.7.7.6"
                     /codon_start=1
                     /product="putative mitochondrial DNA primase"
                     /protein_id="XP_001683403.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652052"
                     /db_xref="GOA:Q4QB95"
                     /db_xref="InterPro:IPR014819"
                     /db_xref="UniProtKB/TrEMBL:Q4QB95"
                     /translation="MLNAIRKHPEGSIEEQPQVVTEKHSEEMATAQEQYHEHTHDRHP
                     AIQETEEAHEHHYHHDAASEKVTSSRYNAASAEAETDATGGSDAMDDATSNGSSSSRK
                     TAMVKGYRIDEVGALCSSSDAMFARRLPSGGCQFFAWPGTPLSVASSAIVSMPDTIRT
                     VHAVFGRAGTPIDIVMDIDAQVPQEYWTMSKIRVYQRKVLDDVLTPLKEEIEKIGEEI
                     ETQVVLQSPNLKKASFHVHTRLKDAAFADFYSLHGFLFRFQDRLPNVDLQIYRPNGML
                     RMFSCMKENRTSAIIVFDESKWNIGFPGGKVSDEQAALHSICVRDPSTFSRVLTFEAP
                     RQSNMPAYGGSKGACGDGSEGALRPPQVLLPLTEKEAIESASRWLRQATEVEVGEWRT
                     WIGLGLCAYRVAYHFRNARNLPRPAMAEMLDAWTEASRKCPLKFHSGECEARWAAFDP
                     EKLGSQSDWWSAYKRLGRLEVPMREAMEREAAFAARCASRYQAAPAAEVPFAPEPPQS
                     AAAVGSVTSASRKMKQQKKAFRRA"
     gene            complement(<327616..>328941)
                     /locus_tag="LMJF_23_0690"
                     /db_xref="GeneID:5652053"
     mRNA            complement(<327616..>328941)
                     /locus_tag="LMJF_23_0690"
                     /product="putative 3-ketoacyl-CoA thiolase"
                     /transcript_id="XM_001683352.1"
                     /db_xref="GeneID:5652053"
     CDS             complement(327616..328941)
                     /locus_tag="LMJF_23_0690"
                     /EC_number="2.3.1.16"
                     /codon_start=1
                     /product="putative 3-ketoacyl-CoA thiolase"
                     /protein_id="XP_001683404.1"
                     /db_xref="GeneID:5652053"
                     /db_xref="GOA:Q9U0V9"
                     /db_xref="InterPro:IPR002155"
                     /db_xref="InterPro:IPR016038"
                     /db_xref="InterPro:IPR016039"
                     /db_xref="InterPro:IPR020613"
                     /db_xref="InterPro:IPR020616"
                     /db_xref="InterPro:IPR020617"
                     /db_xref="UniProtKB/TrEMBL:Q9U0V9"
                     /translation="MFRSSLTHLQAVSRVFIMGGHITPFVGKGSKLFIDKKHPDFGKK
                     QNMTLEEILATTVQHTIENTGLNGKEDIVDQVVVGNFLGELFSSQGHLGPAAIGSLTY
                     GQAGAKNPLMYKPAMRVEGACASGGLAVVSATNALKAGSADIALAVGVEVQTTATARV
                     GGDYLARAADYQRQRKLDDFTFPCLFAKRMKYIAEHNHFTMEDTARVAAKAYANGNRN
                     PLAHMHTRKLSFEQCNGEDPSNVKFLGNETYKEYLRMTDCSQVSDGGAGVVLANEEGL
                     KKMGLSPNDSRLVEIKSIACAVSNLYEDPDDACCMFTSRQAAQKALSMANVKPSDLNV
                     AEVHDCFTIAEMLMYEALGIAEYGHAKDLIRNGETTLEGRIPVNTGGGLLSFGHPVGA
                     TGIKQVMEVYRQMKGQCGAYQMKKIPALGATLNMGGDDKTAVSAVLQNI"
     gene            complement(<330278..>330619)
                     /locus_tag="LMJF_23_0700"
                     /db_xref="GeneID:5652054"
     mRNA            complement(<330278..>330619)
                     /locus_tag="LMJF_23_0700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683353.1"
                     /db_xref="GeneID:5652054"
     CDS             complement(330278..330619)
                     /locus_tag="LMJF_23_0700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683405.1"
                     /db_xref="GeneID:5652054"
                     /db_xref="GOA:Q9U0W0"
                     /db_xref="InterPro:IPR007745"
                     /db_xref="InterPro:IPR009069"
                     /db_xref="UniProtKB/TrEMBL:Q9U0W0"
                     /translation="MGLDTWKTFPKILSEYPKHGVPLPCSDQHPRLPCPETRWARDFC
                     LAQGGSCEYKIEAHFDCLEQHYPKEKVDELRKIFKPSTLDYPTSDTYIRYRHYYIGAP
                     WMSKNNWEGTR"
     gene            complement(<334627..>336714)
                     /locus_tag="LMJF_23_0710"
                     /db_xref="GeneID:5652055"
     mRNA            complement(<334627..>336714)
                     /locus_tag="LMJF_23_0710"
                     /product="putative acetyl-CoA synthetase"
                     /transcript_id="XM_001683354.1"
                     /db_xref="GeneID:5652055"
     CDS             complement(334627..336714)
                     /locus_tag="LMJF_23_0710"
                     /EC_number="6.2.1.1"
                     /codon_start=1
                     /product="putative acetyl-CoA synthetase"
                     /protein_id="XP_001683406.1"
                     /db_xref="GeneID:5652055"
                     /db_xref="GOA:Q9U0W1"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR011904"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="InterPro:IPR025110"
                     /db_xref="UniProtKB/TrEMBL:Q9U0W1"
                     /translation="MSSQVVSSPVTLKSPLSVSQHVGEFNSVRDTNVVEPTEANRTKS
                     HVGPHLGSRMRIYEYSIEHNDVFWAEIARRDFYWKTTWPDDQHVKSYNFDKSKGPIFV
                     KWFEGAVTNICYNALDRHLPAHKDRVCFYFEGNDPSVTEKVTYGSMYTRVVELANVLK
                     HQYGITKGDRVGLYLPMIPFAAVAMLACARIGAVASVIFGGFSAQAIVTRVTDCSPKL
                     IITADASSRGDKPILLKTIADQALDDCSVLGCNVPCLVFENMNRQFCKMKEGRDTWYG
                     DALARLTPEQHEECPVEWMDAEDVLFLLYTSGSTGKPKAIVHTTAGYMVYASTTFMYS
                     FDYHMDDVYFCTADIGWITGHSYVVYGPMIHCATSVLFEGVPNYPDYSRWWQLVEKYK
                     VSILYTAPTAIRSLMQAGDDYVKVGNRSTLRVLGSVGEPINVEAWKWLRDVGGEGHCD
                     VSDTWWQTETGGHMITPMPGCTPMKPGSATLPFFGVQPVILDPMKLNEKQGPAEGLLA
                     IRAPWPGMARTIYGDHARFEKTYFDVDGYYMTGDGARRDSDGYYWITGRVDDVLNVSG
                     HRIGTSEIEDAVNTHPAVVESAVVGFPQSIKGEGIYVFLTFHQGTEVTPELLAAVKAT
                     VRKVIGPLATPDVLHPTQEGLPKTRSGKIVRRILRKIATHNDDDLGDTSTLADPTVVE
                     ALKRSRAKWVDKK"
     gene            complement(<345006..>346775)
                     /locus_tag="LMJF_23_0720"
                     /db_xref="GeneID:5652056"
     mRNA            complement(<345006..>346775)
                     /locus_tag="LMJF_23_0720"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683355.1"
                     /db_xref="GeneID:5652056"
     CDS             complement(345006..346775)
                     /locus_tag="LMJF_23_0720"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683407.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652056"
                     /db_xref="GOA:Q4QB91"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4QB91"
                     /translation="MMMAGQAAGADSFCKYHSGGAASSAVTPSAGAAGAAGSMSTSLN
                     GAPGQPASVVPLGGAGSFYFSFCGTDGLMIGDTADANLSTTYANTVTTPTFSASNTTA
                     NSRAASFTTPGATVASAMQLAAVNLEYFYGIPTPSAPNRADYAASSAASNCSSTSDHH
                     MSERGTAPPPPPPMSTGAQQLTNNVPPQSGVQKDVLALMAAEQQQQKFVLQQRNVYMS
                     GLPINFRPSAFRAMCGVFGRIESSKLCMEADDSSRCRGFGFVLFYDVESANSCISSLN
                     GKVMQGRTLQVRRADLSAAPQPLHPVTQRNRTGSGLVTPPTLGQQTAPAEMPPAPATA
                     AFPLYSPHPPTVGQSSVKPVVMSAVPFTFATPNGVAPPPGSIVHKSASTNASFPLGTN
                     ASASSSLGATSTPTVVYASNSTMLSTMRGGVPVMQLFTAVPPGSAPAMGPQPPSAMSH
                     TSLSSRDGATPHTETPSSVASSSAPIGFSASQHLIQLQAPTTQQQQQQNLPQHSIQLK
                     PQPPMHPPAQPQRPMSVCTNVAIYRPLETASSAGNLNLNSSAGGSAMASAYSANGNVL
                     QDYLMGVDPNASSSNVFYFISPP"
     gene            complement(<360130..>361929)
                     /locus_tag="LMJF_23_0730"
                     /db_xref="GeneID:5652057"
     mRNA            complement(<360130..>361929)
                     /locus_tag="LMJF_23_0730"
                     /product="putative RNA-binding protein"
                     /transcript_id="XM_001683356.1"
                     /db_xref="GeneID:5652057"
     CDS             complement(360130..361929)
                     /locus_tag="LMJF_23_0730"
                     /codon_start=1
                     /product="putative RNA-binding protein"
                     /protein_id="XP_001683408.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652057"
                     /db_xref="GOA:Q4QB90"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4QB90"
                     /translation="MSTSPVSDAFHNNSTKEFSLSFGSHASGSQSESGISQRLDGTHN
                     FATSSILSFDVLPTTGVMADHKSQPPDAVLTAAAAMKATPQAPSKKGGKSVGRSASTT
                     AGGSPVIDQVPTPPAEPVKVKNQNVRRNVYISGVPPTYRSEDFRQLCQQFGRVEAAKL
                     CVDNRNAPTKAYGFALYYSEESAASCIRGLNGSFLQGRCVQARLADSHATPQPLGDAG
                     AAINTTLPPPSMQRDRRDNTNRSRRSGGSRRGSQGRRAVNNSSISGAAVGNSGVPIQM
                     PYNPMGMAAAMPSGGAMPMTMPQYFPFMAPAGGAVPATTALTASAVDGHMAVNTSPST
                     AFFTVTPASCSPRTDCGFGAAGTPLPGPLTPGGSATNGAPRGGAPAAMSALSPGSMVL
                     SPPLDSLHSSDSCSSLGSAKAATRGNTNGGPRDAVGNNANSQAAVSPFNFPFPNMAPM
                     MPAGSAQMMVTTTAVNGANGATSTEWVAPPAATAAFVYYPLPTGGYGAFPTTAATANG
                     VSAYPGSSSPSGLPAATATANPMANGTAPLTYFPMGTVPMNSTATGMPALPPYLPSAP
                     VNASNGGAEGFSGLPPSVVMMDNGMGLQLQMLH"
     gene            complement(<367355..>368632)
                     /locus_tag="LMJF_23_0740"
                     /db_xref="GeneID:5652058"
     mRNA            complement(<367355..>368632)
                     /locus_tag="LMJF_23_0740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683357.1"
                     /db_xref="GeneID:5652058"
     CDS             complement(367355..368632)
                     /locus_tag="LMJF_23_0740"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683409.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652058"
                     /db_xref="GOA:Q4QB89"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QB89"
                     /translation="MLEKVWRDSKSHLRKQQKLVEEYGVEGAVRETLQPSTTSFREQL
                     RQRPLDRAILQEIYLGLHGRRIERKLKRGVSWEHWITKGNGTAPVFNTSSKAQQTFAF
                     GGHIQQVRCATHPHHFPVLLSHAAVRATPAATAGSGKRDRNAKQHQKQLQHQPPPQKS
                     PSRLHPRHSLLPEVAFIGRTSSGKSSLVNAIVNAMITPYGHLRGTTNSLRFYNVANCL
                     TLVDCPGYGYYDPMCTPAIDAENAVRAMRAYLKACAAPGAVQRRQQRCRHGKSVAGPH
                     QPLNGKSGGPADMDANAAETSDNEADDVHHRGGTEPLLLHQPRNVKRVFLCASAQGLQ
                     HLDYAYCDLLEAYQVPFAVVLTKTDAAPIRFLARLTDYTRSQLVRYKQCNEILLTSSL
                     RIAGIDKMQELLGSFAAANDPLHGATPDFSSIV"
     gene            complement(<372020..>375121)
                     /locus_tag="LMJF_23_0750"
                     /db_xref="GeneID:5652059"
     mRNA            complement(<372020..>375121)
                     /locus_tag="LMJF_23_0750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683358.1"
                     /db_xref="GeneID:5652059"
     CDS             complement(372020..375121)
                     /locus_tag="LMJF_23_0750"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683410.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652059"
                     /db_xref="UniProtKB/TrEMBL:Q4QB88"
                     /translation="MMRGFIKEPPAIHMKCLLRPMHMKDRRKGSIHAQSGGRMYTPRL
                     HVPGVCVCAFLSPRTSMHAGSTLSWAFFPYCRFSLHLRVSHLCGERCASLPGSMQHSS
                     LLCRLHPRLLPEARQSSQPSMLPLSPSLALMFRIAMWRWCIFLLSCLSVHAHGHGVVR
                     LPPPPPNGACARTTTPMPYQHASMHPERKRMDEDFLSCLRRVTVGYHSMLKHTYRVLV
                     VFNQGFPALQRFAQQKFLPSNPLSSSCLWLDEADFLEVKARASFYNVPNPLRIDPYAH
                     HPFLSRYAPEQVRREAAGQWKKGRQKAKGATHTAHKDAAATRPVAAHGARPQATNTTE
                     AEAPDHLRTAAEDEAAGHGAASEPVLTGCNSGAGPQNSMEEATLPRRCRGRPPGRTAA
                     AAQPAMQAQIAEQVPHYQVPICTVTLTKPLYLFNMDQMYLAEEGTAVPPLAARCLGRD
                     MMGAYDHERDRALAAWPPRNMSFAGGDGPLALAANPQRPWDEPTPMLGEAASLTWSRE
                     HRIAEGVRELQGRFPNSASDHLCPQGCRHMYSISTRHPYSLPLQHTLSILAHRHGYRS
                     QWWGTLKQWSSIGVLPQPGQNEHILPISVPSKIVHISLIEDAATVMQRCIILAKHRKL
                     IYMFAAAAPVGLPESDVDAMGAHALTRAQQPTSFLPHPGDARHHGSHPDGLSRIFTSA
                     LEDMRVNKRSLPVYFTLRQLRMLKLKLRPDAVGLRPTAAGAAEVLHIRDGAEAVGVWD
                     GEVSAADGEAATAATAPMATVSVDAASTEPRGGMALSCCDATIATIQSTTTPAQASAG
                     MLEYWYHLSQVYFPDSYLVPSVVLTAEFENPGVPLNGVNGQRLPYTTLLYESLVNQHP
                     EVAAVVRRASAADVERGTDDAGLKVSRKSAEHRSCVDAQGAVPAQQGLGRNQDIAPPC
                     ASAAAHTFGSSEVEVDEEDLAIARFVATHSSPKHTQGRSLWYQAQDVLAAGGVVDVNS
                     APVEVMKKPAALWMGVTEAGGSGILEGGSLDKLPGNMFCNVECLTNPDEALRLISVPF
                     DPM"
     gene            complement(<377025..>378071)
                     /gene="RBP38"
                     /locus_tag="LMJF_23_0760"
                     /db_xref="GeneID:5652060"
     mRNA            complement(<377025..>378071)
                     /gene="RBP38"
                     /locus_tag="LMJF_23_0760"
                     /product="putative mitochondrial RNA binding protein"
                     /transcript_id="XM_001683359.1"
                     /db_xref="GeneID:5652060"
     CDS             complement(377025..378071)
                     /gene="RBP38"
                     /locus_tag="LMJF_23_0760"
                     /codon_start=1
                     /product="putative mitochondrial RNA binding protein"
                     /protein_id="XP_001683411.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652060"
                     /db_xref="UniProtKB/TrEMBL:Q4QB87"
                     /translation="MLRRVSLSALVQRVAAGAVIATAGRTIVVFSQQHHILESNQRAR
                     NSPSNVWIEDWEADRLGMKPEPGALPTQLVLDKQLELFNFDQLLSPPEVMEAPKHSSY
                     SSRKVYGERLQFELNDRAQRHSYQSKWWITRGQAYKENLQFKANARSSILLTKSQIKL
                     FHSSQLSGGEALQQYPVSGGSRRVYSKKGEAFQLLQDHIKSNDFNSGLYFTRRQMEFF
                     KLAPLPDQVPVVQEAATGDRHLIYNVDQLEDPHLALKTLQRAPVNVPTFLLSGEPIMS
                     ENTRKFPKTFRSNYWLTGRDAELYQWPIKESERRRGVPFSTGTSAPVQYELFNVEQLS
                     NPDEAFARAGLLIQ"
     gene            complement(<380571..>384812)
                     /locus_tag="LMJF_23_0770"
                     /db_xref="GeneID:5652061"
     mRNA            complement(<380571..>384812)
                     /locus_tag="LMJF_23_0770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683360.1"
                     /db_xref="GeneID:5652061"
     CDS             complement(380571..384812)
                     /locus_tag="LMJF_23_0770"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683412.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652061"
                     /db_xref="UniProtKB/TrEMBL:Q4QB86"
                     /translation="MWAALPPVVSVVTAAEELAGVSMAAHTSGMMCESNSGSCPPAAV
                     APTRCSRPTTLGASSAMKHHHASPLPNEHRAPLNGSQCGHCSRTALPPSEVGDGAACE
                     TAAPLTAVATGGGGSQQAHPGPHAAPLSLQQPHLERNVFQPLASPPTVAAPAPVMPSP
                     AACPISGAPFSRHAVASPGQDVLGYNPSGSPVASPSMRVTAVDTRPSPGLGPTWASSF
                     HQVQPSCCLSGSPLSLAAAGSPAGGTACASTMMSPSAALYVAPKSTPPTSSGAALPLL
                     RPAPTATAHDSTAAHTAVNFFQERDGVPLTASAATTAADQVGAPSWAVADCQAQNHQV
                     PAPLACLSHPTTPVSALTLTPHASSIASRGALRHSLSPVTSALSPGRGAGSLGSAGNV
                     IRAPSFKTPACVSGAPPRHSSEGAPLRSLYAVQSSAWEVGGASSNTSGTAFAAATSGG
                     MRVSSPKTSPQPQHITFAQLGNSGSAGAGVSDAGHGHFQAPAPTQFSRVLDPPTPREH
                     PHPGGGAERANVGAGSPRKVLDGSVCSATLPNHNHSFYMGTAGNDNLSRGFLFPLTSS
                     CGAAVAADGVEDASVMSAGGGGPTPAAMFHVHSPSVAWGRPAGQTTPPMAPVGSNGVA
                     AYGVSDPGPSSEATSILADTYRSLTLFELPPLQYASQLLQGQPPSHQPHPRLQQPPQV
                     PPTPAATTLPWPEPHQTILCRSPQMPSLNEALAGLTQPLNVSRASAMGRCSSLNQSPS
                     PQQLSTGHSRSLSVNGAAAAEASRNAGVASSSFISPTLANLKWQCRFEESLSGTENAI
                     ELPDSSEQVTGCRASAPATGDGRGSASSRPSLSMSDAKPAPRPAYIVEWEQSLIAFQS
                     RAESYYTFKNSCTEAYLTLIEHNVDRFLVCYFSGGVIKPERSLQEALASRAGAVANTS
                     THLFGGTGAGNLDAKRPGGHVASGAGIQKMLQGSRALQRLSETGSKWLTKIGVNLRRT
                     TATPAPVFSEPQTVLMNADPAHRATPAFASTVASPLRSMGAGSPDCRTTPMTIGAAGA
                     ATAAVESGVLEPTYTSLCAADPFGASLTPSAAPGPLPPPATHDSFSSASTSPLPLSPT
                     LPHIGATKAAGTGAVTMAAAFPARVSAEEAELHCLRRLGPYVANVVPETFMDARPSDG
                     VLDQVRCNYAILLHTLQHVLLDANGSGGRVADASSPFADSTPPSPTPFTGPVGSPGRT
                     GMDWLVSQRIRQGLLLPTIQATWRDYLTPLKGKVQELTQIAKMSIDPILEGLQTPRGA
                     GATGGAAAVPLMAPASPCPVLRHDSTAAATPFTKEVSASFVAMTDAERAAREALRASW
                     EGPISRLIRLLRGDEEYLVTIQTMDTEFVESGAAWQESSAQLRLRGAALSDHVPVYGL
                     VLSRLHRLEMEHRTVLELWGGGAATAAGAQHCLYA"
     gene            complement(<389653..>392448)
                     /locus_tag="LMJF_23_0780"
                     /db_xref="GeneID:5652062"
     mRNA            complement(<389653..>392448)
                     /locus_tag="LMJF_23_0780"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683361.1"
                     /db_xref="GeneID:5652062"
     CDS             complement(389653..392448)
                     /locus_tag="LMJF_23_0780"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683413.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652062"
                     /db_xref="InterPro:IPR007751"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q4QB85"
                     /translation="MLHGLLKWCLLSSSTPQDAFKRVHARLACPPLPSRSDADRSGAI
                     TPESRVVDPYHFIVCQHGVLGSAADFENVIVDAFVNHEVSVLEATEIMAAAEREEAAV
                     RTAAMSAAECAGERGASVRGEFSGSPLPLYGNPCPTYRCSSGPPSASVPVACIPDTSG
                     ARHTVVSFTSSVPTVPGSTTTSVSSANDNVMPRTEVKEVLLEAAPMKAAAAAQRHQWQ
                     AASMRDIADSADKASGLHKVAPGSNMDDALAARQHARRAAYKAAYRLQIEYPNRMNGR
                     LYRSGNLQCFSPGSNEYLRTDAGTQVCARRMLAEVVPALQTWLNEVESKEQQRRAKWE
                     VYARTVGTSDAARLSTEAAAPLPICFSVMAHSFGGIIQREFLYLLLVDQAETRASDAM
                     LFHDIVTLRQRLQRLNVSFENFLTVATPHCGAGECLWWPIYFGAWCLARMKLCQTYDE
                     LILSDTNRILQRRLLDEPHLRVLQLFRRRVLFANTHRDILVGFGTCSLIFENVDTDHT
                     KFIGVPPRTAHCAAAFANEATEVSKPILLRSFEEMEQEEAYDGGSDSSSSVRHDSQRS
                     ASTRAKSYTMKDLVSSLAPSSAAAAAKMVHQVSHASARECAGTPVSVVEGYTNDTDFM
                     TATLRPQATSSSVPGLTASPTSTLPSYSQSPMPDSTTATRTQSLVFAASWAIGRTIPA
                     HNEETVRVEDVAAPLADHMVECRNELDNGSQSSTSAASTVGSLLSRPFFLLRRRDSLI
                     LPSPLLRRSICSSSEGVSTSDVHGLGDVGSVTSSRRSRNSSTVTSLLRDPRWASERVR
                     RVASTVHAEVERWLWTPTTTPRAGETSTLGESNGNAAAAAESVMTFSARTSVVVPAES
                     SMALMSATKADVPQYRQTPRAIAATLRRTMSWRVRAIRLDNILPAGHVACLGNWAFLG
                     RSPSVVQAAAEEMLIIL"
     gene            complement(<394158..>396728)
                     /locus_tag="LMJF_23_0790"
                     /db_xref="GeneID:5652063"
     mRNA            complement(<394158..>396728)
                     /locus_tag="LMJF_23_0790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683362.1"
                     /db_xref="GeneID:5652063"
     CDS             complement(394158..396728)
                     /locus_tag="LMJF_23_0790"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683414.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652063"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:Q4QB84"
                     /translation="MDSCVSLTYSSKEEAGRHAVARRHLSPGELVLAAAPFGLVMNPN
                     YCPSALYLSSKATAKSDAATGVSSAEPGGKTAKKAGGGHGCDNRANNAAAASAAGESA
                     SASHHAHTLKDEAGVQGEVSPTSTSRWYTTTPTWCSVCFQEIPAGRWLCNRWSLTELA
                     MDIAQEQEELDRSIRVAEARAPGSDKVNRGDEGGDDAASAAAAAALRKLRKPSKSSET
                     RKHGAVELKQRLLEKALALREELLLRRRQRRRRVEEELPVLRREGWETSTSSSSFAAG
                     AAYGEPAMSGCAGCGVLCFCSEACWRAHRDEHEQSGECALLRSLYPRLMAAYYTMGVV
                     SSSASTGGACSTVVMPGDEPLHWARSTSEPRMLEFQSLLFSAIVVARACRAGYQARCA
                     AAAEDAAVRLEGGVAAQVVAPSAADGGSASVEAKSQANTLDEQSLLPTSPSAVSGRGE
                     QRSSDTLVASSTSTTVDSVAIPKEVRLINEIRAKAGLAGTVEVLDADPELRRFARGVS
                     EPRDHSSTEGLPDISSDSPAADPCAVRTTNAARVCSCASVSTTRGGADHDPLPQLRTR
                     TPQYADLAQMETNLSVISKHNRSTYQRYYRAFAKRVLPVLQQLLLHQQRGVTVGVSDG
                     DSCVDAASRPLAHPEEGTGDVLQVSEVYFQRLCAAVQCNSFGVYDTQDHCIGFGIYPE
                     ASYFNHSCVPNLCRVMHHGSRIAAFYALRAIAAQEPLTICYTDVEQLNSAERRRNLLS
                     TYRFFCMCERCSGKAEGPQMAIAAAGNCESVSGPCSGCVEVSPGAFENPLLLCAECPI
                     HGYLRPLPPPFYSSSPAKSDSSPTWTPSWTMQEVKMRECTVCRSRVVREAVAAAATLQ
                     "
     gene            complement(<397371..>398039)
                     /locus_tag="LMJF_23_0800"
                     /db_xref="GeneID:5652064"
     mRNA            complement(<397371..>398039)
                     /locus_tag="LMJF_23_0800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683363.1"
                     /db_xref="GeneID:5652064"
     CDS             complement(397371..398039)
                     /locus_tag="LMJF_23_0800"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683415.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652064"
                     /db_xref="UniProtKB/TrEMBL:Q4QB83"
                     /translation="MPLKVAGDAVMERGARSGDRPSKSSCTRQAPSAESIGKSKHAPR
                     SDLKIKKKAPWGERQLRDSWSEDAMSKRDRDNMDERIHREYRYHPDEFRRAYIRYTAF
                     LTIPCIMLGMSVTYYYETGRPFWQADLQHLLNLLRVMDTSPRSKLYAYRSVDTHDVPA
                     HVLRHRSENLWKREYEERVFRLTCSAFERPSTDALRLMELEGNLTTSEAAAEGAALAD
                     AAIA"
     gene            complement(<399609..>401168)
                     /locus_tag="LMJF_23_0810"
                     /db_xref="GeneID:5652065"
     mRNA            complement(<399609..>401168)
                     /locus_tag="LMJF_23_0810"
                     /product="actin interacting protein-like protein"
                     /transcript_id="XM_001683364.1"
                     /db_xref="GeneID:5652065"
     CDS             complement(399609..401168)
                     /locus_tag="LMJF_23_0810"
                     /codon_start=1
                     /product="actin interacting protein-like protein"
                     /protein_id="XP_001683416.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652065"
                     /db_xref="GOA:Q4QB82"
                     /db_xref="InterPro:IPR004113"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="InterPro:IPR016164"
                     /db_xref="InterPro:IPR016166"
                     /db_xref="InterPro:IPR016167"
                     /db_xref="InterPro:IPR016169"
                     /db_xref="InterPro:IPR016171"
                     /db_xref="UniProtKB/TrEMBL:Q4QB82"
                     /translation="MGLTPVERAAYYAARSPRFAKVTLKHLSYLHSVLERPCSTSKRK
                     GKMLTDTEAIAPFNVDWMRQVQGAAPAVLMPTCATHVSEILKYCQAEKLAVVPQSGNT
                     SMVYGAEPVHDELVLSTHLMNATPVVSKDTMSVEAESGVILQQCQEACAKKGLLFPLM
                     MGSKGSSMIGGNVSTNAGGIHFARYGSMHSNVLGVEVVTAKGDILNMMSTLRKDNAGY
                     DLKHLFIGSEGTLGVVTRAAIKLYPQPTSKQLAMFRLRDFPSVLGLFRLANSHLAECL
                     SAFEVMDGESMTTSPAKEVPYERTYKNDVFRGGKDFTSAYFCVLVETHGSNEKHDFDK
                     LSEFVEAAQALLGDKLSGGGQHEPILSQSAAQTEQLWALREGIPVHLASSGLIYKYDV
                     SFPIDQFYGVVEHTREILYKHHKMDPDEVIVVGYGHFGDGNVHLNVVDLTRSHGEQLD
                     AALYPAVYEYCAAHAGSISAEHGVGMQKREYLHLSRTSEAIRLMTDVKAMMDPNGILN
                     PYKVLPLEQEK"
     gene            complement(<402101..>403642)
                     /locus_tag="LMJF_23_0820"
                     /db_xref="GeneID:5652066"
     mRNA            complement(<402101..>403642)
                     /locus_tag="LMJF_23_0820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683365.1"
                     /db_xref="GeneID:5652066"
     CDS             complement(402101..403642)
                     /locus_tag="LMJF_23_0820"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683417.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652066"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:Q4QB81"
                     /translation="MAFLITSREPSGPLFLFAHVVFQRVEVSHLSSSAKLATSAPPPL
                     LFCCLHTLPHYATMDPSVKAAGELNTIFGRLGVPCEVCVTSAEGKHVKATANLEEGFA
                     LFEELPIVSWPSPSLLALSTPFCFQCLSLSSHQQPASETDAESPSAAGLAALPKSWSQ
                     CARCASYFCSPECEQASSRMHRLLCSCLPVVRESHGGRDGPGGAEDVKVTATQPLSSA
                     PSSLASSPTSSEITLEALARCVAWITHRLSYAIEQQQLAHEVLQADYVFQQQQQQAGD
                     SARGATWSTASLIYQLFTQVVTLFSRLISPPDNVEFDGVSLASWMAKLRLLLAERCAT
                     QLLVASGAPLSDARRHTLMFDEHQQQQAAPAPTLLWAEALVQVIFSTDTLRTLVGQMV
                     LNAHAINDYVLPPGEAPSSGAFDWVLKGAGLYSLLSCFNHSCVPNAAVSTVDGTHEIV
                     LKTTRPIRAGEPLTITYIPLAAGTASRAERQRQLRNYFFTCHCPRCDTEAAASAAMTG
                     DGNAA"
     gene            complement(<405212..>409714)
                     /locus_tag="LMJF_23_0830"
                     /db_xref="GeneID:5652067"
     mRNA            complement(<405212..>409714)
                     /locus_tag="LMJF_23_0830"
                     /product="Na/H antiporter-like protein"
                     /transcript_id="XM_001683366.1"
                     /db_xref="GeneID:5652067"
     CDS             complement(405212..409714)
                     /locus_tag="LMJF_23_0830"
                     /codon_start=1
                     /product="Na/H antiporter-like protein"
                     /protein_id="XP_001683418.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652067"
                     /db_xref="GOA:Q4QB80"
                     /db_xref="InterPro:IPR006153"
                     /db_xref="InterPro:IPR018422"
                     /db_xref="UniProtKB/TrEMBL:Q4QB80"
                     /translation="MTHMATPLEGAWSSGGAGEGACRNAVSFERLSLVILFVTMLIFL
                     GGTFFMTHKRRIPLPYTVVLFLYGIVVGVVSRWLYPDVAEALGSIPPELLFYIFLPVL
                     IFEGSYAMNIHALRRVFPQVALLATVGVLINTALLAVPVKLFFQTWSWYTALLLGSLL
                     SATDPVAVVALLKELGVDKCMTAMVDGEAVMNDGTAIILFTLLLPAARVGFVDMSPGV
                     IVVRCIWLALLPIALGPLFGFLQSFWLRRTSDGLTKACITVSVTYVSYYVAAEMLGTS
                     GVLTLFFQGIFLSYYCPSLFPGRESNIISSAWEFLVHLGNTVLFSLVGVILVADVLPT
                     VKLLDIFVLVALYIAMMLSRLLMLEVLSPVLNMFSYKFDQKRIALMVHAGLRGGVAAT
                     LAIAVMQEGLEEGVDILKVTSGIVLLTLLVNASTSATVVERLGFKTKSEYRIVKMEYA
                     MELMRSSQEHVLEGLKRDIKYRNASWMQVEKFVRHYIRNPFRNTAVEPEEDEEKMVNR
                     MLMSAFKTALWLQRDKEVITETVVVQMGASLATLIERGELLDVQQMYWYHRHRGASSG
                     EEERAIAAQDSSPQGRRHLSDMSTPSSCYSTQQPQQLGTTQPWRTRPSTGVAAEGEAA
                     AVPESLEEMQSRPSGTPSMTGACQPVGGSSIRASGSDAHGGLAVDVTSLPSHYLGGDA
                     ADEGEKKAETNRMVTNLMRRLLPAWVVLVERFICSPGYFAAAHRRAQENAFVALLAVV
                     KCLIAISPLKFKFIRSETQARRVERWVATQITAANRAIRFFYTNFPEATNNVASSRAV
                     VSVANALEETVHNLNAEHGFGTRATEELGKMVACMRSHTPSTWENNASQNESNLVLRA
                     VAATLLGKGLRSLEIKAISSMGLVRKFREGDIITLPDNAFLVVVFGSLRAVYGQWTTL
                     TEHEQMESFGDTVGLEALMLPQEFRVDQQRRWRVISTDSTALIISFNSIKPFLTERSL
                     RAVKALWRAAAAEVLMPFLSRIVTVPDNEARTKREHLIELIMAGTPLIGPRDCDLASC
                     GTDFHLYFYLRGYDKSGLFNCHTPPCYISIFYVHQLRWVDPDAVLYAVPMRVGDRGYV
                     PWPTTATTAGASGEDEREDESSLEEAEEFEGVGASTRRTSPSLRTAAGRSPAAVCPSV
                     SLQSPLPATRSRCRAAVDELLPVNGHSARARGGEVGRSHRNDAHDSMEPNLVNSSMAH
                     GDRGGGAGALFTRNMEHDGVTPPALFGENSVATHAGATNIINSVLLGCAPDDPDELGL
                     NTSLSVFGDLLDNVASPTPTHTGCDLFLRSPSVSECLGQNSASPFVRDTDISIFYSLE
                     GFATQVPFVNQMLVHYASSMEHLCIATLRYLRFPTDPFHARHAQSTGVQTVEFLLNFC
                     VELSMLKRTCRIVSKWHKEDTEVLHPFHVSNDTDSTFQARVCGWARRHRLNGKFHLKT
                     MVTEMNQYANRRFPDYVSVLRRMVELEPGLKEVGTAEGMNSLCRSILKSSKGAVAAME
                     SLEDAL"
     gene            complement(<417283..>418866)
                     /locus_tag="LMJF_23_0840"
                     /db_xref="GeneID:5652068"
     mRNA            complement(<417283..>418866)
                     /locus_tag="LMJF_23_0840"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683367.1"
                     /db_xref="GeneID:5652068"
     CDS             complement(417283..418866)
                     /locus_tag="LMJF_23_0840"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683419.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652068"
                     /db_xref="UniProtKB/TrEMBL:Q4QB79"
                     /translation="MKTGQRRGWGCVVRPPQLLLRRFFALILLFLCMHAACAKEAEIQ
                     ANAWLSAPTSVWDAIVSDPMTHFAMIQAVKEDFVSAIRVVDSIAEVVVTSLKPMKSQK
                     AWAGGPAYGAYAQFSAVTQLNKEEVFSALRSSNLRSINSIFQSVGFNAAIEVLAADGP
                     PSMRAVGPVLLPVSGSTFFWQVLLGTLMAQNALSVDAFMYPLQMDIQSAVDFTVRKFL
                     IETTPLTNQVNVSSWYVSYNVWAFPGAEVTPSTPSDLRAFAMKSRMPLFNTYMKTVMD
                     TYPSLKAYADLLPTMVHARTPPLGNPFEDNSDSDPDRIFEVLANETGDYLLVFSGDAD
                     RWGQVWEKSRDAVSKSIEEAVEAKLHRRIFVNRAFVTSAKTLPNDSVNVGGLQVLCRV
                     VQGITVISNHPWSPEEVAPLLLQANYSATQALYISGGGPVEGYTKWPPATASQSILLA
                     ASYEASPGSIATTSISYDYRVRLSKDIVGIIVMSVLIIGASLVAIIITVSFCYCCPQF
                     IGGGADRKRTTLSHASIAP"
     gene            complement(419905..422030)
                     /locus_tag="LMJF_23_0845"
                     /pseudo
                     /db_xref="GeneID:12980832"
     misc_feature    complement(419905..422030)
                     /locus_tag="LMJF_23_0845"
                     /pseudo
                     /db_xref="GeneID:12980832"
     gene            complement(<424140..>426470)
                     /locus_tag="LMJF_23_0850"
                     /db_xref="GeneID:5652069"
     mRNA            complement(<424140..>426470)
                     /locus_tag="LMJF_23_0850"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683368.1"
                     /db_xref="GeneID:5652069"
     CDS             complement(424140..426470)
                     /locus_tag="LMJF_23_0850"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683420.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652069"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:Q4QB78"
                     /translation="MPRYDSVSRVGVATLEAMERERELLEREELAYPGYTTLRIQELK
                     HTVISKASTQADLQHAADALREELSALLEVIGQEVEKPMSTQRVLLLKWQQRQQRLQN
                     RENAFQVNVPSTPAYRVVPHADGTEVIERPGRDTPQAPAHETDDAYLSQAVEAEELPP
                     EALIPEKTIITTADVNHVRYLLGLTYRRLERCDEAERMFYDILADDVTNVDAVESLLE
                     LYTGIEGWVPRIRVLLDYLAKEYTKAVEEGRLQSASASNKVPVVDAYCAEEPCAAVSP
                     DAAAASRSTPQQSSSSPSSSVSPADAVATTAGTGAARRSTPAYTTLPPVAPVEVALSL
                     LSDLIVEAAAQKCSSDGEGAASRFFIEVMGPIVRVLDRDYACRLLEALFRAVDEQHFA
                     VRFDSADIAPAARTFALSLVIAFLKALMARRIHEMLPESTRFHFFTLVKLHSALRSAG
                     RVHESYKICEQLMQLYRANSSVYRARVCASSSVALRSSAPSSLHAESSSMLGASATRP
                     VATATTEVEAQGCATEAGALLPQAANASRGAAAAPKDVAEEVLPAESSRLSEPPDVLD
                     DQDANYREAFFQYVSDRAHDSPALGRRLCMEAMAEFPVCAAPWETLALLMHKEDPKRN
                     LSDAIIAARRAMELEPFNVRVIVTLANFYKAAHRYELCDRMMDRYRLMSYMVEEGASE
                     ADMVATAAEIAALDEQTPEAQDLVEETGRAMKEFLERMEQATTYSMPIDKEPRPLRDG
                     PIRFIAQQPDMRPAEVEPHDRELLRQLQMMEPRQQR"
     gene            complement(<427610..>428632)
                     /locus_tag="LMJF_23_0860"
                     /db_xref="GeneID:5652070"
     mRNA            complement(<427610..>428632)
                     /locus_tag="LMJF_23_0860"
                     /product="quinone oxidoreductase-like protein"
                     /transcript_id="XM_001683369.1"
                     /db_xref="GeneID:5652070"
     CDS             complement(427610..428632)
                     /locus_tag="LMJF_23_0860"
                     /EC_number="1.6.5.5"
                     /codon_start=1
                     /product="quinone oxidoreductase-like protein"
                     /protein_id="XP_001683421.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652070"
                     /db_xref="GOA:Q4QB77"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q4QB77"
                     /translation="MMRAVTLKGLGGIDTMSISEVPKAVVKKGTDVLIKVIAAGVNRA
                     GVSQRLDNYAPPDGANELLGLEVAGIVEQVGSDAVGRVKEGDRVMALLRGGGYADYAV
                     AHMGCVMAMPQGYTFTEAAAIPEAFIRAWQILHRHGKVKRGQNVLIHAGASDIGSALA
                     QITEKYFKATAITTSSEEKLDMCRAHASVTLSRTPDELGLAFAPKLKRLFGEESVNVI
                     VDPVFGGTYLSENAQVLAPNGHLIVIAFMGGALVHMNALPLFREEAKITFSKLHCRSD
                     QYKADLVTSFEREIVPYMSERIISTIVDRTFPLEEVAKAYRFLAEDHGHGKVVLSVSE
                     PPKLSM"
     gene            complement(<430918..>432576)
                     /locus_tag="LMJF_23_0870"
                     /db_xref="GeneID:5652071"
     mRNA            complement(<430918..>432576)
                     /locus_tag="LMJF_23_0870"
                     /product="beta-fructosidase-like protein"
                     /transcript_id="XM_001683370.1"
                     /db_xref="GeneID:5652071"
     CDS             complement(430918..432576)
                     /locus_tag="LMJF_23_0870"
                     /EC_number="3.2.1.26"
                     /codon_start=1
                     /product="beta-fructosidase-like protein"
                     /protein_id="XP_001683422.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652071"
                     /db_xref="GOA:Q4QB76"
                     /db_xref="InterPro:IPR001362"
                     /db_xref="InterPro:IPR013148"
                     /db_xref="InterPro:IPR013189"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR023296"
                     /db_xref="UniProtKB/TrEMBL:Q4QB76"
                     /translation="MQAASAVATATATSSGIANLKQEASHEERLKVADHTAVKAWSLL
                     NKMWYPDYHMASLAGWMGVPGGLCYHNGFYHVFYQYNPFSENWGPMHWGHMTSEDLVH
                     WQHQPIALAPGELFDHDGCFSGSSVSYNNKLYIFYTGHTWRTESEKGSGNGTMGDGAS
                     FYQQQCVAVSSDGVNFEKLGAVVRPPPGYVHFRDPKVWQQDGRWWMVCGARDVTKDLG
                     QLLLFTTEDLLKWDDTNWQVLGMTEDKNVFMWECPDMFRLGQMNVFLYSPQGMRKADY
                     AYRNRFQSGYLLGSWNMSLVTAALSEREAGSPKGTASGSHAIGGPRWLASFDVTQRFR
                     EIDRGHDFYAPQTLLTKDGRRLIIGWMDMWESPMPTRGHGWSGCLTLPRELILDPFTG
                     SVRMVPPKELLQLRCAQATILAQRIQESTDVLLVESCTAYELDIAFNMETSTAEKYGL
                     WLGSGAELYVDAQSKRLVLNRHYPQHMLSGYRSCELPIGLLLQLHVFIDRSSIEVFVN
                     NGEATFSSRVFPDEGDRALRVFSVNGTADMVGGTMWKLKATVRH"
     gene            complement(<435934..>437475)
                     /locus_tag="LMJF_23_0880"
                     /db_xref="GeneID:5652072"
     mRNA            complement(<435934..>437475)
                     /locus_tag="LMJF_23_0880"
                     /product="beta-fructosidase-like protein"
                     /transcript_id="XM_001683371.1"
                     /db_xref="GeneID:5652072"
     CDS             complement(435934..437475)
                     /locus_tag="LMJF_23_0880"
                     /EC_number="3.2.1.26"
                     /codon_start=1
                     /product="beta-fructosidase-like protein"
                     /protein_id="XP_001683423.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652072"
                     /db_xref="GOA:Q4QB75"
                     /db_xref="InterPro:IPR001362"
                     /db_xref="InterPro:IPR006232"
                     /db_xref="InterPro:IPR013148"
                     /db_xref="InterPro:IPR013189"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR023296"
                     /db_xref="UniProtKB/TrEMBL:Q4QB75"
                     /translation="MSSQAQQRAPAYAPRDTHAERLAAADREAAARRDSSTNWTWYPE
                     YHLAPYMGWMNDPTGLVHFRDHYHVFYQYHPYSAEWGPMHWGHMTSEDLVHWQHEKVA
                     LAPGDACDRNGCFSGTAVVHEDRMYVFYTGHFALDAATPSNPDAIFEQQCVAVSSDGV
                     NFEKLGAVVRPPPGYVHFRDPKVWQQDGRWWMVCGARDVTKDLGQLLLFTTEDLLKWD
                     DTNWQVLGMTEDKNVFMWECPDYFTIGSREDMKLLLFCPQGKKASEYNYRNRFQNGYT
                     VGQWMPGGPWTVQREFRELDRGHDFYAAQTFLAADGQRRMLMAWCNMWESPMPTKQYG
                     WSGCLTLPRELSYNEATGQLCMLPARELVGLRTPEMMIVPSLLVENNSDAQILENCTA
                     YELDIAFNMETSTAEKYGLWLGSGAELYVDAQSKRLVLNRHYPQHMLSGYRSCELPIG
                     LLLQLHVFIDRSSIEVFVNNGEATFSSRVFPDEGDRALRVFSVNGTADMVGGTMWKLK
                     ATVRH"
     gene            complement(<438396..>439739)
                     /locus_tag="LMJF_23_0890"
                     /db_xref="GeneID:5652073"
     mRNA            complement(<438396..>439739)
                     /locus_tag="LMJF_23_0890"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683372.1"
                     /db_xref="GeneID:5652073"
     CDS             complement(438396..439739)
                     /locus_tag="LMJF_23_0890"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683424.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652073"
                     /db_xref="InterPro:IPR003788"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4QB74"
                     /translation="MGPLSSGSSVAAPFMRHYRAGLLRSTPVRLAMNLHASDLSTPDR
                     ATVNSANKKEFKTALCNELVNKITAQGYYPMSQFVKDCLTHPQYGYYAAKKNVIGSEK
                     ADFITAAEIPFFGDVLAAWVMDAWQKMGTPRVLHLVEMGPGRGTLMRTMLKQIQYSNP
                     HLLHFLQIHLVEVGAARREEQKRALAEFQTAQGKIKWWMNLESLPFSLEPTVFMANEY
                     FDALPVAQFRYTERGWVETCVEVDTDPGTEAHFRLVHAPSGSMSAYLIPDDIRTKGKT
                     GDCVEVNTVGMQTIETLMKKMMDCQKAACLLIDYGKDDHMHSTLRGIRGHRFVDPLLS
                     PGEVDLSCWVSFRQLRWALERLEVARQHLKWFPVMTQHDFLLENGIDIRLAHVIKDEE
                     TKTAMKVLQNYRRLMDKEEMGESYKVFAFQTRNFPNVSPFFAEMPLPPLPQRGGR"
     gene            complement(<440737..>449367)
                     /locus_tag="LMJF_23_0900"
                     /db_xref="GeneID:5652074"
     mRNA            complement(<440737..>449367)
                     /locus_tag="LMJF_23_0900"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683373.1"
                     /db_xref="GeneID:5652074"
     CDS             complement(440737..449367)
                     /locus_tag="LMJF_23_0900"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683425.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652074"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q4QB73"
                     /translation="MEPYPLAAHLSSEARSSPFSPHAFDSTGHGVLVARRPRHGGGGH
                     DTFGERDQSAAQRGPPLRLSTRRLQVFSYVLAELSSATTLLPDYTKAILNLSRRLVGA
                     WQAVTAAAVARTWYEHALVWAAHQWKRTKTSHLRASSLTKKASESYGAFMRVSRRSSR
                     RRAGEKKKRCSSVPVTAAAAASSPSPAVAAALFDSAAASHKRRRLAREATPAAASSDV
                     ALTDQRLGRSQQPSNTPSDGSAPALPCVDSPTSSSKHLQADVAATPPLPSPSDRCRGG
                     LHSRVAHKRRRQLVQRTLQQLWLDAQEAEDKAGQHVEYIRGLVVNALYQQYLQVTVEA
                     SYHDVVLYRWLSPWLFAVRRGSAGPRQTWLRQGYRQRCRSASAPQGGGSLQHALQHQA
                     AVQVVADVQLLRYVLGRARIAAGPSRGAGRRSSSSGDSGIVVASLAMGHGSASSVPLP
                     PTTAAARGAVGAGGPASFATVDGGGAAATASSEGTNSDGVAARRTASTDGSRSSSGLS
                     THDPLDDCTLAVPMPLKSFLQACVLFDPTHCAFALMSRCVLLAQHVRSGDDEQAVPLH
                     VAPDGKGAWQEVRGGVGRADEGATEGVDGEAPAREYFGLFYVVIARRAIGGCACTAMC
                     FGNHKFIFVRCHDTEALLREAMPGAESDGGACEGSEASAEATEEEEERHPAHVSRLSA
                     DADATTCTSNEAVGEAERLAGTDAQTPPSASTSSTAGMVATAEGHRRHLPLSRFCSHS
                     RRMDKLTLPSPARGISALSAHDAHRLKRDATEKSGTGERGRVAEAGPSRRPPSEAATH
                     SLPSSPRSTPPSGSVQCTLSGQPHSPMRLRLSTAAGGMKATASTAWSGAALGAAALQS
                     STAEERLRTRALTRQAPSPHGKRLFTQTLSATQDASFTDCAIAAAPGRAYTASTIASL
                     APALRQPIRADARSSAALVSDASLQSLAARAESMPACSPLSPLLQGTASVFPGDDALA
                     DEEDVEAEFSCASALKPLHTESSRHAVGGGLATRCTASATHPMPGSALLPCRASSSTS
                     LTSSSFVAAFSDSDDDAQDADAADRARCLQQRHGFTAAYPDRIADGDDERSTEEEDAT
                     AEDGEGVFGSSSTQAFVVMHSVLCSCGAQDLTSEFGEATEPAAAASPWFTTAATPSFF
                     ERSHARRRQLDTPLEWPSAPLGDSVQGLSGRSSVPCAADADFPFSYFEQRVLLPPGSG
                     HERRVGGGCSGGGDGEAAHPRAPLIEMEQKNLSPTLPSAWAAEPTDAPLGVACPRARA
                     AGAEAAAAQHKAAATVGDAGALPVEVVVSSPPDPEESKLYDFAKEYSGPEPKGTSSCH
                     RQHALCAAGTSAVEPSEGDMAFAAELYARLQFWSLRGQDRSAYIDPSWTRQSSHKRPE
                     GEKWSAPSASHSCAGNTETLEELVEADRQHPAAPFASYATGVDAPRRVQTGMSRAAPG
                     TRTSDKPVPGEASQSSPDSSMNASDGVSSKNAIELPLRLLHCTVGTIALSDEALQAPP
                     RAGTKVRKRRRAAHADERQTKRRSRVAGSSGATEEEADDPLAKDAEECDEGGESFPRL
                     PSLMTVNARGKALLFEALREATEVVVCGVRESRAHTGYHDVLHQRCPPPPSSTSASAA
                     PQNGAGVRSEGDAGQVGHDPRADAAVTPTTGTPSKSTWITTVNPWMAAAAAAQGCSFR
                     VAAGTLSRDGRNPFAFDTHRHLGVCGIVCWSQGDISREEEAGSSPADVSDDEAVMTMA
                     VPTEDSAPHGAEGISGATHHQDHVRRSDSSHMPKWRWPKLPANDHKQWRCELLKSEFR
                     LARSRCLDCLLVDHTHGRPIAAITLAPWSWPRACFGLPSDAVYSGDDDGDDEGVPSRR
                     CTERHRAGAEAADAPSPQEVVQRSVYIVVGFTHYIAPLWRHLREEKAVLVDMDRTLID
                     NAITERSAVERQRHLRHLRRVVAAAEGVAGAENPCVLWRRYPATPSSERFAGAPLRLG
                     RNDAPPLTAEELAESMVRGADGQQEGVLHLDSRGHHLHSNGTFHFSHRRTEAVEDDCV
                     LRPAIRQRPPHTPEPLLSHAQATTGDTSALSSGCLLQCFMRRTASQRRSLGIVHYEEC
                     GAVRYTAASPSALGPASAVDSPSKSGYGHGYSSFASRDTRETSSASSADADALRSSTA
                     KSATTSATAAATPPARYLLDVVYVRPGVRQFLYRVATQWNIPVVLVTKSTRSRTEAIL
                     RQVLDPHRVLFPDMRSSVVTADEMLRWCDDAERRHDDVGTDEEASAASDVGFAGPVGG
                     MPAGHSRSATSSVPNSAHARLVPLQKPAPKSTAERIARCRKGARRVVQFILDAAAMTA
                     ARRAWRAPAWCDWPNRLPKPRSIAVLDDAPQVWEESDWPCTVNVAPYTLARVDPRAYF
                     SRRGYVTSLVLSCLYGSKCLVCSEGVLRLPEWQGADALTSPSSPHTPSATLSVPESRG
                     LGAYRWPHCVCVCPPDHLRDLARAEEDVPVGYTNTSFSAAASDLSASVSAMLTALLWR
                     MSNNAALCSSQQPLLLPAIEDSVATELTEQARGAESQVGASRRGGGRRRRRRRHACDL
                     GATMCPASEDRCEKALPATATVVDVLRRAGRAMRPGHVDTEGIASPWSPSSAVFATAT
                     CHSFSSASASAQSASSPSSSSSASRSNPSLSSTTASSFSLEPFAWGAGFGHAAVNART
                     DTCSYAPSTMMTAASMPPTPMTFHAFPDLPLESRVLGGVPETDDDEQHGLRFSMGSLS
                     ANTTASSRNTVRGESAALQTPPWDGYTDATSNGYEAHCLRSSAVDDVIPLEMQAAPSV
                     LEPLCTPGSPSYCTEDVGGALAMASVDSVPWSSGGSHKALRSSSSFTPAPRKGVVPIT
                     SVPGTLTERVVVDVDEPAPPWVCEAELQRPRHRLLDDLLDEVEDVTPL"
     gene            complement(450212..454024)
                     /locus_tag="LMJF_23_0910"
                     /pseudo
                     /db_xref="GeneID:12980833"
     misc_feature    complement(450212..454024)
                     /locus_tag="LMJF_23_0910"
                     /pseudo
                     /db_xref="GeneID:12980833"
                     /db_xref="PSEUDO:CAJ04531.2"
     gene            complement(<455934..>456407)
                     /locus_tag="LMJF_23_0940"
                     /db_xref="GeneID:5652078"
     mRNA            complement(<455934..>456407)
                     /locus_tag="LMJF_23_0940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683377.1"
                     /db_xref="GeneID:5652078"
     CDS             complement(455934..456407)
                     /locus_tag="LMJF_23_0940"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683429.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652078"
                     /db_xref="UniProtKB/TrEMBL:Q4QB69"
                     /translation="MFCSSVPLRSRIPDIGHQTTATLKWATYTFWYLLDPILRRHHRY
                     YRRKVQLDRFLERNSIVANSMIGVILGVTVYFSVVCGVLLPPAVGAKERTMKENAREV
                     LNLMECDTSKELPAYQLMRVKREIIGKLHAVADEAEVRRQREEAEKLSELLKSLS"
     gene            complement(<457238..>458935)
                     /gene="LAP"
                     /locus_tag="LMJF_23_0950"
                     /db_xref="GeneID:5652079"
     mRNA            complement(<457238..>458935)
                     /gene="LAP"
                     /locus_tag="LMJF_23_0950"
                     /product="cytosolic leucyl aminopeptidase"
                     /transcript_id="XM_001683378.1"
                     /db_xref="GeneID:5652079"
     CDS             complement(457238..458935)
                     /gene="LAP"
                     /locus_tag="LMJF_23_0950"
                     /EC_number="3.4.11.1"
                     /codon_start=1
                     /product="cytosolic leucyl aminopeptidase"
                     /protein_id="XP_001683430.1"
                     /db_xref="GeneID:5652079"
                     /db_xref="GOA:Q7KF27"
                     /db_xref="InterPro:IPR000819"
                     /db_xref="InterPro:IPR008283"
                     /db_xref="InterPro:IPR011356"
                     /db_xref="UniProtKB/TrEMBL:Q7KF27"
                     /translation="MLRRVLSRGPLPQSLSVGPTSKLTVNKGKLAKSRGVHVHFLTIA
                     ECAAAAGDASAPIPPGFTGKAGEVDFQTLWTTAQDPATAESVLRKSGRKAAGARRAAE
                     KPAELVAGMGAHSTVRDYRLAVTAAVRKAKMCNAAWVSLHPPKQDVFTMTDPYHPPQR
                     LKSHEMVEKTAIFAVTGAYQYDRLKSGTLASKDSAQTGRTRARRAESRAKPPAAPQPP
                     MELVVASSNAQAVRAGEVIGHCVNEARNLGNLREDEGVPEFYAEWAKKYMIPEGIKVR
                     KVLRGQQLEEAGLHLMYNVGRGSRYEPYLVVLEYIGNPRSSATTAIVGKGVTFDCGGL
                     NIKPYTSMETMHSDMMGAATAFCTLKAIAKLQLPINVVAAVGLVENAIGPESYHPSSI
                     ITSLKGLTVEVLNTDAEGRLVLADVLTYVQKYAPLDKKPTRIIDLATLTGAIIVGLGS
                     RRAGLFSPSAMLANSLMAAGTQCGEELWPMPIGDEHKDMMKGGIADLINAAPGRQAGS
                     CTAAAFLSNFVEPEVQWAHLDIAGVADVGDKPKGYEPAGVTGFGVQLLVDFLRHNKP"
     gene            complement(<460543..>462618)
                     /locus_tag="LMJF_23_0960"
                     /db_xref="GeneID:5652080"
     mRNA            complement(<460543..>462618)
                     /locus_tag="LMJF_23_0960"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683379.1"
                     /db_xref="GeneID:5652080"
     CDS             complement(460543..462618)
                     /locus_tag="LMJF_23_0960"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683431.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652080"
                     /db_xref="UniProtKB/TrEMBL:Q4QB67"
                     /translation="MAVEHKSTAIAIWVSCAVLLVVVVSLTIFLSLRQRRRRAARLRR
                     RLCLKSFTDGQQRYANNDAWGTEGVSSVLSPVALHGSAAAAFYRGFERYAGEELEAIP
                     PPASASSFPTPLVVYLRVRAERVYTDACDILVTVDRLRDSLPSDCSSFQILGNDGYYH
                     NDFLLYTAPLEFRVPGLYMIQAHTVHPVDKVVGAVHKFAYVVTGVAPSSGLTPPLPPA
                     NPPLLTYAESSSANNNTSSIDIDIARRQAERAQANRDELRQTSHVSPPAHMQAPSATV
                     EPSADAVSDVPLPPVISPSGGEVTTSTEIVITPHELSTSPDQLRYSLDGSYPTLIYTA
                     PFRLSLPPPSVLPSQRLQVIVQAIAVHAAAAASGDCSAAISACSRLASGRVSAISRAV
                     LLVRPAGLSYFDPQVPTPSMRLRATRATLYFDESDNPPQTQTLYELVFVDEARRKVKF
                     SRQRAQLYDGNPVALTDSVATIHAWTVMSSAAAAEGLSDRAEAAAEDRVRSVPVIYDC
                     SRGATERGKLSRRRIERYNIRPEQLLPPPVICVSCSELQLIFDDPPANCLIAYTLNDT
                     EPALFDVSPPACAAPMGDGAGGVTHDSDKGRSRRGKRDDHASPIVGDRDGAHTCIYQP
                     GKHIHVTLMETQQVYVTARIFLPIFEGSDGALYGDRGAQGGSCLGSGRLLGYRYGGVF
                     HRGFYFNSS"
     gene            complement(<464722..>465888)
                     /locus_tag="LMJF_23_0970"
                     /db_xref="GeneID:5652081"
     mRNA            complement(<464722..>465888)
                     /locus_tag="LMJF_23_0970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683380.1"
                     /db_xref="GeneID:5652081"
     CDS             complement(464722..465888)
                     /locus_tag="LMJF_23_0970"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683432.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652081"
                     /db_xref="InterPro:IPR029024"
                     /db_xref="UniProtKB/TrEMBL:Q4QB66"
                     /translation="MLRLSRVARSSRYTPVVGCAFLVETLYGSKYSANLGLYSMPYVY
                     VKTILLCATGNGLKLREGRYIHGLVELLLPSKVSQDNLTKLELLQFVDAIPMDRYASG
                     NDESSTVDEEEAEDQAVLALMLRGNGDASSDDPTAAAIYAEYCASSPSPLHDECRALQ
                     RPLQGCSDGSHRHSMGDAACDPEGCDALGRLGSEAAAAAAAAARSRAEEAEDDAAAVE
                     SIMSFVSATAFPSSIARVLIYDAVCTCVADGLYSAKEKERVALLSSHIGLSSAVRGQI
                     EKLALQEKVISIRKRRLLLLQPLHTNRTPERGARRWQAFSTLGSAANSTSEEQGQSGA
                     DAAGRRDVGDRGDHQDAEDETDTFAAEEAMRVEAAKTLLRRARAHRSSKRYAGV"
     gene            complement(<468298..>469326)
                     /locus_tag="LMJF_23_0980"
                     /db_xref="GeneID:5652082"
     mRNA            complement(<468298..>469326)
                     /locus_tag="LMJF_23_0980"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683381.1"
                     /db_xref="GeneID:5652082"
     CDS             complement(468298..469326)
                     /locus_tag="LMJF_23_0980"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683433.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652082"
                     /db_xref="UniProtKB/TrEMBL:Q4QB65"
                     /translation="MDSVAAGPFPSSCSLRKPERTHAHIHTHTHTHKADAMGNTNSSA
                     DRSNADDRGVHSEFMYRYETTKKLKLSYMMLKKNVATAVMTMEVTPQHLRDVGTGYSN
                     VCACLKHGGSGGTNSCIQGQAAGREQASISRSRIDREFADESYKGFQTFCEAMDDIKA
                     GVCVTSRTAIHERITVELDRMVLTAERVLKQGRKTMRSMAHFTKVARQVSRRERAAVD
                     QGKDLSSSKRYAKAVKERNEKESLYKTELEAFDQLYEHVMVVSQEFCSSTTDIFLDCI
                     VGYYREIVATIDVSDTPQCSRLQSRFRSREREVVLHQASDAGFCAMPAGHMDGSKSLS
                     STVPLKWD"
     gene            complement(<471048..>473297)
                     /locus_tag="LMJF_23_0990"
                     /db_xref="GeneID:5652083"
     mRNA            complement(<471048..>473297)
                     /locus_tag="LMJF_23_0990"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683382.1"
                     /db_xref="GeneID:5652083"
     CDS             complement(471048..473297)
                     /locus_tag="LMJF_23_0990"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683434.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.0990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.0990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652083"
                     /db_xref="UniProtKB/TrEMBL:Q4QB64"
                     /translation="MLNTKSPSPANSNYDFALRHERVKLIARALKQFGVYITRTTQAM
                     REVASCLSLVGQSYHEVAQCVNNTNPHSRADQDCYISFNRQLVESYGANLQNAATLFS
                     AEMMNIKNGEQFLSYNKSVHRTVMTRLHDVLKMAQRTRDLGDDVKAELKKATSCRKVV
                     SRKEAKYIRKGRPLTESKLYVRQSERMRKHDQAYEAKLRTFDTEYESLMQRQLYVAGH
                     TMDDFLDMNTVYLSHILKVLGCLAPNGAEAIQKMLDSGEKLSDLLGIAPEDQLGCRLR
                     AQNVDVLNSSNVTPVKRGVGATPGKGTPAKSSCCGSSHNFTSYYQNRRQAALYVEGAP
                     PTARALGEDSRGSSEPCQTLSETPERQLISNQTPLRATFGSAAICRAASHSYSAAEPA
                     APSPLQPPSFPAAVRRVDAAPVPYVKPLAIGLHASCGSPGTTTDAAKQTCPAGNAAPA
                     AWVVKTGGRRGSVCDTTNSRTRVELSLGHAQFDDDNTAAGAPPAACLAPAPPPAQYSE
                     ERPMERPLGRSEVPAAQAAMFGLDVARSAAPFDDQLVADSCRRTSLLSLKPVALFPLD
                     VSESSISRKVAPRTSAATTSVANPSTQQRSRRDRKKHKTTKVVAAARGVPLPGTASAP
                     PDEDTMSRSTSTQSQEALESSIHGYHAAHYHCPPPQQLHNLKQHPQRDSAPVSLAHFQ
                     MELTGCSGDAPCQWRNDGLCSEAGGVSGRSQRLSTSYGLDSPTPTPQPFALGTHAWED
                     SQVRPCSSA"
     gene            complement(<475613..>476311)
                     /locus_tag="LMJF_23_1000"
                     /db_xref="GeneID:5652084"
     mRNA            complement(<475613..>476311)
                     /locus_tag="LMJF_23_1000"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683383.1"
                     /db_xref="GeneID:5652084"
     CDS             complement(475613..476311)
                     /locus_tag="LMJF_23_1000"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683435.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652084"
                     /db_xref="UniProtKB/TrEMBL:Q4QB63"
                     /translation="MPKSSPPDEHKVLIKKLTHACASYDSASRKYLTAVKALDSSLEA
                     VAIAIRELSQGEESEDAVTRVDRFCTSVDRHMAGSSAGASFGHNKSGRLSDSAAFNGA
                     EYPFAAYMSDFTREVSSAVDELKEILKKIEKSRSKHDDLVAKYNKKRSEVDTMEMKLA
                     KKNQGIATNEKYSHKLSDRDALKVQVDTGERELRAEFMELLQRRTRILLQVVHGMQTH
                     SSKYYSHLSKAMQA"
     gene            complement(<479698..>483030)
                     /locus_tag="LMJF_23_1010"
                     /db_xref="GeneID:5652085"
     mRNA            complement(<479698..>483030)
                     /locus_tag="LMJF_23_1010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683384.1"
                     /db_xref="GeneID:5652085"
     CDS             complement(479698..483030)
                     /locus_tag="LMJF_23_1010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683436.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652085"
                     /db_xref="UniProtKB/TrEMBL:Q4QB62"
                     /translation="MSMVAPPSTFAEAGIPLHAKLLSAVEADGQVITPTPLLIRVLRR
                     TALDFADVIVDGRCATGTRQVGSAAAVWVHNTNVRVNASQAAAESSSKTPQQPAGDNR
                     ASSPGTGGTNNDKAVPLYRTEAALSECRSLLVLYTLHCLLSATQEPSTDGGSSSSDSS
                     AHVRADADGRVQQLPLAARNWAPEVSIIVAETEASAVELHRMCKSLGEACRLRLNAVL
                     QVGDKPPASLVLSPSTPATEKGTANPEVSGAPAAASDASKHEEGGDISGTAKKTTSAG
                     ERPHLVSIIVTTAQGFLRWNLSALLSAGVDVAVAGSGTASAAAESTSDAASAGAAAAA
                     EPSPSPEMRRVHPHVASIVVEEMGGASVTSPIGVDKAVQQWREVHHILYAAALRQNPR
                     YVPAAHLHPHYMWVCRGPVSHLPATLRQCFSRRSRRYYQIQPSTYISPLAVALMPHPH
                     EGLSSPAESLGIRLVLSQSQADKEAQLRRIVTDRSGLFHRVLLLTHNKEVAQLSALIA
                     SWGMSKEAPTASTVSASASNSVLFSRRMDSLGAQQQCHAAYLQSCEAAERVLPAAAAA
                     SSSLPYSSPVVVTLVAWDALTSLDIMDLDVVIQYYPPQKSLTDQEWAEFIQILHTTVD
                     GEREIELSLRQNRHIKEDNIQEKLQQLREGTTTRPAKSAEGSEQPQRPLPVVVTLMLA
                     ADFTLSAYFLHQYMYSGATGTLTRAATATSLTSTGPAPGRPGVQEPVECPLPVLDISP
                     KHPYFIPLVCGHTGDVEWPATAPSSPPRPRTATAGVNGAEESLLLTLTSGEAVTVKKV
                     LVAKLEKEQRRLDGFTSLSGTAAAAKNMGFSGNSSVGAAPSPVQLLAQGNIAMTANAA
                     SGGSANLSSSGSGGAERNPFAKIAKHSGIATANYAASAAAGVVNPATAAATAIGASGV
                     RANSRRNAGAGTGAGDGGNGSNSNQRQHQQRGGGSGKEPVSSAPNSGGGGSNSNNRRA
                     RSSAAQNSNTGGRGGSNGKDGANANGNGSLSSSSVAGGAAFNTTNAASAAAAQAAAAP
                     SGGAIAPGSKKENETGNTTTRSPLASKSGASDPNVAYAGAKDAGSGSGGDRKGTSNKR
                     RSRNTRGKKQQQQQQQQSSPSS"
     gene            complement(<488818..>489270)
                     /locus_tag="LMJF_23_1020"
                     /db_xref="GeneID:5652086"
     mRNA            complement(<488818..>489270)
                     /locus_tag="LMJF_23_1020"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683385.1"
                     /db_xref="GeneID:5652086"
     CDS             complement(488818..489270)
                     /locus_tag="LMJF_23_1020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683437.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652086"
                     /db_xref="UniProtKB/TrEMBL:Q4QB61"
                     /translation="MGSFCAKPDAAPKDDVHEGEKNYQEGEKSFNDANVEAKSKEQPC
                     DKADAAKDVEATDGEAKCAEAEGVEATDGEAKCTEAEGVEATDGEAKCAEAEDMEEKQ
                     EKFEVDPKNESDDMERQADEKREEWEQKVEEEGQHITDDTENHISCSG"
     gene            complement(<492075..>492608)
                     /gene="HASPB1"
                     /locus_tag="LMJF_23_1060"
                     /db_xref="GeneID:5652087"
     mRNA            complement(<492075..>492608)
                     /gene="HASPB1"
                     /locus_tag="LMJF_23_1060"
                     /product="hydrophilic acylated surface protein b"
                     /transcript_id="XM_001683386.1"
                     /db_xref="GeneID:5652087"
     CDS             complement(492075..492608)
                     /gene="HASPB1"
                     /locus_tag="LMJF_23_1060"
                     /codon_start=1
                     /product="hydrophilic acylated surface protein b"
                     /protein_id="XP_001683438.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1060"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652087"
                     /db_xref="UniProtKB/TrEMBL:Q4QB56"
                     /translation="MGSSCTKDSAKEPQKSADKIKSTNETNQGGNASGSRKSAGGRTN
                     EYDPKDDGFTPNNEDRCPKEDGHTGKNDDGGPKEDGHAPKNDDHAPKEDGHAPKNDDH
                     APKEDGHAPKNDDHAPKEDGHAPKNDDHAPKEDGHAPKNDGDVQKKSEDGDNVGEGGK
                     GNEDGNDDQPKEHAAGN"
     gene            complement(<494225..>494446)
                     /gene="HASPA1"
                     /locus_tag="LMJF_23_1040"
                     /db_xref="GeneID:5652088"
     mRNA            complement(<494225..>494446)
                     /gene="HASPA1"
                     /locus_tag="LMJF_23_1040"
                     /product="hydrophilic acylated surface protein a"
                     /transcript_id="XM_001683387.1"
                     /db_xref="GeneID:5652088"
     CDS             complement(494225..494446)
                     /gene="HASPA1"
                     /locus_tag="LMJF_23_1040"
                     /codon_start=1
                     /product="hydrophilic acylated surface protein a"
                     /protein_id="XP_001683439.1"
                     /db_xref="GeneID:5652088"
                     /db_xref="UniProtKB/TrEMBL:P90552"
                     /translation="MGSSCTKDSAKEPQKSAGNIDTTTRSDEKDGVLVQQNDGDVQKK
                     SEDGDNVGEGGKGNEDGNDDQPKEHAAGN"
     gene            complement(<496116..>496289)
                     /gene="SHERP"
                     /locus_tag="LMJF_23_1050"
                     /db_xref="GeneID:5652089"
     mRNA            complement(<496116..>496289)
                     /gene="SHERP"
                     /locus_tag="LMJF_23_1050"
                     /product="small hydrophilic endoplasmic
                     reticulum-associated protein (sherp)"
                     /transcript_id="XM_001683388.1"
                     /db_xref="GeneID:5652089"
     CDS             complement(496116..496289)
                     /gene="SHERP"
                     /locus_tag="LMJF_23_1050"
                     /codon_start=1
                     /product="small hydrophilic endoplasmic
                     reticulum-associated protein (sherp)"
                     /protein_id="XP_001683440.1"
                     /db_xref="GeneID:5652089"
                     /db_xref="PDB:2X43"
                     /db_xref="UniProtKB/TrEMBL:Q9XTN3"
                     /translation="MDQETRDQMKNAAAEAKDNVHDKIQELKDDVGNKAAEVRDAVSS
                     TVESIKDKLSGGS"
     gene            complement(<497897..>498118)
                     /gene="HASPA2"
                     /locus_tag="LMJF_23_1082"
                     /db_xref="GeneID:5652090"
     mRNA            complement(<497897..>498118)
                     /gene="HASPA2"
                     /locus_tag="LMJF_23_1082"
                     /product="hydrophilic acylated surface protein a"
                     /transcript_id="XM_001683389.1"
                     /db_xref="GeneID:5652090"
     CDS             complement(497897..498118)
                     /gene="HASPA2"
                     /locus_tag="LMJF_23_1082"
                     /codon_start=1
                     /product="hydrophilic acylated surface protein a"
                     /protein_id="XP_001683441.1"
                     /db_xref="GeneID:5652090"
                     /db_xref="UniProtKB/TrEMBL:P90552"
                     /translation="MGSSCTKDSAKEPQKSAGNIDTTTRSDEKDGVLVQQNDGDVQKK
                     SEDGDNVGEGGKGNEDGNDDQPKEHAAGN"
     gene            complement(<499735..>500268)
                     /gene="HASPB2"
                     /locus_tag="LMJF_23_1070"
                     /db_xref="GeneID:5652091"
     mRNA            complement(<499735..>500268)
                     /gene="HASPB2"
                     /locus_tag="LMJF_23_1070"
                     /product="hydrophilic acylated surface protein b"
                     /transcript_id="XM_001683390.1"
                     /db_xref="GeneID:5652091"
     CDS             complement(499735..500268)
                     /gene="HASPB2"
                     /locus_tag="LMJF_23_1070"
                     /codon_start=1
                     /product="hydrophilic acylated surface protein b"
                     /protein_id="XP_001683442.1"
                     /db_xref="GeneID:5652091"
                     /db_xref="UniProtKB/TrEMBL:Q4QB56"
                     /translation="MGSSCTKDSAKEPQKSADKIKSTNETNQGGNASGSRKSAGGRTN
                     EYDPKDDGFTPNNEDRCPKEDGHTGKNDDGGPKEDGHAPKNDDHAPKEDGHAPKNDDH
                     APKEDGHAPKNDDHAPKEDGHAPKNDDHAPKEDGHAPKNDGDVQKKSEDGDNVGEGGK
                     GNEDGNDDQPKEHAAGN"
     gene            complement(<501534..>501851)
                     /locus_tag="LMJF_23_1075"
                     /db_xref="GeneID:12981214"
     mRNA            complement(<501534..>501851)
                     /locus_tag="LMJF_23_1075"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721749.1"
                     /db_xref="GeneID:12981214"
     CDS             complement(501534..501851)
                     /locus_tag="LMJF_23_1075"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721797.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1075"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1084"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1075"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1084"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981214"
                     /db_xref="UniProtKB/TrEMBL:E9ACS5"
                     /translation="MLADTHTHTHTHTHGQLLYLRGVLPLLAASSAVQPLSTSTVCVC
                     VDAAPLPPVSLVVLSECLGFRLGGWGVLGGPRQHRCPACTTVYIRLFPVHATLAYASV
                     CVR"
     gene            complement(<501938..>502111)
                     /gene="SHERP1"
                     /locus_tag="LMJF_23_1080"
                     /db_xref="GeneID:5652092"
     mRNA            complement(<501938..>502111)
                     /gene="SHERP1"
                     /locus_tag="LMJF_23_1080"
                     /product="small hydrophilic endoplasmic
                     reticulum-associated protein (sherp)"
                     /transcript_id="XM_001683391.1"
                     /db_xref="GeneID:5652092"
     CDS             complement(501938..502111)
                     /gene="SHERP1"
                     /locus_tag="LMJF_23_1080"
                     /codon_start=1
                     /product="small hydrophilic endoplasmic
                     reticulum-associated protein (sherp)"
                     /protein_id="XP_001683443.1"
                     /db_xref="GeneID:5652092"
                     /db_xref="PDB:2X43"
                     /db_xref="UniProtKB/TrEMBL:Q9XTN3"
                     /translation="MDQETRDQMKNAAAEAKDNVHDKIQELKDDVGNKAAEVRDAVSS
                     TVESIKDKLSGGS"
     gene            complement(<503368..>503685)
                     /locus_tag="LMJF_23_1084"
                     /db_xref="GeneID:12981228"
     mRNA            complement(<503368..>503685)
                     /locus_tag="LMJF_23_1084"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721750.1"
                     /db_xref="GeneID:12981228"
     CDS             complement(503368..503685)
                     /locus_tag="LMJF_23_1084"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721798.1"
                     /db_xref="GeneID:12981228"
                     /db_xref="UniProtKB/TrEMBL:E9ACS5"
                     /translation="MLADTHTHTHTHTHGQLLYLRGVLPLLAASSAVQPLSTSTVCVC
                     VDAAPLPPVSLVVLSECLGFRLGGWGVLGGPRQHRCPACTTVYIRLFPVHATLAYASV
                     CVR"
     gene            complement(<503772..>503945)
                     /gene="SHERP2"
                     /locus_tag="LMJF_23_1086"
                     /db_xref="GeneID:5652093"
     mRNA            complement(<503772..>503945)
                     /gene="SHERP2"
                     /locus_tag="LMJF_23_1086"
                     /product="small hydrophilic endoplasmic
                     reticulum-associated protein (sherp)"
                     /transcript_id="XM_001683392.1"
                     /db_xref="GeneID:5652093"
     CDS             complement(503772..503945)
                     /gene="SHERP2"
                     /locus_tag="LMJF_23_1086"
                     /codon_start=1
                     /product="small hydrophilic endoplasmic
                     reticulum-associated protein (sherp)"
                     /protein_id="XP_001683444.1"
                     /db_xref="GeneID:5652093"
                     /db_xref="PDB:2X43"
                     /db_xref="UniProtKB/TrEMBL:Q9XTN3"
                     /translation="MDQETRDQMKNAAAEAKDNVHDKIQELKDDVGNKAAEVRDAVSS
                     TVESIKDKLSGGS"
     gene            complement(<505547..>505768)
                     /gene="HASPA2"
                     /locus_tag="LMJF_23_1088"
                     /db_xref="GeneID:5652094"
     mRNA            complement(<505547..>505768)
                     /gene="HASPA2"
                     /locus_tag="LMJF_23_1088"
                     /product="hydrophilic acylated surface protein a"
                     /transcript_id="XM_001683393.1"
                     /db_xref="GeneID:5652094"
     CDS             complement(505547..505768)
                     /gene="HASPA2"
                     /locus_tag="LMJF_23_1088"
                     /codon_start=1
                     /product="hydrophilic acylated surface protein a"
                     /protein_id="XP_001683445.1"
                     /db_xref="GeneID:5652094"
                     /db_xref="UniProtKB/TrEMBL:P90552"
                     /translation="MGSSCTKDSAKEPQKSAGNIDTTTRSDEKDGVLVQQNDGDVQKK
                     SEDGDNVGEGGKGNEDGNDDQPKEHAAGN"
     gene            complement(<507154..>508827)
                     /locus_tag="LMJF_23_1025"
                     /db_xref="GeneID:5652095"
     mRNA            complement(<507154..>508827)
                     /locus_tag="LMJF_23_1025"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683394.1"
                     /db_xref="GeneID:5652095"
     CDS             complement(507154..508827)
                     /locus_tag="LMJF_23_1025"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683446.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1025"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1025"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652095"
                     /db_xref="UniProtKB/TrEMBL:Q4QB52"
                     /translation="MPRPAAHTSAKGRQNLRQHYYATSEQEAGLAHLWHMQRLAAVRL
                     SPSHTIQDAPDVDFQQPGDPTTDHYRQLYADRYAQQVRHDEAQIYAQNVKILHQLLLA
                     SDDMARKGRNMNLVPTSAQVCRFDNIEKQTEHRLRHRQMRQRQIAQENERLLLHLISV
                     SPSLRTAKELDTWYTTVHKKRVQQLSRFKPAEQFAGERVLKAATRKRLSHGCRYGAVA
                     APYPMTPELATAPPLLRGHPYPPLSIAEASRTAPASLLPAVRTTSYGGVPLVLEDSIG
                     SLGGADDCSGDATAAGYAADLHYSPKRLRGTPRPDWQPISATDIPLLHYAADLQLRRE
                     GGGGTSTRARGSGRAFSASYQRRGMYDPVHDTHRELNASGPQGHTTASSTVLRVTPSE
                     EGGVTQIWRHALQRRHDRVVAAQTDTNPYAAQPGRPFAPALQTRYEASADGGWKANDG
                     CFVQRCLPPQGPGGAPPLPLPQTVPAAQPGRRLVPAAPSEPFSSGYRRRRFSSPDSAS
                     PAPVPIQRSGSITTARATTSSQADRTTAAETAEASPWRLGSSRGAYAPI"
     gene            complement(<510153..>512240)
                     /locus_tag="LMJF_23_1035"
                     /db_xref="GeneID:5652096"
     mRNA            complement(<510153..>512240)
                     /locus_tag="LMJF_23_1035"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683395.1"
                     /db_xref="GeneID:5652096"
     CDS             complement(510153..512240)
                     /locus_tag="LMJF_23_1035"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683447.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1035"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1035"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652096"
                     /db_xref="UniProtKB/TrEMBL:Q4QB51"
                     /translation="MSADAHHAVRRLYVQLLHAQHGAHDVMEEEEPGPLPSGSTSVPT
                     NRSPLSTTTFLERNGTPEKTAPAPSPSSPAAVAVASYAPPAPSRHQPGPAASPAATAR
                     FASRVASGFSNARSSHLGWLKGWWRRRCHRYSKSPSTAVGSAALGGEEVTSTVEVRQW
                     TMRLGRTLRQRSFQVEEQLREMLAEHLRQCLKAGAISALTAPSEQGTPARFSAPLLPS
                     FLRVLSTGYAVTISVQNASGTEDGVRAQEAHDAGQNPFFSGLGKEASSKDDTSRDADN
                     PRQRGDAHEESAREADPKSPDIQAAPPRPPASKLVATTASAAATSAPKAAPSRKPSFQ
                     AQLKACQADLSQGWQSAGMPSNPLVPVRTAALCSRLNAHQTDAAGATANTDALANVSS
                     TTYLTQEQENSDTPAAARPPACTLWEYLPISSSLHISMSPAIEKDGKPVTAPAAFQST
                     TSQSPMDKLRVALCRSARKPALGIPQARSNAAEADKRAAAPKTAAHDPIALTTDGHWH
                     RLQAQMRAAQDVSRILLEDAASYYQDGRLKNGGTTTPAAAVSPSRQPPPLSAYAPFSH
                     ALLPGASEAEDSATVVVMVCYTAAPHDLDAVSWSTGACTGDTPAETSPSVSLQPTWVL
                     CFEVDALHEAWLRRTLLEVASREATSSPESVAAASTSPLLTPTHDRLDTTVSLTALRA
                     NVLASLQSMYACN"
     gene            complement(<512907..>514256)
                     /locus_tag="LMJF_23_1045"
                     /db_xref="GeneID:5652097"
     mRNA            complement(<512907..>514256)
                     /locus_tag="LMJF_23_1045"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683396.1"
                     /db_xref="GeneID:5652097"
     CDS             complement(512907..514256)
                     /locus_tag="LMJF_23_1045"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683448.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1045"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1045"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652097"
                     /db_xref="InterPro:IPR002698"
                     /db_xref="InterPro:IPR024185"
                     /db_xref="UniProtKB/TrEMBL:Q4QB50"
                     /translation="MQPIPIAHIKKVLRKEQLLRLRRWAKSEPAQVTAASQQICDHVY
                     EYILARYRPSATSAARGTSSSSLRVAESQGAPLPARLSPPPLLVLAYLPLYFEVDPVP
                     LMQRLWPIAHEQNIHILTPVVLPETMTALSTAGAAAVLSVELTPQPASSSVMSDLLPP
                     QHPAPRTLKSAMVFVEVLDERDLNTAFAPQGAYNIREFKASLLEPWLLGPSRPSAIGM
                     SAPLHSPSTLEGVKGDDEDDHAMLASCHGHHRHMVLCDAYARLFPEPHAAGYRPSGLL
                     EYRDDSEDPSTRLSPAVDEGAAHALGSLDDVSMLVLAPGVLFDVRTGSRLGKGGGFYD
                     RFLDYHGSVHRCRLPADSVPSRVGGQAEGDAARSVGVAVDAPPLAASGVPVPQWDVMA
                     LAFDDQVLRSSTTGTSARAIGVSDTSMPSRIPADTYDQPVHFVVSPSGGVEQVWQYQ"
     gene            complement(<514984..>516039)
                     /locus_tag="LMJF_23_1055"
                     /db_xref="GeneID:5652098"
     mRNA            complement(<514984..>516039)
                     /locus_tag="LMJF_23_1055"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683397.1"
                     /db_xref="GeneID:5652098"
     CDS             complement(514984..516039)
                     /locus_tag="LMJF_23_1055"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683449.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1055"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1055"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652098"
                     /db_xref="GOA:Q4QB49"
                     /db_xref="InterPro:IPR001310"
                     /db_xref="InterPro:IPR011146"
                     /db_xref="InterPro:IPR019808"
                     /db_xref="UniProtKB/TrEMBL:Q4QB49"
                     /translation="MSRRLTHPGASFNFSSPGDTAELCSTTADTHASADEPAANNNHA
                     YWHIVERVPGDFTPNNMIYHQLQRYHLAPAPSTTAAEAGEGGAVPDVFTALVRALQQK
                     PAQSPEEASAGLLTAEDTALAAATTAEKLQRDRLASKPDAQAHAAENLRQMHAYAAAS
                     VANTTPSTIIPEIKDGYRFTFYPFSISAAVSIPYCSQHFCVLVNLKPIAPNHLMVVPI
                     RCISTIHGLTEEEVDDWGRVMQCTIQVLEHLRRQRYSEGGAASSATPAVPPVGNYSIA
                     VQQGSLAGQTVEHLHVHVIPFDPQGRLAGEPEADEAEQRRRPPRTPAAMQAETDALRP
                     LFAQYTAAADSSSTAGL"
     gene            complement(<516827..>518281)
                     /locus_tag="LMJF_23_1065"
                     /db_xref="GeneID:5652099"
     mRNA            complement(<516827..>518281)
                     /locus_tag="LMJF_23_1065"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683398.1"
                     /db_xref="GeneID:5652099"
     CDS             complement(516827..518281)
                     /locus_tag="LMJF_23_1065"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683450.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1065"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1065"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652099"
                     /db_xref="InterPro:IPR018812"
                     /db_xref="UniProtKB/TrEMBL:Q4QB48"
                     /translation="MCSRVCACLRLCFSHPSSSFPSPLCNLLVALMVELHIFDFDGTI
                     FFSPVADPNALAAALVTSGDLGAEDAAAAAKRLHGELRCPVSSGGLGWYQSLSTLSPP
                     AVPERPAEATWFVEPILAHMRAIVKTRNSLTKERRPNVGTQPAAATVDMPLIYVLTGR
                     DVKYYDRIWTLLQQAGLDKEVEDVLLKPSETAGTVKYKLNRFFSLIQYHRPARVFYYE
                     DRVEQGRVLLEGMRALEEVLYRDVGDKHNGTTSGGNGYWKADRVGVVTFDVTGGAAED
                     TSTTTPPPLTSLNTPQPAVVPCAERDGATCQGTDGRHAHLSPIASSLRTSPYSLLRDA
                     CYPVDRRVLFGSSSPTDTLPEAKVSAALDQAERQARQWVERTVQFYNSKSACQDRGRG
                     QGRRPVVRGKQSSAAITTTASGSKADTAAVCDARALRAAVSFAVPPPFVFVMVLVPPA
                     LRGRSTSILSGEQLVAVLRTLEEEKRASDKATAA"
     gene            complement(<519085..>521103)
                     /locus_tag="LMJF_23_1090"
                     /db_xref="GeneID:5652100"
     mRNA            complement(<519085..>521103)
                     /locus_tag="LMJF_23_1090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683399.1"
                     /db_xref="GeneID:5652100"
     CDS             complement(519085..521103)
                     /locus_tag="LMJF_23_1090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683451.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652100"
                     /db_xref="GOA:Q4QB47"
                     /db_xref="InterPro:IPR021867"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4QB47"
                     /translation="MSSEKLQHARNGAGGDHESLSHAPLPESPSQAPALTSTSQSEAV
                     STEHLVWASLIKEQHRYLQAAVQSGVSGSGTAVTAMGALSCLTASAPPPSYREELKAW
                     RCTLTGEAAAQRLSAYAEAMHHLATLYWNPSATPLAGHSGGADDSGRARVEPGAHGGR
                     AGAFESTAPRLGEKRKRSSDTAGGVQTPPSAVVIGEAMPATVTATMSDTHSRHYSDRL
                     GYCLQSIASYYLGEAETEGCGEGTADGAPHAADCRPSAAAQSPSPPCFRVCVEQTRFR
                     QLPGVFARVVKPLRRLFFQRYGRMATEAEVGQLISVCTPSRDDSCSIAPKKSRAGSFS
                     CSSSSTDSSGGSTTAVCAARQLIDADVDARAIVEESTWRRSEHTAWATALHYTRGAPH
                     PTPTSAPAPLWTLDVGSCYGPFFGTILSRAAPLAPVPLHVTSMDLAPYQGAAGCDTGS
                     NGVPSPCVWRADWLQMEFFAEEPETDEAVRGCSTGVAFGTAEEGRVRYQRQRPASSLA
                     DGGGNSGLHPCDSREGSAGNAAQRSLAATAVRLESYDAVFFCLLLSYIPTPRLRFLAC
                     IHAFLALKEGGLLVIVSTRTQGPRRRNWMSEWTACLASIGFQRVQQSIQEKLVGMSFA
                     KVSPSAEVRRSWATAEGRAAWIESLMTSSAALEGLRITADDARSCADI"
     gene            complement(<522561..>524024)
                     /locus_tag="LMJF_23_1100"
                     /db_xref="GeneID:5652101"
     mRNA            complement(<522561..>524024)
                     /locus_tag="LMJF_23_1100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683400.1"
                     /db_xref="GeneID:5652101"
     CDS             complement(522561..524024)
                     /locus_tag="LMJF_23_1100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683452.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652101"
                     /db_xref="InterPro:IPR025875"
                     /db_xref="UniProtKB/TrEMBL:Q4QB46"
                     /translation="MLSQSSGTPFTGEIPDKETLHEVMRYMPYNRRTLTAMRCVSRPF
                     RSAVQSPQSPWAPHKEIMVSRYGQCIIFNAQEDEQGRSNYSLYSISSIGRKFRTHSAK
                     LLGRYHALVANGLSRLVLHHAPVENSFFEPLGALTNLRELELVSCRGVTSVGDASRIK
                     SLESLTIVFCPVEPDGVSGLHLSNLKKLTLRSCSKLSNLNAIDSETCASLVDVHVESC
                     GVYDDTSSAFFSDLSSNLRTLDLTATFIDTALTQIPKEALESLTTLLMSETPLHSMTL
                     NTLTTSLGKNLEHLSLDGCEEIADLSALGSLKKLRFLDVSRLNVLQDIECVAQCTQLE
                     MFRCAATDLNNITFLKNMEHLRVLDATNTALTDYTLIHLEESPELDTVVLTGCLYISS
                     INAFHQCPKIRRILCGRTAVTNEGVEMLTECATLEELDLKMTNVTDVNRLADCPSLKV
                     INVCGSIMMQDAIQRLLDKPSVEVICDSFEEGDYMDC"
     gene            complement(<529142..>531235)
                     /locus_tag="LMJF_23_1110"
                     /db_xref="GeneID:5652102"
     mRNA            complement(<529142..>531235)
                     /locus_tag="LMJF_23_1110"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683401.1"
                     /db_xref="GeneID:5652102"
     CDS             complement(529142..531235)
                     /locus_tag="LMJF_23_1110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683453.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652102"
                     /db_xref="UniProtKB/TrEMBL:Q4QB45"
                     /translation="MLYSPNDADERFCYSDATAGGGGVEREFLRVAASYVASPHEGPR
                     SAYYDFFAAHNATLWTVDSATRVATPMQLDVVYTFVNPRAPSFWRNLEARHVRFEQRR
                     YRDWEELRYSLRSLREFVLASDALAQYHHRHAADVRRLGELGYQVNMSDAGAADGVVS
                     LVRRVYLVLSDKDQVPAWLDTERFPELRVVMHADMFSAEEAAWVLPTLNSNVIESGLH
                     RIPGISRFFFYFNNDMIVGRQLSFFDLFRPLSPPRQMLEMAHLQQANVACDRRTAQPY
                     SDEKRVPLLFETIFNSDGYVRPPSRSTLAGIGAWLVPQSWCAELEDKLPTGRLVDRTL
                     RSLCRPAQFSKPELNSNNVLNRLARYYIQEELPGIVPSVEYAHMPRVVDREVLQTMLD
                     DPINGFAETVKEMRRAYLRSMNNFSPTHIYEPFALAMRRARTAALWCQSDERCVASLR
                     HMRPLTTRKWRRRRNTSCPGHPLEGGSQAIRLQHSDMLARWSSYEEKWLRRIATVPAS
                     LTKTAHNRLFRRSGSVQRTVTSVLASAPQRLYKPSQVVRTLLSERTASAPQKVSREMI
                     SGCRNRGSVDASRVESLVLDVHHHVSTTDLTFRFFIVEDFQRLAIILSRLEHFANNEA
                     NGSAPTAWRASMSPLFITVNDDLDSEVMNKQLRTSRLMGWNESHLTQAAFHRLLWLCS
                     HLAPQAPWERWLDPA"
     gene            complement(<533244..>535088)
                     /locus_tag="LMJF_23_1120"
                     /db_xref="GeneID:5652103"
     mRNA            complement(<533244..>535088)
                     /locus_tag="LMJF_23_1120"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683402.1"
                     /db_xref="GeneID:5652103"
     CDS             complement(533244..535088)
                     /locus_tag="LMJF_23_1120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683454.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652103"
                     /db_xref="UniProtKB/TrEMBL:Q4QB44"
                     /translation="MLYSPDNADERFCYSDATAGGGGVEREFLRVAASYVASPHEGPR
                     SAYYDFFAAHNATLWTVDSATRVATPMQLDVVYTFVNPRAPSFWRNLEARHVRFEQRR
                     YRDWEELRYSLRSLREFVLASDALAQYHHRHAADVRRLGELGYQVNMSDAGAADGVVS
                     LVRRVYLVLSDKDQVPAWLDTERFPELRVVMHADMFSAEEAAWVLPTLNSNVIESGLH
                     RIPGISRFFFYFNNDMIVGRQLSFFDLFRPLSPPRQSLHVYNLSRDSEGSTNASLASN
                     GTGRAALLLEPVLHSDTKYMGAKGEMTSSERMQVMRAREEVRSCMLEQVLPALNSKGR
                     SGEWPAKAVLLPSWATTRVLALPDPHYGVTPRGRGVSSHYYYNLSSIRLEGIGLSFVY
                     AHSPQLVDVEVYRGLNEVELFDFTKTRAAYEGEMHPYSPIDEYAVFEVAMMRGMERQL
                     WTPVWRAAPANAFTDVRDTIESWRAANVLSDSMDAARRVSWRLSSGGADMSMFGALYG
                     DTWGVQLPRPDFAVDLGYWWVRGAVQPVQPVRPSRRLAALKRLYAIPEVGTGDACGSE
                     LALWAARGDDHYYSVLYDMFHHTRRDETFLFEMIDSEMRALLLAAFRR"
     gene            complement(<536956..>538287)
                     /locus_tag="LMJF_23_1130"
                     /db_xref="GeneID:5652104"
     mRNA            complement(<536956..>538287)
                     /locus_tag="LMJF_23_1130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683403.1"
                     /db_xref="GeneID:5652104"
     CDS             complement(536956..538287)
                     /locus_tag="LMJF_23_1130"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683455.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652104"
                     /db_xref="InterPro:IPR001715"
                     /db_xref="UniProtKB/TrEMBL:Q4QB43"
                     /translation="MSARSAALSGRKELLQWLNKLCDADYPAVESLRDGAAYCTIVEA
                     AVNRAAQNCAATQSSEAPVAKSRADQAHVYLAKLDWSATAAVCENADPSRDSVSVREV
                     CFHNMRLLQDMLQECVPAEHRNTVDANRLATGKLQDHVVLLRWLYLFMSKVLAQYSKK
                     ALEKKAGVVAGTVEGVKLNRTVRLRSRQASSNDRRGARGLAQPHEDKIDLMKEENSTT
                     PRWLHAARSPPGASSRERTHRDRGDSARDSKSPFRTPIGPNGGPEAAHTSSRGGLPDA
                     GIRTSSTSARATPATDPAKGYVSESAQEVLRERTVHAHYTRGTIAVPQVFRSTLAHLR
                     DEVEELERQVLYAQERHNYHLTHRSSEGETDRALSVAAAKYDQDTSLGREGRETLSLE
                     ELGELLEERDRLAQQYATVDAVVTRALQSAGSQGKPIPPLLRDLVELLHPA"
     gene            complement(<539924..>543973)
                     /locus_tag="LMJF_23_1140"
                     /db_xref="GeneID:5652105"
     mRNA            complement(<539924..>543973)
                     /locus_tag="LMJF_23_1140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683404.1"
                     /db_xref="GeneID:5652105"
     CDS             complement(539924..543973)
                     /locus_tag="LMJF_23_1140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683456.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652105"
                     /db_xref="UniProtKB/TrEMBL:Q4QB42"
                     /translation="MKHINVETATREQLVDFIRRMHPQLQREQERVHELESQVSGLQA
                     FIHEKNAEIRELRMQSDRLTEKSASDEETISTLIKQMEEMRSVESPSSSVVPASATTV
                     VQRGRTAEHGKGKSHPSANAGGGEYTPETLQPLETVGNGDGGRSPALTPTPLKVNTES
                     ALAQVKSQNAAAAAIAGKMEEIAKLEKKVRELMEVNAFYSAIVSQHDQEEKVRMSQAL
                     ACRSEHSDDHVAGLQQEVERLQLRISTMAGHGEKLQRMIRAVECEKAALREENEALKR
                     ESMVLEAEMEEMTREYARARKSLVAAAAAAVQPSDSLERSFAFAEDVPQVRAASAPQH
                     GLAREPPSRGPTATVDAYSQQPDRRVSYLSTGPAPCVSPLARDGKQGMIGGVAPSAQT
                     ASSIATTQSHSRFAFRSLRPIRVRNPDAHERELLDRIHLYEEQFAQMEAFEADRQRSF
                     DEMERNRAELFVSMNSQLEKQRKEIHRLRKLHEETSLKSSVTAHPSRIHSFVSWPNRE
                     EEEERGSLRRRGSPSPVERCLTAVPIGSHSLRFVDSSDGLDTADDTTTAWANERENVF
                     SHECHGRQATSGASLVSFSPLDELMWLEKHERSNICVEAVEEELQLFVGMHAATVRLS
                     TGVLEAREAQLLRETTDLKKVVDALQTRVVDLEAQLVSTREAEKVVVGDATESEGMAM
                     AGAADADSPDTNLSHISTKLWKGKALHTALMALEAYGTVLKYHTESIKGFRLNSSGSE
                     EAAVSVEGCMDAEIARDLEEVKMALDAARFPPQLQRSFPQAVTPHLYDDSTASRTGGE
                     LLTTCQADTDACDGAEVVGAGSRDQTSLHPAPPQPFSLPTQTQITSSSFHTDSADREE
                     VMHGMAGIVGQVDVISYIPPDIFSNKQGVVRSPRNAVGSVNDGIQEDRMDEDSGSMVA
                     PSHDDAEKAVFMVTEAPGDDAVPLPLCTAEAVTDTSPFQDSLKEEHPQSLTATSGDGD
                     ASAGVNLSSEPRQAESSVSESARQDKEDDARREERLSDDSEDDSSMAHDNGTLNSTSL
                     LEVTAGEEAEFLAQLEKEMAKGGLEMVTEPIEAEDGMVASPGDRDINGGGEDREAGCG
                     ESQRAGSEVAATEASSTASVSPSPCGADGQQQSRRGGASQEKQELDPAVLEAELDEAA
                     SPAESSDGRAGKSAAASSLSPGREDVSEERSSSTSRPSTTSSSSSSSGAGTSTSMEGV
                     HCESAVECDHPAPQIPAPAAGPPLPLPPTSLEALFGAPAAIAASPSTRHDGDRQPFSA
                     SPALHPSARFPDPNVSPQIANLGHAMRPTTPPNSMFLPYAQQTSWGMYFSLPRSEDQQ
                     LQPAGGSKGPRSHGSRSEDDFEAGFDPFA"
     gene            complement(<546348..>548234)
                     /locus_tag="LMJF_23_1150"
                     /db_xref="GeneID:5652106"
     mRNA            complement(<546348..>548234)
                     /locus_tag="LMJF_23_1150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683405.1"
                     /db_xref="GeneID:5652106"
     CDS             complement(546348..548234)
                     /locus_tag="LMJF_23_1150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683457.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652106"
                     /db_xref="UniProtKB/TrEMBL:Q4QB41"
                     /translation="MLVKVLRKVRIVMTAPSSSTAAVDSTNELLDVMDSNVKNASTSS
                     IGSEILSASGRKRSSDLAPAPAAGAEKASATSEAALKPSTGPTESSYFTSAMAHGSFD
                     AVRKEMETQEKIIATLQRDNESLLREKKEILSRCKQLEHDFEHLEAKHSLLLSAQQDF
                     AVRSNMHTANDSAKIVNLQAQVEELQTNLETEKRRCALLLQERNDLAQSKSDTPSLVG
                     SAEITNVAVVREQQGRSEDIVAKLRESQRIHSIQKSTIDALHSEVTRLESERKVSHSR
                     ESNLLREVDSLRTQVRDLESALQQKKGGIRELMSSCQAGSANAQRLKKQETRIRLLEK
                     ALLEKDEFTKRAMEELRAEAKKVCERYQSTVAELRQRLEVPKDDPELQKRISTLEREN
                     LDLRRALGGASVSLAVESAQPVQKLATEPKHHTDVTDKADKPGGQALKAPGSHELEIT
                     HLHSVIERLRAEICEHKQRNITLQSKLDSIHAEWDARLAEMKTNFALQIQTLRSAHNE
                     ELSRLEASHQTQLLEISKCSKADRGDSLASRLSRIVEEKGYDASLIAIGERLCFLEKR
                     YCQKEEEKTHELLEMKRVAELEMKIQKEKTDLLLEQKNTQIKRFQVQLDELLAALSIL
                     QATS"
     gene            complement(<548639..>550144)
                     /locus_tag="LMJF_23_1155"
                     /db_xref="GeneID:5652107"
     mRNA            complement(<548639..>550144)
                     /locus_tag="LMJF_23_1155"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683406.1"
                     /db_xref="GeneID:5652107"
     CDS             complement(548639..550144)
                     /locus_tag="LMJF_23_1155"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683458.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1155"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1155"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652107"
                     /db_xref="UniProtKB/TrEMBL:Q4QB40"
                     /translation="MNWCLSRRWRFRLELLSASLLSRVHIGCHAEPRNNMSTTPAKNE
                     LASVHESIQITLSKIQEDSAKRSSQEQQLISSVASAKCLAGIFSAHSPTNDEVVRALK
                     SAGEEEQVEAECLQRYQQFVEAKKRCFTSVEADLRSVSKVLSGVLAASEKVEEPTSGD
                     CRAEVQENQCDGELLHLLRLWRTVVCLHDLVLGSLIKRGSDGSPCELQRFSAGEERSY
                     VRESALRNTVADTEKMLLAIRKRWRDLTEEAEAVRATAESMTPLPFSDEATLLIADEK
                     DEPLVASINQGLHELQQSSDRLRKKKVAVDEGAAALLEKVRNLSLQTAACRCSVEAFS
                     QRSREAADDANSLMSAKARALQELHRKAQECASEQGLLDRDVGSYKQLCALLVEWAEN
                     EKSEAERIVAAEQEYHSLVSKERAQQEKLRCLRLSIKNLESEVRDASTEKQRIVGEVQ
                     YLSKLVSNPTVVTQVLARASEECHPEREVTALHNYLRFVQKARLERHTSHE"
     gene            <555403..>555774
                     /locus_tag="LMJF_23_1160"
                     /db_xref="GeneID:5652108"
     mRNA            <555403..>555774
                     /locus_tag="LMJF_23_1160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683407.1"
                     /db_xref="GeneID:5652108"
     CDS             555403..555774
                     /locus_tag="LMJF_23_1160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683459.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652108"
                     /db_xref="UniProtKB/TrEMBL:Q4QB39"
                     /translation="MGSPYEYQPEVKWYHVLWDMRNKQFRQWYLKKKYRDMRIAYKYE
                     SHILYQKAGMGFLMAAVFMSIFSSDLAVAVFRWPTEDPNELLKSQVWQKYHNQLNERK
                     EYADKLLQDSNYIHRKNNPGE"
     gene            <556060..>557592
                     /gene="CRN12"
                     /locus_tag="LMJF_23_1165"
                     /db_xref="GeneID:5652109"
     mRNA            <556060..>557592
                     /gene="CRN12"
                     /locus_tag="LMJF_23_1165"
                     /product="putative coronin"
                     /transcript_id="XM_001683408.1"
                     /db_xref="GeneID:5652109"
     CDS             556060..557592
                     /gene="CRN12"
                     /locus_tag="LMJF_23_1165"
                     /codon_start=1
                     /product="putative coronin"
                     /protein_id="XP_001683460.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1165"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1165"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652109"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015048"
                     /db_xref="InterPro:IPR015049"
                     /db_xref="InterPro:IPR015505"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q4QB38"
                     /translation="MSVSRFRHSTGHVAKPQRHLLNVTSSTALWDGSNTISCNDKFVA
                     VPWQTFGGTAVFKHDTFGRLAPNPPLVLGQKGQIIDVKFDPFNDQKLFTASEDGSIFG
                     WGIPAEGLQSNILSPLVELKGHNKKCGIISFHPSANGVLASAGVDRVIKVWDVERGTA
                     VNTISSLSDYATGLEWNLRGSLFCVASRDKTLRVIDPRDCTVVSSVESHASARSQRCI
                     WCKRKDTIMTLGCSKSQQRQIKLWDTRKMESPYSVTELDQSSAAFIPMYDEDLNLLIL
                     GSKGENNVKCFELMNEGLTFSYEVNSNDPMKGLCMMPKWSLDVKKCEFGRLYQLTYHS
                     LFTIEMLLPRKQSCTEFQGDVFPSTFADHSAMSADEFFRGANADPREYDLSGMFDGHS
                     PRLMGGSTPSPEKLPVAVQAAKPLMEAPKGETTTGREKSSVSVPESSEATSAPSDDKT
                     EKHADPCADMTQRDILDKQRRLQELSEKVRTCHHEISALRKALHEKEAEMLQVLEDIQ
                     SI"
     gene            <558814..>559869
                     /locus_tag="LMJF_23_1190"
                     /db_xref="GeneID:5652110"
     mRNA            <558814..>559869
                     /locus_tag="LMJF_23_1190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683409.1"
                     /db_xref="GeneID:5652110"
     CDS             558814..559869
                     /locus_tag="LMJF_23_1190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683461.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652110"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:Q4QB37"
                     /translation="MYPGEYVPAGHNTLSSLRDELRSDLTAQSLKEAWMRVSGGMYFK
                     SIDDYYASVDGLDQEQLGEIVSALLPDLRKYEAQALVTKVLESLSKPADSPSRQLSRT
                     ITADAVGLDNAPGHYTNFLEWMGRMTETKAFKTEHALFEFSRRKFNREDVRVMFENYN
                     LMSKATLEADSTDSYSHFYTVLHDFSRKVAGEDTRHQIGVRIDPAEVDPETGIAVGHG
                     RADGQKYMFTALIRENRDHNGSVTLLGKPLSVAFDDKSWLMEMVLMPFDEAKLDFRDF
                     DVNLISEGKAMPSFANEIAAFACRMAVANAITKLLPLARIPLKKAGLLSVDRRREPGQ
                     FPGFVDGKKNKRKFAKR"
     gene            <560274..>560639
                     /locus_tag="LMJF_23_1180"
                     /db_xref="GeneID:5652111"
     mRNA            <560274..>560639
                     /locus_tag="LMJF_23_1180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683410.1"
                     /db_xref="GeneID:5652111"
     CDS             560274..560639
                     /locus_tag="LMJF_23_1180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683462.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652111"
                     /db_xref="InterPro:IPR018908"
                     /db_xref="UniProtKB/TrEMBL:Q4QB36"
                     /translation="MISLMLLAALLWGVTNPLLKHYSRGMASSGSAKDDALFLVRRPK
                     YLVAQAVNLSGSVVFFHSLREVDVSVGSIVVNSLAFVITVLMSVLVLREGLLRARTTA
                     GCLLVMVGTALCTYSSSAS"
     gene            <561260..>562888
                     /gene="MBAP2"
                     /locus_tag="LMJF_23_1170"
                     /db_xref="GeneID:5652112"
     mRNA            <561260..>562888
                     /gene="MBAP2"
                     /locus_tag="LMJF_23_1170"
                     /product="membrane-bound acid phosphatase 2"
                     /transcript_id="XM_001683411.1"
                     /db_xref="GeneID:5652112"
     CDS             561260..562888
                     /gene="MBAP2"
                     /locus_tag="LMJF_23_1170"
                     /codon_start=1
                     /product="membrane-bound acid phosphatase 2"
                     /protein_id="XP_001683463.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652112"
                     /db_xref="GOA:Q4QB35"
                     /db_xref="InterPro:IPR000560"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:Q4QB35"
                     /translation="MRQVLFLLLLAGLLLCMPALVTAAPDMKLVMVQLIHRHGARTAE
                     PSYNKTQICGDTPCGYLTWSGIEMLSKTGAFLRSRYNTDASVVSEPMFPSEDYDLDVA
                     FSRSTDVLRTLQSAESFLRGFFPNLTSLYPAIHTAPEQDDYILYTNYVPQFQFYWSLD
                     MAGVRAVCNPVVDRNFPDFNTLTTIAQEVYSEGYCSNFTRRTDCAFTLFDIAVSKEAI
                     GELDNYPKLKTNRDKLTQVAREHFARQYVYNRSDTRCFQQGSSGQPILQEFVKNIGAA
                     MAGSSRYKLYHYSAHDTTLSRIACSLQDTADDGLLPPFAQTLVLELLQSLSDSSYHVR
                     VLRGHTGQSPASGFEFAWEPDWQLKCMSASGQLYNASGNRCSVADFTRFVQWSAAPVG
                     SMGYCYLDEKYRQLRNCPEGGIEAGEAWQALSSGCQYYRKRCPSYSCDAGYMLDRLSL
                     QCVCVAPSCLPTFSTAAPGLPDGSPHGAANNTPARPSELSAGGTAAVAMGTFCIGALL
                     AAFVTAAVLLCCKHRKPPPSPRCESCKERHVGVH"
     gene            <564752..>566221
                     /locus_tag="LMJF_23_1200"
                     /db_xref="GeneID:5652113"
     mRNA            <564752..>566221
                     /locus_tag="LMJF_23_1200"
                     /product="S-adenosyl-methyltransferase mraW-like protein"
                     /transcript_id="XM_001683412.1"
                     /db_xref="GeneID:5652113"
     CDS             564752..566221
                     /locus_tag="LMJF_23_1200"
                     /EC_number="2.1.1.-"
                     /codon_start=1
                     /product="S-adenosyl-methyltransferase mraW-like protein"
                     /protein_id="XP_001683464.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652113"
                     /db_xref="GOA:Q4QB34"
                     /db_xref="InterPro:IPR002903"
                     /db_xref="InterPro:IPR023397"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4QB34"
                     /translation="MKRIVAPRRWSAINRVEHPPLMPKQLLQSVCGGLRWLESKSLAE
                     FLAKRAIEEGFPCTKKQQRIFDARPPSSRPALRKSRLHKKCPARRSGGDVQRTEGSLE
                     APRTTGASGALVSSGAALALNSSAFDALVPLAKRKRLVSYDVLDCTFGSGFHTGVVLE
                     NGRPYTRVVAMDCDVEATVSAREIVDEFGADRFRFYARPMSEAKAMFGERSFDAVMID
                     PGPSSTQLENPERGFLLNDESDHALDMRYGPTHGLGALEYLNTVPQHALSGALASYEL
                     LTPQQSMKLARAIRQRRPFDGAQRVLEAVEEAGNELPEEGWGTQGSRRKTSMSWNFMT
                     SLRCIVNHERHELSEALQNALLLLRTDGRLVVFSRLPWEEKLISTTISQHPHALLSYS
                     EAIPIEDVQEHGHSRHTKMWIVTRTQGSSYVLKNSQTLTGEAVQESSMRWMSGLFAGQ
                     TFGFPANNFTFENKDGKDWAAVRRNKNSPPFDSDDDPRG"
     gene            <567257..>568219
                     /locus_tag="LMJF_23_1210"
                     /db_xref="GeneID:5652114"
     mRNA            <567257..>568219
                     /locus_tag="LMJF_23_1210"
                     /product="sir2-family protein-like protein"
                     /transcript_id="XM_001683413.1"
                     /db_xref="GeneID:5652114"
     CDS             567257..568219
                     /locus_tag="LMJF_23_1210"
                     /codon_start=1
                     /product="sir2-family protein-like protein"
                     /protein_id="XP_001683465.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652114"
                     /db_xref="GOA:Q4QB33"
                     /db_xref="InterPro:IPR003000"
                     /db_xref="InterPro:IPR026587"
                     /db_xref="InterPro:IPR026590"
                     /db_xref="InterPro:IPR026591"
                     /db_xref="InterPro:IPR029035"
                     /translation="MRPAGTLASFLERCSARKRGRGCVVLTGAGCSTESGIPDYRGPN
                     GQYHRADFVLLTFQKFMRDDNEKRRYWARSMLGYSTMCGASCNAAHMALQAFTKSGAV
                     AHILTQNVDGLHHLATYGGVGDAEEEHYYKYTTSDAPLKELHGNIHNVICTSCGFFMP
                     RARLQRELRERNPGFYEQYGADVSRTRPDGDYSAPTEAVNAMHLVMCPRCNGFFKPHV
                     VLFGENVPKPIVEATMSLVRDKASCLLCLGTSLQVYSAYRYVLQANQLGIPVAIVNAG
                     TTRGDAIADLKLDVESVGSVLAETAHEMLGVPASMFFRRKTIQL"
     gene            <569633..>571288
                     /locus_tag="LMJF_23_1220"
                     /db_xref="GeneID:5652115"
     mRNA            <569633..>571288
                     /locus_tag="LMJF_23_1220"
                     /product="putative T-complex protein 1, gamma subunit"
                     /transcript_id="XM_001683414.1"
                     /db_xref="GeneID:5652115"
     CDS             569633..571288
                     /locus_tag="LMJF_23_1220"
                     /codon_start=1
                     /product="putative T-complex protein 1, gamma subunit"
                     /protein_id="XP_001683466.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652115"
                     /db_xref="GOA:Q4QB32"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012719"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:Q4QB32"
                     /translation="MNGQQPVIVMNQRVERESGRKAQMSNIEAAKTVASLISSTLGPC
                     AMLKMIIDPMGGTVLTNDGNCILREIDVVHPAAKHMLELARAQDEEVGDGTTSVIILT
                     GEILSLAQPLLERNIHPLKIVKGFTQALSDALAAVEKIATSIDPENKEQLEDVVRACL
                     GTKFNSREEELMCRMAVDATLRVVQVNPITGVKDIDIKRYAKVEKIPGGSITDSVVLD
                     GVMFNKDHIHSKMRRFIESPRILLLDCPLEYKKPETTINVEVTKDTDWEALLKQEEDY
                     VRSICNVIISFKPDVVITEKGASDLAAHFLYKAGITCIRRLRKTDNNRIARATSATIV
                     SRVEELTQEHIGKAGLFEIKKIGDEYFTFITGCPGGSACSILLRGASKDTLNEMERNL
                     HDAMCVARNIILEPRIVYGAASCEMSVSSTLMAKAKSIGGVEQAAYQAVAMALEVVPR
                     ILTSNCGANVIRVVTDLRARHTNPEGWYWGIDGHSGHIVDVRTIKVIEPAAVKVQALK
                     TAIEAASMILRVDDVVSGTKLREEKPTAKPQQQDEDPDGAAEP"
     gene            <573571..>573804
                     /locus_tag="LMJF_23_1230"
                     /db_xref="GeneID:5652116"
     mRNA            <573571..>573804
                     /locus_tag="LMJF_23_1230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683415.1"
                     /db_xref="GeneID:5652116"
     CDS             573571..573804
                     /locus_tag="LMJF_23_1230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683467.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652116"
                     /db_xref="UniProtKB/TrEMBL:Q4QB31"
                     /translation="MSAEREQEVLQMAERMQTKDTSTEVPVASFAYEILKAHPSVRDM
                     GLRERMDFLLKRWNRLSKAQKLDYVNDPLRGLL"
     gene            <574973..>577129
                     /locus_tag="LMJF_23_1240"
                     /db_xref="GeneID:5652117"
     mRNA            <574973..>577129
                     /locus_tag="LMJF_23_1240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683416.1"
                     /db_xref="GeneID:5652117"
     CDS             574973..577129
                     /locus_tag="LMJF_23_1240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683468.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652117"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="UniProtKB/TrEMBL:Q4QB30"
                     /translation="MLRRGIEPDVLMYTSLISTMGRAGLEWQAYKLFSRMIEQNIQPL
                     PETYVALRDATSRQRVALREQIQTKIEEAVDVFPEELARAERERQREEDRRCIAKFNE
                     YMRGVLPATTSSAPVSAPSLAAGGAVPEAEGTPSGDCAGAPPGASKTGAASSSGTIAT
                     MHIRNPTDAWNTTQMAQDVRSHAQSTAKGNTAVELRVSLERMDEEELRIYLAAQRQYR
                     HGTKTQLIDRVLKTVSASSIRAMLDRRCHYFRSVEQILAADLRQLNMSEPSDTTPVSN
                     ADAGARADAAQDRTLGNAEKDSLTPEVLYAPWGILRKPQRRCKEPAVSRNAERLERVR
                     LSEPELLLIHSKAGTNDLDELPESLLRRYAYQFQLRWRRKEGAASLLQAVQWHVTTYV
                     GSALQNGGEGAGAGDVLASPAPTPPIRLQKEAEGMRETLENYEAFRVIAQRTNNLQVV
                     DSKEINRHLQHVRQDAVRRERKMENALRRERHVMEAAGIAASAKSFTPTPTENGGEMQ
                     VLGVAAGTPLGGAGQDVVLEPTSSQSSALVESQSHCSGGEATGKGEDGATASELPPWA
                     LFEEEDEFNLSSGHFGDPEVGRFQELSDSRMQVLPSRTAQARWSVDRQLLPTSLKDVV
                     QEAELEQQRRREAIEKEYERRLQYTRYRKWDSMISKAQQKRRRQAQDDSEEEEEGAGV
                     AVKPLPAKRRLAQLLRKGRDRQKVSAAVLAKYNRSL"
     gene            <578473..>582531
                     /locus_tag="LMJF_23_1250"
                     /db_xref="GeneID:5652118"
     mRNA            <578473..>582531
                     /locus_tag="LMJF_23_1250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683417.1"
                     /db_xref="GeneID:5652118"
     CDS             578473..582531
                     /locus_tag="LMJF_23_1250"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683469.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652118"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR021656"
                     /db_xref="UniProtKB/TrEMBL:Q4QB29"
                     /translation="MAHSSTATRSARPPGTDWQDSYFTLEERYRRLQKRFHAQEQELK
                     LMKVAQRKKDAPSTGPSLSSVSARRLPQPALRSEPRYTEASQRNVEVSGPSSPRCFPT
                     PQNGNSGSAPAHTSLGISALPNRWVDYQISRADSINDSQQPSPPQAALYAQPSSSPNQ
                     PPVQQQPQPHGVEEYIAVPSAAAPQAARVAAIAEASAWGEAGALPDPAMVWGTDGRSS
                     MQNYVVASALYHANEELRRKLNESVTALQTLQQELGCSRAQHAALQTRLENVSAQLHQ
                     LVRERDLSSQKYTNASHTIADLERTLRDRISEEEKIRFSLESQITELRSRLVVGADSN
                     ELLQKDVRSLLSETRDRTAEVMKLRSNLALAESALSSQRHVNENMLVELKSLSTQLVE
                     ERKRLITVTREAHLSSLSGTRVEDLEQQLQRVQEERNAIEREHIKLMSDFVHITEDAL
                     GHAREEVRRDVADWKAAATHWEQVSQLLYKDIAERTQQHLQCRAECEEAQGQRDAAEL
                     QVRSLKGEVALLTAKLDVVWPSHATDAKDLTAEEILNVFGRKDRAGIFLFDERRRRRA
                     AALRRSGANDGEATGASATGETAAAAEEDDGGGGENAGFDLAAAVLGDLPADPTTVAC
                     QLQELHEANAALISEVHQLRLTNDLLQDRLDRLTGRQKEEQARVAAAEVSLQQRERAG
                     HQLLEKQLDRVAFLEAQVRSLRGYHVPANAPIGEVGENENIFELYLGQLVAAEVPEGI
                     EVPEMFSTMFCSADFLVHETVTTGTVRGFNGFFEVTASFCVSMDALLFYYLHTRQLLI
                     QLHRVRNAEEAAAMTLAAAAGAGDEETHLSATDAVDTGTTHSAHGASSSGSMHPCLRM
                     AEHMFETIAEGQVSLADIVLREDCLQSNRPTLKGHVHLVTPAGRHLASVEFRLTARRP
                     YSADFVRLVEKSVATAIAEGAAAASGKEAGDEHDASSHLLDWMRTTASTSLGAAEHRR
                     QESGQGPTLTPRHTRSAAKTTSTDPHLHTRHSRLQLVPVASADGDTSSTASSFFIQQQ
                     SRMAGTAGALVVHLPPPSPPPRQRWPSASSRGRREGSDVQAARHRGGGSPFSSRADHD
                     SDMERSPVSASFMHVDRSLLSAQPVVGGSGGEGSRVMRSAIQCLWVDVERLELPADLP
                     PPIPRLSCYFRVEAADVEVWLDAPPTPRYTWEYTLDVRDGRVGAYGASLPVRSVTQLA
                     SVLREPLVVFLLDADAMESTSAAAVTDPCVWAMAVCEWAQVVHRPNEPQSFALPLLRR
                     DQSVVHGAVLRLSLTASTIGARSSPPHAEPSPSQLHTTGLNTRSPPFIPPPPMSPPPP
                     PLPEELSPPRDLSMEEELLRLEYKDRTGRSFV"
     gene            583257..584282
                     /locus_tag="LMJF_23_ncRNA1"
                     /db_xref="GeneID:12980834"
     ncRNA           583257..584282
                     /ncRNA_class="other"
                     /locus_tag="LMJF_23_ncRNA1"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460436.1"
                     /db_xref="GeneID:12980834"
     gene            <585849..>590429
                     /locus_tag="LMJF_23_1260"
                     /db_xref="GeneID:5652119"
     mRNA            <585849..>590429
                     /locus_tag="LMJF_23_1260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683418.1"
                     /db_xref="GeneID:5652119"
     CDS             585849..590429
                     /locus_tag="LMJF_23_1260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683470.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652119"
                     /db_xref="GOA:Q4QB28"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR028267"
                     /db_xref="InterPro:IPR028268"
                     /db_xref="InterPro:IPR029451"
                     /db_xref="InterPro:IPR029453"
                     /db_xref="UniProtKB/TrEMBL:Q4QB28"
                     /translation="MATAGMHKEALELLQQYAVDLKDFPKARERYTTVIEKELVPLAQ
                     EEDNADVLAATRAAREQVRAAWEEYIASVQQYFNRVVRSTIRDLLDPGSSFIPVSTVT
                     FASETLLMTSSKDRSELNTGPLATATAVGSAESGRLLPSANSANVPAVGNSGGVGGDA
                     VAQLSRRAERMSDFCAVCEKWYVNSEVLFELPEPQALAALAASALASVSRLLRLLGMR
                     MAYVCAGNSLFLCRFIEDGEAVRWAAFCGDRGLNAEVDALLSLMERLMQLNIADPKAY
                     PRVPFGWLYRLSSLLEHPDSVASASPKRRSVAVRIALQLLRHRPDQATAAGLHSVLLN
                     ACIEPNGCVTPDEAQQVVQTFLNLFDAPSTRQYLKPTDLRTIFAPFLSTAKSGGTDLL
                     TMQNNAKELIVTIFSNCVGSLWISSEVTELRSIIDVLHLPGSLDTKMVIITLFNELLT
                     RLAPHRGIVPMDTWKGFEEDRLRKAARDAEEQAMEANDSGGDVCNDTQYLNNNSFMCD
                     LALTDATGDAALFDDFIPTTKALGYHVMDPLLGRVLVCLNYHGLPYALTQLMQNVNKN
                     RVVTTAASSLLQDIFVLMDTVLPQVIVFKLHEAFNKAVGRLANDGSLFVGGLTSQLFR
                     SYKKNSGIGGGASMIPTSTTQMPNTTLNTPGTLDVDDPTFATMLRDCKVDRMKGCQMW
                     NFDILVTLVQGPLHLSRRFRAARELMESLVLFFTPSSHSSTPQICSTFSTQPPDTVSP
                     QMCMVGVELIDLILSSRDGAALLEHMGFVAAVAAMLKEVRIGKPVILRRAVVNTCIGR
                     SLLRITGRLSAHANGLLLMRDHGIFSLVDSMFSKLKGPRLESPTEEDTLQDVCYQLLQ
                     YLYLGAVPNYGVCKDIRQTFRAALGNPSNTIRLCAAQQLKKAVWRDLSTSMKWGIETL
                     LQALHDDFFSVIESAFKLLLSICLCSDEGLDYLIECFPTVLMESEMILSHAKQLRLNV
                     LLYRIASRPSGFRFLQCYGWLEKELRRWEESESVRYTIMLERLQSYDDSAAVAGGPGG
                     AGGVLMSSTSDPSCRHAHSYSDTLGGMYGRMTGNTAYLPLLTTTDASSTKFFPVHFAS
                     VLCSSVEGCAMFKHSKLWTRSVQRLLEQPLPPDIVYDDSLSDEDDLLSENSSDGEFGL
                     TTDAARYMRQQQQSQQRQQQVHPSTNTAYCSGGVGGASVPALGALASSSSVPRYSVAG
                     DGPGNSLSVARVRDGLRGGPGTSLGSNNAGGGVNGNTSTAAANGSGGFCGFGVADQSS
                     IATAKEIETLKKGYLSAPSSKIISASRFCKSSGQSFSLDCVGDIVALKDAILCVAEVG
                     STEVGYGMLLSVPGLQRRFIALSRFASTISVRCMGLLGSAILARSRRGGDDLVKKGYS
                     VLLNPNAYVSAEGIPYSVSFAQMKPSKWVSIACMAAPNNTTARHAHADSIAPPNTQEV
                     PQRILENLYALSNPVSCENAKKTLYKIMKRKPQLFLQPQVRRLCLEISFTYRMHYKER
                     RFLADLLENAQLTDRTPTDPKPPRMQALRPSS"
     gene            <591230..>592039
                     /locus_tag="LMJF_23_1263"
                     /db_xref="GeneID:5652120"
     mRNA            <591230..>592039
                     /locus_tag="LMJF_23_1263"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683419.1"
                     /db_xref="GeneID:5652120"
     CDS             591230..592039
                     /locus_tag="LMJF_23_1263"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683471.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1263"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1263"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652120"
                     /db_xref="UniProtKB/TrEMBL:Q4QB27"
                     /translation="MPRAAHQAHASRSISVASSSSSAQSSSNELDSHRATPKRELASG
                     SRSARKAATLPPASSEAIQVTRMTADVTEGAAASMPHAPSKGVSTESEKRRQRTFFLG
                     ESEQFAFDFGGAVTEIADTVFEADAAQRAAQRVKELEDTTARVQAASASHATTAPRLL
                     TLEEVNAYAAEAMQQGPRRFLTLAKAGSRKRAATTTSSADAPQDESASVNSAPSTPQR
                     AGDENGATLAEAILQFQAALRRYEADLWRAHKQRREEEARQRSKNTRSQHA"
     gene            <592981..>594129
                     /locus_tag="LMJF_23_1267"
                     /db_xref="GeneID:5652121"
     mRNA            <592981..>594129
                     /locus_tag="LMJF_23_1267"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683420.1"
                     /db_xref="GeneID:5652121"
     CDS             592981..594129
                     /locus_tag="LMJF_23_1267"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683472.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1267"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1267"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652121"
                     /db_xref="UniProtKB/TrEMBL:Q4QB26"
                     /translation="MDVAMALYGRVIGALRRHQDVAIGAIILTLVLCVCVPLLVVVPE
                     SRPYGATFIAWGLAFALRAWRCLPRERVHMCRAAHRLADAKMRQRGVGKVLMPYTGAS
                     RLMPVASYSRGNRLPSCSSTEATTRCHGFLAIGSRSPTPTHQARVDMGDNDITANSSG
                     KTSGAAAGSAPSSCDLFLSASALESSAQFLALTHVASRQEPSSSITDRNAASVTPSGS
                     RSASGRRAPRRSHEPFTCMSRACALDFTTLSEHGSEVPSVEPASLSAMQPTTSSSSRM
                     HGCTGAAMTTVSLPQTPVVSGAVQSPAWLPAELARTFSDSKTPLSVCSQPSKVGPSYS
                     QMDTLSPPTYEEAVLSSSRSSSSPRIAVLSTTMRSQRLSPAVARDGAP"
     gene            595328..596320
                     /locus_tag="LMJF_23_ncRNA2"
                     /db_xref="GeneID:12980835"
     ncRNA           595328..596320
                     /ncRNA_class="other"
                     /locus_tag="LMJF_23_ncRNA2"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460437.1"
                     /db_xref="GeneID:12980835"
     gene            <598664..>601705
                     /locus_tag="LMJF_23_1270"
                     /db_xref="GeneID:5652122"
     mRNA            <598664..>601705
                     /locus_tag="LMJF_23_1270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683421.1"
                     /db_xref="GeneID:5652122"
     CDS             598664..601705
                     /locus_tag="LMJF_23_1270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683473.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652122"
                     /db_xref="GOA:Q4QB25"
                     /db_xref="InterPro:IPR006085"
                     /db_xref="InterPro:IPR006086"
                     /db_xref="InterPro:IPR020045"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:Q4QB25"
                     /translation="MGIKGLWQALREYVDDGHLSQFRGQRVAVDMYVWLHRCIHRSVR
                     IRTESVVAFFDAKYSGTLNNTEPDSLDGGGDAVACASPSPAPLSLDDVLVIDDQFLTL
                     VVDKVSALQRFGVIPVCVFDGAAMPMKGGTDEERQRRRVEAFQGALIKLERLYCDARR
                     RRGYTAEGHATGTRITLPRDSRPYEEAVQLLEKAVDISTELAHAVIQVLKEERHVECI
                     VAPYEADAQLAYLCREGYVAAAASEDSDLIAYYCPCVISKLDTFSGKCEVLQPPLCAP
                     HFFRRMAATSATASSAAALLLRSATVNRRAAADDDAIGHRRDCVNSAHAHMRAAALQS
                     LQRPHNSVNGVADVNSGEGTTSASIAATASAFTYESFLLGCILSGCDYVPNLRSIGVK
                     KAFKLVAHATSLRQCFTTLEREFGFPADELRRYRHRILEAFYCFAHHLVYSPLTQEIV
                     TYHPLPSSDSGVTAVLKTQLVGEVWCAQMAQEVCVQCLKDPCTLQLYEGVYQPCVTQY
                     LQRTRRGQTSLRAYTGFHEMSSNRVVVHLEKQRRDGSAISQRSPDKASFGAPLKKQRV
                     ASGFIGSSAAPPQSSSSSQQQAGMVVVRSRFFMVRGRTAVCEHWSTSETDSDGDADSG
                     GSGVHMLVPGRASLCPAEPVTDTSTGGHSPFASLAHRSSSPASLSTTKAANGSLTDDS
                     ANGVGAAAANTSCRTAGITVEEGMQEMRDGCSPSDAAQLDDTAENLSNSWMDVGGASA
                     SAASLLCATASTLSMRDSESRRDEECEVEGEHRAARTQVGREELRKICCMAETRDVEP
                     NTYEIAEGTGATAGAVGTHAASPAPPPPRCACPFGYWQCNRAHSVFESCFLGRQWSRD
                     EGPPPRPLPPEQPTARMPASAKGSSTAPPQSSPVSPLQRSAMSPVGKVASGYVPRAFR
                     PPRSTAAALAATLSASGNSPPVPLKDCDMKPKAEDLAMLRSSSKAELLTTAPLTSLPS
                     LMSPSSPTDGDPASSAAPRPLPSHAPAVRMGIFEKMLFKKT"
     gene            <604829..>608296
                     /locus_tag="LMJF_23_1280"
                     /db_xref="GeneID:5652123"
     mRNA            <604829..>608296
                     /locus_tag="LMJF_23_1280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683422.1"
                     /db_xref="GeneID:5652123"
     CDS             604829..608296
                     /locus_tag="LMJF_23_1280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683474.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652123"
                     /db_xref="UniProtKB/TrEMBL:Q4QB24"
                     /translation="MPLVVQQQHQHRAQGSSKEQGHTANAAAPTPVSAPERGTLASAE
                     TPTTGDAPGRRSGTADYSRLLTLAQPQLTASEATLFALFRGAQKERQLVRQQRLKEWQ
                     KRFVMEGGGRRSSATPILAPPLVTDPFLHLRGLEEPCLLIPDTRGTSVSLGLAADLHS
                     TTDAPTYPTSARATPDAAIMDGFHLGLTCISTDYRTDYASLPLYYVLGVPTALLSLLR
                     PSPSAGKHEFHESKIRDGVIDSGACTWRNRCQAPVDLSRWLVFDIATSQVLLRRRGVP
                     RTDEPPVPRCVSALETQVFLAHTYNFDPRSAYEAAVLQARVPAQPSAPTAGCRASASA
                     VGLSTMRMTSPPLYTLFFFTVARGQTTTNSGVSPIDAGLLYPTCFSSYMSEVPTTQQL
                     AAETAAAAQRLCLHHADTSKPPMLQSSVTGSGAADNSSFFVSMSGKRLRAYAGASSST
                     SANLWTAQLQSRKLGAMGDPAAEPSPSPFAKQAAQMTITYRAETESSAPRDQDGRGLC
                     RQITARQEMAESFRMWREAVATRVPSPPLRTSTSAAAVAGNSGCSRTPPPMTNGQQRL
                     PAPSPHPEHPPQRSKPTDSAPLSPASREQGREENHRSRLEEQLDTEGAALMSDGGAFT
                     QEWSTGFRFGRVAIEVAVPLLFPMPAVMADAAAAPSPLPPVPRGAQASGTDAVIDAPV
                     RVIDAPLADALWRALYTPAAATSASPPTPSTPFSSPPSFFSTTPDAAAAEAVMTAILP
                     TAEERLMLARERVLLPFLLHQPRWVLPGGDSLRALPSSSSRVSDTDDGPRAARERNRP
                     PPVNVCPSLWRLHELEQLCGWRRYRLPFNDVFGSFSRLLIHDLYIMIGRRTRAMLPGS
                     TSAATARAEQADRPQAPLSPLVLLNDAAYVERVLLPAMRCFSANTCTWADSGLCVYRS
                     PYEVLRTERRYVIEGGFAASKKPSTPSSSCVAPPQWRSQASCDGEPADSPAETASEVA
                     LHHRQLSLWLQQLQRVPHELLRRWLAECHGRTSLDPALDARVRMRTGGVPAACLVFFV
                     GSCSSAASTLSSRPSRAPYGGDDDDLRDSGAVAASAEAVEKGLQRLLSLTPDRIAVVP
                     LLDFVVWGALCSDFSAASVQHLTHAADRCRAALDAPADGLAAVKYCVRYPQHLCCNGG
                     RGTTVALLR"
     gene            <612103..>614175
                     /locus_tag="LMJF_23_1290"
                     /db_xref="GeneID:5652124"
     mRNA            <612103..>614175
                     /locus_tag="LMJF_23_1290"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683423.1"
                     /db_xref="GeneID:5652124"
     CDS             612103..614175
                     /locus_tag="LMJF_23_1290"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683475.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652124"
                     /db_xref="UniProtKB/TrEMBL:Q4QB23"
                     /translation="MHEALLSLHSSPESLLSADRRFCSTADRSIRRSTPQALQPPPPS
                     RLPRRATSSPLTSPSTTAAIESTSRAARHRGAPQGSTFYSVAAMNTQTQEALVTSHLR
                     TPDPRDSSTLDRSQCQSVDLPPKQRGSVRKRRGGGGMASEASFRCFRTGPGATLAKAA
                     GITRSAIASDEGDRSSVSGPGGPSSRNDTPLIIDYSSSPLTLAVNSANANNAIKNASS
                     ATSVDSVSISKPVRLSLTPPTPLVEMAPVSASSNTAQSKTSSSSSVVQPEVVATPLFL
                     MRQAPLKSPTGVSRHRSSRSRQDSCASLSAASTVSVEDPSCSHCSRRASSACSSCTDT
                     GVSGFPRPAFNRRVHFLLGDPAGGGLAAAEGLTASLRCSDEAGARLLLCPSTSSIAVP
                     TPSDADQRPAFSANSSSNSKSVLSASSESLHGHLQLGPSFGGAATRPALSSLSLNRSS
                     TPLVQSGGASVFSLHLHKKDGRIEATPSFAPAKSPGSSGMRATEVGGVCFHSAVSATT
                     ASATRIASSRSSTSGTHATATYQPGQPLPKPALKQVSRYSEGWSAADSRTGSKLVNEG
                     SDRWSWWRSNAAAGAGTTASGSPGPLSLTSVVDRRFTSYLQGALISRQRHRVNAAEEA
                     SATAGRAAVAGGVAARSPTAPSSVRTPGSRGRRAELLVRLWLVKWSLVGMVVLAAFFF
                     ILIELVAD"
     gene            <616425..>617333
                     /locus_tag="LMJF_23_1300"
                     /db_xref="GeneID:5652125"
     mRNA            <616425..>617333
                     /locus_tag="LMJF_23_1300"
                     /product="lathosterol oxidase-like protein"
                     /transcript_id="XM_001683424.1"
                     /db_xref="GeneID:5652125"
     CDS             616425..617333
                     /locus_tag="LMJF_23_1300"
                     /EC_number="1.14.19.20"
                     /codon_start=1
                     /product="lathosterol oxidase-like protein"
                     /protein_id="XP_001683476.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652125"
                     /db_xref="GOA:Q4QB22"
                     /db_xref="InterPro:IPR006694"
                     /db_xref="UniProtKB/TrEMBL:Q4QB22"
                     /translation="MDFAFRLFTSVIPVDREKMTHQMLVFWLILTSGGVSMYLLFASI
                     SYFTYFRKLKRQFFPKTIDPDDARELHEQVRQEIWIAVCSIPFMAFLMMPAVTFSHRG
                     YSKLYYNISDYGWAYFLMSPVLFFAFTDFMVYCFHRGLHHPIIYKHVHKLHHTYKYTT
                     PFSSHAFNPVDGFGQGVPYYVFVYLFPLHNILFLVLFLAVNFWTISIHDQVDFGGHFI
                     NTTGHHTIHHELSNCDYGQYTTVWDRLGGSYRPAEQTHQLSSLLHAGDPKYVDPVYES
                     YHEKKGFLAGRFKEEAAARRSKKVGA"
     gene            <620481..>634757
                     /locus_tag="LMJF_23_1310"
                     /db_xref="GeneID:5652126"
     mRNA            <620481..>634757
                     /locus_tag="LMJF_23_1310"
                     /product="putative dynein heavy chain"
                     /transcript_id="XM_001683425.1"
                     /db_xref="GeneID:5652126"
     CDS             620481..634757
                     /locus_tag="LMJF_23_1310"
                     /codon_start=1
                     /product="putative dynein heavy chain"
                     /protein_id="XP_001683477.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652126"
                     /db_xref="GOA:Q4QB21"
                     /db_xref="InterPro:IPR004273"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="InterPro:IPR013594"
                     /db_xref="InterPro:IPR013602"
                     /db_xref="InterPro:IPR024317"
                     /db_xref="InterPro:IPR024743"
                     /db_xref="InterPro:IPR026983"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QB21"
                     /translation="MAMTEANQDCVQWVERRLQDTLGCTIASELTDHHYFLINEFLMG
                     EDAQYRVLFAYYAEPAVTAAHQRRAAGGCRAFFNNGSSAKNFKLSSRRQTKGSDIGLN
                     RSHPVSDDEDCVDGTAASSYFAFAGAGGSRASNGSDLVVSSGPQPPQLQIVAGFPELA
                     LRGNLPGASTDVLYFVRLDAEKPLLRETLENYVMWGTLRGNYLLDSFLRTVRQTILPT
                     FLHNQWPTSIKKDVHTALHRFMATVVEDVNSLKGQTVLYVPGDLAAGAKSDTYADHEL
                     VQRYEATVIHWTRQIKAVVSQRDTTNTDDEGHAGPLEEIQYWRARARDLGSIRLQLNR
                     DDVAAVVKVLKDAKSFYYLEPFLGLRTDIERGTEEAYDNLRYLCTLIEPCKRLATAEL
                     RDIPLLVQDILKNVQLILIFSKFYKKEHITRLLRIVSSEIIGRCSSRINVRAIFAGDV
                     ADGMKALEESMVAGEAWLTECRRMLVATRRRFRVEKGEKLELDESFLNEMDGFVRHRC
                     QNLREICLSQLQFGFTGTADGESGGNGAVSMSIARCSNAVASYRGMSRRTKLSGLVRE
                     QIPAGAPLSVPELDGVIRPPASLFEGKLPIFRGNKGPELESQLMDIQRAFKAKMEVLR
                     HFTYNVLDVKATQWVDDYRALKTDIDNFAVMMRQIITAAFDAVATVSMGSEVIEAFTL
                     ISKSEELLMQLDRNTDRVFRLFTQHIKSVRADVQRYFGRVPPLFYRHPPLSGQAAWAA
                     NRLSFITCAHDALRRCYALPSSPEKDEAMHLYDRLDRTLREMVRKEYVQWTSEVPAKP
                     AELLDAYLLVQRPGTGIDLEHPPLYDVNFPINLLLLFSEAHNWQRMGETVPPEVAEMC
                     TREERLRLYRENVSMAVRLHNASVRSLSNAELRLFSLRIEAMDAKYVPGLNKLCWNSQ
                     GIVEYFVRECRVQADRVQAIVDDFKFCGTFIDYHCGLIAETLSVLVEKKVIYTPEAFV
                     EKQNAYRAAVVQKVRKIHELMVQKLYTVFQYFREDYMMSETVRVEWHDYMERVDVKVE
                     EALRMMVKRSLLTVERVLPQDSSEDRLDERVFRLSVMISVAADQKPVIHATPSVQELS
                     QLVNDVCKAIIGVVRGLPRLEESLQQRVSSETEALLTENNTVAVTYAHPGGATSLALR
                     GSYYEYMTRDQDTILTLGRIQEAFMSISEKVRDKLNQTWQLHQSSTTDNLWTTQRQDR
                     RIKQGWKLEDYRINMDHVAQRREGIEKQEVFSDVLFLQLDFTKMKETFRAQCQFVIQH
                     YHGLLYAEVKQELDNTYDSFNFTTEALSREPKTLDQLGEMMRQCTVALDALPSVEGQF
                     DMLSQKFALITSEAYNFGSVDPADVTRCEELPEAFVKYTQQLQAIRKQLDVYKEQFRV
                     EVETELRTLASKSFALYQQVRDEAPTSWALTTAAAFGQLETLERKAVSLRELEKSLQQ
                     GIEIFALEKPPLDDLVKAEAQLKVLRRLWTLVRSWRTFTHTWKHMYFMKLNSERMLDD
                     IEDTRREVLQLRKEMEQMDVWLRLKDDIDLIKKILPIIDDLRTPAIRPRHWEQLKVQL
                     DTAFELEDETSFCLQRLMEAHVEMQAEFISNMAIAAREELKIETDIEKIALVWEETCF
                     TIEPHQGYHKIAAVEDINTVLTEHLMMLSSMKMSRFVDSFRPRVVMWEKHLSQVADTI
                     EGLLSVQTKWMYLESIFIGSEDIKRKLVAESKKFDSIHAHWLSIIARLVSDPNVVRST
                     RRDNLLEQLNSMNSDLELIQRSLEGFLEDRRRCFPRFYFLSNDDLLEILGHTKDPEKV
                     QPHLRKCFEGLYRLALKEGRNNRVFAGGMSAVDGEEVPFSPPLQVDGLPVEVWLHRVE
                     VKMRDTIKSCLNTTLKDLQDNVYIPRRPINREKLRQWVEQHEGQALITAACMNWTFQT
                     EVAIAEYGDLHQNGLSLARRKPSPLYKVYKKWKSLIRKYCQMVREPQSRLQRNKLVAL
                     VTIEVHSRDILRHLLAHRVHLLEDFEWTRQLRFYQENAGSTSEVASEAGMSDAGAVIT
                     AGAGEPTCVVRQTSAVVRYDYEYLGNSGRLVVTGLTDRAYMTLTTALQLFRGGLPQGP
                     AGTGKTETVKDLGKAIGKYVMVFNCSDGLDYRSVGRMLSGIAQTGAWSCFDEFNRIEV
                     EVLSVVAQQIMSILSAVSEQKRHFLFEGTEIPLNVNCGLFVTMNPGYAGRSELPDNLK
                     ALLRPISMMVPDFTLICEITLLSEGFEESESLSKKVSILYELMEKQLSKQDHYDFSLR
                     NIKAVLVQAGNLKRENFPGTEQQLCLKAMKDMNLPKFVKEDVPLFLSMLGDLFPGVSP
                     QGAGLEELRAATVDELEAEKLQVSEHIITKCLHLWDTLHTRHGVMVVGRTASGKTITW
                     KTLAGALRRLKEAGVDGPYEAVRVSLLNPKSVTLDELYGSYNQATREWKDGILSDLMR
                     QICRDATDPNYKWLLFDGPVDTLWIESMNTVLDDNRMLTLNSGERINMNPTVRMLFEV
                     QDLSQASPATVSRCGMVYFSVEDLTWRPFVSTWLQLRRDFEVAMNAPKPDSTISELQT
                     FVDEALTRALQFKRSECVDLIPTTEFNTIRSFTTMLDALANTEAAPVMPGGTHYQAAQ
                     AGENYLPQLRMMAMFCLIWAVGGSLTADSRRKLDAFVREMDSSFPSMETVFEYFPDLS
                     SLRWVGWEEHPDVQKPFAPPSDTPYYEQIVPTVDVIRYSYIVSQLVLSSVQLVLVGTT
                     GTGKSLIANQVLHDLPADMYVATHLHFSAQTTAKNVQDIIEGRMEHTSKKVCNPPGGR
                     RMVCLIEDLNMPAKEIFGAQPPLELLRQWMDNGFWYDRTTRSKRLVNDMQLLCCMTYG
                     RPDITERLLSKLNVFNVAFPAESVVVRIYSAILGHRFTPYADLKGYVDAIVRATIEVY
                     MKVSNDLLPIPSKSHYLFTLRDLSKVFQGIYGCYLEGITSKEHLVALWVHESQRVFSD
                     RMNDPADKVWFRQLLNDKLNNVFQTKWANMLKARGKDSRGQALSESESPIFVDFLDGE
                     QDEMAKYKLVPSMEQLRQIVEEGLENYNTEPGARPMNLVFFADALEHLCRIHRVLRQP
                     QGNALLVGLGGSGRNSLSRLATYLAGYSMFTIEIHKKYDQERFHEDLRTLYKACGVKR
                     QQKVFYIADTQLVDSSFLEDLNNMLSAGEVPNLFAKDDLQQINDDVHKLALLSGCRDS
                     PDELYNFFVRQARQHLHLVIAMSPAHKLFRVRLRQFPALVSCTSIDWYYAWPNTALKE
                     VGLRYLRDSRDDSAESDELLETISDLFVFLHDTTNQRAEQMRVQIRRHTYVTPSSFID
                     LVRGFRSMLHSKRIDIIEQRDKLANGMSKLEETKVTVSEMREALKVQDERLQAKSAEV
                     SKATESIQARQHIAEEQQTLVASEKVKIEQTKRSALADQAEAQADLDRAMPTLLEAQA
                     ALDKLDKSDINEVKSYKTPAVMIRTVMEAVQTALHRKLDWDEAKKSLSEPKFIDMLKT
                     YHETHDMTDQKLLNALEKYVKRNDFTPAAASAVSKAAGGLCQWVIAIHKYGNIYKEVH
                     PKIVKNENAQQKVRAQEEMLRQKEEKLQRIVDEVRQLETDLQANIAEKNRLMAEARAT
                     QDKLNKAQIIVDGLEGERGRWTESIARFELDLENINGETLLACAFMCYCGAFTAEYRQ
                     LLWQSWMKEVRRVQLPLNRDYDFVNFLADPTEVLDWQQAGLPGDEFSRENGAVVVFGP
                     RYPLMIDPQQQAIKWVKRMERDNGLKVIDPKQPDFQKTVEYAIQFGCPLLLQDVLEEI
                     DPLLDPIMSRSFIMKGKRKLVKVGDNYVEFKEGFKLYITTRLPNPHYTPETCTKVCLL
                     NFAVKEQGLEEQLLKIVVEKEKPELEHENEQLILHTAAAKKEMKQLEEDILDLLSTSQ
                     VSLLENKRLIETLQTAKVTAANIQNQLQVAETTSVKIREAREEYRECARRASLLFFVL
                     ADLGAIDSMYQFALDSYIQLFQTSIRRSSEKIVSHEMEERIKTLNEWHTAAVYTNTCR
                     GLFEHHKLLFAFHMTMRILQTQGLVNIEEYVFMMRGAQMLDKQSRLPNPASAWLSERA
                     WDHVLELERLSAFHGIAAHFEQRPDEWRAWYLLERPEEALLPEEWETRCGGNALQRMI
                     FTRCLRPDRLIFMVYEFIEEQLGSQFVDPPVFNLKDTFDESTNTIPLIFVLSNGVDPT
                     KQLQSLAQREGRELKVLALGQGQGDNAKRALQEYSQTGGWVFLANCHLMVSWLVELEK
                     IIDAIFEQNPHRDFRLWLSSVPTPQFPIGVLQRSIKMTTEPPKGIKANMLRLYNTFSE
                     DDLATRSAEHPLIYRNLLYALCFFHSVLLERRKYGTLGYNVLYDFTSSDFDVSENIIQ
                     LYIGHMHSDAVEDVPFVTIRYLIAEASYGGRVTDDWDRRVLNTYMAQYMCPDAITQSR
                     YPLAAADEYCIPEDCNTLLAYKNHCSQLPITDPPEAFGQHANADIASRIAESTALLDC
                     LISVNTSLVRDGGGSSGGSAQAVTQEDRCLEILASIEEPSKAATPNLLDYTAIYESTE
                     GDRDNALSTCLLQEVQRYNALLKTIHRQKAELRRAVKGEIVMSEQLEAIFNALLLGRV
                     PPPWMSAYPSLKPLASWAVDLVERVDQMRLWSQRTPTVFWLSGFTYPTGFLKSLQQQQ
                     ARRDQISIDQYDWEYAILPSEERAIAHRPKKGAYVRGIFLEGAGWNGEANTLCEPKPM
                     ELIVSMPVIHFKPKLRSGKAKLASVYECPLYMYPIRTGTRERPSYVVAVDLESGDAVP
                     ETYTKRGTALLLSTDE"
     gene            <636224..>636793
                     /locus_tag="LMJF_23_1320"
                     /db_xref="GeneID:5652127"
     mRNA            <636224..>636793
                     /locus_tag="LMJF_23_1320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683426.1"
                     /db_xref="GeneID:5652127"
     CDS             636224..636793
                     /locus_tag="LMJF_23_1320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683478.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652127"
                     /db_xref="InterPro:IPR007372"
                     /db_xref="UniProtKB/TrEMBL:Q4QB20"
                     /translation="MAPMLGWGAKRMSSNSELKDVDMYVYVEPAGLLGRFLGRPLRFK
                     VQQFSFLVNRRERALQRVEVNADSLYPQCEVHMPSRFERVPLSFSEVERVTQRTRSYV
                     LDAPRYPLITYDVEADTSDAVKGTLSLHGASHTVECSKVVEGAELVVRCPVRLSQYHV
                     PPFKMWLGLFTQADTVEVETRIPAKVLKL"
     gene            <638001..>647291
                     /locus_tag="LMJF_23_1330"
                     /db_xref="GeneID:5652128"
     mRNA            <638001..>647291
                     /locus_tag="LMJF_23_1330"
                     /product="putative DNA polymerase zeta catalytic subunit"
                     /transcript_id="XM_001683427.1"
                     /db_xref="GeneID:5652128"
     CDS             638001..647291
                     /locus_tag="LMJF_23_1330"
                     /EC_number="2.7.7.7"
                     /codon_start=1
                     /product="putative DNA polymerase zeta catalytic subunit"
                     /protein_id="XP_001683479.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652128"
                     /db_xref="GOA:Q4QB19"
                     /db_xref="InterPro:IPR006134"
                     /db_xref="InterPro:IPR006172"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR017964"
                     /db_xref="InterPro:IPR023211"
                     /db_xref="UniProtKB/TrEMBL:Q4QB19"
                     /translation="MHMQVVSIEHSLERPHAALGDAALSPIFHRVSARCPVLHLFGYV
                     HIPLDLTPTTAGASALVASTEPCNASSSVPENELDGDAEIMAAATPHSFAHGSSGGGI
                     LRLSRATPLVGRLSGTPAPVQQEDASPSPKRVTYALDADGHRNNAAAAGAVARHCDAP
                     SSSFPPPCSNLCLATSAIGSDGDPLILTGGSLGSSAAWRGGYTQRRACLHVHGVYPSL
                     LLPQYDRNVSADQLAAQLEAVALRVLARQGTFVPTQQLVHNVHIVHRFNVYGYRPHAH
                     AFYEVELIDPDLLPRVVDVLQNSTEVGGRRWQLYDAHYRYHTQFMVRWRVSGIAPFPL
                     PAGRCHVRLPTAPELSENLPVLSASLEGVGRLQAHQHSRGSESDAAKRELKDKDEEEH
                     RQAAASFAQQSQLLFRQRWRPDELGRATTAEVELDVAGADLLDHSSAMEEEEAKGAAA
                     AAQGPRKTVKAGDNLSYTRRIIRHYFSEHGVSDTLRVADTIAMERHQQECAHVAAAES
                     KGQQGRYGHVMQIQRGDPTVRWLRHRMLEYLKERTEANAAVAAALAAPSAVRKTEDGG
                     EVSTAMCLASADAATASALPLPSATHLVESAAKLQDQRAIRQQLLAAYRQPGGATSRA
                     SRHGHRCGATDAMTTRAYSDGHVAVPLSLAHVADQESAIAGGEALYVGFSSESLQLSV
                     PQSQSQPQPQQPAAAPENAAGQPIPSSSAYQPFFDELSATAYADVAAAPTQDLFTALA
                     QPSAPSLPSQGAGLTTSVAAAVITTPRRSSVSSKKASEADSRNMRPMLETTRELASNA
                     DVTSACAAFDSITAAAPSSAVSSSSSWSSWSSALSSSSTASFSSGRTSPDHGNSCMEG
                     REGVGPSFFCSSAAQPRERAQGEPCLAALDAAALVRETPTQRLTQSSVGRSPRISEGR
                     GDDFAFDALDRIGDEAIRPSVGASQNDGSLPRLRRDTSRATLDELVGAEKDHTPEDGR
                     CCAGIAAAASPTTAPPTRLLTRHGLAEGDCVAFVHVRDVASSLRHGEVLAVARVAVLT
                     TETTELQWLLRLSETHLAAEEQALVRRGSWLRAQLPTAAATAAASTAPSMRDYHSHFA
                     GTACDVQLGEVVLSNVYDSVLTSVLEGDTQAAAPSAPTQQLPAGDLAVSAAHTLDMGE
                     IDLRVCETNPEEGSVSWQPRRHRPSDDAAAEVQVWRVHCFTDVAAYHSFAGPPDGRHR
                     PHAGHPSCSSPPLLRVLCRYAYHVDARVLTSVCPAVFTPDVRKFAVDGRSLPSSQRVS
                     SRGGQQLESGERGADAAAAHRLWRAGASSSRVLFTQPQPLLPLGDPRAHSRAAAASLT
                     SPPAPSSPPVEAPATLAKAPWLEASEDGCEDALLFPSSSASTGSSRGGGRDASKRRDE
                     VAAACAAHAAPLGLTLMPDTTLPQSSCEASAGLPSPSAAVQPPQDAADAAPPPAGKCL
                     WRVSLMRTPPPDFAVGRMRVLRGVQAVRHFAKHAFVSQGQARLRRRGASCTADGNRGA
                     AADAAAVGAIEEADTAPQLRFSKETADADGDGNGEPAIGATVSDGSRVNAARSGDTLA
                     AAGERRATEIVVLSAASSCAHSSSAAPMASLMVSSLTPPRSSSSSVDPVREVTASQRA
                     FLDLLQAGRHLDEGGARMVLLQRRGQLGCMVDGMRRCCAVSASGREGLLLSRGSGGGS
                     SGDWRVCVSAVAWPWTAATGVTSSDGALLPCRYEAVASFPAPSVSIAGASRGGRVAPA
                     AARATPTRRGAKQSLPLSVVSRRKSTSHAPGLSLSATQQPQHHLQCTLRVLYIEVLLH
                     HLLGEAPASASEVLAVGLGQATTATNSTIAVRVFCVAAPLRCSAARAATHPSAAGRPP
                     PLVGLTEAVQVVTMPDEAALLARVRGEILAYDPDILISWDGIKYGLGYLALRYRAVLQ
                     RNLASDLSRVLQHHGYQRTNANCGLHSAAAASASGGDAGVDSGAAERAFPSVAEEGPT
                     KSGRGGAEAGELAAARYRSRSLASHAAAPFTVRHGSSGGGGEPLPSQESVQSATAMAA
                     RSSVLSSAASSASWTAPLRDLDEGDDGVDGGGTDDVGTKGGACGRRGGALAGQTVEYR
                     EGGTMRWAHTGLQRNGQSPLLARPRAAVDLRAAASASALPAPAAAAADHYAKRFGTNM
                     HVVGRICTSLGRDLRKEIKMPSYSLSMVHVQLLGQPLPYFTDSYLSELFLTPQCADAL
                     GGGERHTALRYLASRVAAPHRIACKLRWFTRLLEFSRMYGILTKEVITRGSQFRVEAT
                     LLHFAHPLRYAMLSPSLSQVHRQPRIECIPLVMQPKSGLYRHDPVVVLDFRSLYPSLI
                     IAYNLCYSTCLGIVQPHSHGRLGVLPRFRQSNAALAELLPDDGTQHDGVVFSPNGAMF
                     VPPSTRVGLLPQMVQAVLDTRFEVQAALKHIAVPSGDITMQQRLQEQQLALKMLANVT
                     YGYTAASYTGRMPCVDLAEAIVSLGRQTLERTIELIHNTPAWRAEVVYGDTDSLFVRL
                     AGRTKADAFRIGQEMADAVTRSSPAPIRLQFEKVLLPCLLLVKKRYAGYMWSSPTQEA
                     PTFLAKGIEVVRRDQCPATAQLTDRLLRLLLDDASATVLRQSYYAAVERLQSGAANPL
                     QCIFRRAVKLGRYKDADDTHLPLAARLAFQQMEKDATQTPCWGERLPYVVVRSTTATN
                     KLTDKVLHPERLLQVHDTHSLDATYYIVRHVNRTLDRMFYLVGISFGRWYQAMPRRRT
                     AHAALLNLPTFMAAQQRQQQQLQGVVPPDARGAVPPLFSFDTVSAPLSPRSRQMRLGQ
                     LASLMEGLRHHHSSSGVLSALSGGAASAAATTAATAEEISDDEDPSDEAAQPKEVADL
                     TRPSTQEVIDVDQFATQRSNCPSSSLTDAAPPRRDRFLKPDLAASRSGRRKRWRTVTL
                     ESFYPRTLCVVCEEEAVSLNDISRQQAVLMRVGVVGCGAAASSRRCTTVAYPLPSTAP
                     AAPLPLPHRLPPICTRCWSDPLSLHLRVQQQCRSMNRQMNALQGLCARCISGGGDAGD
                     AAADDYRLAVADMEDMDAFCMSSTLTRHRNCPGHAYDGVDGSVPRHVLAAVELSAEGV
                     PRGCVSVDCAVGFQKKWVTTQRTQWQALQAFLNKVL"
     gene            <648162..>650243
                     /locus_tag="LMJF_23_1340"
                     /db_xref="GeneID:5652129"
     mRNA            <648162..>650243
                     /locus_tag="LMJF_23_1340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683428.1"
                     /db_xref="GeneID:5652129"
     CDS             648162..650243
                     /locus_tag="LMJF_23_1340"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683480.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652129"
                     /db_xref="UniProtKB/TrEMBL:Q4QB18"
                     /translation="MTTTSSIAPLDSASFLSTLLEPGRTVSLEDTTRTYAAMDVVERC
                     DVYDPSVPNVASSPRPATGDGAAQAELDGKSADGATTAPAYPIRAAHAQGRLWSHFAG
                     AQETVAQRGLSEGAAEPPTWFVQLCRDLYFRTDSGAADKRVTDDFDVVAQASDPLADQ
                     EAAEAARSAGSRRGVAAPPPLPAGSSSACTRAQRADDSVEVDPYVWLPFDLLDVKDYN
                     VGPYEFPPTATYTAEQQVKLCLGQRHREYVHFCNTYCFPERWQMPTSMGTQPARLLVD
                     PSCPTPVVFLQLSPDFPPAMWLPMKPSVTAIRGVLSSFAAQAFLHREEQHAVFAHRYE
                     TVKRVMELQQMPTTQEGDVLRFMAYEARNTPYLDAPLREYPNQQEFFLGEYDDPERLL
                     EHFDLCPFVFAISHLRAVTDLHAEHMTPTIEGAGVAPSLFRCIFSKALIQISVHLSAE
                     VKLPPQDPEAFHFMWKDSQVVPKMKIPVFARVSWPDNRNLCGGGLLARRFNKLFSTEF
                     ASDTPGDAILSVYYVMQWAQRVQDLLGVHGMRQRVAELEAAAHLPEPAKLYPGTREIP
                     NPEYTAQERLGMHIQYLSHLGDPQVLETIQALLPTASAPVRMGCAKAALIAGDRELFR
                     RIVSSEPPGRMQHYMTKLVVKRKTRDLVDPEPRLLEDQYEFAAPLWTKRGTRIDRNTL
                     EGAVDAARLLR"
     gene            <651125..>653239
                     /locus_tag="LMJF_23_1350"
                     /db_xref="GeneID:5652130"
     mRNA            <651125..>653239
                     /locus_tag="LMJF_23_1350"
                     /product="acetyltransferase-like protein"
                     /transcript_id="XM_001683429.1"
                     /db_xref="GeneID:5652130"
     CDS             651125..653239
                     /locus_tag="LMJF_23_1350"
                     /EC_number="2.3.1.48"
                     /codon_start=1
                     /product="acetyltransferase-like protein"
                     /protein_id="XP_001683481.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652130"
                     /db_xref="GOA:Q4QB17"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR023404"
                     /db_xref="UniProtKB/TrEMBL:Q4QB17"
                     /translation="MSDHADIDEAARKRLRAEAPFVSPLPLPPPAAPLLPCDASHNGE
                     SAEAAGHILVASAPPHKEDSVASTLHTSAKEARFEGRCMPPSFHSLLGEYEVPEEAKD
                     VEDLVGGHEDFSDLPEARREALLQSVRTLVKKAAGASSAEQLEHLRVKGSRLHGFKDT
                     ARKSELTAAYRQLVREGAIAENAVVEALLIRKKGKSHSGVLVVTVFMGPGEFSCPKDC
                     HYCPNQPGIARSYLLKEPGVLRGFRNGWDPISQFYDRASALENNGHVVDKIELIILGG
                     TFSFYPQRYAEEFMTASFYAANTYYDSAPLRPMRSLAEELTLNEGARCRIIGITAETR
                     PDYISARELRRFRSLGITRVQLGIQHLDDDILNLINRDCPTAKTVVAIQRLLDAGFKV
                     DAHWMPDLPGSSFEKDMELFETLFSAENESFQVDQWKVYPTATVPFTKISEWYAQGQY
                     KPYAELDNGAYMVKLLVYIMEHCPYRIRLNRIIRDIPTTYIMGGEKRCNLRQVIEAEM
                     RARHIRCKDIRERECKGNPVDRANTHLFTDEFRASEGTEFYLSVENKDRTQLYGHLRL
                     RLRDDASREESNILPVLRGCALVRELHTYGKLIAVSQQNTGRETQHVGVGTQLMREAE
                     RIAKERGYHRMAVIAGVGVRRYYAKLGYRLEDTYMVKELDEQASAITEDQVVQDDDNE
                     NSAYSSFLSTIKSFFGFHKNTP"
     gene            <654360..>655607
                     /locus_tag="LMJF_23_1360"
                     /db_xref="GeneID:5652131"
     mRNA            <654360..>655607
                     /locus_tag="LMJF_23_1360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683430.1"
                     /db_xref="GeneID:5652131"
     CDS             654360..655607
                     /locus_tag="LMJF_23_1360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683482.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652131"
                     /db_xref="UniProtKB/TrEMBL:Q4QB16"
                     /translation="MTRRASVIAPLSSTCALLSTTAPAGAPSLPTSFSAPLHTAQRHK
                     SFAATIQDMTIMRMGSSYKPGMYSSKDISSGPRAGIGHDPVFASFLLKKIVGPLRRKQ
                     SNSPEDFLNVDEAGKWMDAKNAAKVLGIKEEELPRLTKTTLEDAFRKEYKGRTNAHQE
                     EVVIATEVLLEYLDSSVYVKKSRQYYRKFLENARHEVDAELTREQRERNESLIWWFGI
                     AITCACAVVFFVAYSRKYVTRSDVASIGTKTAEYFVMTFLQPKNTEPKPDYNTRYFNT
                     PTSMELDKKNGRYAKQFLSTEEIRQAERSAAYEEQEEVEMLKLFNDERERSVRDRQDD
                     KARESRVSVYLPEKVEEAEQPAQSRDSSDKTAFEKLTFQEFSSMLASNFGGGSRCQRL
                     TEETSSRTERLNAARERIKSASS"
     gene            <658248..>659447
                     /locus_tag="LMJF_23_1370"
                     /db_xref="GeneID:5652132"
     mRNA            <658248..>659447
                     /locus_tag="LMJF_23_1370"
                     /product="mitochondrial carrier protein-like protein"
                     /transcript_id="XM_001683431.1"
                     /db_xref="GeneID:5652132"
     CDS             658248..659447
                     /locus_tag="LMJF_23_1370"
                     /codon_start=1
                     /product="mitochondrial carrier protein-like protein"
                     /protein_id="XP_001683483.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652132"
                     /db_xref="GOA:Q4QB15"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q4QB15"
                     /translation="MLVHTAQSSPGDYVEGHGSSSDTATPPAAAARHDTKLRPAKTAG
                     ADGGCRDYNSDALYANPEITALASSVATTVAKSLLHPLDTLKCRLQLLSTDMLEPPPC
                     QRYQSCTSKQSLGLLRSRLRQLRYQYAGQWTLGHIYGGLPLKLLLYVPYQATYVSSYN
                     FAQRTLEAAGREGEDAAGRRSKNYIWHTVASAVFAEVVSAGLRVPMETMKMRIQSAAA
                     SGSLHALRQLWRQGFASCVRLAVPQTLMHDIPYSIIQWVVYETLRPWSQQWKERAVQR
                     GRGAELMATSAAPTSFWSLYGAELARTFLSGGFSGLLASVLTVPLDNIRTRVVVATAR
                     DCHLTVADVVRDAYQREGMRGFVRGGSMRVLWVTANMACYFPLFEGVRSLLQRRGNGS
                     NDPGTSS"
     gene            <663774..>669419
                     /locus_tag="LMJF_23_1380"
                     /db_xref="GeneID:5652133"
     mRNA            <663774..>669419
                     /locus_tag="LMJF_23_1380"
                     /product="putative DNA polymerase theta"
                     /transcript_id="XM_001683432.1"
                     /db_xref="GeneID:5652133"
     CDS             663774..669419
                     /locus_tag="LMJF_23_1380"
                     /codon_start=1
                     /product="putative DNA polymerase theta"
                     /protein_id="XP_001683484.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652133"
                     /db_xref="GOA:Q4QB14"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QB14"
                     /translation="MTAPTITSPSTQSGKWFLSALEHEQRDYATAISPAPPSLQSPSL
                     LPPYRSPCHSGASEQVLPVPPAAPSTPKAAPSTPPSLPLPLLPCDSTSPLPPVPQLRV
                     HDLAALPLSSLSREASLLPSSSRRGLSVPLSSLRLECAESPLSPLLADSSPALAIDLM
                     REQAGALVTAAAAGGERQTLSSLASPDRSVGELARVQQQQQQASTRPSSALTAAEEAE
                     REECDEALEYEMAEDLRMSMDIAFTPSGTGSCAPPLFSQSSMMQEERQAEEEGGSEGA
                     TCIMRGSAVAVERAGDNSELRSSPAMSGQEGSAQPFFRFQDGAGDVLISGSTPPPSIA
                     IPAVLNEHALISGGTATADSSAAPPTSSLAVLPSAFAGLPSAPSTWPIREATPPHLPS
                     ELVPGTELLPLGVAVAADGGGGPSVGRMGPGRHRTVFSFSSLRVGTASAAALPDPFPE
                     PQPRLCQLSVATTTGQASAGSARNVAASVAEPATPVSSPPSEACATTHPPDLWLPSLP
                     TEHVSPPCDPLLMRVSSQGGKAEGCAAQSVFRMGVVAPTPTSLGSDVLSSATGVSALS
                     AANAAPPLSDLHVTALPYLATAAAGGSGAPAVPARPGRTCFTLHSAARTTGTLSSSAA
                     ATSTEEPTTAAASASTGAVPPALTEASYLSAEKCFFRGGTAELQQLPGHGAASPQGTE
                     GLMVSLDGVASATPSDTRKMPSSMESRHTTGCAQPVIANAQPALLRPVDSTPSTVVMH
                     RTPSTLTSEEPAWNRRSAPFPQPWPSLSDGQPPALLTVAAVTPLVGCMGAEAPTVAAP
                     QSAQAPAAHDETTQPYLRESREMVSYVPLAPPPPSPPLLRPAGTDDTAELFYGLPREV
                     GHFYATRRGVTSLYDWQHDVLTRPEVRQGGNFVYSLPTSGGKTLVAELSLLRCVLNRR
                     KSCFLVLPFVSLAEEKTMALQPLTTAYDFNVDGHYGSSGRFPLSGAPAVYVCTIEKAN
                     SLLNHMLEEGRTDEIGAVVVDELHMVGESGRGATLELFLSKVLVINAARQRKRDAVVA
                     PATQSRCSASGLRPGWPEELEDAEEDLHERAVMTDTAKAASDPGSLQIIGMSATVPNL
                     RTLAEWLRAAYFEYDFRPVPLHAYSVVGGLVLRDGQHNERNLSSDSVTQHLVELATEV
                     PDASVLIFCASRQQCVDTAKGIVNYLKAQAIAGQKVPSPWMSGSSDAAAEAQHVSVLG
                     VPFPSLTRGPVTAAAMAAVPPQASAAIKGLLADLEALAHHEASQLSEVIAFGVAFHHG
                     GLLAEERDLIETAFRRKHIRILCCTSTLAAGVNLPARRVIIKTPYVGREFLTKSRYLQ
                     MCGRAGRAGLDPYGESFLLLSSRDQARGHALMHAAVEPCSSKLLEDDQALTRSLLECV
                     GVGLVADFQSACEWSGSLLSRWAVGPVDASWQPHIAAAAAPAVPASTGVAPPGAAANG
                     TRESVTGLFLASGVGYDGDATAAQDSESSRSAPGPSASPPSHPASPASPPLTCVPPTA
                     MKAMVRASLVTLARCGFIRVACTRVGSGGSNGAITVNNTDTISTFTGTGAGTGGGDCA
                     AAGTTVGKDNGTASSASPETLPSSISDDAHADASAETQDACHAQVLVTSFGSSSVRSC
                     FSVEEALLLRAELDELRHTGLILSDDLHLCYFLTPLREVGKCDWELLRLMMSRMSDSR
                     QRIASLLGVDAYFVDQQAMGLGGPLQATEEGRRRLFTARRFYVALMLADVLAEVPMAT
                     VEQRYNVSRGQLQNLMRSASMFSSSITSFCHAMEWFSLEAVLSSFVKRLGFGVKPDLL
                     PLMEIRGMQPPRARALWSAGFKKLAAIAAADADDMVSKVKSMNPKDSKAAKFFTKRSA
                     LMAIREANLALQSQIKEKKGELQELTVCCGGGGGVRGAR"
     gene            <670226..>670723
                     /locus_tag="LMJF_23_1390"
                     /db_xref="GeneID:5652134"
     mRNA            <670226..>670723
                     /locus_tag="LMJF_23_1390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683433.1"
                     /db_xref="GeneID:5652134"
     CDS             670226..670723
                     /locus_tag="LMJF_23_1390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683485.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652134"
                     /db_xref="UniProtKB/TrEMBL:Q4QB13"
                     /translation="MLSSASSAFALWSACGIVALVCAFSTALLCVTVRQLCGRVNAMQ
                     HGAVAIALIPVSVFLGHVLCASYNALGETLQTFAKENVQGLPQPLVYVIVAIRPLVAQ
                     VGLTDAMWMACLLFTAYSVAKVWHHLIDITRLLKASRRRLQLPDMRERRRQEEAANTK
                     LQKRR"
     gene            <671400..>672041
                     /locus_tag="LMJF_23_1400"
                     /db_xref="GeneID:5652135"
     mRNA            <671400..>672041
                     /locus_tag="LMJF_23_1400"
                     /product="putative Ran-binding protein"
                     /transcript_id="XM_001683434.1"
                     /db_xref="GeneID:5652135"
     CDS             671400..672041
                     /locus_tag="LMJF_23_1400"
                     /codon_start=1
                     /product="putative Ran-binding protein"
                     /protein_id="XP_001683486.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652135"
                     /db_xref="InterPro:IPR007681"
                     /db_xref="InterPro:IPR016123"
                     /db_xref="UniProtKB/TrEMBL:Q4QB12"
                     /translation="MAATRTVDLYGGAMRISLPQTMIDVSDFRQVPDNQEVYTDADTG
                     ASVIVELLRRQTHVCNSEAGAFFYHDLAKDNGCAPGSISQEATCTLPPSAYPLLATSA
                     APAAPAECGLVAPQSCDFACLTTGLQRISKYTNEKGKDNEVFVGLAVLRFTPPVSTEI
                     LVSVSCPAWLHPESSEARVVKRLLTEQERLLLLHTAVASLEVVEWGLFVPEEE"
     gene            672913..673907
                     /locus_tag="LMJF_23_1405"
                     /pseudo
                     /db_xref="GeneID:12981177"
     misc_feature    672913..673907
                     /locus_tag="LMJF_23_1405"
                     /pseudo
                     /db_xref="GeneID:12981177"
                     /db_xref="PSEUDO:CAJ04925.2"
     gene            <675679..>676422
                     /locus_tag="LMJF_23_1410"
                     /db_xref="GeneID:5652137"
     mRNA            <675679..>676422
                     /locus_tag="LMJF_23_1410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683436.1"
                     /db_xref="GeneID:5652137"
     CDS             675679..676422
                     /locus_tag="LMJF_23_1410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683488.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652137"
                     /db_xref="GOA:Q4QB10"
                     /db_xref="InterPro:IPR001041"
                     /db_xref="InterPro:IPR004489"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR025192"
                     /db_xref="UniProtKB/TrEMBL:Q4QB10"
                     /translation="MLRKVAPRPYKTMVRRMAATDAAAEPHAKKAVLQLVRFDPETNS
                     SRVESYEYDKHHEYMVLDLLIAVKAHQDPTLAFRSSCCEGVCGSCAMNINGINSLACI
                     TFAQQVTTVAPLPNFPVIKDFVVDLRHFFQQYAYIRPFVRNASLHRSQVDSIMERYNN
                     VARVLSGVSPSEGQALERAQEELASVQKRETTVAALLRIADAAVDAGNATQALSVLEK
                     VEQQGVVLDSTKVTEMIERALKNFAAKSN"
     gene            <678869..>679834
                     /locus_tag="LMJF_23_1420"
                     /db_xref="GeneID:5652138"
     mRNA            <678869..>679834
                     /locus_tag="LMJF_23_1420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683437.1"
                     /db_xref="GeneID:5652138"
     CDS             678869..679834
                     /locus_tag="LMJF_23_1420"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683489.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652138"
                     /db_xref="GOA:Q4QB09"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="UniProtKB/TrEMBL:Q4QB09"
                     /translation="MCEGNIHTVRPRTCSGWCALACCYIPCVVAIALIAANVIPYHLC
                     FLRRLRAACEIGNASFVYYYYCVVVMVLAEVMVYGNFLLAIFTCPGFVPHEPWSEAPV
                     YQGRSVSDNPYEVFELDRAGRLRYCSFCKQFKPDQAHHCHTCHCCVYRMDHHCPWINN
                     CIGRGNSKFFLLFVGYIPVGAFHIVLTSLFSCVFHFPKFFDTTLQDDNILQSMVIILS
                     IIFSTVMGICFLAFALHFTCMAYRGQTSVSRMILSKKHPDELEQARKRQAEDRAFYMF
                     DLFGSDQQWYRMILPFKPDHDLRHAPHGYARRFGGSADVFFMSPV"
     gene            <680924..>682276
                     /locus_tag="LMJF_23_1430"
                     /db_xref="GeneID:5652139"
     mRNA            <680924..>682276
                     /locus_tag="LMJF_23_1430"
                     /product="DHHC zinc finger domain-like protein"
                     /transcript_id="XM_001683438.1"
                     /db_xref="GeneID:5652139"
     CDS             680924..682276
                     /locus_tag="LMJF_23_1430"
                     /codon_start=1
                     /product="DHHC zinc finger domain-like protein"
                     /protein_id="XP_001683490.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652139"
                     /db_xref="GOA:Q4QB08"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="UniProtKB/TrEMBL:Q4QB08"
                     /translation="MMCCGYLTPVVVAIMIMALALASDAYSIRLISLHRHDTWRIIVC
                     LVVFISTTVMGLLILWSYYAVIFGSPGFVPRDPWAHPPLYAAPSLRLHGGVEQAFALQ
                     FSHHPPHQQLHPPGLHQPQADSPDSLAMRPSSLPGVGRQQVANSVLAPAPFDNTDGAS
                     PLCAGHPQSLSVIASAAEVDKGACTALLTAGNTGAPRGGDGSDAIIVRVDEASPTRFQ
                     HASPPGYFCAPLARSPEQQQHRNPPTCLNPYTVATLDRSGRLRFCYVCQLYKPDGAHH
                     CGVCGRCVYNFDHHCPFVNNCVGRNNYKLFMVFLLYGSVGATLGGCLMLVTIFAVDND
                     AITDKLVWVAVPALDLIFGAALLIFYSQHCLLLRNGQSTLESLIEAEKDPCSGSCCAC
                     KRPRLTPEQKEEEARQRREKIERHQRTLMGKESPCWRRYAPLPVRTDDTADDTLPGTA
                     "
     gene            <684428..>686338
                     /locus_tag="LMJF_23_1670"
                     /db_xref="GeneID:5652140"
     mRNA            <684428..>686338
                     /locus_tag="LMJF_23_1670"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683439.1"
                     /db_xref="GeneID:5652140"
     CDS             684428..686338
                     /locus_tag="LMJF_23_1670"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683491.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652140"
                     /db_xref="GOA:Q4QB07"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="UniProtKB/TrEMBL:Q4QB07"
                     /translation="MPTPTVHRGPRVRSWRALWNLLAAYRLPLIIFLSATALIWGYNI
                     FFCRLLRAVREAETTGVLPLEAMSLLQAQRHTLGYTATGTCAVCALTLGNALVALMYW
                     SLARVIFTCPGYVPAEPWRYTPRFDAERRHHLKVTWSAQRKCIQEQGVAARQRALQAL
                     QEQQALWAYQLHMLQQQQPPHAYPSPASGLITALGPPFASAVTPGLFPAPNDASRSDS
                     LLMAAPTPQQPFSPQLAAAGSCVISCTPALAVDASLSVGMANIAANSAKAAVLCSGPA
                     APQRACAASGTAPSSTLSPSATETTATAITTTATTASSFCSASSSSASGSATPVTSTS
                     SRGSTGARGPHGSSTSCDAAPPALSPHRRPCTAIAAAKPTVNPNLVLEYEADGSLRFC
                     GVCHQYKPDGSHHCRVCEHCVFDMDHHCHFLNNCIGRHNYKYFFLCIFYSTLGGAVNS
                     MLFVTVYGCSVVCHDWGHGWWWVPAGMCAISVCIAYLWVQHIFLLIRGVSTLERMTEL
                     SSEHFLMSVSEPGLSQVVRPGSCCSDCGMAIGECVHGIEALGERLVAPLGCNSKSRRL
                     YKTTASFLTSSGRGDGEGGAPSAPSARAERRAQRFVLLFGLPRCCLYHLLPLPPPGES
                     SQQRARSREGEV"
     gene            <688456..>693153
                     /locus_tag="LMJF_23_1680"
                     /db_xref="GeneID:5652141"
     mRNA            <688456..>693153
                     /locus_tag="LMJF_23_1680"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683440.1"
                     /db_xref="GeneID:5652141"
     CDS             688456..693153
                     /locus_tag="LMJF_23_1680"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683492.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652141"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:Q4QB06"
                     /translation="MLNAQSSRLRRHTSSTMLTPEQMHALVKSPPPLLSGPSTRPAAE
                     TVAAAAMVVSSQPKARTTTDANNIAAPHEGRTKCEPTDRSTAATVTHTASTSARSTDP
                     SMLTVRNGALYARRPNDSCFNDDWFRQFHIKADSAAQPRLDDSEEALLTALEKETAVR
                     EARLERRSRDIRKKLAEPSRDPAGHIYPPPPPVTQATSETEIHERAMAAEEFAKTLLQ
                     RRRHGEERDRRQRQRERHGTSRSPLMRLGTVSDNNTVFSDTTFLNTQCRDGVDVNDAE
                     AVEGHTMSHASSSGRLLTRGSCEAEEPHEASEMSMASLALGRMSLRSCSVNKVTDSAL
                     AIMEMLANRPDVVLPSPAETAVVRRGDVLSAKHILKRDLEEALRSRQGSTGMIAGAPF
                     FRIVPKLNIAGVAQANASAVRTIVNELRRAHVEGPIVWVNLREEPLVYINDTSYIVRE
                     RADPLTPIIIPNVTGLSIECIERKLKQEVLQEAYENGGNVSVHLECCGGNMEDQWVCA
                     SRSEVLTLAEVFHRVEKETDHQVMYFRRPITQNIGPQPEDFDFVLDACLEEPKAVFVF
                     SCQSGRGRTSSMMQIANIVRFYQLCVKDVTADMRVLREKVNGPSYRTIQKLVSLFPDG
                     KLHERRLMILMELADKVYSMADHINEAFSGMNDAPEVAKMRLQVYALFLVFSYYCEQR
                     LWNYSTRLSFTQWLNENSEMKLLIGSVREKLDDQLKLERVFSLSSGGPEADALRAIRH
                     RRGNVLSTGRILLSLPMSNHSRHEIMALRQLAPGVPVLTCGRVGEVARDQLVCDIRDT
                     FPHVRSIHWISLRAEPMVLINEVPYTLSDYDAAHGSAEHGATMHVSVQAMEQIEDRLR
                     RDVLLEAQDNGGFIILHRLTTAGEREVLRVKVVSARTPRSTMEEFVEATGVCYSRIPM
                     PFSGELLASDIDPLLHYLAKADINQHDAIVINDSAGTTRTTVALNILTLFRASRLENL
                     RSLQTTEEVATLLRVGATDRLVGNAQVAARAEVPSEEIPEHHVELLLASTICQMLTAG
                     RLLRTVDAVIALGGRGRCWNILHALDFLKKRIGVLGNNKSQCIVDALHGLRCYLLVLL
                     SCLYLDAQKGEGFTIGELLFSDWVTAHAEVSNIVEHLEDRGEAALEYVAADNLMKADL
                     SRRSGNVLTANFCLKADHFPGCQKKGLRPALCGAPNFRKVDFLNVYGVAIPTLKGIHN
                     VLSLLGASSEPLQVYPGQSNDSEPYIGFAAQRLFEPAFKPEELQHPLRGSVVWVNLRE
                     EPILYVGDRPFVFRDLAAPYVNVVLTGIQTEKVELVEYELKRDVLTEAAQYDGKFLVH
                     DEGNPGELVGVWESANEDTVKTLREVYDELVVKQFRCQMLRLPVTDEQSPEIRDFDLL
                     VNALLPRIAKHLDRRETLSFVFNCQMGRGRTTTGMVICCLLIGLVIPEYYDELHSAYR
                     DSLYADTESHLGRGEYSVIVQLKRVLAQGRTAKYQVDLVLEACSKMQNLRTAIEAFAI
                     AVSSPDTIESGRARAHHAGVHYLKRYFNLIVFAVYLQEEYDRISKCMRHSFKDWMATH
                     PEIFTLFDSCVLK"
     gene            <694747..>695604
                     /locus_tag="LMJF_23_1690"
                     /db_xref="GeneID:5652142"
     mRNA            <694747..>695604
                     /locus_tag="LMJF_23_1690"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683441.1"
                     /db_xref="GeneID:5652142"
     CDS             694747..695604
                     /locus_tag="LMJF_23_1690"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683493.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652142"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QB05"
                     /translation="MASAAYYKKQQAQLHLAKSEMQAIMEKLVAAVAQSRPRSPLRAM
                     LQTLDRIEEEGIGSASAAANIAPPLVTPRLIILTGPPGCGKSVQASHVAAFLGGVHCA
                     LPSLVRDAFSGGRLPGSKVVYVPESLQAELRAAKEAFARQTLAAATASSFLSSLPPDL
                     AARLVVNRIQYETGQRQAAADTVSTPEVQRPTSTVFFVLDGYPSTIAEALALEAATGQ
                     EISVAVTLRCPADCLQARRRSPAPPARLASLGTFEAYWSAQHKLQVVDGAQSIAAVTR
                     QVLAALEEE"
     gene            <696572..>697447
                     /locus_tag="LMJF_23_1700"
                     /db_xref="GeneID:5652143"
     mRNA            <696572..>697447
                     /locus_tag="LMJF_23_1700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683442.1"
                     /db_xref="GeneID:5652143"
     CDS             696572..697447
                     /locus_tag="LMJF_23_1700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683494.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652143"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4QB04"
                     /translation="MSRLVIDSGACVRLWRFCPAPAPLTSNESLIRYASLGHGAPSEF
                     RAHSGTKDMADLPFQWDDGNCISPFVASSEADTEAFAAWLTERYLSPIVQHITASSRG
                     CAHQLCAVSQPHEMRLTDLGCGDAAAALTLVQHLRKGWCTLQGATADAPSPDGASCLR
                     ILLTGIDLDDALLDTAAANMSAFTAAAASPLSSLVSIETHLLSQDIRAADLNVCFPRC
                     VQGGAASFCAPTRPPYVLYMYLLPDALALLREKLVDIMERGWVVASNRWPIPGLEAFL
                     RDRAGNVHIYLHAAL"
     gene            <698235..>700274
                     /locus_tag="LMJF_23_1710"
                     /db_xref="GeneID:5652144"
     mRNA            <698235..>700274
                     /locus_tag="LMJF_23_1710"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683443.1"
                     /db_xref="GeneID:5652144"
     CDS             698235..700274
                     /locus_tag="LMJF_23_1710"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683495.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652144"
                     /db_xref="InterPro:IPR010796"
                     /db_xref="UniProtKB/TrEMBL:Q4QB03"
                     /translation="MNVFHFASSQRYRSRLPLRQLTFTVAVYRAIVVEEDKAELLVEA
                     TVGWDGKVLSPAETLSIYKDVTHLSRREAAGTAPHSDKSGGQRGASAVGLEGAPPVSS
                     PAIVPAPAPGPLLPNIPSLPALSDAIARISRLPFSFFTRPSLEDFINQAEEDVPVDPS
                     PGPSLLAPIVLRQHRRDHQPNRCMFLMWAAGELLVRGRTLGAASPGPVGGADGVAGGD
                     SADGGSHAAASLTAHPTTGVAFAPPSAVGAVAEAESSIDIDDVTWSGNERVLCTLTAE
                     QDEYFFTAKPSLNKLHTLFVDAAYIYTFRVTVARAGALVGQREPWAGGGTRQGVPIDG
                     CLLPSSIAPLEVLLANVRDLAQSVAEQYESLEVGKVAVARRLLRQVAMMAPLERVGTD
                     GGAAAAAAAAASVSSSSEVARRRRGQGALGPGMSFSAAADRTGVRGIMGTLTSSSRSQ
                     RAASFRAALLSPAGYKRSASMLPRGSCQYHIFGTVDRCVGISEWTLFVRCQLVEDEAV
                     TPSMYDPLPTSSSSSSSAVCAFTSQLAHASTFVEGEFLLDVDHIFNLPFDHSFVGPAL
                     PSSPLRLIATAFTEGAAAEGLQAPVAYACVSLPIASPGHHTVTAPMWAPHKTGVEFLR
                     STLVGGAPGLVDARQAGPALAHRTGLNVKEGLYADSVGTLHITVNVIHHKHWDSD"
     gene            <701102..>701494
                     /locus_tag="LMJF_23_1715"
                     /db_xref="GeneID:5652145"
     mRNA            <701102..>701494
                     /locus_tag="LMJF_23_1715"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683444.1"
                     /db_xref="GeneID:5652145"
     CDS             701102..701494
                     /locus_tag="LMJF_23_1715"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683496.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1715"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1715"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652145"
                     /db_xref="UniProtKB/TrEMBL:Q4QB02"
                     /translation="MQPISSAVPVDTYTAPLVNASYKRANGEAPLSGRRASDRQLPYV
                     PALVRPQLQFFSENDIRALELRMEYQAWTAARSQRIDARASRVSAEAHAAAEQRSVML
                     RQRAARHAKAAGDVRVKKIQEDYRTMGM"
     gene            <702205..>702621
                     /locus_tag="LMJF_23_1720"
                     /db_xref="GeneID:5652146"
     mRNA            <702205..>702621
                     /locus_tag="LMJF_23_1720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683445.1"
                     /db_xref="GeneID:5652146"
     CDS             702205..702621
                     /locus_tag="LMJF_23_1720"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683497.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652146"
                     /db_xref="UniProtKB/TrEMBL:Q4QB01"
                     /translation="MSDPASINHYDARAYTRKGATRRVVVREKPLLKSRMQRCADYLR
                     PTTRHGFNIVGTFELSKVMACIIFPVFMLLYWKNKEKELPDSWEQQFGGLQHRQFRED
                     QLPEQDTDYFSIMENFQERREAALQKKREALQNRIV"
     gene            <704031..>705254
                     /locus_tag="LMJF_23_1730"
                     /db_xref="GeneID:5652147"
     mRNA            <704031..>705254
                     /locus_tag="LMJF_23_1730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683446.1"
                     /db_xref="GeneID:5652147"
     CDS             704031..705254
                     /locus_tag="LMJF_23_1730"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683498.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652147"
                     /db_xref="GOA:Q4QB00"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR024766"
                     /db_xref="UniProtKB/TrEMBL:Q4QB00"
                     /translation="MPKRGRANSTDASYAAEHGFVEVSDADSPATQPISVEEMMESQR
                     DPLLEQQLDALEVDEDFRESIRAMTPNTRRDVLNDIIRHQQHTEIEEGLMRGFHVGDF
                     GSAGPLFTFGAGIPPGMHQAHMMGGSQGNTDADDYADMMGDAEEDEEEDELHGSDRHA
                     AVEEDEEAETGFAVERPPFLLRGMPMGSIDSTGMPHVQHLGGQSPQQAGAQPTVLDIL
                     RLIAGHGTPQARSRGGDGLHHQGRGSGQRTAFEEGMMNFHNLIGVLQQANMMQSMGLD
                     HDIDEMTYEELLELEERIGNVSKGVPPALLDSCMVPLRSTSADAGTCAICQEELRGIS
                     ATATATATTATGAASTATSPSGTDKACVKLLNCPHAFHKPCINQWLTQNKTCPICKVE
                     VLPKPAPSSSSAPSQ"
     gene            <706041..>706793
                     /locus_tag="LMJF_23_1740"
                     /db_xref="GeneID:5652148"
     mRNA            <706041..>706793
                     /locus_tag="LMJF_23_1740"
                     /product="putative Qb-SNARE protein"
                     /transcript_id="XM_001683447.1"
                     /db_xref="GeneID:5652148"
     CDS             706041..706793
                     /locus_tag="LMJF_23_1740"
                     /codon_start=1
                     /product="putative Qb-SNARE protein"
                     /protein_id="XP_001683499.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652148"
                     /db_xref="GOA:Q4QAZ9"
                     /db_xref="InterPro:IPR007705"
                     /db_xref="UniProtKB/TrEMBL:Q4QAZ9"
                     /translation="MSGLFNSYEEDFNDTVRGLREGCSKLQADIDAQSAHEKDPTRIY
                     HPPPATGPLSRAQQLQVVQQSLSHAKDLLTSMMYEMTDLAPSEGAAAKEKVEAFRKIC
                     NGLDREVAQLRQSCNAADRTDLLRFGGPAAAGGTGDAFMAEADADTQAHRLLALETTE
                     KLQGGTSTLRKAEAYLAQTNSLGRESLNTLRTQTEQIAHVQETTNDVDAEISRARVLI
                     DQMQRTAIKHKMWLIGIILLLLGFIFLLAYLH"
     gene            <707856..>708872
                     /locus_tag="LMJF_23_1750"
                     /db_xref="GeneID:5652149"
     mRNA            <707856..>708872
                     /locus_tag="LMJF_23_1750"
                     /product="putative Qb-SNARE protein"
                     /transcript_id="XM_001683448.1"
                     /db_xref="GeneID:5652149"
     CDS             707856..708872
                     /locus_tag="LMJF_23_1750"
                     /codon_start=1
                     /product="putative Qb-SNARE protein"
                     /protein_id="XP_001683500.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652149"
                     /db_xref="GOA:Q4QAZ8"
                     /db_xref="InterPro:IPR007705"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="UniProtKB/TrEMBL:Q4QAZ8"
                     /translation="MRPPRRSCRALRLVQRAPKRDLSRPSLPQPSLLRPSLLSLVPLL
                     SLLQHLHTHDAAMTTLFQAYEEEYRDGVRTIRDESEALRHSCDRKAARYKAPPVTGPG
                     SRVQRGAHLTTVLAQVRELVNSMEYEANDLPAAHRQTAKERIAEYRTNLRTLEEGIAR
                     LKADASAADRLDLLGDIERKTTSASGADEATAPGALDDVTKAHRMVMLDNTAKFKDAA
                     GKLLQAERLLNDTETVGNEALTSLRYQTETMQHIQETTIVVDEEVSDARRIISGMQKV
                     MIKHKLILTAIIIVLLFLILVAIYVSVTKNHRNSSSTSSEATGEPITSVAPSLSWLSS
                     KLKQ"
     gene            <710242..>712797
                     /locus_tag="LMJF_23_1760"
                     /db_xref="GeneID:5652150"
     mRNA            <710242..>712797
                     /locus_tag="LMJF_23_1760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683449.1"
                     /db_xref="GeneID:5652150"
     CDS             710242..712797
                     /locus_tag="LMJF_23_1760"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683501.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652150"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="UniProtKB/TrEMBL:Q4QAZ7"
                     /translation="MTSPTCGDEAGRRRDTLREQATMLLTLHQHLLQHQKAAHQAFAS
                     LDQACCSLAASLAAPSAHGVIGGAASKETPSEATSPLSLSPPSAAQEFTQLLRRVEVL
                     HQFLFTNLYVHQRESVLRLVDDVERLVAGNALAPSSLARPLSAMPDGIDSSSSSCGGA
                     DGSHLGEELRELRRQITQLRYQLARPAKAHASGCLSTHTDGAARGLLPQTQTTSFSSP
                     PQENGNSGSSSAAPRAVRHAPRAPRAQAGVAASKMQGTARQNMPRLRLFALSSAFQKH
                     GVAGQKGLAAVLYAVQRRFHVHAVVLGCTPSPEAEVDVAVRLGCLCLVVPHHDLGSFP
                     VHPGLAVTSDRVVLAHMESRSDGMSSTADASPLAGDAAECDEDLALMADGGGKCTAAL
                     EELFVSLEADLPLMTAAEPVWPSPFTTTPAERDAPGSQALVVERSALHRDGRQTSRQR
                     KRHRSGGAALSSAHSTCASTPEGVAMPTCESDALSNTAADLFSPSSRARITGASWLRT
                     GAVADVMNPAEVYDAAADADVIVPSQLAVESQHVGITQNFSLSRRSTTPSDSPRATPV
                     LRPHEGVARADDAAASASAANVSAPQQLVFQISNSVKYLKAQLMEAIVQLGGVVDQSS
                     GYSRACRYLVVAEGITERTEKYLGACAAAAYILPPRFVFDSQRRGYWLANRIQEYDMS
                     PQRIIAHAPRAVPIFSNWRVVLITCRAAAARGVLAALLAGGCTQATAFVVDITAEPPM
                     DPGARSCVYDETCATAEGLVEGVSPSSSIAARTLQSATHILVECSAVTAHGFFQMPDW
                     MPACVRQPEYQPRVFTLELLYFCLCAHPERVFDAEGQLSEVDALTPACRVEPV"
     gene            <714331..>715188
                     /locus_tag="LMJF_23_1770"
                     /db_xref="GeneID:5652151"
     mRNA            <714331..>715188
                     /locus_tag="LMJF_23_1770"
                     /product="putative Csl4p homologue"
                     /transcript_id="XM_001683450.1"
                     /db_xref="GeneID:5652151"
     CDS             714331..715188
                     /locus_tag="LMJF_23_1770"
                     /codon_start=1
                     /product="putative Csl4p homologue"
                     /protein_id="XP_001683502.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652151"
                     /db_xref="GOA:Q4QAZ6"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR019495"
                     /db_xref="UniProtKB/TrEMBL:Q4QAZ6"
                     /translation="MPVILHTGARVAPGDAIFTSPAAVTASHDALEGAAAEEAEVVPG
                     EGCVVQYVEQYIAPSAPTSSAPSAVVVRSIIATRQGVAQWDGRLVSVFALASCALASA
                     GGAEYAAACGAGASDGSAVASPRHAVLGPRPGDTVHLRITRLNRLFAFGEIIAVNWSW
                     CSHRSLFSAAAGGGSNSGVFKGILRQEDIRPFKPTKDQLLPPPLSLAFGVGDVVLAEV
                     ISQSDVHQCQLSTTGEGCGVVESFITTVEGQYGGQAKVKLEHIPGRRDAMMIRSTGEV
                     VPRWCPLLP"
     gene            <717671..>718282
                     /locus_tag="LMJF_23_1440"
                     /db_xref="GeneID:5652152"
     mRNA            <717671..>718282
                     /locus_tag="LMJF_23_1440"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683451.1"
                     /db_xref="GeneID:5652152"
     CDS             717671..718282
                     /locus_tag="LMJF_23_1440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683503.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652152"
                     /db_xref="UniProtKB/TrEMBL:Q4QAZ5"
                     /translation="MYCGGDGAKALSPTNQAMRNIDHMELETHSAYGLRCEEGNAIHA
                     PVPQRTVWMMYVFACISMLLSAALFVLCVIFAFVFGLLLTGAHDTSLGAFVVAAFVIS
                     VFGAVAYLLTTLFVAVILRCSLCYRCRSSNATRLSCCEAVICALILLFSCALSCLTGF
                     LLADPRSDQNRKMLTAMCVLTTFCTLSFGAFVVLLVMHGVLRR"
     gene            <722341..>722850
                     /locus_tag="LMJF_23_1445"
                     /db_xref="GeneID:5652153"
     mRNA            <722341..>722850
                     /locus_tag="LMJF_23_1445"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683452.1"
                     /db_xref="GeneID:5652153"
     CDS             722341..722850
                     /locus_tag="LMJF_23_1445"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683504.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1445"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1445"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652153"
                     /db_xref="UniProtKB/TrEMBL:Q4QAZ4"
                     /translation="MKRSARCWRECCIVFPFPSGGWTEGVAPRAALPTPLSRSGTDSA
                     YRAADHCPTVETRARIGFRTTTALHATDGTSCCALVPSYIRTRCAVQSPACGYVSARA
                     LLRISVHLTLPPTLPRFTSRRALGLLPIRGGAAFIARALPSPSPSPCVCFSTLYTVKL
                     SYVISRSSC"
     gene            <723521..>724993
                     /locus_tag="LMJF_23_1450"
                     /db_xref="GeneID:5652154"
     mRNA            <723521..>724993
                     /locus_tag="LMJF_23_1450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683453.1"
                     /db_xref="GeneID:5652154"
     CDS             723521..724993
                     /locus_tag="LMJF_23_1450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683505.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652154"
                     /db_xref="UniProtKB/TrEMBL:Q4QAZ3"
                     /translation="MPRGHVGMSSIEARQRRESFMEKFNAEQTVQERQKRTVEWELRG
                     NERHEQKDVLRYMDVIQAQHNDVLVARRRRLAELLTRENELHTSMMTSLPETDAQRRE
                     RLIRKAQELRARREEAKRLDNCARHDRLFCAKIDCLRQAESRLKVMQVADARYEQMDA
                     AAERRRQEAAEDVIYAQQAIEAQRVATERDQRDLEMQYIRQRRMIDDLAAQVEGNRQR
                     KEVEKEIARRDTEEFYRLLHEEQAEEARKRLQRREKNRQLAQEMMEMNEELKRARQQE
                     YEQLKKEDKEALEAILASLAAEQQKQRDEKQRRMAAERQHMLDLQKMAQCKDDKHALD
                     KLWEEENEKQWRKREVQWEADQAKRDTLLRNILIARRQQILDKRQKAKEDAMLRKLED
                     EKFLESLSKERDIDAAERERRMALLKETQQYLEWQIQQRIAEKEAARLAKRTELTDEQ
                     ALEKQYEDRIAREMANLEAAKPARYRDVPLLQKKHRNQLF"
     gene            <729209..>730780
                     /locus_tag="LMJF_23_1460"
                     /db_xref="GeneID:5652155"
     mRNA            <729209..>730780
                     /locus_tag="LMJF_23_1460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683454.1"
                     /db_xref="GeneID:5652155"
     CDS             729209..730780
                     /locus_tag="LMJF_23_1460"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683506.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652155"
                     /db_xref="InterPro:IPR003018"
                     /db_xref="InterPro:IPR007303"
                     /db_xref="InterPro:IPR029016"
                     /db_xref="UniProtKB/TrEMBL:Q4QAZ2"
                     /translation="MTLETTPAPTFSSKKELYDWLVKQVEALVHDMSKRFTPQANLVI
                     GLSNTAALCFYELNRFCNPEAALEKLRVNWFGFYLFQAPGLLALGPFQGRPACTEIRV
                     GKGVCGTVAESGESMVVQSVHEFPGHIACDSASKSEIAVPVLIENGSVVAVIDVDSTE
                     LGHFSEEDREGLERMAAVLAQHLDFPMARALAVNPALGLPGYSALAGGEKALQPHGDA
                     EAVPQATPVTTTTTTPATVTAVTRIPFFKVEVKQPDVTTKCVGGWQFTRTNLDRIMTQ
                     DETKQLQDSLGISALPEIAFQGKTLSVSPESDREHPWLHFSVEALMCSAAEYYQTEEF
                     KTLVNPQLRIPVSAGWESFHFEKYDPKVDWAWRNNFCGLVPDRGRLVERPRDAADAPG
                     INWDILKDTSLLILFYGDFDMMEDDLRDHGMVTSSVKYRVMSSAFFVLFRHFVRVDNH
                     EIWMREVRVFHEFGKTRTPSGVPHIVFLEQLRHVRIAEPVEGVDWKSMSPDAISAKAT
                     VLLSREWMLEKVATA"
     gene            <731829..>732491
                     /locus_tag="LMJF_23_1470"
                     /db_xref="GeneID:5652156"
     mRNA            <731829..>732491
                     /locus_tag="LMJF_23_1470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683455.1"
                     /db_xref="GeneID:5652156"
     CDS             731829..732491
                     /locus_tag="LMJF_23_1470"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683507.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652156"
                     /db_xref="UniProtKB/TrEMBL:Q4QAZ1"
                     /translation="MEILKKTAAFRVQKQVEGRPAEEVTQLSLSGVPALPELWSPYTH
                     LTHLLLICMKPKLVSLDILGLNKLQALRLLDVSDNAVAVTSPPPAVPSLVRLLMPNNQ
                     VSSLEEVRRLAQSFPSLEVLDVADNDVDTPAHFASVFGTFPKLVALNSRMRDGTEVVV
                     EDSDETDSDEECEDSSDEESDEEVGQTGSSGSTGRETEEESESDTEPVAKRTRAEGEK
                     DG"
     gene            <733216..>733953
                     /locus_tag="LMJF_23_1480"
                     /db_xref="GeneID:5652157"
     mRNA            <733216..>733953
                     /locus_tag="LMJF_23_1480"
                     /product="putative alanine racemase"
                     /transcript_id="XM_001683456.1"
                     /db_xref="GeneID:5652157"
     CDS             733216..733953
                     /locus_tag="LMJF_23_1480"
                     /EC_number="5.1.1.1"
                     /codon_start=1
                     /product="putative alanine racemase"
                     /protein_id="XP_001683508.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652157"
                     /db_xref="GOA:Q4QAZ0"
                     /db_xref="InterPro:IPR001608"
                     /db_xref="InterPro:IPR011078"
                     /db_xref="InterPro:IPR029066"
                     /db_xref="UniProtKB/TrEMBL:Q4QAZ0"
                     /translation="MSRYDIASEPTAETLALNYKAVCDTVAQESGNRRVTLIAVSKTK
                     SPACLLNLYNLGQRVFGENYVQELGEKAKELPEDTVWHFIGHLQSNKVKELLEGVPNL
                     RVVQTIDSENLASKVNEGCRKYRGGRPLEVYIQVNTSGEETKSGTEPGEATVTLAKYI
                     ADECPLLQLKGLMTIGMPDYTSRPENFECLTKCREDVAQAVQMAPEDLELSMGMSGDY
                     VNAIRMGSTAVRVGTSIFGQRYYPHKQ"
     gene            <735429..>736346
                     /locus_tag="LMJF_23_1490"
                     /db_xref="GeneID:5652158"
     mRNA            <735429..>736346
                     /locus_tag="LMJF_23_1490"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683457.1"
                     /db_xref="GeneID:5652158"
     CDS             735429..736346
                     /locus_tag="LMJF_23_1490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683509.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652158"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="UniProtKB/TrEMBL:Q4QAY9"
                     /translation="MGGATSKDRYDRAAATGILTLNTQKVKSWSSVTKALKKLSALRI
                     ITITRNPLRDPVPYAFTALSLWGTLVSLDLSHNGLTCACALGSEAPLSKTHAKEARAR
                     IATAPVSNAAHGTTRLPLESLNISGNDLHMLPPLLAARFPRLRRLVCTDNKTTLDIPL
                     SLARCVGPSKSLEVVALQRNRLKTFVIADSTVDKPFPALRELLLDQNHLGGTVSLGFA
                     ADEEAPTMASLRRISLDEQKGKEPLRRVSAAIFAHCPGLTSLSLQGNCNEEEIRDSLV
                     RSDIYRKWQVRQKDRVDKKLHAGGQADLI"
     gene            <739087..>740493
                     /locus_tag="LMJF_23_1500"
                     /db_xref="GeneID:5652159"
     mRNA            <739087..>740493
                     /locus_tag="LMJF_23_1500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683458.1"
                     /db_xref="GeneID:5652159"
     CDS             739087..740493
                     /locus_tag="LMJF_23_1500"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683510.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652159"
                     /db_xref="UniProtKB/TrEMBL:Q4QAY8"
                     /translation="MSASSTVSDRRVCIFFDCRVAGDGKGYEELRQTVYAQCSQLLTL
                     SYLHYQRSGTTLSATVHLVTHTRVESFATPFCATSTDHPIDSGAAGVISGLRALAAAQ
                     PDHSVNACGAAIFGNRMESVLPHVQRALGGSQQRHQLILFCSSYVSHTEATQSLSGLC
                     LDASPHQRLRCILVDWEAVCVTVGELASNVRVYRCSRSARQLQAAMQEILSLFLLPDV
                     RSSRRLGLQLGLQAVPVIATISHYGAFLDGRDTIGSVVATDRASSAAAPMAGGVMHQR
                     LAETNHRHNRANAASVVERDDRDPWSTLHLRAVLEADNIDESFLMGDTWTLALDTSAA
                     STSTLTSSSAPSWPCTASTVALWHAFCNAFLGDALVFTGEETGIEAHRHAMQRHHHFV
                     AYFMPDRTMRVREIVPPELRFVPLPAFPTREGLREQKAYTTEMQRLREQLVSHCACAS
                     FSLDALLSSGGHGAASTP"
     gene            <741453..>743780
                     /locus_tag="LMJF_23_1510"
                     /db_xref="GeneID:5652160"
     mRNA            <741453..>743780
                     /locus_tag="LMJF_23_1510"
                     /product="putative vacuolar proton translocating ATPase
                     subunit A"
                     /transcript_id="XM_001683459.1"
                     /db_xref="GeneID:5652160"
     CDS             741453..743780
                     /locus_tag="LMJF_23_1510"
                     /codon_start=1
                     /product="putative vacuolar proton translocating ATPase
                     subunit A"
                     /protein_id="XP_001683511.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652160"
                     /db_xref="GOA:Q4QAY7"
                     /db_xref="InterPro:IPR002490"
                     /db_xref="InterPro:IPR026028"
                     /db_xref="UniProtKB/TrEMBL:Q4QAY7"
                     /translation="MPREACSGLWRSEDMVVLSLHMQREVAHDAVLKLGEIGQFQFED
                     LNKDVSAFQRDFVQEVRRCDDMERKLRFLQEESEKAGVATIVDGDAEGETMSSLEHKI
                     DEVYSEVVELNEQYQALIEERNRSKEHLEILSRDFGGATGDGVLMVTGVIPKERIPLF
                     ERLVYRATRGNSIMRTDNIDKPFYNINANEPVYKSVFAVYFSAPRLHERLIKIAEANA
                     ATVYNYADSEQQLTRMHASLQQQVDTITQTLNQSAYRQRQVLLGIAAVCYEWRRAVVT
                     EKAVFSTMNMLKFSGSTAIARGWAPVRSCEDIRTAIAEAEYLSGAQVATIIEELNTKE
                     TPPSYFKTNKITGSFQSIVDSYGMARYKEANPGVFTIITFPYLFGVMYGDVGHGIILT
                     LFAAFLVFKEKSFEGQPLNEIFAMIFGGRYLLLLMGFFAVYMGLLYNDMFGFSIEIFA
                     SGYRWPQLPPEGPDGIVYPSFPTGRPSVKPESSVIFGIDSAWSETENKLEFYNSIKMK
                     CSVIIGVAQMMAGVLISLTNYIYFNDSVKVWFRFVPEVVFLSCTFGYMCVLIIVKWLT
                     TWENTHDAPSLLETMTNFFLAPGTITLPLFSGQAALQVMLLLVSLACVPCMLCVIPYV
                     EKKEHDQKMQERAAHPPADGEEEGEDDFQLSEIIIHQIIHTIEYVLGCVSNTASYLRL
                     WALSLAHSQLSEVFWSFAFLLTVDYDSGTGICIFFGFAMWMTATIGVLLGMESLSAFL
                     HALRLHWVEFNNKFYAADGYAFEPFDLAETLSKLR"
     gene            <745154..>746455
                     /locus_tag="LMJF_23_1520"
                     /db_xref="GeneID:5652161"
     mRNA            <745154..>746455
                     /locus_tag="LMJF_23_1520"
                     /product="putative protoheme IX farnesyltransferase"
                     /transcript_id="XM_001683460.1"
                     /db_xref="GeneID:5652161"
     CDS             745154..746455
                     /locus_tag="LMJF_23_1520"
                     /EC_number="2.5.1.-"
                     /codon_start=1
                     /product="putative protoheme IX farnesyltransferase"
                     /protein_id="XP_001683512.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652161"
                     /db_xref="GOA:Q4QAY6"
                     /db_xref="InterPro:IPR000537"
                     /db_xref="InterPro:IPR006369"
                     /db_xref="InterPro:IPR016315"
                     /db_xref="UniProtKB/TrEMBL:Q4QAY6"
                     /translation="MLTDFFWWSISYESTTVLRRALSSLSAARVCRFREPESCRTIKQ
                     VGKTMLHITAARHAQLFRLTQRRLQSGTFKACPYHRTKEGSPTVMAQGAMEHCPVVGT
                     TPHMGCPVEARLCDRRPPTMSIMVSQMGKSQLSAYVAATALAGYVIAGGTVPLVAAAV
                     TAGTMLQSCSANTANQIIEAPYDKLMKRTCRRPLPMKFLSPQAATAISSMELTLGTGL
                     LYCVSPPAAALGVFNWFLYVCIYTPLKRVSALNTWFGSIVGGVPPLMGGVAVAGIITP
                     PVWLLATFLFVWQIPHFNGLAFHCRRDYEAAGYKMLAFYNPWRASFYAVALSVLMAFL
                     TLVCPTLAGMEVEGMWYYSVTAAANALMIYKSLLFHNEPVRHCRGCFVFSYVYLSVVL
                     AAIMLNHIQPMHLAQRAIDYVAAEATKASTPSSAVVSTAET"
     gene            <749695..>751650
                     /locus_tag="LMJF_23_1530"
                     /db_xref="GeneID:5652162"
     mRNA            <749695..>751650
                     /locus_tag="LMJF_23_1530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683461.1"
                     /db_xref="GeneID:5652162"
     CDS             749695..751650
                     /locus_tag="LMJF_23_1530"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683513.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652162"
                     /db_xref="UniProtKB/TrEMBL:Q4QAY5"
                     /translation="MERGTDGMLSAPEESGGRDAAVCRNAACPYWHRNQLTHVKMAVM
                     VFLDSVRCQSVLDEHLCAVTHATARLARHVHHADSISLVCALLCEVLQTLIATGLYMR
                     LLTDKQSTRAMMSAPTVKATDAQRAAPARAALLRSAEEVERWSAVEQQQQQHSSSTDS
                     LSLATAAAAQFQLHPSSLSWRCMLAAVEDVAQRRWLGRQGVVLFPSSPELHLQYVLAV
                     LRSGGSVAEVLETCLASCRTLSAQAAASVVAGLDCGQYATRVARHTAYLLARVFVHVA
                     QMDTAAALAFLAPLLSTDAEAGVAALLLPLARQNLTLLMVALRRTGHLRYTNFLPLAA
                     ISDIALELASPDGANPTESGRDALYAALKLIVSYKRDRFDAQLVSCCDAALQISVLRT
                     FSYRLAYIERVVEKTVPESPLSQGVLYSEYVDAVAEQQSVHAAALVADALVRNEGASC
                     TLTLLLRGRLRMWGVSLSSDAQNAVSAFCSANQLSLDELGDPAHLRDAFQTPCFSRSP
                     PVEWVCAYALHVMCSLDGETAAESAWAKMDALPVELLMHDVVAAAFFFHVLLQLSGEA
                     RSATLFHRTVNRCLSLFLEAHLLGWSSLEGSAENMIGLPHYLSLCIYQEVPLLLGPGT
                     DDTFAWRCLVLEVAARLGVLHPLLVTD"
     gene            <752663..>755560
                     /locus_tag="LMJF_23_1540"
                     /db_xref="GeneID:5652163"
     mRNA            <752663..>755560
                     /locus_tag="LMJF_23_1540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683462.1"
                     /db_xref="GeneID:5652163"
     CDS             752663..755560
                     /locus_tag="LMJF_23_1540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683514.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652163"
                     /db_xref="InterPro:IPR003961"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="UniProtKB/TrEMBL:Q4QAY4"
                     /translation="MPPASLTFEPPSVVAVFATHAVLCWEQPRTPHTTSFAEHMAWEY
                     QIEYNCSCRVRQQPYCATGSNTFVLLATPHEGETYYVRVVAKASFAGSTSGLVSAKAA
                     FTASCNVAMPWRCSARPPVCVFDALYLSANVEAEDIAALSAARSSTIDNAAVLDGKSV
                     CYTLEGDIAVRTYRMLYSGTAALPVGPARTVYYMVATTRLHTGKRTRAMELLSIMQRE
                     GASIVFCGIGDGGRLALCAALTFLSFLTTACPALCASVLCITYGTPRLLLKEGPRLLA
                     HTLPLSGQLLHFTQLPLIEHTPFVSDTVALSQRGSGVAVDTPPLGYANGFYRNMLLGA
                     QCRVTDWTGLHFRLSSPDELSTEAEEAEVFDVVGQLRALSELFFPSSLQWLSPSVTSV
                     SCRTEGPLLHVSVEGANLHYCPRVTLTPSYPRATPLFPRVVVITPLHLECTACLLPWV
                     QQRAAGRGLRDAVPLNISAFLLVQTSLGTAFAPAPATVALPEDLFELFCAAQQGSAPW
                     SAEAAPGLVECALQLQPLYVLAGTDDVAFPSAAGNALYNPLLESLCALASAAEVTLSP
                     GYAGATAKPGSGLLDFISSVGARLSARAADAPTDAVPALRVPGIEAAYLKNALKEWKG
                     TGFTGVEVWRSRCASWRQRIFGVLSLLSEISYRNTLVRMLRVLDGDAEVDEDVPFACI
                     EAYLYAHTKYHINAAQCSPVYMDQLLYTELSLSSFYGAVAHIFKSEASSASGSPLSYL
                     RESMLLWALCHCFELRREVARTTFCCSVGCAGCGVSTLSSCISSLLHHKEARRHGRRG
                     TCFRTVQCRVASSDLSAVYLAAQTGVRCCVFLAAEASDLTRTEYTSMSVHIQERLAYS
                     GQHVFRVITKADEHLQSISDLRKELENETSWAALMSRVGAQLLGGCGTEEQRLVVALA
                     PSTSRLVELLACTPAEVEQYAQRLRSYSEALLLDCLRLSVLRGDADCPRTA"
     gene            <756508..>758892
                     /locus_tag="LMJF_23_1550"
                     /db_xref="GeneID:5652164"
     mRNA            <756508..>758892
                     /locus_tag="LMJF_23_1550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683463.1"
                     /db_xref="GeneID:5652164"
     CDS             756508..758892
                     /locus_tag="LMJF_23_1550"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683515.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652164"
                     /db_xref="GOA:Q4QAY3"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="UniProtKB/TrEMBL:Q4QAY3"
                     /translation="MDGDPRVSALQWEVAKEASTSPKTWAELARTTAAATAADPVERA
                     NAVTLVYERALRAFASSYKLWMAYISYRQRETSRMCGPNEWFQAVREVYERALTELPK
                     MPMLWVSYMEFVVASEVPRVTMTRHILARALAALPATQHHHLWKIAKRWCAMPIVPSA
                     TVRAVWWLYLSFQRSLHAKREYFQVLVQKGDFNGFLQECVRLGLPDKSNKGAVEERDL
                     LLSDVSFWETVQTALQGKGWRFTGDIGRLRELVALGKLRCASPVELSMAFAVFLYGQG
                     HMREGRQELRQLLDEAPEAQTLISLYHLAVEMEDQLVESFAVDPDLRGLDDAAYNGVV
                     QHLFGDGDPLRHLERLAREFPLLLNQAQLRNSPHNAALWLKRVELLQEDVYAGRSTFD
                     DLVALYRQAIQQCTAGMSRVDGAAAQLFSSCAQTLIRGGKLDSAIAVLSEGTWCVPFT
                     SAALNVQLLGLLVEVQLMSFASPLSVRDALAERLTSGARSGASKRSRNGLLQSSAALP
                     RVAHHPHAWIMWCDVCAAYDSANAAAWHRLVEALASSPAFSAEAACYVAHKAYVCRQE
                     SIAVMMLERAVAATRQQPTAQLFVLEQYLSFLCVRDGRQVPLHQFREVFSLVQQVTPV
                     AIRTAPSAVIDLYVSCAYMEAAIGLYGTAVRMMQEISLVATAALRGRDEHLRVLQAIL
                     EHSITFTEQRRGYNSVRAYCGALVQRLQHALLLQRVALHWAAIEKRSGNTAQAHLILD
                     ACGDSQDPSTEHGEVYWRLWESLCTNVEEFEKVARRRQQASIRFNKRQSAKGAE"
     gene            <762709..>763728
                     /locus_tag="LMJF_23_1560"
                     /db_xref="GeneID:5652165"
     mRNA            <762709..>763728
                     /locus_tag="LMJF_23_1560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683464.1"
                     /db_xref="GeneID:5652165"
     CDS             762709..763728
                     /locus_tag="LMJF_23_1560"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683516.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652165"
                     /db_xref="UniProtKB/TrEMBL:Q4QAY2"
                     /translation="MWALTCRPIQNTEALQLMERYKAHNALQSNQWLLPRHLACFAVR
                     PLYPAQLVLPTSSVIRLPLSAVPFSSLPLSRKREVFGLYPPPCTPPGSCSLLECSGAA
                     MRWRPASLSECFDAAFVRSDSPSSHQHLLCATDCAGSVTVAEEVTVFNAQETNNPFLV
                     DADLVHRNLLTKEAYEHSIGSSLTTIAAQFRYTSFEWVEATAAAAVGLRVRSSAAPHL
                     VNCVDMLRVVHISQLPYTRQQELVAEIPRMTLIKSMTISYIFYHTRWRHHKSMELMRP
                     LLHSNIPCCDTPQAQALQPLLWIAVDLDMEFRGPVMECARHSRTQFYNSQQLEVDTCA
                     VPSRS"
     gene            <764837..>767614
                     /locus_tag="LMJF_23_1570"
                     /db_xref="GeneID:5652166"
     mRNA            <764837..>767614
                     /locus_tag="LMJF_23_1570"
                     /product="neutral sphingomyelinase activation associated
                     factor-like protein"
                     /transcript_id="XM_001683465.1"
                     /db_xref="GeneID:5652166"
     CDS             764837..767614
                     /locus_tag="LMJF_23_1570"
                     /EC_number="3.1.4.12"
                     /codon_start=1
                     /product="neutral sphingomyelinase activation associated
                     factor-like protein"
                     /protein_id="XP_001683517.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652166"
                     /db_xref="GOA:Q4QAY1"
                     /db_xref="InterPro:IPR000409"
                     /db_xref="InterPro:IPR011044"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:Q4QAY1"
                     /translation="MRRRRSRLTLYWLTDKEWFLGEDECVRPASRWRSLLGTVTEGVL
                     SLASDHLFFDDGGPNVVIFPLSRVADAAVHLCNEHISVTFTCRNAQHREVVTPPTSKH
                     SVPGICRPYPNKETWVFHFPRTSEWVAESLRSLFTRHRIEDILSRREVALQSASSVVS
                     FCARRQVPMREQRGVLYIGDADLVFEPLFPLSVHGEVRLDRRQCRHTFARWIIFQAVG
                     LDLYTSDSPAATPALSLIFHNPPERDEAAHLLAERLGILPYHVSIQAVSEAWRNHFMS
                     SYEYLLHLNKWASRCTNDVFQYPVFPWVLADYTSSALDLSQPSTFRDLSKPIGALSPS
                     RLALLRERAEFLREAEETAYLYSTHYSSAAIVAYYLVRPHPEFQLSLQGGTLDVPERI
                     MESIPQLWNSVTTNSSNFRELIPQFFDEGFVALCGPPLLPLGLHTDGSPVAAYVKLPP
                     WAASSEDFVRQHRAALESDIVSASLHLWIDLVFGTAQTGEHACVADNLFHPFSYPQCD
                     RQLSVPGLHLSSCEYAREFGNVPIQLFADMHPPRARIVHTLACTAEALEACGCVTKSA
                     NQQRLLSMMEALQFIEDATDTVADSADADDEDAHGLPTHAAVLTVISTTSLSCRSARF
                     VTLGHSHVDPPASPTAVLLVVGSDQRTATLFDVATGKRIRSFPDFDGLITATAFHDGH
                     MFVFTETTSCYVLSLTSHAVAHFTAEVTPAPVLHACFASQLVVLADSNAQLSGWALQR
                     GTSPLLFESPLSFACEASSRVACIGTSADGDTVVAATEQLEVFVCRGGTCCECMLQQV
                     PAPSAVLHIMPADRLTRFWVFFLEEATLYDLGGLPLRRISTTAASIITCPQLAYQLYP
                     LCIHIDNGALEVFQLLHSGERAVPLPCSRLRSLRLSSAGNLIAFVGTALVDCEPSLVL
                     TMAALTAQLTG"
     gene            <768818..>769285
                     /locus_tag="LMJF_23_1580"
                     /db_xref="GeneID:5652167"
     mRNA            <768818..>769285
                     /locus_tag="LMJF_23_1580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683466.1"
                     /db_xref="GeneID:5652167"
     CDS             768818..769285
                     /locus_tag="LMJF_23_1580"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683518.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.23.1580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.23.1580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652167"
                     /db_xref="GOA:Q4QAY0"
                     /db_xref="InterPro:IPR007710"
                     /db_xref="UniProtKB/TrEMBL:Q4QAY0"
                     /translation="MSTPKTIYIAGPAVFHPDNGEAYYNHVRALLKEKGVVPLIPVDN
                     IATGALSIRNKNIDMIRACDAVIADLSPFRSKEPDCGTAFELGYAAALGKLLLTFTTD
                     TRPMVEKYGGEMAEGLSVENFGLPFNLMLHDGTDVFDSFEAAFAHFVDHHLTP"
CONTIG      join(FR796419.1:1..772565)
//
DBGET integrated database retrieval system