GenomeNet

Database: RefSeq
Entry: NC_007265
LinkDB: NC_007265
Original site: NC_007265 
LOCUS       NC_007265             840950 bp    DNA     linear   CON 16-JUN-2017
DEFINITION  Leishmania major strain Friedlin complete genome, chromosome 24.
ACCESSION   NC_007265 CT005263
VERSION     NC_007265.2
DBLINK      BioProject: PRJNA15564
            BioSample: SAMEA3138173
            Assembly: GCF_000002725.2
KEYWORDS    RefSeq; complete genome.
SOURCE      Leishmania major strain Friedlin
  ORGANISM  Leishmania major strain Friedlin
            Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae;
            Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Rogers,M.B., Hilley,J.D., Dickens,N.J., Wilkes,J., Bates,P.A.,
            Depledge,D.P., Harris,D., Her,Y., Herzyk,P., Imamura,H., Otto,T.D.,
            Sanders,M., Seeger,K., Dujardin,J.C., Berriman,M., Smith,D.F.,
            Hertz-Fowler,C. and Mottram,J.C.
  TITLE     Chromosome and gene copy number variation allow major structural
            change between species and strains of Leishmania
  JOURNAL   Genome Res. 21 (12), 2129-2142 (2011)
   PUBMED   22038252
REFERENCE   2
  AUTHORS   Ivens,A.C., Peacock,C.S., Worthey,E.A., Murphy,L., Aggarwal,G.,
            Berriman,M., Sisk,E., Rajandream,M.A., Adlem,E., Aert,R.,
            Anupama,A., Apostolou,Z., Attipoe,P., Bason,N., Bauser,C., Beck,A.,
            Beverley,S.M., Bianchettin,G., Borzym,K., Bothe,G., Bruschi,C.V.,
            Collins,M., Cadag,E., Ciarloni,L., Clayton,C., Coulson,R.M.,
            Cronin,A., Cruz,A.K., Davies,R.M., De Gaudenzi,J., Dobson,D.E.,
            Duesterhoeft,A., Fazelina,G., Fosker,N., Frasch,A.C., Fraser,A.,
            Fuchs,M., Gabel,C., Goble,A., Goffeau,A., Harris,D.,
            Hertz-Fowler,C., Hilbert,H., Horn,D., Huang,Y., Klages,S.,
            Knights,A., Kube,M., Larke,N., Litvin,L., Lord,A., Louie,T.,
            Marra,M., Masuy,D., Matthews,K., Michaeli,S., Mottram,J.C.,
            Muller-Auer,S., Munden,H., Nelson,S., Norbertczak,H., Oliver,K.,
            O'neil,S., Pentony,M., Pohl,T.M., Price,C., Purnelle,B.,
            Quail,M.A., Rabbinowitsch,E., Reinhardt,R., Rieger,M., Rinta,J.,
            Robben,J., Robertson,L., Ruiz,J.C., Rutter,S., Saunders,D.,
            Schafer,M., Schein,J., Schwartz,D.C., Seeger,K., Seyler,A.,
            Sharp,S., Shin,H., Sivam,D., Squares,R., Squares,S., Tosato,V.,
            Vogt,C., Volckaert,G., Wambutt,R., Warren,T., Wedler,H.,
            Woodward,J., Zhou,S., Zimmermann,W., Smith,D.F., Blackwell,J.M.,
            Stuart,K.D., Barrell,B. and Myler,P.J.
  TITLE     The genome of the kinetoplastid parasite, Leishmania major
  JOURNAL   Science 309 (5733), 436-442 (2005)
   PUBMED   16020728
REFERENCE   3  (bases 1 to 840950)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 840950)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire, CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR796420.
            On Jun 1, 2012 this sequence version replaced NC_007265.1.
            Data release policy www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..840950
                     /organism="Leishmania major strain Friedlin"
                     /mol_type="genomic DNA"
                     /strain="Friedlin"
                     /db_xref="taxon:347515"
                     /chromosome="24"
     gene            <4496..>5947
                     /locus_tag="LMJF_24_0010"
                     /db_xref="GeneID:5652409"
     mRNA            <4496..>5947
                     /locus_tag="LMJF_24_0010"
                     /product="putative pyruvate dehydrogenase (lipoamide)
                     kinase"
                     /transcript_id="XM_001683467.1"
                     /db_xref="GeneID:5652409"
     CDS             4496..5947
                     /locus_tag="LMJF_24_0010"
                     /EC_number="2.7.11.2"
                     /codon_start=1
                     /product="putative pyruvate dehydrogenase (lipoamide)
                     kinase"
                     /protein_id="XP_001683519.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652409"
                     /db_xref="GOA:Q4QAX9"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR018955"
                     /db_xref="UniProtKB/TrEMBL:Q4QAX9"
                     /translation="MSRLSLPSLGLFVVFVRVLCSCITHVGRADLQMLRRGFCRSIPL
                     LGPTFTELVERLDSFEKEFIEWKAFRKAVESTSPKVTEAAKEIIAESMKEVKTSKVNL
                     ENPLTPEEFTELNQFYAKQKVKDIFFENLLYINTPNDLMQHSEIVFRQYLVRIARRVR
                     HLNHAPYGLSQMPGIQMLKKWYQWSFHDVRSTPVPTTRDGCYRCDRMVRRVFLRHYNV
                     SSLITDGMVEFAGREGWTHVDEEVMHTYDELQHFFEAFCLGRVRLRFLVGNYMYLSTK
                     ILGVSREEYAVNDADGLTVPIFFDHNADDFVGQICKRCSLLVLTKCAIKEAQATYDAE
                     IELKLAGDPSLVFVGVPYITYDIICAMLEDAVSANVDRQERTGKECTKIEVTLAQWPT
                     NKRFVLRISDTAGGMTLRQASMQLSCWSLYRNIQGHNQDTISTWTSSPIRLPYAYNAA
                     RVIGGNITLASIEGYGTDRQLYLPSTGLAGVSL"
     gene            <6630..>8081
                     /locus_tag="LMJF_24_0020"
                     /db_xref="GeneID:5652174"
     mRNA            <6630..>8081
                     /locus_tag="LMJF_24_0020"
                     /product="putative clathrin coat assembly protein"
                     /transcript_id="XM_001683468.1"
                     /db_xref="GeneID:5652174"
     CDS             6630..8081
                     /locus_tag="LMJF_24_0020"
                     /codon_start=1
                     /product="putative clathrin coat assembly protein"
                     /protein_id="XP_001683520.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652174"
                     /db_xref="GOA:Q4QAX8"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR011417"
                     /db_xref="InterPro:IPR013809"
                     /db_xref="InterPro:IPR014712"
                     /db_xref="UniProtKB/TrEMBL:Q4QAX8"
                     /translation="MNSTDTKQSAGYFKEKATIGLSSFSGDEIVKAILKTTSHLLKAP
                     KEKYMQKLVAASYGQYGSGLREGLPINEFIVRELEKRSHTHNWIVVLKTMVSFHRLMC
                     DASDSMVETICYYRHVFRASNIKNLADTADGAGQAYFIAQYMTYLEERCVMQSALGKG
                     RRVEIREFEEYLETLNAKSLQPVFEILLRLFEAVPAVEYREAVVNNFCTLEAYQLLVR
                     DGKQLFQHLAKRVIFILDGFEDFSLPEKRRWFDLYRRYASAFASVKQYFDSMLCSSRV
                     FLEPVPKLKPLPESLLTRLEGDIRASETAKEGLCTLESLGICSREDSRVDSKEEKIRP
                     PRAPEPAVVNQSEAVTALTPAAPTVSLDDLFVPSQEPTKPVQPASCPASWTPAPLAAT
                     SFQQGSEQFQWETGVPQNWGSGGHITLQAIATPPVPPPQHAFSGGAPPPAGEGALYPL
                     VQSALKQPPPPVQFKKPADPLKDLYNSCHWQSN"
     gene            <8548..>9048
                     /locus_tag="LMJF_24_0030"
                     /db_xref="GeneID:5652175"
     mRNA            <8548..>9048
                     /locus_tag="LMJF_24_0030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683469.1"
                     /db_xref="GeneID:5652175"
     CDS             8548..9048
                     /locus_tag="LMJF_24_0030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683521.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652175"
                     /db_xref="UniProtKB/TrEMBL:Q4QAX7"
                     /translation="MRVLCLRSLATWPAGLAARFYGGQGGARPPAGGRYPRAVGPPHP
                     DRRNVPTEPQIVARLITCFPRINTFVPISRWAAALPDDLREALVPYGGLGAFASAQSN
                     FFMIRKENGVTVASLSAMGAELAMEHERKEKQEQKRVEKFNQRRDKFASRGRSFSPSQ
                     GGPSRK"
     gene            <9459..>9959
                     /locus_tag="LMJF_24_0040"
                     /db_xref="GeneID:5652176"
     mRNA            <9459..>9959
                     /locus_tag="LMJF_24_0040"
                     /product="putative 60S ribosomal protein L17"
                     /transcript_id="XM_001683470.1"
                     /db_xref="GeneID:5652176"
     CDS             9459..9959
                     /locus_tag="LMJF_24_0040"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L17"
                     /protein_id="XP_001683522.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652176"
                     /db_xref="GOA:Q4QAX6"
                     /db_xref="InterPro:IPR001063"
                     /db_xref="InterPro:IPR005721"
                     /db_xref="InterPro:IPR018260"
                     /db_xref="UniProtKB/TrEMBL:Q4QAX6"
                     /translation="MTHYSRKPQVSSKSAKAKVSDLRCHYKNTFETANVINGMPLRKA
                     QQLYRQVLAKTRCIPFKRYNGKIGRTAQAKEWGQTKGRWPRKSVVAMMSLLKNAEANA
                     IEKGLDPNQMVIKHVQVDQAARMRRRTYRAHGRITPYMCSPCHVQLFMSEKKERVPAP
                     KSAPKK"
     gene            <10422..>11822
                     /locus_tag="LMJF_24_0050"
                     /db_xref="GeneID:5652177"
     mRNA            <10422..>11822
                     /locus_tag="LMJF_24_0050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683471.1"
                     /db_xref="GeneID:5652177"
     CDS             10422..11822
                     /locus_tag="LMJF_24_0050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683523.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652177"
                     /db_xref="UniProtKB/TrEMBL:Q4QAX5"
                     /translation="MIRWAAVLRCGAHGVREDRQALARHHLNLLDKRHWELTTPSRAL
                     PVVEVLIRSGVLMDRLEKSSTKPLASLTPSMTKKERSLVQKLSHMLHQASPPTACRVS
                     RNAVEEDEAVRAAYSAACATGACTIDVVVDLAFVRHLRFPLSALMLLELVESRCVKVC
                     WTRGKPCLSKELLDSICDLFAEHEQSLDFRATWWLLSLLGGGTQVRDWPITLSAGKRL
                     FRLCVRRIHYLLPDLPLEDLLLAYVQLARIEGYEKPFIVLGEMERLLLATSSDEYTGV
                     STNVLLRFMTMPFAVRHADLNLRLCAGWSAASRITEFTQEECLAAFAIVAALHEGCVA
                     ESAAAVAALRDWEMLHDALFAQVFCVAHEMTAADCFRILDQSELINVSGWGITVPQML
                     LEKLKKRILSECTHYAMDECRVPETAELLLRVALGLQALMQRYTVLPSSAADEHAVAE
                     CILLLERCITVLPPHG"
     gene            <12399..>13643
                     /locus_tag="LMJF_24_0060"
                     /db_xref="GeneID:5652178"
     mRNA            <12399..>13643
                     /locus_tag="LMJF_24_0060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683472.1"
                     /db_xref="GeneID:5652178"
     CDS             12399..13643
                     /locus_tag="LMJF_24_0060"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683524.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652178"
                     /db_xref="UniProtKB/TrEMBL:Q4QAX4"
                     /translation="MSYSSLLAALILFFVSLGFANGDSSFNFEAQMILENATVNSDFV
                     VTSDFTELITTALQSVSNPPSPLSTVVQAVPPHLVIVLSMWYTGEPESVQRAISNING
                     TYTRWASGDTLAVSGALSHTCLTNIGQQPTFINYTNSCSSWDALLPPSSNQTCWRNLS
                     LTFYTAVTSQSDPRASLQSSLCSFLPTDCGLITYGDLTRTQITISDSVVTVNVMPFTV
                     MSENREATLATLVTYAQYASVLVEHKIVYILANGVQVFFQGDPQSLSINGTFEQCVKK
                     MWYLVFLIVLVPLFLIVSSCLFQRGRASGKRHIKDSEREIRAGVRFSAAPWTNIGGGY
                     QYGPPQGYGGGYDGVGGWQNAGALYASPQNAPQRLSEQGLQGGFEFWGGQHYDDQYFG
                     SQQYDAQQRVPQESYENRNSQL"
     gene            <14539..>15858
                     /locus_tag="LMJF_24_0070"
                     /db_xref="GeneID:5652179"
     mRNA            <14539..>15858
                     /locus_tag="LMJF_24_0070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683473.1"
                     /db_xref="GeneID:5652179"
     CDS             14539..15858
                     /locus_tag="LMJF_24_0070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683525.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652179"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:Q4QAX3"
                     /translation="MRCTRFWLCGALSHVAEGTGVVKDYQKIDSQRKEVAAREAKKEY
                     EGYPLRYQLLECRPGMPLALTKLKYLLACRRTHPDAGGDAESFLRVSLAYQDVMKDYG
                     VETVDNKIVNLGNFQSDDHEAQNYLEARASISSYIPISTLEDHIRQIEEIQSRLGDEL
                     LEKLTSNSNEAMWLLEDIEDVMEQTGLKTVKLRVLEDGKVRVSDVQMLTDGTERPLFL
                     ADGEAPPERRIPASATGAETAGVNSAPANASTADAPSNPAMEAPQSSEETLHEAEVSR
                     SDIDILNEKNTLQDRQDVAGLAARTATEVMNNTEEVKQMKLESSVLFVFLVSLTTLVY
                     IYIEGAMRAKRQASSRPETMEHVTSDTMLPWWGNDAEYESQVKRIFVDEWRKARASSR
                     RAQTFQDGVARESLDEETKREMDLKIFTVTAEKLRAMRDNAEKHHVR"
     gene            <16887..>18116
                     /locus_tag="LMJF_24_0080"
                     /db_xref="GeneID:5652169"
     mRNA            <16887..>18116
                     /locus_tag="LMJF_24_0080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683474.1"
                     /db_xref="GeneID:5652169"
     CDS             16887..18116
                     /locus_tag="LMJF_24_0080"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683526.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652169"
                     /db_xref="GOA:Q4QAX2"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q4QAX2"
                     /translation="MVESLARAHTQVFFHRNKVMCISAGSTEVAVYDPLCSVTEIISL
                     PYRVVRAEPADHGFVFRSDCNRVFGYDFNKGLTEVMNGCSITGFLGHYKQYAVALLHD
                     GDERVVGVTEAGSIVELDAALPCVPFTSLDDVVLYTSENEVVSLKGGSAVSPVGEVHL
                     SSSQPTDSEVLCTVCLCEFDGDDGITLDCGHYFHKECIEQWVGNWMDFAAKGEHVKFT
                     RAVCPGGCKHLVRHPLLAQSKQISELYTEVTAKKAEQLKHFDATKAQHEFLFYLCGRC
                     GGVFYGGDQVCSRMQGHEPSSSPQELVCDTCIGKDHRTCNTLMAVFKCRYCCNPATQR
                     SFGTRFMCDRCIARWDTAEPALIPCPGADSCPFHGNHPEPVCNIAACLTCLDPAMVSH
                     IFDRVAGVADGAGGGTD"
     gene            <18693..>19379
                     /locus_tag="LMJF_24_0090"
                     /db_xref="GeneID:5652170"
     mRNA            <18693..>19379
                     /locus_tag="LMJF_24_0090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683475.1"
                     /db_xref="GeneID:5652170"
     CDS             18693..19379
                     /locus_tag="LMJF_24_0090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683527.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652170"
                     /db_xref="UniProtKB/TrEMBL:Q4QAX1"
                     /translation="MLLAKKMSSGRIYKFLFRKEQPQWLWDMALEVRLPALFLLGVVY
                     VNTKCYCDSLTAYQAGSRWGITQGKLLELRKLNYRYIIVPRYAVKYEFEVDGKQYVST
                     RGTTGSPYRNWMEGWYYDTITEAEYLQAIPVLRVGERCSVFYDKKNPKAHSALAQDAN
                     SFEISFLGFLAVFPLLMGHYMKAHFWMLRKAYMPNRKMRIRFPVYDHPKPPPSPPKEP
                     QQISQLPPRN"
     gene            <20224..>21063
                     /locus_tag="LMJF_24_0100"
                     /db_xref="GeneID:5652171"
     mRNA            <20224..>21063
                     /locus_tag="LMJF_24_0100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683476.1"
                     /db_xref="GeneID:5652171"
     CDS             20224..21063
                     /locus_tag="LMJF_24_0100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683528.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652171"
                     /db_xref="InterPro:IPR027012"
                     /db_xref="UniProtKB/TrEMBL:Q4QAX0"
                     /translation="MSGECVYDLVSASDSLGAGGNVVNVKPAATAKKSRRAPPPTAST
                     FGIHGTSAVVANAGGEYTDASVHPSRKPIGTFGREVGSTVTPENFLRKNEGPLTASRG
                     APTVDNSAFKKSEYHREKTKPDVPLRNERPVMGLRTEKNFVVANAVENTMAVPTKVTP
                     APQPRATDREDFGKVPQYITEIKEDMTARKQMLEDHKGAERAAQERWSELSASELAQL
                     LDGLQRRWDALNKDYQTKGFNKLETPSQRAHQELVEKQLVAVEFAIQKLSRQHVFVFD
                     DQK"
     gene            <21996..>23312
                     /locus_tag="LMJF_24_0110"
                     /db_xref="GeneID:5652172"
     mRNA            <21996..>23312
                     /locus_tag="LMJF_24_0110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683477.1"
                     /db_xref="GeneID:5652172"
     CDS             21996..23312
                     /locus_tag="LMJF_24_0110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683529.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652172"
                     /db_xref="GOA:Q4QAW9"
                     /db_xref="InterPro:IPR000176"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4QAW9"
                     /translation="MFFDQRRVLTENAPRRPYQNNASTASFECPLLKGLHYGQRKLML
                     SEVEFLVQISMHIKRRCSGAAPKRVLVVYAGAACGLHLPFLFSLFPALDFVLIDPAPF
                     CPRVKEIASKEGSCVLELIEDLCTAELCLRIRRTYHETHDIFLVSDIRSGEPTGMSLN
                     QEHTDMIQQDNNAQREWCFSLEVEAAMLKFHPPYPAAKDSDPANYKAQDATVEEYTYL
                     DGTQLLGVWAPKSSSEVRLIVVGPFKRGYAAPTRRYYCTVHEEQCYAYNTDNRYEKDC
                     TAERLILEAYLSAFPGAYQSVEPLSKELSEQLEYPLFCPLEPGFTEQHARWVTLLYST
                     RKPAALQYFDLLKNDMSVEQVAGLVTKYKDCCEIPAGVKVGDIELTPHFWSVFAAGDF
                     AVVYCFPFVRWEWKRHAHRRQPDKRRDDGRKNHRRFAGKKRTANTA"
     gene            <24133..>25800
                     /locus_tag="LMJF_24_0130"
                     /db_xref="GeneID:5652173"
     mRNA            <24133..>25800
                     /locus_tag="LMJF_24_0130"
                     /product="beta transducin-like protein"
                     /transcript_id="XM_001683478.1"
                     /db_xref="GeneID:5652173"
     CDS             24133..25800
                     /locus_tag="LMJF_24_0130"
                     /codon_start=1
                     /product="beta transducin-like protein"
                     /protein_id="XP_001683530.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652173"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4QAW8"
                     /translation="MKITINIELAHSELYKAAHLQQTVSELDPNAAVRFKTDTSFLAQ
                     RIKDAVKAKQYDTVVSELVHRLSYPASFADSLEVMCSMAFFSKGRVESGEGVAPFVEV
                     LTRLPEEAKAHAREAIVQRAMAFLSKPRRLDCSRAPLIGYAETLAMMTRRELLSVRSV
                     VGTLVQMIENDTTRTAGMTCLGKLMEVAYEAVRNCDAATLSALRGAVRLAQVNDTFLY
                     DVEYIMEAFGWSPYKPALSLRRSSCHHEFPILSLAYCGGANHREVVVSSSSDGTIGTW
                     DGVGVLLQNVLLSRHYASCLDLTNRGHTLIVGAVGRYTNTPPAVIFYNEDGNRKAQWQ
                     ECGGTEPDDASFISSLKCLKDSSGSRYCVGVQTSNANSLMIFDGQHVTQRYFDHTDII
                     TAIHVPSDRENLVITGSRDCSTLIYDLRDPRSVSAATHHTNTVSCITSCDNNLFTAGL
                     DKRVVVEDFRMLRSPNVQRDMESAVLSMSVSNSLQCAVATLTGVYLINFSSSTSVPTS
                     SRSDCGGSASRYNAVCWNNAGTILFGGGEAHTLDLFAPAYELNSFEV"
     gene            <27730..>28914
                     /locus_tag="LMJF_24_0140"
                     /db_xref="GeneID:5652180"
     mRNA            <27730..>28914
                     /locus_tag="LMJF_24_0140"
                     /product="ankyrin/TPR repeat protein"
                     /transcript_id="XM_001683479.1"
                     /db_xref="GeneID:5652180"
     CDS             27730..28914
                     /locus_tag="LMJF_24_0140"
                     /codon_start=1
                     /product="ankyrin/TPR repeat protein"
                     /protein_id="XP_001683531.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652180"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q4QAW7"
                     /translation="MDDGARIAEDVEKFLRAARSRETADCSRMLKEKPELVNCVEAGG
                     YAALHFAAFNGDAETVRLLLEYKADLNIENMDGNTPLVMSVKGRQLGCIRMLANAGAD
                     VNKESHSGSTAAHYAASMGYLDCLRLLVELGAKKIYGESEAGTLLHWACHSGDVNCIG
                     AVIYELKVPINAVDKHGGTALFTAIFMKKMEAVEFLVEHGAAVNIAIANDGSTPLHIA
                     VEHANSECVRLLCSCGADASAKNGEGKTPLDLAKAANNSNAVKELEKAQLPQEKRADE
                     AARFKNQGNKVFQQGENVKAAKFYTLSIHLDPTNHVYYSNRAACYFNQHFYTGAYWDA
                     LRCIALDPSWPKGYLRKAATELALKKYSDALTTASQGLKLDPTNKDLQQVKDEAFKML
                     KK"
     gene            <29857..>30519
                     /locus_tag="LMJF_24_0150"
                     /db_xref="GeneID:5652181"
     mRNA            <29857..>30519
                     /locus_tag="LMJF_24_0150"
                     /product="glycosomal membrane like protein"
                     /transcript_id="XM_001683480.1"
                     /db_xref="GeneID:5652181"
     CDS             29857..30519
                     /locus_tag="LMJF_24_0150"
                     /codon_start=1
                     /product="glycosomal membrane like protein"
                     /protein_id="XP_001683532.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652181"
                     /db_xref="GOA:Q4QAW6"
                     /db_xref="InterPro:IPR008733"
                     /db_xref="UniProtKB/TrEMBL:Q4QAW6"
                     /translation="MSVVGTLSTYMAATDSRDKMIKGAGCFFKLMGALYGNPNFMKAG
                     AAMSDARCLIRMLSWLSNVQKISDAMEKRIVQPRDVLFVLRVLFDGIFSLLDNIVFAG
                     RFFNPNSPSLSQMSYVSRASLFYGYAVAVVLDVYDLARDPKMPKRGDRYLVLTRNACD
                     MVSAIGNVCTVDIGGVNVAGLGLISAIIATREQLLAAATKSGGNTIGTIPAKAAAQQP
                     KK"
     gene            <32295..>33164
                     /locus_tag="LMJF_24_0160"
                     /db_xref="GeneID:5652182"
     mRNA            <32295..>33164
                     /locus_tag="LMJF_24_0160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683481.1"
                     /db_xref="GeneID:5652182"
     CDS             32295..33164
                     /locus_tag="LMJF_24_0160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683533.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652182"
                     /db_xref="UniProtKB/TrEMBL:Q4QAW5"
                     /translation="MTTLEKQLQSSTLSKQCRADLLNHVEEVETNSRRLPKKMITLPD
                     PNLPSAVTMPTDNSVKRGTRSATAGANMARSLHYTTRKREKDEMVASRITSDRNLSGT
                     YFKDCSHKFVNGARSWSDPFRSSRSRTALSGKDMDFVYRYAEAATGSAIERPQPADDA
                     SVAATAAYRKAFRQYKGRDPTAKEMEEAGRLVYAFDENCSVGVLQKPHSCYPHTHISA
                     VKTHIRACPNQVYLPEVPPVRAARSEFPGPIPTWSSTKRTTTMATNGTYRPGHHQAKS
                     LKWEAVSTVVGSR"
     gene            <34095..>34823
                     /locus_tag="LMJF_24_0170"
                     /db_xref="GeneID:5652183"
     mRNA            <34095..>34823
                     /locus_tag="LMJF_24_0170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683482.1"
                     /db_xref="GeneID:5652183"
     CDS             34095..34823
                     /locus_tag="LMJF_24_0170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683534.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652183"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR024253"
                     /db_xref="UniProtKB/TrEMBL:Q4QAW4"
                     /translation="MERTADQRIRTTEWEDVQYRYGNRVGKYQTHELEILAQQIADRN
                     PNTCLIAYDPQAEKVAAKLERGGYECDKGGEEEGTNFIVDSDDEDEALAAIRRRRLME
                     LQRQKAMECFGVLQHIPGADYVAEVTEASSSCWVVAALIKPGHSDCEALLTVLRTVAQ
                     RRRSVKLVSMIYTEAIPNFPDRLLPCVLLYKDKELKKQITGLAGWQAQKRLSVATVEL
                     VLSRNGVLPPIEDDGIEEALEKDE"
     STS             35091..36075
                     /standard_name="fa14e09.s1"
                     /db_xref="UniSTS:202387"
     STS             35111..36075
                     /standard_name="fa14e09.s1"
                     /db_xref="UniSTS:202387"
     gene            <35683..>37290
                     /locus_tag="LMJF_24_0180"
                     /db_xref="GeneID:5652184"
     mRNA            <35683..>37290
                     /locus_tag="LMJF_24_0180"
                     /product="putative ATPase domain protein"
                     /transcript_id="XM_001683483.1"
                     /db_xref="GeneID:5652184"
     CDS             35683..37290
                     /locus_tag="LMJF_24_0180"
                     /codon_start=1
                     /product="putative ATPase domain protein"
                     /protein_id="XP_001683535.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652184"
                     /db_xref="GOA:Q4QAW3"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QAW3"
                     /translation="MSVDGHLIADVQRLRQLGEQSLFLLVVGGKGAGKSTALQSFTSG
                     LQVATKARHAAGVHDCVLTAPAAASSDDDFTLWTLTYASVAHSSSTLGALSTRAPLLR
                     PFSIIVADDIDLLWLLCSMNGFLPLLQRLLHAALTSSSCAVVASAPSQNTVPAWLLEQ
                     KVPALYPLRELTEAGARRLLRSVPQPLFKSHGELLISAQAPFTSRQVFLFNACMALEA
                     ASHGATGEKLRSLVQEDCTFLHHQRSPTGAQRAPPHLYGLGEVRHRIRTLVSVFAAHS
                     SPGGGGRLMGSLPSSTGLLLHGPSGCGKSSLARQTAADFQSIPFFFVECTMLFSKYLG
                     ESEAQLREVYRQARTRPPAVVVLEDLDVIAQSRGAMQRGDGDQSSGNGKSQLDVTRRM
                     LAGLLCELDGVTDNSGVLTIGITNAPQVLDAAVLRQGRLETLVYIPPLTQDGAEEWCT
                     HFFERFDGTEEQRRECVVMVASHAVGCAAASLQYVLRKVFEASALRHGWDAASAGSLP
                     LPTLLEIQGHLFESCSVLRRVEHPHFE"
     gene            <38378..>40819
                     /locus_tag="LMJF_24_0190"
                     /db_xref="GeneID:5652185"
     mRNA            <38378..>40819
                     /locus_tag="LMJF_24_0190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683484.1"
                     /db_xref="GeneID:5652185"
     CDS             38378..40819
                     /locus_tag="LMJF_24_0190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683536.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652185"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="UniProtKB/TrEMBL:Q4QAW2"
                     /translation="MDYRSPFELRQQLLEEARASQSTLPPKKWKSKTKGSSGGNSDSC
                     AAPLPRQCTVGKDGSGFMPSTALPDDPTALVREVPGAENIEALNAALEREEAVQRYVE
                     KEKLSVEESAKYIMANGSTMQRISFFGHVREQLVELPSKGISKVLETLLDSMWAQDPE
                     LQCRAPENLLKLVGLLDPNTATKMYDFTKTMLTVQTPEIRVAWCELVLGLIDYLPVSV
                     LQSDLIVLAVNKSEHAQPQDQRELSCKLLGALCQHISSDKVEELILPRALALCQDTNV
                     GVRQRMCQQLCAIAHSLGVEKAKTRVAPDLFELLSDEEQAVSRAAFSCLIDLVEFFGP
                     VYRREKLFPIIKNFISNPPSEVVGLLVGEFGRFLDAIKTDIVSDDDVKLFADFFCAAA
                     TRHEEEARRQCAFNFPAVVASLPRTVFATHLSKALLSLSSDSCVAARVSAAAGMHELL
                     PLLHSPTADLLERPFLRLIGDPDTFVRAALVKHINNLLDYFRSELKSSSRVSFFSAVL
                     DALLSWVSEPVVNWHTMQHVMQIVDHYIASFEERTLTEQVVPRLWEYAKTGATILKAD
                     CATLIMHIASRIENSIVKAQMFSRLNSEYGRSNSCYARQTYIYFVSASFRFFSMRCVR
                     ERMLECCLELQRDSVTAVRLALARSLPLLSQTLRKSNAGALEEEFAAMVGRLCEDVDE
                     EVQEEAAKYVAGCKRHAGADAAAPSRFNEEVDGRRERAELAMLEHAKETDKAERRAKL
                     RDLLKSEREKELMELPSPPKGRKPAPPASTAPLPLARRHGSKISMLPAANTVSLPRIA
                     TAKQTPARTMNRKRP"
     gene            <43931..>44848
                     /locus_tag="LMJF_24_0200"
                     /db_xref="GeneID:5652186"
     mRNA            <43931..>44848
                     /locus_tag="LMJF_24_0200"
                     /product="transcription elongation factor-like protein"
                     /transcript_id="XM_001683485.1"
                     /db_xref="GeneID:5652186"
     CDS             43931..44848
                     /locus_tag="LMJF_24_0200"
                     /codon_start=1
                     /product="transcription elongation factor-like protein"
                     /protein_id="XP_001683537.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652186"
                     /db_xref="GOA:Q4QAW1"
                     /db_xref="InterPro:IPR003618"
                     /db_xref="UniProtKB/TrEMBL:Q4QAW1"
                     /translation="MSDSEWSSDSGVSNAEAIAAASLNKHLGELMTLQHPSRVTHRRP
                     AYATSEGTTASSATISHTPRVSGEAPRKQARMDISSLIRQALSQSSAHCTSANVDEVA
                     GRVVAALRQKAGGAEVARAVTRALADPLNEELRESVLSGLLRPEELVALDEVSLLNQA
                     ERSVLAKARRERLNQHSVEYLERLNLTVTNMLTCPECRSHECYANFRFTDFVKWQGDD
                     QTPTLQRCCRCSVSFCNERGKRAASAPGACLCAWVAVKVLSATTASRPCIHPSSNRHR
                     TARRGSTRETGKISRFSSCRTRHHFCQKR"
     gene            <45650..>46651
                     /locus_tag="LMJF_24_0210"
                     /db_xref="GeneID:5652187"
     mRNA            <45650..>46651
                     /locus_tag="LMJF_24_0210"
                     /product="putative transcription elongation factor"
                     /transcript_id="XM_001683486.1"
                     /db_xref="GeneID:5652187"
     CDS             45650..46651
                     /locus_tag="LMJF_24_0210"
                     /codon_start=1
                     /product="putative transcription elongation factor"
                     /protein_id="XP_001683538.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652187"
                     /db_xref="GOA:Q4QAW0"
                     /db_xref="InterPro:IPR001222"
                     /db_xref="InterPro:IPR003618"
                     /db_xref="UniProtKB/TrEMBL:Q4QAW0"
                     /translation="MSDSVQLPASSEASPPSPPPPPGVPTHSVSPLAAPSREAEDVQH
                     SSAASPLKRPRVAEPVTHFLTPNALGGLRHSSNSVSPSPATLTAERVCHDAHADTDAV
                     SPKQARVESRSVTPRSPYSNLPRKIPRKTPVSSPTSSLANSTLVTPPTAAAASHACTS
                     APSVTTAAKRITLHQRWAALLHGVLMKERPSSESERVMGLCVRIVESIPGDMEQTKDT
                     FQTLLFNIKDSKNGELRRKVVEGELLVERLVTMDDLELANPELRKHIEEKIEERSKDT
                     NLSEIRKAMRTSNSTLFKCRVCGARDSSWEQRQTRSGDEPMTVIITCNKCNTQWRKY"
     gene            <47618..>48640
                     /locus_tag="LMJF_24_0220"
                     /db_xref="GeneID:5652188"
     mRNA            <47618..>48640
                     /locus_tag="LMJF_24_0220"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683487.1"
                     /db_xref="GeneID:5652188"
     CDS             47618..48640
                     /locus_tag="LMJF_24_0220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683539.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652188"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4QAV9"
                     /translation="MRVTVKWFLTGRYSVIEDSDAILSPDTTIAELKGLIQIRFGFAS
                     NELLLILDHLLENTVTLRSLSIMGQPCDPIMTAHVVRESMLEMSNLGDQDDTSKDDDL
                     HEFSHADFILAMKMLGKDVPVPDDRLVAMRLNAPRQRPVFLDARREGEDDAAGPERVP
                     QPPPGMPGLAGCEIPAYDPKKTEVYQIVSRVRYGPRKEGVDTEFAIQYPGVDEPFPFW
                     DMRTPDPFARIDGQCAPGEVCLELFYFGDFDAVKDQSSFLLVVRQSLQSKAGVRLRTP
                     LPLREAGCMYPLIAAPIVLHEMDAMELGDIFFEDFGKVESARPLKRNSDGAEVAGSGG
                     LGCAPQ"
     gene            <50785..>52401
                     /locus_tag="LMJF_24_0230"
                     /db_xref="GeneID:5652189"
     mRNA            <50785..>52401
                     /locus_tag="LMJF_24_0230"
                     /product="putative protein kinase"
                     /transcript_id="XM_001683488.1"
                     /db_xref="GeneID:5652189"
     CDS             50785..52401
                     /locus_tag="LMJF_24_0230"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001683540.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652189"
                     /db_xref="GOA:Q4QAV8"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4QAV8"
                     /translation="MEGPSDKLLREPFQASLKRERSSSYTTERGRPTSPHLRRLRPLT
                     TSSSEGKGAADGDGEEDPHARRHAEPELFELTPLGGTANINVRATRFGVEGLRIGRDP
                     SCCDLVLPSNLVSRLHCVLSVLGDDVFVHDNSFNGTFINGRRVGRGRCSALHPRDTLS
                     FLNPTLEEASRCGFEFASLPGHSSSGFTAVEGLQRYELGPVLGQGSLAAVRLGIDGET
                     GAPVAIKLIERGRFSCEEAAASLHTEIEMMRSMDHPHVVRVVDAFEGSGCVALVMEYV
                     RGGDLFDYIVGRGRNPFTEAEARHLFGQLLEAVLYIHGRSIIHCDLKPENVLVDVVKR
                     GTDDEVDTTSASATATATTLQTDGDAALSVVDDHQAEAKAVSPYDVRLKLADFGSAKY
                     EGGGAGGGMLETTGAATPVYAAPELACFPADGAPPQEISAAVDVWSLGVLLYILCSGT
                     VPKPPRSDTVVAFNRSMTHLSVLCKDLIARMMTVDPSQRPSLADVCHHPWLDGVTISG
                     APDRGALGSKDVLSVTAKLSPSFPEAAKPL"
     gene            <53425..>54825
                     /locus_tag="LMJF_24_0240"
                     /db_xref="GeneID:5652190"
     mRNA            <53425..>54825
                     /locus_tag="LMJF_24_0240"
                     /product="WD repeat protein"
                     /transcript_id="XM_001683489.1"
                     /db_xref="GeneID:5652190"
     CDS             53425..54825
                     /locus_tag="LMJF_24_0240"
                     /codon_start=1
                     /product="WD repeat protein"
                     /protein_id="XP_001683541.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652190"
                     /db_xref="GOA:Q4QAV7"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR022052"
                     /db_xref="UniProtKB/TrEMBL:Q4QAV7"
                     /translation="MESGADVVCTGKVPPPVDAVSQTSSTAAAEEATSYQETVRFCTW
                     RKHVRNLYQHLFHIDLVWESPVAQFMPYVTTKSGLTTHTILSGTRTGGQEQSYIQLLS
                     ATVPQDTQALDGSDIAYSEATGEVGGYGMAPHACGLSIERRILHDGDVLAARYAPVNP
                     LLVASSSSNGNLYVFDWSRVPLGRFPNEPPRPRAPLPPNELSSDATEEERAQYQKRMR
                     ALNVVVTEQDRWDRRTGEGQHVLTLKGGNGASENLDWSTNAEGVVASGSTGRVCVWRV
                     ANLSKDDSRQVEPFKVFSLEDEEARVTQVNFSWTSPDTFVAASSTGAVYFNDVRMQHT
                     TEVFSIENAATSLALSPLDGNALLVGDALGSVRFFDLRQSSKPVQVDCLHDDEVTTLQ
                     WCPHSRHLFSSGGHDGVVCIYNQTRHKALFKHWGHTDVIMDLGWSWQEDGAGHLVSTD
                     SNAIMLWRPRDFFYCA"
     gene            <55829..>57646
                     /locus_tag="LMJF_24_0250"
                     /db_xref="GeneID:5652191"
     mRNA            <55829..>57646
                     /locus_tag="LMJF_24_0250"
                     /product="putative ATP-dependent RNA helicase"
                     /transcript_id="XM_001683490.1"
                     /db_xref="GeneID:5652191"
     CDS             55829..57646
                     /locus_tag="LMJF_24_0250"
                     /codon_start=1
                     /product="putative ATP-dependent RNA helicase"
                     /protein_id="XP_001683542.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652191"
                     /db_xref="GOA:Q4QAV6"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QAV6"
                     /translation="MSEAEVQTEWSELLLDTRVLEALEDLAWKQPTAVQSACVPLALK
                     GKDISIQSRTGSGKTGAFVIPAVQRIITEREQRSNARALPNPCVLILVPSVELCEQTA
                     EAAQLIAKYVQPRLAIDNLTSGGAVTARRIQSAHIVITTAALLAKGCSQGTVTADTLQ
                     HVRLFVLDEADVVASMAERSLRTVQSLLPPSMQVILASATLTKGVAAVKGQLLRHPVN
                     VVLTSEDVEELVRGDVEDSAASQQGLVVESRVRVRDPLKKTLHQYYLVATDECHGHTL
                     LFGLYRMALITGKTLIFVNDDEQTYRLQNFLEQLGVATLAYDANLPINVRLDTLRRFQ
                     SGMVSTLVCTDGTLESAMQLQASLEEPQPGEKGSDGQLWSSSSRRRPRSASVRGRANT
                     EAPSALHRGIDFAHVRNVVLFDGVEATDPIALSRYTHRIGRAGRAGEEGVSIAIFTVP
                     QARKYLRPLQEYCRERGDVIRPFRQMQRAEVAKLQYRVDSVLGNITRASTRKMRVASV
                     AAELSRSSYLANHLSQKDTDALQRVMRRSSKRIRVERNILEVPEYMHLSTADDVGAYR
                     KRVQAKQTQSNRLRKATQKASADPLKAVVSRLRSSKRKA"
     gene            <58754..>68272
                     /locus_tag="LMJF_24_0260"
                     /db_xref="GeneID:5652192"
     mRNA            <58754..>68272
                     /locus_tag="LMJF_24_0260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683491.1"
                     /db_xref="GeneID:5652192"
     CDS             58754..68272
                     /locus_tag="LMJF_24_0260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683543.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652192"
                     /db_xref="UniProtKB/TrEMBL:Q4QAV5"
                     /translation="MTTDASPVNPYLLFSRADEFSTDAKIDYALRHNHLYTSRGDSAT
                     FAPTPLNTELDRRTLVRTLEELKRGVSLGDRLLPVTPSTCTTHNTTASAFSSPEDTAS
                     PQFDAPNDGDASNVFFDGIDDLDTKPWDTAASSQANYWNWQMEVLYQSYHIWIALDYG
                     RGVFSITRNGVVLVDRMPTIVASILQVVETTLHAREQDLQQLRSFVEGAIADEQTRSR
                     VMQQVWSPTVFVSVVLLNVPHEVEKAVPFSRPTSSEAEAARSGVHRQRQRHQPSIIMY
                     PPEYRRFTPLENDDSEHSRCSAVTVLFHCDARKLLNDGTFLDRLRDLLSRYESVYRER
                     STPEKWPQSSLGASLEYLVCAMPEKTPECNTLILVSKVGAKASSEAFNFLQSTVRRKN
                     LIVSIVALNRLLAFDSPELSPLVRFLSSVGGFAAHVDYWLALAAPRLNNEWCRKFEGA
                     RCLAQQIFVHLIKGFPVTIPGAARRDLLADAVGEPVVLYDGDHDLPDFVIGASTKELL
                     RASAALRFNQGWSVLIDYRDESATSHMAARYDHDFHRGTITLHYEMNINRPAVYRRLL
                     VSGTKALVDRFCKTRWDDETTNWVGEDSGHWLAYLSLLRLRVIMWMKAEQTLMQLLNA
                     GPRQTPMNAIPDLAHLSSAEGMLSQWFNVSTVYSLGVFFRFEQLPPSMLVSYTRAQVA
                     NGAPTEAAARACIRTAMERRHRLVGREEDLTYMHTETVTTPSFAGAANAARDVFSLVQ
                     FFPQYETSSGSDFGLAGAFECRVSCVLCDRATQEALICALLSDIEEAVSERNKATARR
                     DRHLLVRTSHHTENEQALRLVKTSLSTRRMRLLTSYVEGKWHPGADAGSAVKKEKGMF
                     KLGFPLLFRIPLLSFPWPLLNALCFRWILGCSEFYPFLAEEIFSHIVSRRLHAGFVLI
                     VYYTSSLKAVLMKRVGDPETHSHVCLFDVLEAIPSPTSTSVPAAPISLRRFVTPFKRA
                     QSSQWTYTHDIEEDMHIATAVFTCKVIATQQPSKRSLLARQMRERGFSPIVARVESIL
                     FSLHVRYTEYVELRSPPSLGVKGCVQLRERLLNIVSCVGDRSAVVKARMLQADYVQRL
                     SSGADVVDPDTDVYVSVLCPMRYKTALCVLILESDTEAGTGRHVVKVALAALDGQLLE
                     YAIAQQYHHSRPTLPGGDTAAASCSEECAAASPSHSAMPECIADRAVVLSLRHLLTVF
                     TSVYCARELISFIKRASAEMAAPAVAELTDAYAHLGNYAVEMDVTHLLNIVQWRCCAA
                     AGGLPWRSKVQEVLTGVLASQQRSFSAHPTLWLPKTRADRALPRDEMSCGGASSPYEA
                     ADDEDVPEYDGANDGLSATRANATSEDGANKGKSAHPDLLPVAVKACVLLPLSTSGVG
                     IEEKAECRWLSSAFNSCDERRQNTLRERSEWAIPSASLKDSTATVSSSSEAVYAAVER
                     LKLRLFVKTVPADLLSLCEDESFYPPQTAVRRTLRLLYYRFTSEEAPAAVGGPSMSQA
                     ASFVTAPSYLGAADEAATTELDELFAQPMAVAWDRQRCHDAFHSCTDRGSLPIRVGQV
                     MQQIAERLKWRVAVYCLQNACYCTSFRQLKARVDAEPATQTAIPGVTTDGAAAVAAGE
                     RRDDKARETRLRDPVLSHNESVRATGLTENAELHALLCDVVTPALLSSHRFVCDTFPV
                     EFTQQKTNVGRVVPEEAIKDVFRHCVDEDWMWVLPTLPLTYVVVPNREHFGERWVLVC
                     ATTKPSQGVSGARVLLYDAQGTPAALETMRSYSSHLRTHMCNKIKQVSQLHLLKQLRE
                     SFNASAELIPPAWGDQFSQSSGAPGCSGSAYHGSPPLDSQDAYADGSPFYLSGRNVLE
                     IPIYYKLQHQCKKILHRIQGHCSRLELVAIFNRDQCFLAADDVEGDTFHYLRLVFVKD
                     TAHTVSVTSRPPPLTSSDRCPQLVVQLFSATPNASVQRPLQRLQDFCYFLAVQELQGH
                     LNYVQHKMISFNDLVFLQNQRLEPIVVNLRTIFDIALSDSDHDAPRESSRDVGTCQER
                     QREIAIALLFLNLREYKFKPFGVQDEPTHATSNFVEHYNLEKSLNLEPAKDAAPRPNC
                     GSQALQAWRFVKIVDGLTDVLVSCCLHVHPDNPHVIVLDRYLTRIPAERYINGDSENT
                     ILAHLGHSVEKTISQLRFFGLTSPGHPSFPLLRSSVHTTVGELLRISQETSSKDSSLL
                     RYRHFSLDNVNLAVLPMLMDRICGALSHYGPTCFTYTAGRAAKGVVHVPNFSWKWMES
                     IQNDAMADLLELYVTCGYDVMDSPEATAPLAPTRVVPYVVPGVPITSVTIEESQMSLL
                     GEYQLCERGCPLLEYRIVLSVSLTEGLSLALFNLRDTEYVVRLLGYVVLAMEEKSALL
                     EDVLLQRMGYAVPSFFSEADLARNCCGDDTNVIRTKSLSISFDAYRRRVNNVRFRPQP
                     DAERDAPLVVILEGLYNRGLIVNYAFSLEDAVKVLFDECPQYSLQECVRVVDALLEAH
                     VLCDYPSSVLKPQISVLASLPHNEQLRSDARNCRLSEVSGVPEDALVACVYHRHILAS
                     HIIVEAQNARSGVTEVLAKCDMLWRAGPQNNVLELAKAIVTLQLKSKEVFGTRVPDFS
                     LRRERWRHEDDVLDPILPTQTQQNMSYARPVDASLQLYTEHLHQLYPSMCIIDLDPND
                     PLTTSDEVLLNRLRCRYGKVTSEDGGVVLFSPHLYYGVIPFVDLLRCGTFYERYGPLA
                     DALGEEAIVSPITTSGLFIIEVGFQVVHYALDFFVINGDAVPPGITAKVAADFKQTLL
                     FESVLYDAAVRSLAHCMRTHSVALSGQQKTYMAVKNLVKYHPFPPMHCANIVAAYTIT
                     DPRVMRLKNLTPGGAANSGDVHVGTDGVLYLSPHKHHLLQREQTNDVYMYDGLIIWER
                     AQLFVLLTSTTGVSKASPESNRYLSQLALSARHLLLNQLLDSTQQERLDVAWRKFLTD
                     GRVAATTARRGNMERELPSYDEFELLRGHSHKIVLHSYVPMLQMILEPVEWSGDGWRL
                     QAVCAQLYPEHVLRVIGRQRSARDSPETSASTPHARHYDLNTSSPAGAALPRHAAAAS
                     IAAGPIGGYDITRLFMSPCLTGWFVVTFAPSKAEESGCFLAMECFSDPHRPFGASVVV
                     EELSLYCKPSRALHQHRVMTFLSEMEQALVERFVRLVNSAVWSSIVPCVSQFMM"
     gene            <69390..>73403
                     /locus_tag="LMJF_24_0270"
                     /db_xref="GeneID:5652193"
     mRNA            <69390..>73403
                     /locus_tag="LMJF_24_0270"
                     /product="putative protein phosphotase"
                     /transcript_id="XM_001683492.1"
                     /db_xref="GeneID:5652193"
     CDS             69390..73403
                     /locus_tag="LMJF_24_0270"
                     /codon_start=1
                     /product="putative protein phosphotase"
                     /protein_id="XP_001683544.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652193"
                     /db_xref="GOA:Q4QAV4"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q4QAV4"
                     /translation="MHASWVSAARLFVSPHTDTVQLTLLQPGVRTYVDGQRLLRIGSP
                     VEVLATQRISFGADPTSYVVTPAPHSLVPGTHAACPPPPLAVPAYPAAVTREGQTSSL
                     FTSPSSCVSPRLGCSLPPLCVDEEGERDTATAVSTSPEALTAVVAPANMESRQSGTPR
                     EAVSGSPLLAAPRASKMRGCCLTHASRSIAVTTTSTAENASAVRRTTEKCAISAPATE
                     RTSTDLLVECTATVARCSADVVSTTTGAALPPAYSKEERLGAAACSPSQGLTGEHAHS
                     LASLCNETAELARRGIFKGESRARAHLHNRPCWTLGPVTSVRSPDWEVLRAMQGDTTP
                     PGPKGIYQLSCGSVGFDEAMTHLRRGRVGPLAPSAGEVRQRPQPLRPRLQRAGAARHC
                     GARHSSRGLSLEFTERTSVDVEGEGTATATHATPLSRDEAVTEPSSVLSSDLTATQSA
                     RQRPYMREKLHLFPRVPVNPFIVEAFGQTHRYRPLAHLSDTPQADSSCSSAKSEDGSA
                     PVDVFDRFAGVPWRHPIVADEMVTPRTAALLGDILRRRPDSTPASEDATFLHCALRRS
                     YDADKDRFSYVDSPAFVQLIYTRFSSLLTAIKARMQVSRPVLRLSSPLLCGGDLLGSF
                     ADLMVLLGSVAHFAHWSTMHTPLLLLGNYVDVGWHSVEVCMLLCCWAYLQPSKVHLLR
                     GPHEDPTVNGNCRLLGKRCLRYKCRQRFGSRRGIALWAQLNDVFTLLPVAAVIDERVF
                     ATHGGVPLLRASTAPGGEEEKGAAVRRQRGGKAPVHCLYSGTSGSPTPTSSDANTTVS
                     SSCRLSAGVCAGERRTACAHERGGDDARESVLFAALCPFDMRYHRSQTPVMEKPRDAI
                     TADDAEAQNDITAIGLLSLAPLSGYQVDESDGCPRASTECAAARGAVVSATALPSSPT
                     PPSSTVPPPRQGMTGVAPQGRCDMSAAVALPAATTQAPTPALVSPFSRAADTRFIAAA
                     APSHSEALTRTTPACSTPSAATGAVRCVAHGGRVATQRSTDACREASSSLERSRREDF
                     LPFETLRQGCAPPTAAAAESSPAPCSAASACVTGSEVRSSQECEADTWLPSTHTSVDE
                     GAPSEDDFANLLAAMHTGEYAFRTLQCSTPLESQDVTRRLRLVRELLWNRPREATAKL
                     LMPEEELDSDGGNAAAVPWWRPYRVEGCCCCCPAGRAHRCCHTFGSGALIRFFLRFRY
                     SMLIRGAPEDPSELCGAELSEEGRLLTLNTCSRRCKTVLQAAACVVESQTLRLATWGS
                     QELADSLGQLSLSSLPGVRETEAARADFEQFVCNTLHTRLRDHHIVGPADQWSVLSAY
                     KTYIQRRAAASASSRRL"
     gene            <74278..>76338
                     /locus_tag="LMJF_24_0280"
                     /db_xref="GeneID:5652194"
     mRNA            <74278..>76338
                     /locus_tag="LMJF_24_0280"
                     /product="dynein intermediate-chain-like protein"
                     /transcript_id="XM_001683493.1"
                     /db_xref="GeneID:5652194"
     CDS             74278..76338
                     /locus_tag="LMJF_24_0280"
                     /codon_start=1
                     /product="dynein intermediate-chain-like protein"
                     /protein_id="XP_001683545.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652194"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4QAV3"
                     /translation="MNTVASPRASIGKHRALHSAAAGNAVRKQSSGGQAEVIAAVLGR
                     ESNKPAAEVVVERILKAADPHVMSVPVYYDYKKDARVYKCFPSTRQVSTLFAMDGNTI
                     AKDSLEALQQEEDRHRRIQEVEVAAAAETNPDLVEEGVSTRILKNQFNYSDRGSQTMN
                     QPMRERTVMTDPPPSASFGALATAWAIYDAYEGERIEAEKAAAAQRRAAQAARASKDE
                     ENALTHAAAEASIRDGADVGPKGVVELLASPEFRSALQVMERMVNQNDCHDIIDDFKY
                     WEDQSDCYKEDGTLLPLWRFFTEKTRKKAVTAIALNGRYSDLFAVGYGSYDFLKPCKG
                     TVHCFTLKNAVPTGSGAPVPAHPEFSFHLDCGVLCLAFHPREHSLLACGLYDGSVCVF
                     DMRVSSHDAGGANHGRPLYRANVRTGKHMDPVWQIMWMESTSELSFYSISTDGRVANW
                     MLRKRELTSRDVLKLSTGVCTADPEQMLLNELGGMSFDYSPAHDKMAVGTQEGNLLLC
                     TVSHNGQCVERYEGHSMAVYTTRWSPFHPDIFLTCSADWTVKLWMKGSPSPLVVFDLG
                     DAVGDVAWAPYSSTVFAAVTAGGKVCVFDVAQNKTEPLCAQTVVKNAKLTHIVFSEAD
                     PILFVGDTRGTVLTLKLSPNLRKVSKPGKGEPTDAAHIKTLEVEKLNHLVEVTMKDRA
                     LLGV"
     gene            <81036..>81752
                     /locus_tag="LMJF_24_0290"
                     /db_xref="GeneID:5652195"
     mRNA            <81036..>81752
                     /locus_tag="LMJF_24_0290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683494.1"
                     /db_xref="GeneID:5652195"
     CDS             81036..81752
                     /locus_tag="LMJF_24_0290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683546.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652195"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q4QAV2"
                     /translation="MVGLVKPLFPNTLLTEAQDERRLLTLVLDLDETLVSNRDSRQSA
                     AVLRPYCLHVLNALRHMKELEIVLWTASTKETALPVVDQLHKTGIIFDDIIFRNSIWF
                     TQPIHTKDLRLLGRDMNRVLIVDNSVGCCKLHPRNALLVEDFHGVKRREDAALVNVYY
                     VVDALLRMMRERTMPVSEGLGCLMAEGQLCHPVSYDLPAFFKCIPLTEVPELKRPPVG
                     RFARANTAPPNTSIMQHWVY"
     gene            <84001..>89361
                     /locus_tag="LMJF_24_0300"
                     /db_xref="GeneID:5652196"
     mRNA            <84001..>89361
                     /locus_tag="LMJF_24_0300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683495.1"
                     /db_xref="GeneID:5652196"
     CDS             84001..89361
                     /locus_tag="LMJF_24_0300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683547.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652196"
                     /db_xref="GOA:Q4QAV1"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4QAV1"
                     /translation="MSRGVKSSQSSAARAMVSSMGTPAGLSSFLGGFTTGLENRANAE
                     LESDYVVGLKLLNKTSEITKQKAFDRLLELMKSTSDQVLLQFASATVEAVIQHARHPK
                     PSIRTSSYQLLQALMSKNKELKKTIVPELKVLSGVWVMGMNDMETAVCQAAAAAFDVA
                     FPAEKKTLMLQQLMDAIMVSLRTAVEEVMASKKPLQDDALDPNANKIYAALKSMGYMV
                     KQVSAAQTAVLKFVLDPQLYGALLPPREAPKSYLLVKTPLARSAVLALLRDVVSFCPA
                     SPKVHQLVSQALFGSILDPNVAMALRTWELLLFWCRSNVSDVVSHMKGGFLDDVVNCF
                     MGCQHSELGEVIFPCLFPLLTSLSKDARCEGILDEFCAALVERLSVMSETPNVSAHDL
                     GVVLTALMECWELHCVRKKTSRVSEDSVELLTVISFNVVKLMQTEAKATRYQAAIIAA
                     MAKSLLKTANRCEDVCRQCLTVIGAQPGAAFRVLPDSPEPAVQRSFALFQARLLGRLC
                     ASTSTPPPPAPAATTTSPTTRTEGASTAHGKALVVDVANTWLLQQVAVRPDEQKWARL
                     AAFFDETRDTQFYPSDAVADAVLDILCAYVRHTHGEDTSAQAHTRESRAALATLIKAG
                     LEWKHRPASRDLMEATSSTQEHTLKEAALRHLMQDPARLCEVLTCAVAQCDVVGVSQC
                     VAVYVERELTLSEEQRRGVLEALCTSVKETLAMVTESAADSDAGSTTTSDSASRYSSS
                     ETSSISSASSSTSSSSTSDSGLGSDMADVSASAAGGGDTANLAPEARERMKKWGQLLR
                     SGGAFAGLLHLDAAYVVGHLLTPLSYISAAVATRVFVEQYISVKAMRVALQRQQHHSE
                     DNDDLVAYAMERKVHWSSIADCNAVTAEVGELLDSYSVRAEDRDAVAMALLHSVFSDD
                     DDLPLSFFAVYRLSQLVPYASKACLESFATSESGWQQAAVEVQVAALASNESALSLYD
                     GYLSLDLLRPTFTTTVRTAQLVRLIDSVDGAAAAVAMANADPKTVARVFGQLLRVAAA
                     KEVLADGVRRTLFGSVFPAMLACLDVAEVAVEVAALVTSTEGPMAAAGVPYLLPTLAA
                     VLRDVAQAEDTVFLRRAVRLVSAVSSTAVTALFHAEGAKGISPVLAAAYTTFFSVLDE
                     VADMLRFNIAAQLPAEQERLLLEASCQLPTWDLTTAKLTLVVLRHLASLPAVADSTVK
                     SLIAYASKQTPLSGLELLAELSCTRIPTPDVYSELIRVIIDALCRCHRLRHLPSNGRL
                     QKESGGSLMGSAPAALTTLRRVVMAAVLARRGVVLHSRMDSVLRSTVNLVVFDAVCEA
                     VSQLRSTKEGEVAPLAKLIAFTSRFMGDLLTSDVMTLRGSKMSVEKIASVLCFAYAWL
                     FATGIAKLEQLGVSTVASVIRSVCLLANLTLMRVTVPLAAPMQTIMQRFSLKPLREEY
                     STAQPAKVAQFRHQNSVLTKTQKQKMLLFPYLLSWCVYLTSAPPPPTEEAQGTGSNAA
                     CDKDWQRQVYSLLDLLFALMLTPMERVSTRLDSTFIGASLNPGAASDSSATGPLGFEL
                     VALTRVDAPDQMAQLARGAFAVFTQLLHDNTLSLTKSWLETVERKGRALFYSSVGQHI
                     TGILIQESFLSVLRHSPDGSSSFSVGDGCSVEVNVAQQLIDLSYEMEDAKVAVRITFP
                     PAFPLHPPVVEYETGRECGVSLKKWRSWMLKMSVILFGGSANVWECIDLFHQNLDAHF
                     RGIEPCPICFAVVSHVNHKLPDVRCSVCHNSAFHSNCLYTWWATGSNNVCPLCRSPWI
                     AE"
     gene            <90369..>91328
                     /locus_tag="LMJF_24_0310"
                     /db_xref="GeneID:5652197"
     mRNA            <90369..>91328
                     /locus_tag="LMJF_24_0310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683496.1"
                     /db_xref="GeneID:5652197"
     CDS             90369..91328
                     /locus_tag="LMJF_24_0310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683548.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652197"
                     /db_xref="UniProtKB/TrEMBL:Q4QAV0"
                     /translation="MKPYVWPTSDEAPPPSGRRTFPRQFQVNHGTLNLFSPAVPESQQ
                     CNTRAAAGSFSITGQRGILHQRNHNKESTATREFPVNGLRRVSAPQRSETPHGIRHIR
                     DAAGAQQHVQVVNITDAYKDPMQMGPRRTGVKCLPQKSESDDVSVALSFAGSRQQLSA
                     RVLAAPVGKPSRPSLYPIDYSDQERFAQAVRDHAQKRTRGLAEFYVQLVRDTVGSVTS
                     STPKPAIVPWSLDQEPTRRVLTLGRCRDQLVALTAMPISLSDLALLLWGAGNGEVANS
                     DSLTSDCDKDASLPLNCRPVPFCDFAAAFGQNSSDVRLARMKV"
     gene            <95407..>97056
                     /locus_tag="LMJF_24_0320"
                     /db_xref="GeneID:5652198"
     mRNA            <95407..>97056
                     /locus_tag="LMJF_24_0320"
                     /product="putative fumarate hydratase"
                     /transcript_id="XM_001683497.1"
                     /db_xref="GeneID:5652198"
     CDS             95407..97056
                     /locus_tag="LMJF_24_0320"
                     /EC_number="4.2.1.2"
                     /codon_start=1
                     /product="putative fumarate hydratase"
                     /protein_id="XP_001683549.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652198"
                     /db_xref="GOA:Q4QAU9"
                     /db_xref="InterPro:IPR004646"
                     /db_xref="InterPro:IPR004647"
                     /db_xref="InterPro:IPR011167"
                     /db_xref="InterPro:IPR020557"
                     /db_xref="UniProtKB/TrEMBL:Q4QAU9"
                     /translation="MLRRLAPLLAEFNFVPLVSKVSHKETKYRLLTKDYVSVVQPGAG
                     LPEMLRVDPAALTLLSSTAFDDVEHLLRSSHLMSLRKIFDDPEASDNDKFVALQLLKN
                     ANISSARLLPGCQDTGTAIIAGYRGDQVFVPGNDEEALSRGVYDIFQKRNFRYSQNVP
                     LSMYDEKNTGTNLPAQIDLYASKGMEYSFMFVAKGGGSANKSFLLQETKSVLNPKSLR
                     NFLKEKLAMFGTSACPPYHVAVVIGGTSAEMTMKVLKYASCHYYDDLITKPDMKTGYT
                     FRDLELEEEVLKVCQNIGMGAQFGGKYYAHDVRVIRMPRHGASCPIGIGVSCSADRQA
                     LGKINKDGVWLEELEMEPSQYLPDLKEDELLKTPAVMVNLNRPMPEVLQELSKHPVRT
                     RLSLTGTIIVARDSAHARMREMLEAGKPLPQYMKEHPVYYAGPAKQPDGLPSGSFGPT
                     TAGRMDPFVDLFQSHGGSMVMLAKGNRSKQVTKACHKYGGFYLGSIGGPAAVLAQNAI
                     KKVECLDMKDLGMEAVWRIEVENFPAFIVVDDKGNDFFEQL"
     gene            <99385..>102507
                     /locus_tag="LMJF_24_0330"
                     /db_xref="GeneID:5652199"
     mRNA            <99385..>102507
                     /locus_tag="LMJF_24_0330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683498.1"
                     /db_xref="GeneID:5652199"
     CDS             99385..102507
                     /locus_tag="LMJF_24_0330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683550.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652199"
                     /db_xref="GOA:Q4QAU8"
                     /db_xref="InterPro:IPR015324"
                     /db_xref="UniProtKB/TrEMBL:Q4QAU8"
                     /translation="MLRRLVGGLASRGGSIMNLRASHFSLSSPSSPLHASQPSPCHTS
                     VRAIGTAMPGAMHQPGESGQAAGSSTTIPGKETWGQFSAKMRHGRRRIRVIDIAAKMS
                     YEYQMLKKMCKRRPAMRQWAVRDDYCDMSPGVVVMSPSMQAAFMKVFRLKDKGLIRQC
                     LRDIIPIIEYRNREERPAAMRDKASDMIPEGEPDTLNQKKRELFERKETGENFKPLYL
                     HDKRSQAKLRFKIRQRLIKFQRQIAIANAVASRTVLYSTDDAIGYFLFRGAAMYAGMH
                     RVFFELSKQLPHFVPKSMLDFGAGTGTAILVAKEVYDPGALAYPLYRSMRQTMTGNVS
                     AQAQQLRELRYDLRRLSRNNTEKRKARFMAVAALLERGEVDPADLPADLRREIAQVAA
                     NAAANKKRRLISESHARYREVVDGTEWEDGDPLGEKKSMAEDPSNVFDGEEDGDGGGD
                     GAAAGERTWWEKLVDMENATAQERASRRLQPLQEVTAIEPSPGMMEIGTMVLHDDIPN
                     VAWKRYLLPEDESIQHDLVVAAYSLSEVADSANRTRLVQQLWKMTRGVLVLVEFSNLH
                     NFNLLMEARDTILEEKGIGLWDWQPTIVAPCPHEQRCPLRHCKAGVKSKRMRLCTTEA
                     QYRATFIDVWARHMPLKVGIEPISYMIFARNELVPERAERREAQVKREEAERVQARDA
                     KQRELYAASLSLKDVVFDRLSDEALHRPSTGVPEKLSGAAAADDVAPSSTLTQALPSG
                     ATSAAEVGQLPLTVPRLAQTSAQRYNKLVYPLQFPPATHRYNRAFVDAGYQRQRAITP
                     SEMLVVREELKDMLRRVSRVSPSYLRVVRDPTCRGKIQACFCTPDGDLITARVYRRFY
                     GDHSSVRRHTTMRWQHIGGWKLLKRIRSGSLFPHDLPLYAVNRHPQVDFPNTLVGVKH
                     STVEKTAMQYNDPMSLMETPEEELSREEVKQKRRLLRDEEEHRKAEAKLEEVLGTKIR
                     DASLEGHIDARRRISAEEWAKAVRHARQKTVRHTQQTIPNAAKMRALKRTLEVRHRNV
                     WREMKQNRRR"
     gene            <103425..>106346
                     /locus_tag="LMJF_24_0340"
                     /db_xref="GeneID:5652200"
     mRNA            <103425..>106346
                     /locus_tag="LMJF_24_0340"
                     /product="putative ethanolamine phosphotransferase"
                     /transcript_id="XM_001683499.1"
                     /db_xref="GeneID:5652200"
     CDS             103425..106346
                     /locus_tag="LMJF_24_0340"
                     /codon_start=1
                     /product="putative ethanolamine phosphotransferase"
                     /protein_id="XP_001683551.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652200"
                     /db_xref="GOA:Q4QAU7"
                     /db_xref="InterPro:IPR002591"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /db_xref="UniProtKB/TrEMBL:Q4QAU7"
                     /translation="MARDERFSWCPVLLVIALYTGSVLLFTTSMLSTSTVMRTVATEP
                     CCDTKVPPADQVVLILIDALRPDFVLSSLRPFARTGGQCTVHEDALGRQRVDGVYTGP
                     TLHYMEESLRSRRSASVAFFLVADAPTTTAQRIKAIATGTMPAFLEAGSNFNSEAIEL
                     DSILRQVNGSAVLLGDDTWEKMFPNTPTRRHWKRAVGIPSFDVADFDTNDNAVLAEVY
                     SVLTAETPEAVSRVRVTPHAEAEEQEGHARLVVAHFLGIDHVGHRVNSDNPFMNGKIL
                     QLDQMLRNVSRTLRERATSMNTMLLVLGDHGMTNSGDHGGDSAQETDTFLFAEYFPGT
                     DAGATHAHTRSSPGASLARAQALIEQRWRDGVDAEFDRLRSCHRRAGVPRDRLGATYQ
                     VDVTTTVAVLLGRPIPYSNFGRVIPEVMVLANSSADIDAVERCNLRQLQRYFKESEMK
                     VPRDASWTRPGISVTQKLADMSLYARRTRTDMNRLGMFIGSTGLLLCAMSLLWSPTIR
                     AHVLPCSGAGWFMRWTALTLLLRLCSVFSNSFVVNEDSEVLGLLSSLLMFLLVSRVWE
                     SWSQRRSSRAGPSSAGDGAKLATAQQSSRLTALDGTCWVATILPRETIFLGLLVVGLR
                     LGVPMLLRYRAHITHTVDTESAVDRALLTLPAGLRFERVGIVFGGIAWSALYPHHVGR
                     TTMVFTCACLALVYHVPVAHHVVPLLCIAAYPLTCKWASSSWVLQRRPRSRMASLAAT
                     SGHTAYAYLVTVLWLSSLCNERVGTAIVVALYGASLPFLCCLLRVEPVLTQGVVLHLS
                     AFVAFFAEGHQCMLNTIDWSSSLVGMPGYNMYAGGALVLSRTFHTFMLVPFALRAWPG
                     AAAAAAVAKEKGSHIDGAACEEARKGHTTATTVALSMPAPRAGVSATVVITVYTYLML
                     AQSAISCFNGYVQKAHLMLFPVFCPKLLFDGVIALLTCAAALLALIHPTPSRHCVVFP
                     R"
     gene            <107311..>108102
                     /locus_tag="LMJF_24_0350"
                     /db_xref="GeneID:5652201"
     mRNA            <107311..>108102
                     /locus_tag="LMJF_24_0350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683500.1"
                     /db_xref="GeneID:5652201"
     CDS             107311..108102
                     /locus_tag="LMJF_24_0350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683552.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652201"
                     /db_xref="UniProtKB/TrEMBL:Q4QAU6"
                     /translation="MEAYMHTLRLRVRDAAHSCWTAAFPSDRPSGAYSIYTCMINSGL
                     LVWSFAVVLSHPCETVAGLWVYAGMAHCFINMIFGVLVVVLTRRQIAAGIPEETSQWL
                     VCFSNPLIAVYSLYLVWEIVWMIAVGQFSDRNPHTTCSSHLNVQVAFFVFYLLVGFVL
                     FHSTFITERWRRPRWRRFAAMRYDYLHRTRTRYTVRWNDEDTSIGGDGEPVDLDRVEM
                     SPPDGTERTTTLDYASVTDDSTTAAGDGRRDRDSRDARGCRRAGG"
     gene            <110765..>112567
                     /locus_tag="LMJF_24_0360"
                     /db_xref="GeneID:5652202"
     mRNA            <110765..>112567
                     /locus_tag="LMJF_24_0360"
                     /product="putative UDP-galactose transporter"
                     /transcript_id="XM_001683501.1"
                     /db_xref="GeneID:5652202"
     CDS             110765..112567
                     /locus_tag="LMJF_24_0360"
                     /codon_start=1
                     /product="putative UDP-galactose transporter"
                     /protein_id="XP_001683553.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652202"
                     /db_xref="GOA:Q4QAU5"
                     /db_xref="InterPro:IPR004689"
                     /db_xref="InterPro:IPR007271"
                     /db_xref="UniProtKB/TrEMBL:Q4QAU5"
                     /translation="MSCGRWQEYARGGTDVLVCCAGVRRGLLCLPLSRPSPPPRRGEP
                     LTHHFACLPPHNTKHMHIRRQASEGSPKATRVKRHPRMRADATGASPLCPRKRRVSPA
                     PTHTLFSSSTPLSPSTVPACSDESLKKHFVCRSSRSGTSHYHHCSVDMGSFSSPMWVR
                     RYVLNFNAAALVLLAVQNAGYLVLISYSQQQGKEYQLPAGGAEAEEEEGRTVTFKASH
                     FLAATELVKLFLSFLWCVVDEARAMQQERCSAGAVATPTAALPVEDSGRCSIAPFAET
                     PKSVAGASCHLSHNLDDAADNMDAEYFDHAVPLRFLFSRKRFAAVFLSRMRHALGLDH
                     KYKEALLMIVPAIVYAIQGLLLIYSLKLLDPTVFQVLYQVRILFLAVMMRVVLDFRLS
                     PIRWGALVALMFGITLAQMGAQSTRADMTTSKADDAARSEMEIAAATEKTSSTWSMEG
                     TLAALAGGFLSAFSGVFMEFVVKKRGNQFHLSARNIHLAFFSVVYFFIVFLCEVFQPE
                     EGGGGLDEFASTFFDGFTRLVWFLVVLQAIGGILVALVVRYCDNIVKSFSTAFAIVLS
                     GTASVFLLHTPLNGTFLLGSFLVMTSITMYTAKK"
     gene            <117748..>119043
                     /locus_tag="LMJF_24_0370"
                     /db_xref="GeneID:5652203"
     mRNA            <117748..>119043
                     /locus_tag="LMJF_24_0370"
                     /product="putative aspartate aminotransferase"
                     /transcript_id="XM_001683502.1"
                     /db_xref="GeneID:5652203"
     CDS             117748..119043
                     /locus_tag="LMJF_24_0370"
                     /EC_number="2.6.1.1"
                     /codon_start=1
                     /product="putative aspartate aminotransferase"
                     /protein_id="XP_001683554.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652203"
                     /db_xref="GOA:Q4QAU4"
                     /db_xref="InterPro:IPR000796"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q4QAU4"
                     /translation="MLRHVCSSAVVAYSAGLAPVSCRRDGSTSYFSAVPRAPPDAIMG
                     IAADFAKDMCPSKVNLCIGVYRDEQNKPFVLESVRKAMSHIVERDTQMDYAPIAGLPS
                     FVNSVQRLCFGKPMLDVQGDRIASAQTLSGTGALHLGVQLLQRSSGGSGTATLHIPSP
                     SYPNHLNILQHLNVEASYYPYYNLNTHRLNIEAMLNYLRQLPAGSVVLLHACAHNPTG
                     CDPTPEEWQQIVDVICRSDLIPFVDMAYQGFATGDIERDAYVLRALNQQEVPTYLVAQ
                     SLAKSFGLYGHRTGAVHIRCTTQKEKANVLSQLQSTIRATYSNPPIFGARIADEILRT
                     PQLRELWKSELNQMSSRLQDVRHRLVAQLRACGSTRDWEYLEKGVGMMSLTGLTEEQV
                     MALQQKYSVYLTRNGRIAFSGLSSENVAYVAQSIHDVSR"
     gene            <121285..>124308
                     /locus_tag="LMJF_24_0380"
                     /db_xref="GeneID:5652204"
     mRNA            <121285..>124308
                     /locus_tag="LMJF_24_0380"
                     /product="ppg3-related protein-like protein"
                     /transcript_id="XM_001683503.1"
                     /db_xref="GeneID:5652204"
     CDS             121285..124308
                     /locus_tag="LMJF_24_0380"
                     /codon_start=1
                     /product="ppg3-related protein-like protein"
                     /protein_id="XP_001683555.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652204"
                     /db_xref="UniProtKB/TrEMBL:Q4QAU3"
                     /translation="MLQDQDRSRRAKRKHAQTSSSFDRWLERTQRRGAGAHGSGVDHR
                     SYMDDGCHVDPQSIGRAALGHRSSHAPLPWSPVLYPISPPGQHSRLEDLEARLLMQGH
                     YNHLFPAAAARDEVGYNAISAPQVAPASRTLDMPPSDAASSHSCGGVAYSLGGTVDGI
                     AKDGGRSVAIGGPLFLSTPHRHTQEVRSRCALPSGGTDATGVISAAEVEAERYIARLE
                     EEVQTLMMEISDKDRCIVLISAAKEAMAVQLQEQMTRGDLISDESATRQMLSYNFMRR
                     VAFHKTQAESNLALELNTQISVLKYELKLAETMLAQSQSSATAAASQHQQQLLKEKKG
                     EDELARSFSATLRSLLQDEYDRLAQLVSEMPSKVQMIMSASGSTPRGEGDNAAKDAVA
                     LQQRRLHELLESLLASRGGAAASPSPPPLKDADSSHLVGLVSSVCRHHAAMTDIYCAE
                     ADRKAALAQYEGDIVRLISAKQSVLTWATLYQEKKDEVKHLKEKIMSLRAELRAAQEQ
                     SRRVVSSGPSAGGGVGSAISTQRYEAYAAPYVPASAKLRRSSRDAPESSSISPQMKPR
                     AAAIKMPIGVLREEARRLGALPASYYWPLVRSASPSMGSLSASSSPAKAERRLRIQDR
                     KHEASGKRGGSEEAVAASAVVEVLTVVSSSSHACSPAVSASQAAPRQLESGGTSPSAP
                     SPRAALPRTEKAQRSAAQSQPRVRGRRQRSQTTSQKCSSRTALSSSSSSSRQSKVLPA
                     ARALKVATLKRVFAAEEASSLDSSSSASSLSVLSHTKPQRAAAKPTAATATQQPRPKA
                     LHNSFDDADSGSSDAGAATVPEGTFDALHRRSTSKLAATGASAKAAVSSKTISSAAAA
                     SENPKKHRAKVGGGDDASSANVSMTSLSSVPVKTTVGGLSTSARTIENKGTSAASAKP
                     THMRRSSFDEDDSDDGAEDSSSSSDNASATPVPAPRARVGSSTARASTAAAKPSAERR
                     SVSATTNTTPSTSRLGEATSKILSAKPTKLKLPTW"
     gene            <126696..>128564
                     /locus_tag="LMJF_24_0390"
                     /db_xref="GeneID:5652205"
     mRNA            <126696..>128564
                     /locus_tag="LMJF_24_0390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683504.1"
                     /db_xref="GeneID:5652205"
     CDS             126696..128564
                     /locus_tag="LMJF_24_0390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683556.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652205"
                     /db_xref="UniProtKB/TrEMBL:Q4QAU2"
                     /translation="MDPAPRVSVMNVTVLTCILVLYIAHDAGFRFWMTRSDTLPLTAA
                     LAHDTKVLQQHGDVGLAYDAAIGHVRTPPLQLYSINAERFAANYTARMRAAAAGTASQ
                     NDSPRPSSAPSAADDTFSDALPMAAVVVESTWLTPDQDAVSSVYAQRLLEGYRYALLS
                     GAPWLLLSGSAAEASVGLQFLRLLPRPAERIFPDSVLERWPLPLVTAALQLRESMAPY
                     ETLGAWVHGAGTRPLKSFPASSMTSGASQQQDAHESWVPGHSSLQSSLSQLLSAYSLA
                     VTGASHVRPASLILGAEWMRRMDAQHRSSNTATNANGATRAAADGHAAPEQPRVTVYA
                     TKPDADNGDDDLTMEKNEDGGASKDAASAPWEQPRVLELHVNNTSTAVHVTVPGMVMI
                     SDANINKRAQHMAMTVQQLVELTLVHRHATRSSSAPMDTEREVGWWWWLGRPYGVTVI
                     AGRWEQQRVKLLYMKAFREAVADSQEGLRKAVQLLHQSRCQFERPLLPLSCHGVRGPQ
                     LPPSALPFSTAVPARSRIFVLPPPYEDLQSVQPKPEWLNYTGELPASINAEASRVAKL
                     LGRVSFFLYFNYRRWMDWFLASLPVGSYQDHFVLISVLMSDFAEHRISWMDVLHLR"
     gene            <129904..>131889
                     /locus_tag="LMJF_24_0400"
                     /db_xref="GeneID:5652206"
     mRNA            <129904..>131889
                     /locus_tag="LMJF_24_0400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683505.1"
                     /db_xref="GeneID:5652206"
     CDS             129904..131889
                     /locus_tag="LMJF_24_0400"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683557.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652206"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:Q4QAU1"
                     /translation="MEAALTELKNEGNAQFASGDARGAIETYKKGIRLIEADAGQQQQ
                     QNVDPMGASATSLTASEEARRLHVLLYSNMSNAYLSLREFRESWEMAAAATRLDPHAW
                     KPWMRFIEARRRGGFPFDALVHSLRYLRPLLRAEREQRRMTAAEATATLDAIEAPLCD
                     ELGLLRLSPDIELVEYAGGVALISRRQFQPRDVIFVEHKYTRISFEESGMSTQPDLTM
                     ELIVEYFAERLRPEQAVAGKRWCDFKKDFTGAWPRSDNDIDVDTRETISRHLRTRFPD
                     VAEDDFRELLSTALMCRFNCFHSGFFRTCALANHSCHANIAMKYSSVEETVKMIAVDI
                     IQPGELMNVKYLSDAHFLLGVGKRRELLRSWLFWCQCDRCQRDSQATALSEFVECSAC
                     GAFSHSALMGFNPASDPLLQAREACCACSADMVWSPVQRDLLQKELMRTFTSSTSYYT
                     ATELAEWMHTQLEMTEKLRLHPEHWVYRALFYFFAVALTAMVDCVSVGLSEPRISQFV
                     VDEMKHLFGACGLQTYYLPRCASARAKAGAVKHMAGMVAVNEVVCTSSDSGGGCEFLK
                     SLIILWELLVPFYPVNEMWSVNDAICKLVLLHLVYPAPATTLAPSLALRLLQRHGSYI
                     GDVNAAKWLHSYSMHRTTFNAKEPLPLTKVKKAFKGG"
     gene            <134201..>136483
                     /locus_tag="LMJF_24_0410"
                     /db_xref="GeneID:5652207"
     mRNA            <134201..>136483
                     /locus_tag="LMJF_24_0410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683506.1"
                     /db_xref="GeneID:5652207"
     CDS             134201..136483
                     /locus_tag="LMJF_24_0410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683558.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652207"
                     /db_xref="UniProtKB/TrEMBL:Q4QAU0"
                     /translation="MATAAAATAPLPPPLLIYLNSDVGMERPYRISLPASVDTLAELC
                     QYLTARIPLRPGDDTTGRGYRFLYAASGKPLWRVKECIDAGTIVLSVGPGFLARRPTS
                     STAGPQPPPAAGPVIDITPDRPAAEPAAESGKGRRGSPSASPPIKQPADDRCGMRGGG
                     GGRTNGGAADYPAGNAPTSSHAATATTIPPGSAAEQRGSVDAAWPPDPSVRCPSQAEE
                     RERLFSITPNTVMRGGGPSVGGSMSSQPQPMPMPNGFGVVSSAAVSSPEESLFTSVPP
                     GTLPVPARTSTAWPGTGGLGGPAPVAQPATTTSTSAAAIPRGTVFLEHKAHPLPPRPA
                     FAPMPSLAGSLSALPPCHQPLSAVSISSSLDYLLLRKWAAYQRLHSTSPNDLVADEAL
                     SRLFNSLGRKGAANGGAPCRVLVSGPPRSGVSTTASFLLRHYLRTLQFQPEHPFYNSV
                     LLALDFRLLFGPETVAPAAQPPRLLQDLGALYQLVVRSVIDAVVAQRPALREAGALLA
                     QLWDLVIKPNVQPPAPPNFTTFTQAALFVGVDVLASWTRLAARMYPILQSACRTPDVP
                     QLRDAAMDLIFYAIPAELASSLKFSGLFYALDGLEQLTRCYAHRVTRPAGDLGPLLQA
                     VTADPRAHLVVAWPSTLSPQSMYLPGLTAHVSTIGLVTRAALNAMHFPQVLRCHDKEY
                     PLEVFLGCPGYLSIVSDMARPFRKTLSIPITAFSAYYQQNYEQSGARAAEGYALRLDM
                     PAAARELDALLQCVQALPLR"
     gene            <137490..>138413
                     /locus_tag="LMJF_24_0420"
                     /db_xref="GeneID:5652208"
     mRNA            <137490..>138413
                     /locus_tag="LMJF_24_0420"
                     /product="putative ubiquitin carboxyl-terminal hydrolase"
                     /transcript_id="XM_001683507.1"
                     /db_xref="GeneID:5652208"
     CDS             137490..138413
                     /locus_tag="LMJF_24_0420"
                     /EC_number="3.4.19.12"
                     /codon_start=1
                     /product="putative ubiquitin carboxyl-terminal hydrolase"
                     /protein_id="XP_001683559.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652208"
                     /db_xref="GOA:Q4QAT9"
                     /db_xref="InterPro:IPR001578"
                     /db_xref="InterPro:IPR017390"
                     /db_xref="UniProtKB/TrEMBL:Q4QAT9"
                     /translation="MPSDESRWCLIESDPAVFREIIQTVGVKGVSVEDLIMLDSSMLE
                     QYEHVYALVLLFKWQSSEQASPLGTVVKDAPVFFAKQVIHNACATLAIMNTLCNYPDQ
                     VELGPKVQRYLSFCQELDPEMRGSLLDSFDELREAHNSFAPQSAFTKDGPSPKDADVY
                     HFVSFVYRHGHIWELDGLQEGPLQCREATDANYREALVEVVQRRIDDIAAKDTTGAGQ
                     GISFSLMTIVDDPVTVLEKKIAALRAEEKPTTALDEELAEMLLLRKKDKEANVRRRHD
                     YNAMIVALLKTLAERGKLEKVVAEVQAKASK"
     gene            <138991..>143367
                     /locus_tag="LMJF_24_0430"
                     /db_xref="GeneID:5652209"
     mRNA            <138991..>143367
                     /locus_tag="LMJF_24_0430"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683508.1"
                     /db_xref="GeneID:5652209"
     CDS             138991..143367
                     /locus_tag="LMJF_24_0430"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683560.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652209"
                     /db_xref="InterPro:IPR007308"
                     /db_xref="UniProtKB/TrEMBL:Q4QAT8"
                     /translation="MCDRADDSRTRVQAIMCAMHEVGEGDAATKTPPPFCLFSLLLGS
                     SGFRGVATAGPTERLCALPQAQTLGTSPSSRLPPSLVPFSCPLVPCSLRLRLCVCLRR
                     HTPVPFDPLLPSRTCALPPRAPPPPALHRTKTCLAYLCCGLSLSNSVPHPFFFALSQL
                     DHPNASMRRLAPLLTTAPSLSSVVLNVSSAYGGARAVSPCRTMTTMAVCEASSDALTT
                     FTSFEVESELSLAQDDLEQLQLDLQSVRASSNASASARTRHASTPSPSRLAASSSVSL
                     TPPPMKISVASTPSLRCPPLPLGRPQPVVLPALLQRPRWRNVVHERYRASVPGYVDAC
                     AQVLGNVRNMWEVCAANRRRREEASDSCFAEHVSTLLRHAHADALLVLLEGVAGAHHG
                     GDVFADGAALFRCELILHLVRSLARRPVELSGKHMAHLSKLLLSCPQLLTAAPPSQNY
                     LAQALVAEVQEEVWSSFTCLCYATRRSLRRRQNVDCLEALLCGVYMRAHHEPATLQSS
                     GRDSRTSRLVSAMLRSCVDARDGGWQRRYAGHPLPPHLLARVRQAALCHLVHRCLLSG
                     AVAKVGAAEKANEENARLLLSWALLLAREDMDPVVHAAVVYRLSRGPGLAEGGSPAGA
                     SPACVESWRRLALLVEAVRRPSRLGEQRATAPANGAEAFQGVDQACKDTRGWAVLSVD
                     RRQLGALCAQTHAPLSLWSATGPVVSRGVEAARARTRDAAVQRVSDGAAAALRAYVRL
                     RWEPLSISEAEQLLPDDAALAVSVALTEGARREAPTSITERMIAEECEDVIESAADMP
                     PHAVCLAEVLCVRLLRSMQRWKGTSLGGVIAPPASSGTAQASPAVLPASQQRRVLAAL
                     WKLSAYARAEVVTAALLELQGEAGTTAAAGKSGNVHSDPSCTAPSSALMGPSMPPRAC
                     WPLIGAVCRHAEDVVHVTRELMSHREMMAAPLSLASLQRLREWLVGLPGSLHSAHLVK
                     VLREWAEIEKSKLSGASSRAQECLTAWDDVVRTALEQHAAHALLAALDGQCAAAAVTT
                     GPCCSPCGEELRSTYAVMTGPASAQLRRIQWIAEANSSAVREWRWSMGVASPLIGRTT
                     VGRSASLLHPASALPAAVLAVEATELDLTDTEHDAAVRLLCQRCFSDLSGSNTFSWSD
                     RLACRALERAQATSTPTTQLGVRIDEDLAADHSSAADGDADAPSCPSKQCKGTIVSAA
                     ALHYLLTRGNPTTSSATATAPMFSTAELGDALHTLSVYVEFLVKTRRSGVYDDPCSER
                     AINRRLRCAAAAYVNCLSDAWRVTLRTIAPPTSAVPLHVADEEVLLMCFPAFYHCALR
                     LYDRLLSDKAVLDKGSDEVLMSLPCLSGALHEAAFRALVRTSGTRRRNIETTLLLADR
                     VARQWAALGMVSSSSSVAHAAVASAPSLTDDQPAFCVPLSVYQLVLATYAADRTPLPQ
                     RVRACCEAALRREEKRQWVGPS"
     gene            <145634..>149743
                     /locus_tag="LMJF_24_0440"
                     /db_xref="GeneID:5652210"
     mRNA            <145634..>149743
                     /locus_tag="LMJF_24_0440"
                     /product="hypothetical predicted transmembrane protein"
                     /transcript_id="XM_001683509.1"
                     /db_xref="GeneID:5652210"
     CDS             145634..149743
                     /locus_tag="LMJF_24_0440"
                     /codon_start=1
                     /product="hypothetical predicted transmembrane protein"
                     /protein_id="XP_001683561.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652210"
                     /db_xref="GOA:Q4QAT7"
                     /db_xref="InterPro:IPR021520"
                     /db_xref="UniProtKB/TrEMBL:Q4QAT7"
                     /translation="MEENATIPYVLSIGTLPTTTAQLFAYISALVIAGVIEYVLQVLP
                     KCHRFIAARAKEVRSTAEEIWQPPRSIRKAVWCLMRLMRRWEVFTVPGITSVLLYMCT
                     VASLIHLYMFHQNPDNIQLWTYQETHFDLTSMGPSLVSPVHDPRSLSPYGPRSDRTLA
                     HFCGRPTASSYDGYTGAPHAAYMHHDVERDRYVVRTFGRGGMRVDERRRSGVGRSTYE
                     AFCAAPRSVQRGTPLAPSPWLDGETNWQLGDAAPRHAVNGAFNFTVRPLAVPHAAAAA
                     AAAGATASRSGNADADFTKADQGLRTHYRRYTRDELLQRHAHLDFIYSYVNGSDITRS
                     YTKPFAKTWECWNMIASVQLLWGEMQHAADTDTEAPHIAEDAFSRYIAELLFVSASSP
                     CAMSELLADVGTGKDAMKRVEASLWWAATHPNGPRSVGDAPLPPPEMTLTNMELLRAL
                     GADLESAKPDDIDADCDELRHGMRGLLEHTRSWHRGRMAVVAPYGNVPLWLNHSKNFF
                     MRSLYAAATATAARAEASCDAADGDDSRVLGTAEARFVKEAHTGTLHYTRIHIVDQRA
                     LMPPAPLTTVNSYVVEPFVYRLRNASSVFIYMNDDYLIMKDVDITDFVNEFGGPLLRV
                     RKSDSMEYFESNRDYFRRGLVFNTMLMHRDLDKIPADLEELVQPAAAATALTSVEGEA
                     AVVRRGVVRASWAAFAAAVDARSSVATPRGGARATSTACASNSSAAVCAWAECAWGTA
                     EGTLTRDTCAMPRVSTQGEPAWAADAAGTFALVPPSSTTPGSSEWTWAGKAQMPALVH
                     WGRRVLDRVTADLIAPRYYLETTTIVLSDDDTEQFPPRAALSSVAEHLHLLIEVLTHV
                     RRDSEEVADTKSSSMQLLRRLTQAVANHEFPTHRVFKTQPRLRKYRMRLDSHAPYPQC
                     RNMWGYIHKRYAPDLNLNMFMERKRTTMDLLPPSTHTAHMLRHPWAASSQYLPYLMAK
                     QAWRMQRGAGLSPLGNDTPVFPVADVALDNEDGCAPATYITEAEESARYHEFRDDLLW
                     NRRTMKKIRSYQGVKPFTNINSKFSSNAVGETLRNFLEELFPTPMLLEQHWRSTSGDE
                     GGTDELRVSRQIDGESGARDLQFAHLDVNFKRLMHVPLILVSNDEEGFCPLLRSLRHA
                     LPNFRGRRVVQVLVPPADGVSLRAARADRRHGYRDFLPVARCSLPADRLRRVTLPADS
                     GVADVVVAGLRLAREDVAVEQWEAPALVELRGRRVALRAVQALVIDARTLHTGARGFT
                     ELPLALAVPAELLAHEDFAEHLLDAAAQSLVRSPTAAEAAAVAAVVPMEEAASAGDFA
                     ASVLVLSEADAEVRHTHWAHGASEHDLLSGTPLPYDKMEDMKEMVQWGF"
     gene            <153038..>157141
                     /locus_tag="LMJF_24_0450"
                     /db_xref="GeneID:5652211"
     mRNA            <153038..>157141
                     /locus_tag="LMJF_24_0450"
                     /product="hypothetical predicted transmembrane protein"
                     /transcript_id="XM_001683510.1"
                     /db_xref="GeneID:5652211"
     CDS             153038..157141
                     /locus_tag="LMJF_24_0450"
                     /codon_start=1
                     /product="hypothetical predicted transmembrane protein"
                     /protein_id="XP_001683562.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652211"
                     /db_xref="GOA:Q4QAT6"
                     /db_xref="InterPro:IPR021520"
                     /db_xref="UniProtKB/TrEMBL:Q4QAT6"
                     /translation="MTVATAKFLYVRHPTLCCFLLLIGAVVLVIWARIHKWHQRARMA
                     ARLRMKDVRHVLQMCRRRPRSWHRIAKAMAMTLYNSWPLNATVFATLLTVHCVLLGIE
                     RLYTYRNGPPNLQLWTYQETHFDLTSMGPSLVSPVHDPRSLSPYGPRSDRTLAHFCGR
                     PTASSYDGYTGAPHAAYMHHDVERDRYVVRTFGRGGMRVDERRRSGVGRSTYEAFCAA
                     PRSVQRGTPLAPSPWLDGETNWQLGDAAPRHAVNGAFNFTVRPLAVPHAAAAAAAAGA
                     TASRSGNADADFTKADQGLRTHYRRYTRDELLQRHAHLDFIYSYVNGSDITRSYTKPF
                     AKTWECWNMIASVQLLWGEMQHAADTDTEAPHIAEDAFSRYIAELLFVSASSPCAMSE
                     LLADVGTGKDAMKRVEASLWWAATHPNGPRSVGDAPLPPPEMTLTNMELLRALGADLE
                     SAKPDDIDADCDELRHGMRGLLEHTRSWHRGRMAVVAPYGNVPLWLNHSKNFFMRSLY
                     AAATATAARAEASCDAADGDDSRVLGTAEARFVKEAHTGTLHYTRIHIVDQRALMPPA
                     PLTTVNSYVVEPFVYRLRNASSVFIYMNDDYLIMKDVDITDFVNEFGGPLLRIRIDDP
                     MIYNESNQEYFRRGLVFNTMLMHRDLDKTPADLEELVQPAAAATALTSVEGEAAVVRR
                     GVVRASWAAFAAAVDARSSVATPRGGARATSTACASNSSAAVCAWAECAWGTAEGTLT
                     RDTCAMPRVSTQGEPAWAADAAGTFALVPPSSTTPGSSEWTWAGKAQMPALVHWGRRV
                     LDRVTADLIAPRYYLETAKVVVMEEEPEPVPPAKAWAGLARDITDISQLLHTMNLVHE
                     RSASSSDTCSQLMRHLEVWAARLAGHEFPTHRVFKTQPRLRKYRMRLDSHAPYPQCRN
                     MWGYIHKRYAPDLNLNMFMERKRTTMDLLPPSTHTAHMLRHPWAASSQYLPYLMAKQA
                     WRMQRGAGLSPLGNDTPVFPVADVALDNEDGCAPATYITEAEESARYHEFRDDDDLND
                     KAMDKIRSYQGVKPFTNINSKFSSNAVGETLRNFLEELFPTPMLLEQHWRSTSGDEGG
                     TDELRVSRQIDGESGARDLQFAHLDVNFKRLMHVPLILVSNDEEGFCPLLRSLRHALP
                     NFRGRRVVQVLVPPADGVSLRAARADRRHGYRDFLPVARCSLPADRLRRVTLPADSGV
                     ADVVVAGLRLAREDVAVEQWEAPALVELRGRRVALRAVQALVIDARTLHTGARGFTEL
                     PLALAVPAELLAHEDFAEHLLDAAAQSLVRSPTAAEAAAVAAVVPMEEAASAGDFAAS
                     VLVLSEADAEVRHTHWAHGASEHDLLSGMPLPYDKMEDMKEMVQWGF"
     gene            <160614..>161444
                     /locus_tag="LMJF_24_0460"
                     /db_xref="GeneID:5652212"
     mRNA            <160614..>161444
                     /locus_tag="LMJF_24_0460"
                     /product="putative ubiquitin-activating enzyme"
                     /transcript_id="XM_001683511.1"
                     /db_xref="GeneID:5652212"
     CDS             160614..161444
                     /locus_tag="LMJF_24_0460"
                     /EC_number="6.3.2.19"
                     /codon_start=1
                     /product="putative ubiquitin-activating enzyme"
                     /protein_id="XP_001683563.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652212"
                     /db_xref="GOA:Q4QAT5"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q4QAT5"
                     /translation="MLNSALYERTQILIGDDGIRSLQNTNIFLAGTGGVGGHCAEALV
                     RAGVGSITIVDYDVVTSSNKNRQLIALDSTIGKSKVEELARRLRDINRHCVIVALDAF
                     ITSEDAEEVLSRQRYDFMVDCIDSVTCKVALLAAAVKLKIRAYSSCGAGGRIDPSLVS
                     IGDLFSTENDGLARACRAALRKHGVGPGDVTVVHSSEKGIPPLKPQRQEAGGRDRSMN
                     GTISHMPPLFGLMLASAVLRCAVNPAAHDAEVEQRRKRERKEQKRALKKRRKETPPTT
                     "
     gene            <162207..>163469
                     /locus_tag="LMJF_24_0470"
                     /db_xref="GeneID:5652213"
     mRNA            <162207..>163469
                     /locus_tag="LMJF_24_0470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683512.1"
                     /db_xref="GeneID:5652213"
     CDS             162207..163469
                     /locus_tag="LMJF_24_0470"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683564.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652213"
                     /db_xref="UniProtKB/TrEMBL:Q4QAT4"
                     /translation="MGGEGLHRLSPGDTRSRGQREADLFAHRKPSSGTGEHSVWCDLI
                     LVEAGFRPLEARNVVLVITRSKVLLRVVATGFALVIHLQDIVQARHVVPAHAVELHVE
                     VPSAASPEDYNHPGREKRTVTTNRLYRVYPKERGRDSTNACAQLFKLITSLLPAHVQQ
                     ASEESNLDDVVAWYERVDACSMLSYHLSEEVGLRELDSISYSLPHLSSSASVTRPAAF
                     QAEARQYPPTRRQARSALSLGSSCRGFRAPSDMFDDAHMATTPHLRRIYVVPSPSFWR
                     LPKASSPPTPSHLLSHERWTPPHLHHDVSAEEASRSASASTSTMQRQHTLRRTPESPG
                     TFFATTAPASRHQLHQNETRNQQPAHTSPAMGVGMNRRESSLTAGMCGLRPLTTRTPP
                     FLSSSSARSSWRGAQWPVNLEYGPTTSG"
     gene            <167292..>170954
                     /locus_tag="LMJF_24_0480"
                     /db_xref="GeneID:5652214"
     mRNA            <167292..>170954
                     /locus_tag="LMJF_24_0480"
                     /product="hypothetical predicted Kelch-domain protein"
                     /transcript_id="XM_001683513.1"
                     /db_xref="GeneID:5652214"
     CDS             167292..170954
                     /locus_tag="LMJF_24_0480"
                     /codon_start=1
                     /product="hypothetical predicted Kelch-domain protein"
                     /protein_id="XP_001683565.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652214"
                     /db_xref="InterPro:IPR011043"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="UniProtKB/TrEMBL:Q4QAT3"
                     /translation="MADICAECTSSIAAASTGTLGTPPPMIWAAGNSAPRRHGSPSSS
                     CTMAKQQRMLSLPSSRREESYQQSESTTHASSTAVTATVTTTSAFTLASPPCDMSVTQ
                     GCRQYISNECKEEKRQYFLQQQCPQRMSWVRICGSGLSVMASFDESAANSLRTSRSLL
                     NVIAASSGSWEDPRDSVASTGHGGGGHSTSGSDSTVPPQDASLSSSDNSVGMDSEVVL
                     QPPARFGHTAVLYKDSQILIFGGKSSDEHYFNDVYQYDASARRWSCLQEECIDEVAAA
                     VGASEQGSASPSYASAPPALSSFSSPTASPLASMRWVEAALVAVPLAEAAATDAPSPH
                     YSGSANNSGSEESSATRRCAATSRDFAAHVQQGTVADGPLAPSVGSRHGSTSRQCNSL
                     SEAGVRRRRRPAGRVGHAAALYQDTMYILSGEQLGRYFDDMWALDIPSVTWNKECGLP
                     FSPRKGHTMHLLPADFTATRARQDMLVVFGGLVKASRVRPRPADPELPTRNQGDTDFA
                     CAPTNAVLLYYPTQRRWCQLKTCGEQPSARFYHVSQLITGTALLLVFGGRSATPAQTG
                     DGTAAATEGAFLNDLHILDVSTGFWRHIRDVTGDIPSPRMCAASVFVNETFGVFAGGG
                     DTYCEDAFEFSLQSRRWRRLKPSNQPACSRPTVTYTKDRLVFFGGFAPRTGVMSCTME
                     LCLSPLSLKNQCLLWWNRCVFEKHIRSCTKSRAAEMEDKATAAAAMERSGSGWCTGCG
                     GQVTLQCSPAATAHSSPIATPRSWGVNRGFRRPAPLRVPSFDQSGTLSAAAPAWGGGP
                     PAAQSSARGALTRSPTPSYSPSSPAVFSPLAGGPKLMPSWQDAAGSNTNITGGNTVHA
                     SGCGGTATAFCSPASVAPPAQNLFPSRPSTVMNSSCSPSQAGSPATVSTAASTSQTHL
                     WPHMAAGSVVCGGGGSSSNNNSAIAHPRGNAALAVAEADVVTGAADVTRWCSAPSAAA
                     PLSHSAASALFCAAPSPSHTAAPGRSSLPPPVTATGEQPASACFFTNCARHLGGYVAA
                     SFPRLTRCSSNQAPPPAHVGGPSSAAAIVSSGRRGGSGSAGSGSWCFSLHMRSPVSPL
                     QGRAMRVDVALPGPSPSPQPVYDSSAGVVGYRHSSPFVRRSNSIPNGGGSALVIPQQQ
                     SHTSTQLTESTSSRASSAHSTRSASTMSAAHFPNTYAKHTIQRLEGMTGPYLLQALAA
                     RLKRHEAEASTDKRTL"
     gene            <172128..>177944
                     /locus_tag="LMJF_24_0490"
                     /db_xref="GeneID:5652215"
     mRNA            <172128..>177944
                     /locus_tag="LMJF_24_0490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683514.1"
                     /db_xref="GeneID:5652215"
     CDS             172128..177944
                     /locus_tag="LMJF_24_0490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683566.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652215"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR003591"
                     /db_xref="InterPro:IPR003603"
                     /db_xref="InterPro:IPR025875"
                     /db_xref="UniProtKB/TrEMBL:Q4QAT2"
                     /translation="MVRFSTPLVLASPSLSTLHPLSLPRTHTRNDTCMQAHNSTVAHS
                     VSRAPFSLPPSTHPPPAPTPLPHAHTHTHTKTLCHSPFSGVWVLVCVCNSSVWGVSLL
                     YLFLFVGASFQGIVLHAWKQRIGTRARTHLEVWAAAPPLPSPLSLSSAMSARATTFAG
                     VTFDPHGTSMNLTTASAAGAEPSAEIEQLRQKLSLDLQCQPELRALLELCGESNAWTV
                     EEAMQQPDTITTIELFLFHVPRVPLVQFFPNLVTVKFMSIGLESMANLASLAHVEELW
                     LSDNNIRVIEGLYNMTRLRRLYLQGNRIESLNGLPPLRHLRELWLSRNRLSALIHLTP
                     LRKLRSLYVSCNPLESLENAFSKDMSHLHEVNLSGCHLSSIIELRHLQQLTCLRSLWL
                     LDPLFGDNPICRLNNYVTLTISMLSSLDTLDGTFVTSEQRSLVESVLHKKQLYYAMRA
                     QMLDTRITLLARHAETCALRHTRDTGRALLKLKSCVQPIEHELAERTIYHLDDKHGAG
                     GSSGSLCGVIAGGDKGGDYAGGAPLVVPTATLEALGRQLSRAIDTREVQERKTMLKLA
                     EATQAAKLQAQLLKERFAVELHTAGNVRLEHLAPDHEAYGAAVELVQERFDSALFDER
                     FGIAEVEVTGVRRILNRGLRLRFDDRVKELHVDLANPQLRSRFVGLFGIVPVTQQGQS
                     ACLQHVLVNGMAARLAAPSEDGKKSGVASQAGRTLYQPVPAEEGVPLTNSLFYADEER
                     LLSCCATTGGASRGCDSSPPVLQQSYNAAALSSGSEASTLCRGQVVLYRVYLGKTVHA
                     LGGGGCVGRSTSPPPPASFLKQNGRVWRKDYGADTCAAYRLLPSTAATTPAGESGSAS
                     AQPSPSPYVWYCFDRALLLPDCVVDYTYSMRNTPLTQPSRSPLPAGGGASCMSRAEAM
                     ALLAGLPLPPVVGCEASSADADDSQHSGKGTDTVEDVLHCGEQLLQFIYWCSPPSKHA
                     HSRDTASHGNTLQQVAEAETNEALASACKVLGKACMAGLLRNGAVDDTAGGGDDRSND
                     ASSSSAANPLHARHVEEYAAQMCVNGAPLSLCALRSRGITAVLQDFATPLCASITALD
                     LAHNRITSVSWFALAKEVPQLQWLNLSGNALSRLHFDGSALPSLRVLDVSNNELGSVT
                     DFAAIRTAAGALEELVVYGNPFLRHADGQEAEARLWLYLLPPPTSAMAMAAGGSPAIV
                     KLNAHSLGTYPGTLASQRFRRACLLPGGRVTPHVSRVTACLVKSIQRDDELSCAAASL
                     LSVEGAATQESCFEQVAAQLEMLMVADKLEAHLREACQHPPAVDEARPRFPSEALGGS
                     DLPLSPSLLSCLNECHTFRWSHGLLDDPRGLVDLLPNLCHLTLRGQALTDVHPLLHLH
                     RLESLNLAENHLTELPCLEELRALRELVLDFNELTALPLTVGPLPALRTLSASGNKIA
                     QVDINLFVRSTNGTAALGPPSPPTTTPKLEALYLMYNRIADMNVIYALRDVTSLLILN
                     VAGNPCTAPRGAADDDEVRPYLIHVFPQLKVLDGVSISAAEMAKAREVYAGKVNSDLL
                     IERARGPPETWASVRHLNLSHCSLKEVNLLEPFKSLEVLHLQHNLLVSVLGVAMLTEL
                     TALDLSHNRLGSAPWRNPIGGALSANSTGAPAAAGANGAATTSPAALGNTLARLKRLQ
                     SLSLEANQLTDLSTLKLCFPHLKFLNLRCNELQFIQRGLENLPELRELLLDQNKLRGL
                     GSDSFAANRKLIILSAENNALRSVEGLQRCRALEQLRLGANRLGDLNALLNELQSCPL
                     KAVVLVGNPIARKTNYRATVITRLTQLTDLDRRVVTQDERDKAASARMMELVAPPNVV
                     IDMNYFAGMGAAPAGSPGLPLQNGLTMNGFAGAALNGGTAFSPRGRSVTVPVNGAAVR
                     SSLSPPQLTGIRAAIVPNRRGGDADRLAANQRIRPYRR"
     gene            <178940..>179644
                     /locus_tag="LMJF_24_0500"
                     /db_xref="GeneID:5652216"
     mRNA            <178940..>179644
                     /locus_tag="LMJF_24_0500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683515.1"
                     /db_xref="GeneID:5652216"
     CDS             178940..179644
                     /locus_tag="LMJF_24_0500"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683567.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652216"
                     /db_xref="UniProtKB/TrEMBL:Q4QAT1"
                     /translation="MDKAKTLEVLRGMKFMQRKEEAKRRAAFEVAQRDEIERQLLHPG
                     TGSSGASGGVSDGGSSALRDRGGGGPVRATVLYDDSFPTHAYSLSRRSFTETLGGGGA
                     IPVAAGLGDTDAHLEGSAVESRVSLKDVGEAQASADAALDDSDVASDEEVADLWGGED
                     AEGELNDPTAASDRRNQGVKRTRDRRGDRNQHACSDGRFIVKPSLRAPKLPRRLQETV
                     AEQKRQRAEEEGDMNM"
     gene            <180372..>182705
                     /locus_tag="LMJF_24_0510"
                     /db_xref="GeneID:5652217"
     mRNA            <180372..>182705
                     /locus_tag="LMJF_24_0510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683516.1"
                     /db_xref="GeneID:5652217"
     CDS             180372..182705
                     /locus_tag="LMJF_24_0510"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683568.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652217"
                     /db_xref="UniProtKB/TrEMBL:Q4QAT0"
                     /translation="MEQQAQLSDAARQRQQQQRSTGTTAITRSTNEEAFDSVRQAAVV
                     MFKQRTKDLTRLTQVETQCQAIEAELRQAQTCVTQLMAQQASLEALVEEEQQCTRQRE
                     CRLQELHSALLQLDEEQQTSGKLQRSAEAAIGAATAFIRTFTNADGRLFQLLTMASAR
                     TAGRSALELQRLLADVQQALVAAEAHRQGLMCLPSFSLTAEASASGYLRYTAPSSSTA
                     VVSADVSITGVSHALHEWAVRMDWAQHRELVDVVQIMQQLVAWLSTDGSAQEEAQQTV
                     ALGRASCEWGLPWPPLPPFTEDAVTEHQWFGSPSLPSTTFQADIHGGGSAEVAAEDEG
                     RRATLPLEECAVDVDDNVVPSSEVVQLLLQQHLLAPLQAISAYNAHLTAVCAQQHLQL
                     PEDASSLAASLTATQQRWISFHEAWQQWREEVLQTQAAAEAAIAAATELDAAQAALRG
                     FQRDCEEQSHNCASRKKEVANFKETEISHYAAAWSRGVCASQAQRDSFCAMSDAIVSL
                     TKEASALTTALHDDSEHHAHETHARDVALAEQQEQLTVTRQRAAVAKTRAAALEAECA
                     AAQRVQQLVRDQHEELLSCATRRLQPPSGAAGNNNDGENVNETAPKDLGELPVARCAA
                     SVAQKLLHSATACSPVHAAWTERLVELASEVHDVAGRNGNGSLLISSVAQLFANLIDR
                     CGGDQAAGGESVSEAALDAAAARLAIQNAVAGLRLPSELFLDVVDAELLAQVPYLRTW
                     RSTEQAIRASIDKHREFMCDATAEISILRSELATAEE"
     gene            <183896..>186283
                     /locus_tag="LMJF_24_0520"
                     /db_xref="GeneID:5652218"
     mRNA            <183896..>186283
                     /locus_tag="LMJF_24_0520"
                     /product="putative DNAJ domain protein"
                     /transcript_id="XM_001683517.1"
                     /db_xref="GeneID:5652218"
     CDS             183896..186283
                     /locus_tag="LMJF_24_0520"
                     /codon_start=1
                     /product="putative DNAJ domain protein"
                     /protein_id="XP_001683569.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652218"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:Q4QAS9"
                     /translation="MMRSITPRRCVALGLFGLLLVICLTHELAGMAALAATSARHTAL
                     YKDLGVVAGASKEEIKKAFRAFTRQHHPDLKETFQEKEHAKAAMAKVLRAYEVLSDDR
                     KKAAYDESGIIPGEAPNLEEMTATELFEYYHQSSPIFSKSPTLKSLTQLRRLQEFRGG
                     RVILIQVYDDTQCKNCRYYSAAWEMLYQSSLVEAGVLEMYRIDALSEEGNPLLAHLGI
                     RYRKEPYVLAIVDGEAWTLYSIAETMKQRNHNRVFHSLLEFVMSFFYDVFQQTRSLEV
                     TQLEDILTFLRAPRSAKQPLRALLPTINAESIPVALQMRYNQVEVRSVPREFLLEFVE
                     EYCEMEIGVKDRFGENVPMAEFIVVSTEALPMPPKGMTETSDTATSEAEAEASTPQKS
                     CRLVHVGAAVALTYKKASRFIEDHLPERHVGMKGLRYAGATDFLQVCRDNCVVWMRED
                     CAEAPDAHVAALMANDYLSFKTGYWCMEEERRLAKVLSKAGVWTATSKNLAASPSALV
                     AFVGGNDSITYQLVSLHPKAPEELTAQDIYTALSTLVGNAEEAEDSSEAARVAAPIPS
                     HLPQPVASLLATDGFPISRKQRLYIQAMTIYTFAAPLVSNSWPFFMMYLIHRFVLNRN
                     KPEAEEEARKKREESATAAANGASSANEASAASVRRRIRKPQPRVGPYNPRDMKWAKE
                     EKGFLLLLVEDGLAAGALPLPRLALDEPFTVRVLGTGQGKWRQWILEHKPAAPEGAAE
                     NLPEAERQISLMAIRKTRMKALVKSDAQTIHAFLCDLLDGTKNPSEELPSWAYDE"
     gene            <188257..>188940
                     /locus_tag="LMJF_24_0530"
                     /db_xref="GeneID:5652219"
     mRNA            <188257..>188940
                     /locus_tag="LMJF_24_0530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683518.1"
                     /db_xref="GeneID:5652219"
     CDS             188257..188940
                     /locus_tag="LMJF_24_0530"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683570.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652219"
                     /db_xref="UniProtKB/TrEMBL:Q4QAS8"
                     /translation="MEPYASPAAVPPPHVVYDALSKAQKAAPQLRPIPAFEVYKVARE
                     EELAAYRMLCRVLFMHHGTPLPKAQQRILDDMGEDLCIGQTRQGLEKEMAEQDKVLQG
                     IRKSGVLRRRGDFTDGVEEMTVEDYLAEAPKDDGNGLFMPTSKVRRVDGADSGATRAT
                     VIAAAAGLGAKRKGNVHAAVSKLAKEAETAGKSLLYASSAQEEQQLIQVLQQKRELLV
                     ALREELTEA"
     gene            <190311..>191699
                     /locus_tag="LMJF_24_0540"
                     /db_xref="GeneID:5652220"
     mRNA            <190311..>191699
                     /locus_tag="LMJF_24_0540"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683519.1"
                     /db_xref="GeneID:5652220"
     CDS             190311..191699
                     /locus_tag="LMJF_24_0540"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683571.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652220"
                     /db_xref="GOA:Q4QAS7"
                     /db_xref="InterPro:IPR007871"
                     /db_xref="InterPro:IPR025714"
                     /db_xref="UniProtKB/TrEMBL:Q4QAS7"
                     /translation="MTDAMKRLATALEGSPASLEHEGPLQDAHLIAIRDLATSATVTD
                     LRNRLLNGSLCPQGATRLTAALWNETSVRGYQKCLLAARQARLDAGHSFNSYDHLAEA
                     GVAMRSAMCSDGAQPKTCAEWARLIDLYTSFLPDRSHIHELENLPQEIAIGELLRETV
                     ERVRRAEDHAGGDGFALDCVVDVGGGNGFLAAQVAERLQCDSVVIDPFFPAHSIDCCP
                     RLWRDTAHRARPATRRQRTLHRTVALFRDVRWSDAVPAAPARTALIAKHLCGSGVDEV
                     LRHLEAQECLPRILVLAPCCFNKITVDRYCDAAYLRQVMGIDSEEALERVNRLTDWNM
                     SCYQSTHERMLARVEAARRSSATSGRGCACEVQIAMEAVASQALPAVDSSSAAASPPC
                     CYQRRSGPRSIANSITCTHDFALLAEALLNYGRMQWLQQRHYDVHLVQYVPDVVTPKN
                     KCWLAIRQAHTS"
     gene            <192738..>194279
                     /locus_tag="LMJF_24_0550"
                     /db_xref="GeneID:5652221"
     mRNA            <192738..>194279
                     /locus_tag="LMJF_24_0550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683520.1"
                     /db_xref="GeneID:5652221"
     CDS             192738..194279
                     /locus_tag="LMJF_24_0550"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683572.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652221"
                     /db_xref="GOA:Q4QAS6"
                     /db_xref="InterPro:IPR007871"
                     /db_xref="UniProtKB/TrEMBL:Q4QAS6"
                     /translation="MLNYRCKRRQYHSVLWSLQFVLALLHHARKGVARSRQQQRERGD
                     GREDDNCCCSTSTDAADTESDTLIAFQAAADGALASFAAQGPLSASQLLSLQNSLTDA
                     DVRDLCVQCMRHFITQQQQQPARTLTPVQRPLFSAENVFAAPTPLLQVLWPTESVRQH
                     YTWALEVAHRNRIDSSDLLAMPGYLQEAGLHARCVFAGYSGAKHDERSTVAQDSERRA
                     AHAWARLIDLYTSFLPDRSHIHELENLPQEIAIGELLRETVERVRRAEDHAGGDGFAL
                     DCVVDVGGGNGFLAAQVAERLQCDSVVIDPFFPAHSIDCCPRLWRDTAHRARPATRRQ
                     RTLHRTVALFRDVRWSDAVPAAPARTALIAKHLCGSGVDEVLRHLEAQECLPRILVLA
                     PCCFHKCSLDTYIDPDFVSALLGLGSAATFCHLTRLTDWNASVYQRLQGVDLSARGAS
                     APVSKKSVRHLVSCPEGIAASVEAVVSQGRVQWLQRHGYIVRLVEYVPDCVTPKNRCM
                     VAYRT"
     gene            <195188..>195580
                     /locus_tag="LMJF_24_0552"
                     /db_xref="GeneID:12981277"
     mRNA            <195188..>195580
                     /locus_tag="LMJF_24_0552"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721751.1"
                     /db_xref="GeneID:12981277"
     CDS             195188..195580
                     /locus_tag="LMJF_24_0552"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721799.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0552"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0552"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981277"
                     /db_xref="UniProtKB/TrEMBL:E9ACS7"
                     /translation="MSTDLECGSEALGRYTCKDAPRPSVCCTNGCCATSPYDLDMYTG
                     LPLWLRIAVAILAGFVMVLIFTFCLYRDRRSMRAYTLLKQEEAEERRRQRRSEELHEV
                     HPIGPQNSGGEPLHIPDTQSRPSLRPAG"
     gene            <196434..>196712
                     /locus_tag="LMJF_24_0555"
                     /db_xref="GeneID:12981278"
     mRNA            <196434..>196712
                     /locus_tag="LMJF_24_0555"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721752.1"
                     /db_xref="GeneID:12981278"
     CDS             196434..196712
                     /locus_tag="LMJF_24_0555"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721800.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0555"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0555"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981278"
                     /db_xref="UniProtKB/TrEMBL:E9ACS8"
                     /translation="MDIDMFLLFETVTAGIFGVVLVTIIGMSILTCVQRGQRMKERRQ
                     QCEDLVASTREKQQHLQRLVGINNLSDNPHLFDDGASNSSWSSRKSRR"
     gene            <198017..>199105
                     /locus_tag="LMJF_24_0580"
                     /db_xref="GeneID:5652222"
     mRNA            <198017..>199105
                     /locus_tag="LMJF_24_0580"
                     /product="hypothetical predicted transmembrane protein"
                     /transcript_id="XM_001683521.1"
                     /db_xref="GeneID:5652222"
     CDS             198017..199105
                     /locus_tag="LMJF_24_0580"
                     /codon_start=1
                     /product="hypothetical predicted transmembrane protein"
                     /protein_id="XP_001683573.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652222"
                     /db_xref="GOA:Q4QAS5"
                     /db_xref="UniProtKB/TrEMBL:Q4QAS5"
                     /translation="MEKANQAQHSRAPGKQSRSVFLVGVAIMIVILFVIGHMLAMRPI
                     TSAEDDMLSSACTHAQLVMREEWVDADTRLAERPNFIVRNRAQLLELYRLRVFVVATE
                     AGVLNVTRVLNSLRNCNYSQRVFPIDIAVHVLGNASAMSFVPWSHGRLDFYAHRLYDN
                     ASLSVPILMADVWKPQSDFELGMLLTASAEVSPYWFQWVMSALRHYAPTSTETSIELA
                     TDKDSGTGRGRLLSPLSTTLSGLALGMPIAETTVSAVSAFFAPHPSTTSIFTASFWKA
                     MVARAGPGTDVYAAPGNWQAFLNTSTSVPGHDEHRFLYPPLDKFGALACEETTACAIR
                     SLNPSEVAELVNVSALVHKVQRLPEQAT"
     gene            <200037..>202103
                     /locus_tag="LMJF_24_0590"
                     /db_xref="GeneID:5652223"
     mRNA            <200037..>202103
                     /locus_tag="LMJF_24_0590"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683522.1"
                     /db_xref="GeneID:5652223"
     CDS             200037..202103
                     /locus_tag="LMJF_24_0590"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683574.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652223"
                     /db_xref="UniProtKB/TrEMBL:Q4QAS4"
                     /translation="MPTNAAQALEKLVPGRLLQLADNGTPTIVTPLGNEGSLNALIHA
                     YKGKGYLPYFTHAVKAAQRSLVNELRAAGVEVPNGAEASHLEGVCGVHCRDEASCSHI
                     IPDEHITATLYGEDTDDTRMIVACDPIQTKLRDDCVECFPRVNKVSGWEELVVRVHLF
                     YPNTVPCMSVQDRRARLVTQKQFVPKNARTLQGYHVFHYAKRGSSVRTPHCESMFPYT
                     PKTTESKGFTRENRCTAITVESVFVRDPARQQRPFYAEDAGQARVYFSYLRVDAFVTD
                     DELVEHFPLESMDVAAMPAFTDNRYVEKYHVLVRLYLLAHDQGWTATQPHGCPHPLGD
                     RVGLPVLFRSCATEVIVPDACSHDSQLLLRQRLLPDVEMQVTRFCFRRIVSEVLRQRV
                     VAAAADTPECCIPVVCYMPYSDRVPVFTDKQVGVLARLYPHLGIRRPTSRREWADLSR
                     TLYQHCISLFDILAAVGVPLRDAHGAVIDTDAYVPYTADMADDYFLVIANRPLRDYTC
                     VTNQRWLCEQLLLPDHRPPISARAFAAWVRYWNAMAQLKHELEKQVTLDTVSAHLGLR
                     LPAGKTGQRAACLVNGLVTDAKGGLIFPKLGGRRFRDREHVGALLPGAPVLYSFWVDG
                     KLQFTYVRMPMRFVRGLPLKQVNGQRPVQSVIAAGGAPANRGDGTQRGGGQVGEERRA
                     NVAIHA"
     gene            205316..205387
                     /locus_tag="LMJF_24_TRNAPRO_01"
                     /db_xref="GeneID:12981279"
     tRNA            205316..205387
                     /locus_tag="LMJF_24_TRNAPRO_01"
                     /product="tRNA-Pro"
                     /db_xref="GeneID:12981279"
     gene            <206042..>211411
                     /locus_tag="LMJF_24_0600"
                     /db_xref="GeneID:5652225"
     mRNA            <206042..>211411
                     /locus_tag="LMJF_24_0600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683523.1"
                     /db_xref="GeneID:5652225"
     CDS             206042..211411
                     /locus_tag="LMJF_24_0600"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683575.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652225"
                     /db_xref="InterPro:IPR021714"
                     /db_xref="UniProtKB/TrEMBL:Q4QAS3"
                     /translation="MALVEPLVGHLLSKYKETVLEGLSKIRHTLQVGGEQANELAVAV
                     SQREEALQALRATLLRHEYFVPTLQTLTVVLTQLVERGNRVALAREVLRGDCAALFRK
                     TLATLSDATLTHVTAALQFLTVAVKDAPLLVLARLRSPADAHVTPAAASAASMSPLAA
                     VATQRRADVPLHLAAFRLQLTYNQRRVRLTRLGFLVQLVTSPMHNAVVDTICSHGVLT
                     HLLEDAAELLREGTSAGVACALSALRVVRELFVQSRHITAEQKRRVLLAQRNVFRLLV
                     RALEFDHVADNAAAILYAIVDETIESPADYASTRVESLEDQGMPNYLLFFLLRQLRPK
                     ASERMSQLVLHILQRAPDLIRPYFTRVSGHLAEEGSSHGVASATVRVAVLNLMTRTFL
                     CPMPYHLAAQQVRLEPVVAKTSTFYTMCPRDVADEICPAWVAEYVHRLINGSTNLLML
                     ALAMQLTQAALMRAKRVLPLVLAVQNAAKRNKRTSTAGDAAAGGSAAETVVSLPSPRD
                     FTEADLDVLQGNDTAEAEVWDTYNAQVRHHLQAALPSREEFWHRMTQQLHRTLTASAA
                     APTSSATSPSSAATDAVLEKTHVVVQRMLLLMKSYVDVFDVRVPWLSAVPIFLPDLAR
                     SAVSSTSVARGPMTGKGSNGHATAAAASVHPITAALQKQNDILKPWPAASVALLCELL
                     AVSQQRRVPMMKMHHINMSQTVGIGEWPLLLSILLWVTHHRPHSPPRQESMEAVQEAR
                     AMGWAAQLLLWTVHSVTIHSSCTMAEAHLWLSCLTPNTVPVFLHVLNHLLMRSLSKVA
                     DRVTHELRDAQHGVLAAAALHFIDRTKEKQQQKGSAGGGEDDGDGEQHAHQQLRRKQK
                     TPRVECANNNGGGSSSNSSSSSSANLWGTHLQASLAEFESVVGRVVHLWERRARLLAQ
                     TAVAATAELNVPRVTQQQCIEVLVLADRQRGFAKAPRRCRLTSQSAHLRTFAFTLHSP
                     VLPLPEEEAAVALLSRLSIAVSSASPLDGEVLGRAAKQAPMRTSLVEDVCTALGIEDS
                     LAAKDKAAKAPTPPWFAMSSVCWQVAGVLLSLTHSTASAPSSRSSSATEAAHKLALRL
                     GRALLSDEAAVTAHLRANADREGSLAGLLVLMLACTRTLLQLISLSGAEQRHPCLSVD
                     ECAALGRVCLDVYSGTLGVQDRLIYAVCLTLHYLSAARHVAHAATATAATKEERADEA
                     AAEQQGKRQRSAAAKYLSPDYHEGAEVPDALVQRRFLLCGHTASAARTPEVEMLSWHL
                     DTLTEEDMTCMALLASSRLHNAIHLEDGSSADGATDLLGAVFPELRSAGDAHVTDLER
                     LSLSNVLDLRYMVPLLHRVASVSATFSAHLPTGRVIPLLLKALTSIDPQLRSAAVAAL
                     STLYIPKGALRVVVSVARIKLAQMQMSPSTGGAGRRSQQPAQPRRVSSAAAVPRLPTP
                     LAIMLIMSIRPLGRYDDVLHHHLVHFLMHLESVLDTPMPFTRWATTPPLAAISVPLML
                     ERQEALQLRTNKLGGGGKSSGGVTQASAADVAQELRKEIPPQLAFLLQLLRHACEVPQ
                     DGAALIESNGLDGLLLLCDMLTASDGQRASYVQCLLILCTQSAALTCLFARAGHVLPW
                     TVSFLWQLCREYGKATPYPYSGQTFTTALELLRVMCAATVQSKISLAEAPALSDAAAE
                     QLKESMRQLRAWVVDAHVTARDVLDVFDDIIGRCSHAAHGQHSGAAEADDTRGTEGGV
                     KAKEAGAVSPASASQPSSPPPLAERRRETPSRCERRTPPKRVRAEGTAEVGVVGGVAA
                     SLCRP"
     gene            <212834..>215923
                     /locus_tag="LMJF_24_0610"
                     /db_xref="GeneID:5652226"
     mRNA            <212834..>215923
                     /locus_tag="LMJF_24_0610"
                     /product="putative DNA helicase"
                     /transcript_id="XM_001683524.1"
                     /db_xref="GeneID:5652226"
     CDS             212834..215923
                     /locus_tag="LMJF_24_0610"
                     /codon_start=1
                     /product="putative DNA helicase"
                     /protein_id="XP_001683576.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652226"
                     /db_xref="GOA:Q4QAS2"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR010003"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QAS2"
                     /translation="MNCQCDHPARYLISRDGKPCYTCALGRCRFYALAPVQCEGYTRV
                     TLGSPGCPLADTGVVLRFEALVHPTRKDVACFMIRVQGEASRWDTLRLAVLQDSQFEG
                     MWYTAGRAFLYPMAQYTRLVTALRACSLPHVAFEEIPSFYFRCVERMRQLPRQYADDV
                     AAGRACLPDAEDCVYRRLKPFQRDGVRFVLERHGRAMIADDMGLGKTVQAIAVAHHYR
                     DEWPVLVVCPMSLMENWAKEFNKFCGIPFARIAILQGAKATATSLQAVAIVSYSSLKC
                     VENAHFNVVILDESHYIKAGAAKRAQQSLKLCRASRRVILLSGTPAMSRPIELYAQLQ
                     AIQPSLVPSKAQFGARYCNSFVGRFGIDMTGHAHPDELHSLLRHFLIRRTKHELGSEL
                     PSKSRQLLYMYITEKEKKALEKQIIALRRSLSSTSAAATSSTSSLVDNGGGDWAARAP
                     NVFEMKMATARAKIPAVQDYVSGIVEQHLDSGEKLILFAHHQCMMEALRSAVEAVRPR
                     QPIDYIYISGDTPPAQREPAAEHFRTEATCTVAILSMQSSGIGHNFTCASTVVFTELD
                     WNPSTHLQCEDRVHRIGQAQPCHIKYLLAEGTSDSVIWPLLQTKLSVTAAMFETSKMT
                     GAEVRLHDGADKQKVARRDVVAATTLSTPSASQQSTLDQFMQPQPSQAVSRGGEEVDG
                     AVVSMQESPRVSVHSQSSTGQAALASLERDPPPLIPFSELGDDFVVTSAPQLSNFSTS
                     RRPRLSANSGISTTQPTALPSSPSTTVPGPTPKSANITSVLDLMRHTSSRKLGAGSSA
                     AEPSHSVRAAAASPVVNLTGMASAQPVAMQPSSPGVTPPTMDITASAGAVAPSRRTVF
                     TLSKTGAQSFISTAAASTLTSSCSGSRALCPAAPPTVPEAPKTAAVHVPLRPNLHLKR
                     PRTGAEHGSGGSTSKRDNAISGDANALAATAVALAEISCAVGPAAAATLAPLPPRTTL
                     PVQTQSVMVHPIMLAASSSSSSSSAPSPVTSTPRRTLFKLMGSASGAPSSPMPAKPQ"
     gene            <216854..>219283
                     /locus_tag="LMJF_24_0620"
                     /db_xref="GeneID:5652227"
     mRNA            <216854..>219283
                     /locus_tag="LMJF_24_0620"
                     /product="putative ubiquitin hydrolase"
                     /transcript_id="XM_001683525.1"
                     /db_xref="GeneID:5652227"
     CDS             216854..219283
                     /locus_tag="LMJF_24_0620"
                     /EC_number="3.1.2.15"
                     /codon_start=1
                     /product="putative ubiquitin hydrolase"
                     /protein_id="XP_001683577.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652227"
                     /db_xref="GOA:Q4QAS1"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:Q4QAS1"
                     /translation="MDVAHNRSLGFAGKEILFRKIEFERYRKPHVVEYPRSAVVLNPQ
                     HTRQLRDAMCTQRQGGEHDGSDADDDDEGAALRGYSDSDDDEDDDPRRVDKATELCSD
                     AQFRSSLHLRWQAITPVGLGLMNLGNTCFANSVLQALAHTPAVAQYFMNTFRSADSQL
                     GAPFDFAFALAETFRKMQHAPQQGRTGGGGAYRPGQIMSSLRLLSKHFSIGRQSDAHE
                     FAVQLLFSCQKSLLHRLVGSKKVHPRVAHTTALHRICGGYLLSQVMWSRQEEIQQLLR
                     AGKQQEAMDLKMEAKQAEGKRAQRASRHGLDPQTLYSNTYDPFTILSVELAGRTLQHC
                     LDKFCAVEELDGRSYLSPRQVGVRAKKKLSIHVPPPVLVIHVKRFTPTGNKINKHVPF
                     PLELDITRYCTLLSSSSSSPPPPNHVQPHNGVSSPATMKRSDCQYELNAVCVHEGRSI
                     DYGHYYTLAKAPNGMWYEFNDSHVSRLSEDQLQQAQVYMLFYSRKPTVATEKMQPPRQ
                     QQHNIRGSAPASESSTAASKLGAATAVEEDGAVGRELSESEVQALMEKRRAAQRQAGS
                     LNGHRSPPPATAAETPQLLANASGDSGDGGHAVEPASPSSSTTARAQTFKRMQEALPT
                     DSDSDGNDEKQDCAYVRRLPARLNGCAVQDSRIEADVAPPPSQRDDEHNAPADGEAPL
                     KLAKVSLYGGIVKSMKCVLKDGTDGGASTDTTPPQQRKSPNFRVGRNAVQALHQRKVL
                     NTPETVRRPASAHKFQQRIRDPMWEMEMDRGKVKKVKSKEKVPDPFEGVNPFQEVSRG
                     MFDVRGRRRRA"
     gene            <220524..>220844
                     /locus_tag="LMJF_24_0630"
                     /db_xref="GeneID:5652228"
     mRNA            <220524..>220844
                     /locus_tag="LMJF_24_0630"
                     /product="putative ATPase subunit 9"
                     /transcript_id="XM_001683526.1"
                     /db_xref="GeneID:5652228"
     CDS             220524..220844
                     /locus_tag="LMJF_24_0630"
                     /codon_start=1
                     /product="putative ATPase subunit 9"
                     /protein_id="XP_001683578.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652228"
                     /db_xref="GOA:Q4QAS0"
                     /db_xref="InterPro:IPR000454"
                     /db_xref="InterPro:IPR002379"
                     /db_xref="InterPro:IPR020537"
                     /db_xref="UniProtKB/TrEMBL:Q4QAS0"
                     /translation="MMRRAIAQPVARRAAAASSALVVAPRQASTVALSVQGLHYVGTG
                     LAAIALGGVGLGIGAIFGCLLIGCARQPNLTKMLFNYAILGFALTEAIGLFALMLAFL
                     MLFS"
     gene            <222898..>224631
                     /locus_tag="LMJF_24_0640"
                     /db_xref="GeneID:5652229"
     mRNA            <222898..>224631
                     /locus_tag="LMJF_24_0640"
                     /product="putative MCAK-like kinesin"
                     /transcript_id="XM_001683527.1"
                     /db_xref="GeneID:5652229"
     CDS             222898..224631
                     /locus_tag="LMJF_24_0640"
                     /codon_start=1
                     /product="putative MCAK-like kinesin"
                     /protein_id="XP_001683579.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652229"
                     /db_xref="GOA:Q4QAR9"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q4QAR9"
                     /translation="MSSRICVAVRKRPIADPELDIVETPTPRCIVNEPKIKYDLSPYT
                     DRHTFTFDEVFGETCNNSGVYQRCCLPLIDTVFNYGNATCFAYGQTGSGKTYTMLGSQ
                     KEPGLYAIAAREIFARANDIDAVVYVSFYEIYGRKIFDLLNNRKRLFAREDADKVINI
                     CGLSEHQVTDIQEIFDVITAGSAYRAAGQTSANAESSRSHAVLQVEVRETRSANARRA
                     PKTIGRISFIDLAGNERGADTFDCDRKTRMEGAEINKSLLALKECIRALGMGKSHVPF
                     RGSILTEVLRDSFTGNSRTTMISTISPSSQHCVNTLNTLRYTQRVKDLGGGGIGGGAK
                     IEQVAGSPPGRRPAAPRRKPFEALPAKNRPEWVSDFASDPSPDMSPSENGGYGGESDG
                     VAAGAAPRNAAKPRGRQPSVGRSGGTPPPAAAVVKVKDPKIATIVQNHIAALESNDDD
                     DDIDDDGCNYPCAVEGGGVMQREEERQVRRVHAYVVEEIAKAEEKLIALHRRHIDSKM
                     TGIKEEITAIQSFEESDSVDEYVARVRVLLMKQRDDMNEILAMLNGIGSMLRDEEDLS
                     KTLTSSVSARR"
     STS             224289..225724
                     /standard_name="ORS_179"
                     /db_xref="UniSTS:254591"
     gene            <227070..>229982
                     /locus_tag="LMJF_24_0650"
                     /db_xref="GeneID:5652230"
     mRNA            <227070..>229982
                     /locus_tag="LMJF_24_0650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683528.1"
                     /db_xref="GeneID:5652230"
     CDS             227070..229982
                     /locus_tag="LMJF_24_0650"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683580.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652230"
                     /db_xref="InterPro:IPR008580"
                     /db_xref="UniProtKB/TrEMBL:Q4QAR8"
                     /translation="MGLSRGHSPRLRRTEVQVPVTLNVYSLIESNKKLSKMGMGVFHT
                     GVVVYGIEWGYGEVVDNPNASGLFCVHPGQAAGTLYRTIRIGHTTRSPMQVDTILHRL
                     ENEWRSSDYHILHHNCNHFAQAFCDLLSTTEKLQVPSWCNRAARVGDRVIPRRLATKV
                     QHMMDDEPPKAAAPPTPASNISEVPTSVVPHEWYLHPSICQPLRYIDESKPLSVVTRG
                     GHSASASAAAVDGSSSRYSAECDLVPPPGYEMADAGSVCPPITRRETYCRTDEKGSVT
                     HMMAIEEQPSVTPSSRRESACKSTASQCATKTTYGHSPAPPSLGVAFSSGGEDRVMLP
                     RMRASTSQSCSVAPTGSPQASEIETDVENVLQSETSEEPSPSFMSHLPMISSPNRGAA
                     NPRKATPSGSTTNRRRGASFEQQHHVENDSRDEGAEASSEKPLCMTFNSSMESMSAEL
                     SDQGGSSAQPHSSFLATSNAMPVGCITTLLPASPNPPADEVTRRSSDVMAGEHDVSTG
                     VVNMSSEVSNNASSDFASAKHKHRAKATTTSSAIKEQRPKREPGNEFSDITGALVCDA
                     PISSATAEASPAGIKHKNSSAWKLLKNQCGLSSKTGSGNAVCKYLSTPSASSTPSSSS
                     SLLQPEAHDDKEAVSVATDSGAVDPAADSAPASRQERGHTHVLLSAPASPSSPHSTPV
                     ALERKDMGHDAASNEVQDANGTTPTPTTAALQNAPRMLHLGGDSPASATELMPQSSER
                     RLSRSEPSLVRGGVPSPVSPPDLGLATTASRPIDSPGPQPPPSFVTPERPSIITNSGA
                     VTTGCSPAAAHQQCRRASSSAAMSDSPPPDRERCRTPIPFAGRRRGNDENVAPALQLD
                     LGSDEAEPPVSRSNSRHSRTAVEAGTLSTADKTAHAPMVSRSCGPSSLHREETATGDS
                     RIGENASSAHSQAPLAAKPSLNTELADPARLSPTPLESIRAAEANQPPTLPPCGTH"
     gene            <230994..>233285
                     /locus_tag="LMJF_24_0660"
                     /db_xref="GeneID:5652231"
     mRNA            <230994..>233285
                     /locus_tag="LMJF_24_0660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683529.1"
                     /db_xref="GeneID:5652231"
     CDS             230994..233285
                     /locus_tag="LMJF_24_0660"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683581.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652231"
                     /db_xref="UniProtKB/TrEMBL:Q4QAR7"
                     /translation="MWQNALIEISNRAGKKATHPVLNKLQKAVATDLSISRVHSGKST
                     GSLFSVKADALRDSRNDYITHLQNSTLYSSLSTLTPAVRAADESDTLLRRAEGFPFLY
                     AQEAFCVLIKAGEVQNALRLTTFWKYQKPKHLKVARKKVKRELFRTISTLEEVKDALT
                     LKVLIDILSAALQEQQLAHKSALQAVSLTHSDACPPFIQYKLFAPLGSAVTTDVLVCA
                     AEAACRLDGREGIPVLENLVILDKCTSVSVSAATTARLPYQLYRLLEVWAEEKLLDPK
                     LTAQVCPDLPPKLLHPSHYTTLDILALSAAEARYIQKNWVSRGLFHPSSNKLGQCSKW
                     SCMMSRLLANSKTLQAVEAKCLLIALMCGPAKPAITGDSRSVSAVRKSILGLLRDLKP
                     SVRRHAAANLLKKRHLFAALKISPFTTACVYLQSFHSKNTVDPTLCKICTALLFRLCR
                     AGRYADAARVIWNHLSVECSVTAALFKKNAMTVEFAVVAVSHAMREACAKKYSRSWMG
                     YRSLALLRTAASASHHVTVMYCVPVCVGALECGVPFSAVNEALSHIFSSDAAQKAWAL
                     NLVRLCSDAEVTPTKTKADRCGIDASIASYLAQMCRLQGGKDGEVVLQTPSRSKQLAL
                     WTTLTEPHSNPCLNALMAAVFLDRTARDSIIECTWFLRQSQNTQAFAQKERANEMPLL
                     DIWNWEVAAAMASNCTSDESFTVFLECLKRRKPSCITRTGDSADNIAALMCCELDIHY
                     LTPVVSRDQYRGFHSSEITRAIQ"
     gene            <234202..>237693
                     /locus_tag="LMJF_24_0670"
                     /db_xref="GeneID:5652232"
     mRNA            <234202..>237693
                     /locus_tag="LMJF_24_0670"
                     /product="putative protein kinase"
                     /transcript_id="XM_001683530.1"
                     /db_xref="GeneID:5652232"
     CDS             234202..237693
                     /locus_tag="LMJF_24_0670"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001683582.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652232"
                     /db_xref="GOA:Q4QAR6"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4QAR6"
                     /translation="MDEVSVLNYLGPHPQIVRFLGSYTTSKNTSFFTMELMDSDVGRE
                     LREGNATLHEEGVCAAVAYSVLLALEQMHSHAVAHRDVKPGNILLKRLSEPEEWACIY
                     LPRDDISARLLPKSSIVSAFDPTLCTSKEASSREVVPGIRSRDDSASYAKAALGDFSA
                     AHSTHCADDVAFFDTRGTLHYRSPEQLMGKRSVVSENFAAVDLWGLGCTLYEMVTGTR
                     PFPGSSELQVLMSILDALGSDIQSFPVATKHATLFDKIPASPAFVDLLQRLLCLDPTR
                     RCTAKEALHHSFLASIRDSALRCAEAEREISTDRLPYVIGIPLTLKYASFTHIPELRF
                     SRISRTPLKATASAPSRLSAPQQPPGSGCPAPPPVSDTEIAALTVVAEGEAAAQTRSK
                     HRDVNHWSDGATTTQWGREGDCENEEEKETPSKKLLQQHCSDTTGTSFLSESSYLHWS
                     EIRPAARPSAPPLPKPLQHKENRVQCSSGCSAVAFLGNAAVGSTPSPSTSANDPPPQQ
                     QPQSLSGSMQRTVDIASRNTVSRALNISDSSVKGVRTERSASHVDFDLSPVPATQLFS
                     TDTDTSACLAPHPATAFLPRRAQPVLQLASGSTFTASNLRANSSFERENLMVGRCGGN
                     GASTSAAVGVAGPPGAIHAGHCSTPRQHHGQRPTAFSGRALRFSEETDPFARRSWGSS
                     AGQQSCLNSLLTSPAPVGQRAVEECSPQPSPIRPIGVATRSPSGLPVAADCSGLFLDD
                     SGGGLGWIGMPPTTPAVQESMGAGAGACEAVAALMPTLARDISRGSEAGAAVAPMLYP
                     VRLQPSWNASNTTATGIVQPPNSPCVRRCVHLLEPTPGGCSRSRTCSAVALTTDVTTA
                     AVAERPDASCSSQRQQPATSPASTGGRDAPSSRIMPLPIPLSVATVCQSATQSLCAPT
                     PRSRTPTSRTLHETPRTQRFSCPTSALRTGHAGHKNGNQRGSLQSQGALTSCVHGGDD
                     ILSAAPFLCNQDANASVTHLVHNVCASVGLTGSGGDAAPTLRCAAASPLGSLVACTHS
                     SQLHCTPSSSDPAPEIAVPINCDGCNHPEVANEASPTPDVTVVRAPGAVPFMGGPHTP
                     LPVHSSASPLSQPCDAPLLQLNSASLDSHRRSGKGHESDRIETPQSKRRESMKRMREE
                     AMNSEDTAAVRQSARVV"
     gene            <240032..>241675
                     /locus_tag="LMJF_24_0680"
                     /db_xref="GeneID:5652233"
     mRNA            <240032..>241675
                     /locus_tag="LMJF_24_0680"
                     /product="myo-inositol/proton symporter (MIT)"
                     /transcript_id="XM_001683531.1"
                     /db_xref="GeneID:5652233"
     CDS             240032..241675
                     /locus_tag="LMJF_24_0680"
                     /codon_start=1
                     /product="myo-inositol/proton symporter (MIT)"
                     /protein_id="XP_001683583.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652233"
                     /db_xref="GOA:Q4QAR5"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q4QAR5"
                     /translation="MRASVMLCAALGGFLFGYDTGVINAALFQMKDHFGFSEHSWQYA
                     LIVAIAIAGAFVGAFISGFISAAFGRRPCIAVADALFVIGSVLMGAAPNVEVVLVSRV
                     IVGLAIGISSATIPVYLAEVTSPKHRGATIVLNNLFLTGGQFVAAGFTAIMVVFTSKN
                     IGWRVAIGIGALPAVVQAFCLLFFLPESPRWLLSKGHAGRAKAVADKFEVDLCEFQEG
                     DEVPSVSIDYRPLMARDMRFRVVLSSGLQIIQQFSGINTIMYYSSVILYDAGFRDAIM
                     PVVLSIPLAFMNALFTAVAIFTVDRFGRRRMLLISVFGCLVLLVVIAIIGFFIGTRIS
                     YSVGGGLFLALLAVFLAVYAPGIGCIPWVIMGEIFPTHLRTSAASVATMANWGANVLV
                     SQVFPILMGAIGVGGTFTIISGLMALGCIFVYFFTVETKGLTLEQIDNMFRKRAGLPP
                     RFHEEGESGEHGNRHREDGDFDRMATEDVCDLSSLGNQVVSFAKAEDAFTEVAMTNRH
                     AVSNKFEERATSSSSDPQSLKNHDEEQQTAIQAAPHEPK"
     gene            <245669..>246193
                     /locus_tag="LMJF_24_0690"
                     /db_xref="GeneID:5652234"
     mRNA            <245669..>246193
                     /locus_tag="LMJF_24_0690"
                     /product="hypothetical predicted transmembrane protein"
                     /transcript_id="XM_001683532.1"
                     /db_xref="GeneID:5652234"
     CDS             245669..246193
                     /locus_tag="LMJF_24_0690"
                     /codon_start=1
                     /product="hypothetical predicted transmembrane protein"
                     /protein_id="XP_001683584.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652234"
                     /db_xref="GOA:Q4QAR4"
                     /db_xref="UniProtKB/TrEMBL:Q4QAR4"
                     /translation="MLRRSRVTRFIVPSSSSPELPRFLTEREKPILSTSGDLYAFVVE
                     YDHRSTIPRLGHGPVHSDFFSRYLFSGSPLAGALTAGGVALFVLTFGYHVGKPVVDAH
                     RELLWKRADAAHDKRSRESTEGAAAEEKGRDSLSPVEEFDDLIEVKGEEGWSPSHTKT
                     GAFESHSHRSLDVE"
     gene            <246942..>249911
                     /locus_tag="LMJF_24_0700"
                     /db_xref="GeneID:5652235"
     mRNA            <246942..>249911
                     /locus_tag="LMJF_24_0700"
                     /product="hypothetical predicted multi-pass transmembrane
                     protein"
                     /transcript_id="XM_001683533.1"
                     /db_xref="GeneID:5652235"
     CDS             246942..249911
                     /locus_tag="LMJF_24_0700"
                     /codon_start=1
                     /product="hypothetical predicted multi-pass transmembrane
                     protein"
                     /protein_id="XP_001683585.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652235"
                     /db_xref="GOA:Q4QAR3"
                     /db_xref="UniProtKB/TrEMBL:Q4QAR3"
                     /translation="MSRKRRQRAAALSGTPFPVSLASAASSASSEQLPNGTTRSRTKC
                     RENGDGCCVSARHSPHPEPPSLSRSEAVRGVHSRVSSSSNGAIHREEPSVVGMEDFPS
                     PVPYLRRVASSDGYLNGSKHGKSFPVSKRPPTGSASVGITAMQNATYCGNWSQVVLGA
                     TSAIMFLLVLCVSYALYILVTPYGQSIMNGVLLSIVMHPQSRLRSSLYMGTAVDRMTH
                     MQQRWAVQGRLMGLVGSWLSLCHFASFVVMQGTFFLGLNKIHVHAQSVLLEEASAAGC
                     GAGVGAKGASTRTMPRCPYASQSVTSPATQSVASTTRQGGAGGLSRPAGTPISSTAAS
                     KTPPSTGVPPAQLHRPLVSTPRGRRVLRWLTISIIVIVAHLLVGVTYFVLLHAALGVV
                     FAVMLPFLPAHTFVSSMGRLWRVAVLLFFVAGLTLNLTADVLSISEAVRLTTSAVVGS
                     GGGDGYDAAMAAPSTSNISDRVLTALGVENCTTTAPLAKVAVTGDGIASGEDATSEAT
                     AAATSHADVDALSVLDEYRSCIEAFLIGKIQDLVVQEVADMFSDGNVSKMVETLMEVL
                     PPQLRAVVTRDDTVLAGLEKSASKGDTSSLSGGEGGTHEKAAAQPLSWRAVLANARGL
                     RPASAIKSLVYDSLSGTSARTLNSASDTSVRGATAAGHKVEINWLTVSRLIASRLLPY
                     VEHALRLFFRVGSNLLGLFDSIYAVILFVFCYRYLTQLEHTVLYYGVAKLLRVMQPEL
                     GDHHARTIEQDITVSFITLLQSFWHLTWFHFCITFCTFKLWGFPTPFLLGLVSVVLAL
                     FPLVPKWLSPCSIALVYMLVQLASLVTSEGTSCSGNRGPVEAHAAAATDVPLLSFPPG
                     RSWIEVLVWGKPYALHYIRALSFGLAVLLECGDEWLLCVSRGLRGGFFTEADGKGREQ
                     LQPFVIGTALVLGFVAYGIRGIVFGPLTVIVARVLFDNWDIVLANREPGRLTLPPSSF
                     VGVEGNDEEETSMVESP"
     gene            <250929..>252248
                     /locus_tag="LMJF_24_0710"
                     /db_xref="GeneID:5652236"
     mRNA            <250929..>252248
                     /locus_tag="LMJF_24_0710"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683534.1"
                     /db_xref="GeneID:5652236"
     CDS             250929..252248
                     /locus_tag="LMJF_24_0710"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683586.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652236"
                     /db_xref="InterPro:IPR007553"
                     /db_xref="UniProtKB/TrEMBL:Q4QAR2"
                     /translation="MCAYASILVVSAVHLCFCYRSHTSQSMTPAKALRLSSLPLATAW
                     WRQHGLADRLEGFRACRQPTPRQRPLQRTADGGVSLGWAGLLAGAEQSRTSSITTATD
                     RPPDLPLVLVSACLLSYPVTYRGTHTNLPASLRPTPLLFLTEVLFKELGLVQCVPVCP
                     EVQWLGLPVPRVPLRLVRGSRGTDDARQRGSGWAAAQHSSSATLPSLSMSASDSVAIK
                     GEREARYLVESSAEDHVLLRCDAPNDTFAEQSPSPQLHSAFLAQLVQDLKAVDGIILK
                     SYSPSCGVRDARLYEEAVTSPPSSPCDQHACNACERAGKPTSASFIGRRPAASASAQR
                     RFDLVDGFFTQQLRDFLTSMHGVGGERRADARCHSEAAAPVITCDRLLTDFYTEERLR
                     RSPLAGKVKKRHVAGNASEAAPHLTSLDSFMESVLQHRDWRVSQHRC"
     gene            <252893..>253150
                     /locus_tag="LMJF_24_0720"
                     /db_xref="GeneID:5652237"
     mRNA            <252893..>253150
                     /locus_tag="LMJF_24_0720"
                     /product="putative mitochondrial translocase subunit"
                     /transcript_id="XM_001683535.1"
                     /db_xref="GeneID:5652237"
     CDS             252893..253150
                     /locus_tag="LMJF_24_0720"
                     /codon_start=1
                     /product="putative mitochondrial translocase subunit"
                     /protein_id="XP_001683587.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652237"
                     /db_xref="GOA:Q4QAR1"
                     /db_xref="InterPro:IPR004217"
                     /db_xref="UniProtKB/TrEMBL:Q4QAR1"
                     /translation="MNPNQPPRRKTAFNEEFDVMQAIQEDRMAYHASIACHERCVHNY
                     FFNNFYWREKTCMDNCLDKINQATVITNINYGKFEDVESKK"
     gene            <254178..>255737
                     /locus_tag="LMJF_24_0730"
                     /db_xref="GeneID:5652238"
     mRNA            <254178..>255737
                     /locus_tag="LMJF_24_0730"
                     /product="putative signal recognition particle"
                     /transcript_id="XM_001683536.1"
                     /db_xref="GeneID:5652238"
     CDS             254178..255737
                     /locus_tag="LMJF_24_0730"
                     /codon_start=1
                     /product="putative signal recognition particle"
                     /protein_id="XP_001683588.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652238"
                     /db_xref="GOA:Q4QAR0"
                     /db_xref="InterPro:IPR000897"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004125"
                     /db_xref="InterPro:IPR013822"
                     /db_xref="InterPro:IPR022941"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QAR0"
                     /translation="MVLAELGQKIGQAIHRMSAKSMLGEDDVKELMNEIARALLQADV
                     NVTIVKKLQVSIRTELALAEEGAGLNKRKILQNAVFNGLKRILDPGVKPFLPVKGRHN
                     VVMFVGLQGSGKTTSCTKYAAYFQRKGFKTALVCADTFRAGAYDQLRQNATKAKVRFY
                     GSLTEADPVAIAKEGVAELKKEKYDLIIVDTSGRHKQESALFEEMKQVEEAVKPNDIV
                     FVMSATDGQAVEEQARNFKEMVAVGSVIVTKLDCQTKGGGALSAVAATRSPIVFIGTG
                     EHFEDFDLFNPERFVQKMLGMGDIGGLMDTMRDANIDGNEEVYKRLQDGLFTMRDMYE
                     HLQNVLKMGSVGKIMEMLPGMSGHAATAGQQGDIALKGFIHMLDSMTVAELDEVRVKK
                     MMTPSRMHRIARGSGHSVVEVQNLIISYTKFEEIVKKMGKMNFKAMMQDSSGPAAGHM
                     GQQQMGQLAKLLNPNMLRQIGGMGGLQGMMKQLQQSMGGGAGGAGGLPDMSAMANMMQ
                     MMQQHQKPPRR"
     gene            <257461..>260685
                     /locus_tag="LMJF_24_0740"
                     /db_xref="GeneID:5652239"
     mRNA            <257461..>260685
                     /locus_tag="LMJF_24_0740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683537.1"
                     /db_xref="GeneID:5652239"
     CDS             257461..260685
                     /locus_tag="LMJF_24_0740"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683589.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652239"
                     /db_xref="UniProtKB/TrEMBL:Q4QAQ9"
                     /translation="MPNTQHARTPTRNVRGEAPVRHWLLVGHRNVFSDDPSPPSCAQA
                     AQPKSPSGSVSKSKKKQRCRSVKKATVESAAPFASSRAFSADRYKDANEWEGNVFGID
                     TAYLTSAPERLSQSPNEDAESAPCAPAVVAALQKTEACTHTRKEPRGQQHSAESSVVR
                     PTSPLEHAEDGVDAVQTRDSSHAPTQERAALLSGSILLSSPAPSGEHAGDTAPSVGVI
                     RSATMVPAASGKNAFRQQPDASTAVNINDAGTGCALACLPETPRRPMQVCFFRSSESR
                     WQGVRTPNETVLEADSDGNGTDTHGDQKNFIQSHARDRVPHEETEPCVTPPRTPHAVS
                     TITTLQEKGEEDIDFGGEDGAVADACRCLNAPTTAVVVREQSQVNVSLEHSPPSPVLP
                     ALPRTSAALNPTEELPTAAATTSFRSSGGSPIPPPIPPYPNNREESTANATPLRHSDT
                     SNPALWQRGSPGDGDEGRMCIEGPHTPDAVREALPRRLQSASPSSQESVNAISSFFPA
                     GRPDSRKRVSPLSGQGPSSSYGCSDGGSTLESHQTRRLTPYCDTDEEDDSRGISASRN
                     VTRPLEESAQEAEQLHHRLPAEDMAAAALPGACLSSTDSAVTPSATLLQCDDDPATLS
                     SHVQAEEPVCPREVSWRSALQFSHALLTEYQRSVLTTFMTVCKAAWLPSMAVCRLGYV
                     CTLAYASPRVAEQELATGITVSEVHLLFQLCCTSPSESAADRLVECFFATQLVRYVNW
                     VRHLQFEYLYVRMVVLRAVSMMELHERRLICMQRDLGIRDAIELFMLLAPRPRAPTVS
                     TGRRVFSAFRMALHALSGGGNAGATTASAKRSESCSGRTQHKPSSLATPRCATGCQLI
                     ANEERRQHRPPRVEPLFASETWKAARATCDVSAAMSPTNHGAGDNHGDTRDVARKVAG
                     ATNSPPEMPECHRGTPHLLDKKCSNDCGPMAERRSGGGVSSVLPALWLPKLIRSTPRI
                     ASVAHKTREEADMVTAKTDCSEVERQDKAGFPRRGASSVLSSRSPNHREPGRRNSRDA
                     ALPNGGLRARETVQPTKRRRTPPLPTDADFVNLHDAEVLKRFVK"
     gene            <261898..>262875
                     /locus_tag="LMJF_24_0750"
                     /db_xref="GeneID:5652240"
     mRNA            <261898..>262875
                     /locus_tag="LMJF_24_0750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683538.1"
                     /db_xref="GeneID:5652240"
     CDS             261898..262875
                     /locus_tag="LMJF_24_0750"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683590.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652240"
                     /db_xref="UniProtKB/TrEMBL:Q4QAQ8"
                     /translation="MSIDAGLCDRYVVFLDIDGVLLPVPKFTFGGGNLSGRCAQTLKR
                     LIAALGGRDKVTLVLSSTWRNHPVMVDRLNTFMQKEAGDGIPVVSERTPNGTVLMSSV
                     TYYADDPSEQRLVRDRVDEVYRWLHTHITDHPEAIGGRWFAIDDMQLDVDERMRGHFL
                     HTQTDVGITEADVDTACAMIASHPSPTEAYAAAVAALADPALKAEEVEIQRVLQSRLE
                     AQLAATTAELTEAQEKMAALSAEKKDLIKELAEKQRSIDDMRYRLAVYDFSKRYPCLA
                     TAVELAGTKSGAERRAMDAAIRTFVTLLMDRKELQKKMRSEAKKVKQAS"
     gene            <265169..>268552
                     /locus_tag="LMJF_24_0760"
                     /db_xref="GeneID:5652241"
     mRNA            <265169..>268552
                     /locus_tag="LMJF_24_0760"
                     /product="putative DNA repair and recombination protein
                     RAD54"
                     /transcript_id="XM_001683539.1"
                     /db_xref="GeneID:5652241"
     CDS             265169..268552
                     /locus_tag="LMJF_24_0760"
                     /codon_start=1
                     /product="putative DNA repair and recombination protein
                     RAD54"
                     /protein_id="XP_001683591.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652241"
                     /db_xref="GOA:Q4QAQ7"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QAQ7"
                     /translation="MRKSAAGSGVANGTFRPPTMSSEGTPAERKPRTHPLLPATLAAA
                     VPRFMTGWRALSNGSFKAPGSGDASNISDDTVDLPGPTVTCVTSTGARREVMYPAVTP
                     HSAGSTAHDDLVAYRLARRSQIDYHQPESAAKAVAARALQAAAAARGKTDADSEDSGS
                     QGGGTAKLLKVEAGTGGVKAAPGAPEAAEGGTAAAASEGHETAAAAAANEDAIPADKV
                     VSRYPVSPYGKLYFQVETDGATRHESVGIVIIDTELLGAIMYDRVGRQYGNRPDPGYP
                     IKQEEVDSAKAGSVLKVGTKSVLLITALTEEAFRSGEFFLRSEHDLRVKEDKAKAEAA
                     AAEEAKARKPGMSFGNSLSNSSAFASILFRRRPKDGETGFVVPVAGRPKMGKNGIIMD
                     ELHPLHDPDREKAVVLFRADYKRDVHGRRQVSVVVDPIIGDKLRPHQIIGVKFLFDCI
                     TGERMLGYHGAILADEMGLGKTIQTVATIYTCLKQGKHGQPTARKCLVVTPSSLVKNW
                     CNEFDKWLGEGAVRHFAISESTPKGDRIISRFDGDGDVLVISYDQLRKYIDRLSGLRS
                     VELVVCDEGHRLKNAEVKTTKAVDMLPTRNRIILSGTPIQNDLSEFHAMVNFVNPGIL
                     GNRDLFARVFEEPVSLGRDPGCPDHLKSLGRDRARYLSVLTQRFILRRTQSINESYLP
                     PKVDVTVFVRLGEKQELAYQKLADVVESAECTPLVLISALRKLCNHMDLFHDAVHLSH
                     QIGNSAGASAQQQQQAGRRRGRSSAAGESQGIPLSVLPKGFRPGGLSMDCGSKMHFVS
                     LVLDELKGNGEHDKLVIVSNFTQTLDIIAALCNSKQIAYFQLDGSTPIKKRQQLVDYF
                     NVPGSQEIVFLLSSKAGGVGLNLIGANRLILFDPDWNPANDAQAMGRVWRDGQKKCVF
                     IYRLLSTGTIEEKIYQRQVSKQGLSANVVDMQEDSKQHFTLEELKSLFKYKADTLCDT
                     HDLLGCTSCEAAESLATSGRGSRGKQAEQIKMQFRKVGQPKKKSGPRMDELKAWRHIS
                     AVASFNLDSVTRAVAKHAPSLLSFLFADERDNTKVAGPAVSTRVKVDKPAFEEDEETI
                     TCASQAAMQQQESEMEIELIDDDDDEEEAELESSEEVSD"
     gene            <271334..>273055
                     /locus_tag="LMJF_24_0770"
                     /db_xref="GeneID:5652242"
     mRNA            <271334..>273055
                     /locus_tag="LMJF_24_0770"
                     /product="putative malic enzyme"
                     /transcript_id="XM_001683540.1"
                     /db_xref="GeneID:5652242"
     CDS             271334..273055
                     /locus_tag="LMJF_24_0770"
                     /EC_number="1.1.1.38"
                     /codon_start=1
                     /product="putative malic enzyme"
                     /protein_id="XP_001683592.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652242"
                     /db_xref="GOA:Q4QAQ6"
                     /db_xref="InterPro:IPR001891"
                     /db_xref="InterPro:IPR012301"
                     /db_xref="InterPro:IPR012302"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q4QAQ6"
                     /translation="MFAKSLVHLIEVSKRPGRGVDYLRNRFTNKGTAFTAAERSHMNV
                     EGLLPPSVETLDDQVERYWDQLNRFNEPINRYQLLRNVQNTNVTLYYAILTRYLKQTL
                     PIVYTPTVGEACQRYGDLYQKDHGLYLDVASKGKVRRLIQNLRKTNIDVIVITDGSRI
                     LGLGDLGSNGIGISIGKCSLYVAAGGVKPSRVLPVVMDVGTNNLELRNNPLYLGLRKP
                     RCGDADFYALLDEFMEAVKDTWPSAVVQFEDFSNNHCFDMLERYQKKYRCFNDDIQGT
                     GAVIAAGFHTAVKLSKIPLEQQRIVFFGAGSAATGVAESIADLAAETGVKKEGIKKNT
                     FFVDSMGMVATNRGDKLAKHKLGWARTDIPDADIASLKTLEDVVRYVRPTALIGLGAT
                     ANVFSREIVEFLHSCCPHPIIFPLSNPSSKAEIVPANAYKWTNGDAIVASGSPFPETV
                     VSGRTLQSSQGNNLYIFPGVGLGCCIAQPPYIPQEVLVAAAACLSTLATPDDLAKGQL
                     YPPIEEVRRVSREVAVACIQKLQELGLAKADLPDNRPDLMKLVKTAFWEPRYLPENYY
                     LEKELIR"
     gene            <275860..>276783
                     /locus_tag="LMJF_24_0780"
                     /db_xref="GeneID:5652243"
     mRNA            <275860..>276783
                     /locus_tag="LMJF_24_0780"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683541.1"
                     /db_xref="GeneID:5652243"
     CDS             275860..276783
                     /locus_tag="LMJF_24_0780"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683593.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652243"
                     /db_xref="UniProtKB/TrEMBL:Q4QAQ5"
                     /translation="MNTNGRSAYDMLARMSDEEDDDVPEDLELTFVPASKRREPASSH
                     AVGHHAGNAVPSTLNSPTHSGPAVINPKPRAETVYEQERNAKVRQVLAEQQKTALGVV
                     FSLDAFEAPSPGRYTLAGLQEATGTPAPSCSSAPYNREDQRRGFSQYRGRGGAEGGGR
                     GGPGGGGGPRRYRMPNPNMSGEEQARYIRHRRNMAVIRNALREVDPETLEYMQVTQAP
                     DQLPLNRNCEGFSKPYFSTDRGRGGVDAGGGRSTSSYRGRGGGGGMHGRGGRGFSPYS
                     VGRGTGATRGDGLGRGAGGGCGRSAPFSPYS"
     gene            <277306..>279054
                     /locus_tag="LMJF_24_0790"
                     /db_xref="GeneID:5652244"
     mRNA            <277306..>279054
                     /locus_tag="LMJF_24_0790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683542.1"
                     /db_xref="GeneID:5652244"
     CDS             277306..279054
                     /locus_tag="LMJF_24_0790"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683594.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652244"
                     /db_xref="UniProtKB/TrEMBL:Q4QAQ4"
                     /translation="MSAMSSSDDAPPHQRLASEQSKRDSGAHVGAREHIHDAPTLSAR
                     ARFLRELERYASDDDDYGGNGGAAVVGAGPMRQPNQANGAPQRRTAFPLVSATRAAAP
                     SVGPSSSSDFFFGGEGGSHDEADDEDVGEDAVWSTASAASLARTLNGVPVTGSTSDIG
                     TTGGSAAPSRVGLQLLHRMHALSTSGDRRSSGHDSAVHSAATRANVMIPQTSPTPTSS
                     ADFEVVHAYVPLSTGGFLSTANAAHDTMEGYQVRIGDVLSLRKPLSCTDPPPSSAVAS
                     APASSPTTSTATPSIAALTLTTGSAAAGASATGSLVKDVAQKAMGHFKSAATFTSEEQ
                     KYGRKLTPDMVRLLFEVTRVDYQGRSIEALFLDGTRAKVSFFEVRPAGYVERKMYATW
                     KADPSSRPVTIIHSNASSPTTSSAPNGAVMPSSVPSPALPPPPSVTAAAWWVIPRLLV
                     RVTTEAAGDWYGKKCVVKAVQRSENRVRLAEWVEEGRSDGGESGSRSFHNCGKPTAAT
                     AETRELIGVDGLETVVPKKGGRAMVVLGSRRGEMCTVRNRVRGADGELTAVEVEISRT
                     KEVMTLQAGELCALAR"
     gene            <279835..>281643
                     /locus_tag="LMJF_24_0800"
                     /db_xref="GeneID:5652245"
     mRNA            <279835..>281643
                     /locus_tag="LMJF_24_0800"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683543.1"
                     /db_xref="GeneID:5652245"
     CDS             279835..281643
                     /locus_tag="LMJF_24_0800"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683595.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652245"
                     /db_xref="UniProtKB/TrEMBL:Q4QAQ3"
                     /translation="MATASPSLSSNCFIDAATYFESRRGRRTFPERNASQILLGDASA
                     NSPIEEEEGLVRRQAQASAPVAWQQQQQQRHQQMRPTRRPRGPGIAFAARIEASGFPA
                     AASRRSACADVVPECLYQYDTSELRTHKRPAQMPNRVKQCDRNLQLFLRPEEQVVRSA
                     AAAVMLGESRDGQLSYSRYPSSQAHEHSKDPRMTADAIEASSSPFSDSAPHDQAMMTD
                     RRSCLPYAPAAELDDSLLLKESLSSDRLRLLEHLYQRERSRLRGASRSVERDVGAVAE
                     EDARAWHGQAPVSSLPWGTTVLPFRHGDSADVAANLPSLRRRAERSSVRRDDGDGAVH
                     AHPLQGRDWQPWERKYACEAHPVTPRTRSSFHASSQIADSNERSDNDNDRNGGVDYTH
                     AKSFGNATCSANWRCASASHRRRVTGSYDDFSDSTEARNEPPKHTTRIGSRMAMADAA
                     PRVPHISAWFAPLRNDRVARQAHHTRSADHARASHSLRGEKERQAGQLQRHISAASPS
                     VQGSSSSTAAGARPVETSPAASARTQATVTLSDVCTHQPLRAPSLQQRQHGKLAGSAA
                     SSPLFPTSSARVQGRDDAALTLRDVCGALNTAAVVM"
     gene            <282454..>284202
                     /locus_tag="LMJF_24_0810"
                     /db_xref="GeneID:5652246"
     mRNA            <282454..>284202
                     /locus_tag="LMJF_24_0810"
                     /product="putative phosphotransferase"
                     /transcript_id="XM_001683544.1"
                     /db_xref="GeneID:5652246"
     CDS             282454..284202
                     /locus_tag="LMJF_24_0810"
                     /EC_number="2.7.-.-"
                     /codon_start=1
                     /product="putative phosphotransferase"
                     /protein_id="XP_001683596.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652246"
                     /db_xref="GOA:Q4QAQ2"
                     /db_xref="InterPro:IPR002745"
                     /db_xref="InterPro:IPR006055"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013520"
                     /db_xref="UniProtKB/TrEMBL:Q4QAQ2"
                     /translation="MPAAPNSQRNAELVKSTWATPSRLPPSGQRPQRRAIAAAPSAAS
                     SEFPYIAPQPFDAYVVLDFEATCEADRRISDAEVIEFPMVLIDARTATPVAEFQRYVR
                     PVKNPVLSRFCTELTGITQDMVSRCDPFPVVYCEALQFLAEAGLGDAPPMRSYCVVTC
                     GDWDLKTMLPAQMRVSGQQGTPLSFQRWCNLKKRMSQLGFGNGSGCGGGAAPPLGPSG
                     MPDMLQMLGLPLQGRQHSGIDDCRNLAAALCTLLRRGLVIDVTFSTAPFRRWHAPTEA
                     QLPALDALPSTLADGAAQHSRDVPPPPRSHARTEGDARQPKQQQQQPPAPAEKGRSAY
                     RRASSVDFILPTLVLDTHRDAVQELLSDTSPADAPSRVFDEEELKTVSKFMSTLLRHK
                     AIQWRVPITSNGYVLLDDILRQPPMRKQQVSVQDVARIVCDSDKQRYRLAYGAADGRL
                     YIAAVQGHSIDGVEPLLRALTSVEEVPVAVHGTYWEAWKAIQRCGYLSTMNRQHIHFA
                     KGLMNDEQVVSGMRANVQLFIYLDVAAVLADGVALYESSNGVILTPGIGHTRQLPLKY
                     VAKVVDRSDGRTIYPA"
     gene            <285398..>293611
                     /locus_tag="LMJF_24_0820"
                     /db_xref="GeneID:5652247"
     mRNA            <285398..>293611
                     /locus_tag="LMJF_24_0820"
                     /product="putative inositol polyphosphate phosphatase"
                     /transcript_id="XM_001683545.1"
                     /db_xref="GeneID:5652247"
     CDS             285398..293611
                     /locus_tag="LMJF_24_0820"
                     /EC_number="3.1.3.36"
                     /codon_start=1
                     /product="putative inositol polyphosphate phosphatase"
                     /protein_id="XP_001683597.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652247"
                     /db_xref="GOA:Q4QAQ1"
                     /db_xref="InterPro:IPR002013"
                     /db_xref="UniProtKB/TrEMBL:Q4QAQ1"
                     /translation="MAAAASPFSLPRARLSALQQLPLDSITVFDTATHCHLLGTDSLQ
                     KNFHLLSCRKHSAEQTPCHNAVSNSSVASTTGSDGRQNVIVSESEAGRAGVGTAASPS
                     ASHAELFGLDNLHDFTNYAVYSPTEAGALVDALRREHGATMRVLSAVAFLGAVRFTAG
                     YYVVLVTERRMAGYLGVHRLFEAVSVELVSLQLDPEWVAAAETQARKRLQQLRCGGGI
                     GARGFKAGYSPLISTPETTASSPFAPSTFSSRPTRAGYGSKSVASGAGASASATSYIF
                     QRRSLEELYRQQFITSLSRASSFFYSHSYDLTNTLQRNMLAAGAAASDGAQPITYAGN
                     RGRHGFERCPDRVAAADARAEPSPRNGQPLQPRMQYVWNEYLLEPWQRNDLDAKSVDA
                     EISDVAEADVGGGDAPAAPPAGRAKLYSVPQYPPALSRWCVFLVHGYITQRAVVVRRP
                     AFRTLLITLIARVSKASAGVRYLRRGLNSDGHVANHVEVEQIISDESSWNSAFTAGAL
                     TSYVQLRGSVPVRWYHPPTASRLLPKPPIVIGPHDSQWSETCLHFQHLLEQYGTPVLV
                     HDLLKRRENNARESVLSDAYRAAVRAMVAAVDRWTATADAATAGQDGEERSNASEPRV
                     CGADILQYESTDLRSLSQLAWNTMTAVAEQHFSAVRCFVSRRCCPVATLERYAQCASH
                     LDHSDFLMMGDTSEVAEAHDRRVSGDVEDAEVVQLQCGVVRSNCLDCIDRTNLGQLFH
                     GLHALGEQLSALGLLRHAADVCDSPAVMEMLLEMYLAMGDAIATQYGGSAQVGAGVLH
                     RGAGWDQLMGVKRLYHNVMGDRDKQEAMNLLLGRKQPLPRRGSRACNAEMHSPGQMAP
                     LSLDQASPSSTAPSLSASITSASAAVAAASTGAGRGPLASEDAVTPPASFFSGIRQTA
                     SRWWSEATSSASSSVAAVAAAEAEAEADYYEQVSSAPRLPLAGLLTSWWVQPLRRFDE
                     WCAACGVSALRSATRNSKMADAASVRRLGAVATPKAPRSSLAHSDVSFSRAPTLASST
                     SSRASMPTSAAVAAAGAYGGDELALRLLAAEAQAQERWRLFIANVERQACLAPARRDA
                     ATQLYHDRRRGVSHSDVNDDTAAAPSLPSLFSPVPAGIPASDASAPSRTMQWSLVSSA
                     TSLTVRAAVAAGSAEAGALSRAGYATVASAALAPLPLSAPLLAAPPCLFAEPWVILRT
                     TMHVLPVESVAAAERWSTRTSNASAAALCSGNFVRSGKKRASIYGVGDVFQREPPYSV
                     GQAVVRQLLGRFPPAAAVVTAHSRRQALMEQHQPWRSPPEAHPHDTFPSIVRSSAFAL
                     QNADLERLAYREVLWIVDAVGRAAAGGRGVSAESLQRSASRASMAQPSSLPGWPWTLS
                     TQEVADRQFTAALLVDWFGAPATWGLEDMVRVVQRLVYPELLPVEVLQVLRSSRVQPP
                     LEGAELLFAGAPARVEEGVEEREKRVDAETRQYWHERLAASVGQRGPLFARGTAATAF
                     QHASRRTAPRRDPGGRGGALPGRTSPVCFSPPSTPLPYQWDVDVDAGSPVQAAVALLC
                     RLAGVLRFAAHDTTASGASVNGTGIEPVVMARGNGAVAATSMAARWSHVVSTGEKRGG
                     ASVNVLAVSAHDADAAQDEKAAAVRRVEEALLPLLEECPIANAPASAYLPGLFPEHET
                     LPDSLRRQWLLCRLLQPIFARCALTPPTLHSLLHDFFAALLTVDDAAAGPADEVHGKR
                     EQRQQCRRREYRVRYSFVLPQQPPQGQSPSLQPSGDHAADDAGGRGDGWHLYNLFFGR
                     PTSLSSSSPQEPANADKACSSPTSAAASRTLNIPATLKVRHCCSALDLYRWSVAHCPL
                     FLIPPEGEPSSASVVSRNGSSASRSTAAAAWHLLWWAVDNNFLIPVVRRRGQATLEML
                     ADETALFCVKRDVARVALNVERRCRDDVWRPQQPAARANSGKEVPGSSAIYGVDLTSS
                     MLRLHRPLHRSALAGILALSENLASLGLRAATQVQEFFRARNVHGWARQSLGAGAGTT
                     VALFGGRAVGATGVVDSSSVASASSGSSAATPAAVVRRFHRLAEDCLQSVQSAMVALQ
                     HMSLEVLARDAAMHDYVSFFVNVYNAAYVAAWLTNVKELVSNGAAAATADTNSPAKSS
                     HHQHQGALRAPTSRTIDLFPLPTLCNTSYACFMYAYGVVIGGVFVSLEEMKYGILGGN
                     RAPPHCDLPLWPPIGGNGASPCCPSSSQQSRELDWRQQMQRLVPLHLRADVSEAARLN
                     ALQRHPHLQEALDFIDMCEALAPSTSHIHDACAEGDGAHALSAKARLSSHEQGATRNP
                     SSSCRAPSLLQPSPASSLDVAAAAATATDSARRSVRVSSSLPSETASARGPGCQGDGG
                     PQPRRRHELVDVWSVDVVRHLPFRIVLQLIDTYLPPPVLHLCAGSVDAEWKESSADVT
                     GDDDGSGAAGSSSPVLLDGRDRVPWYLQPIFNATPLVHTTLQSSKLGAAYAVARDGDG
                     PAAGMLTPQVSQDANGVLLQPCRMWSSPSYYVVGGDGMSGDEAVSHSFQLLQTLAGSY
                     LGAGLYHPISHGTTGGSAEDASLRAPAQHLCLPLHSGDAFTQLRATEAAFRSALLTTD
                     PHLFCDTAAPPSSTKSPVAAAPFRRSSQPPPLSLPTASSQPPHLRGRGGAAGMHTSAA
                     GPSARLVFGGSGNSVTSCSATLQNAMKPLLYEWCRSVEEMSKSTLLSRPGWQMRVTLQ
                     MVRLLEESYASGRAVRAAQAAMRSG"
     gene            <294939..>297374
                     /locus_tag="LMJF_24_0830"
                     /db_xref="GeneID:5652248"
     mRNA            <294939..>297374
                     /locus_tag="LMJF_24_0830"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683546.1"
                     /db_xref="GeneID:5652248"
     CDS             294939..297374
                     /locus_tag="LMJF_24_0830"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683598.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652248"
                     /db_xref="UniProtKB/TrEMBL:Q4QAQ0"
                     /translation="MMRHTVVRHHRTGKARAFIMRDPSLKILRAGSGFQQLKRMGMPS
                     QKTLGYRQVDNFYANNQYQHAWPLLTHDDLGNSDQSNQTKNILYSMYMPKRNKGTAPW
                     FRGADTYSVKYCEQGRYEYQRYLMINRFPSEYKRHFLRFLGNIRGSKSRDAVPQEALH
                     WLLRMIVDNFNPQHVHYIAAMRTLQDSGELDMARDVWKIMERQQTWPDTATICAYLDV
                     CVEAGEKTWAVEAWNRYCTELRFLQAGEVDPKPITRTPFSLTREELLYLPKWKKHFDH
                     DPNLDVPDLNRFNRTREVYLRMAKVMLASDDMSMFEHFFDKLQAAMLTTPTPVPEPPN
                     PHLVRRPRWSPYEHQKSLHHSPWRMDNNGRAMALGPSRTIEGEMQSRFFSNPQFLVHA
                     VKEAVAVVLQRHMAMFPEATDAQTAAPAFFELTETAQETLAFCDGLVQRMMERLEDKL
                     GSLGTSSLLSTLLCIRRVVGKQSGRALLEYANQFLAKKATLSADGLRESLTAPNYFQI
                     LAAYADESAYHYDPKTRQYTYAPGFRPTETMKGLSATLNEISANQHVAWSAEMHLQVV
                     RTLVGCGTMKANAYFVENVLRQFKWDSRFLEALYAEYRRHNTVDGWAELTKRALVWTA
                     RYNVIASERLKRLIEDDYDIIHVQTRTFRELAVFQFRDAEEKRHARDVVNELPNPWID
                     YVTHALPFPDRDAGYPDEYGDIGQWRAPGGPGSPVKGPGYYAPPMEGEHMRGYTAEWR
                     DLKNPMKPPAFPEPWERKYKQYARGQHPSYDMVYAGPMPEIFPGRRDFRKPTRWDYHD
                     VEKQGKHKISGPY"
     gene            <298725..>299438
                     /locus_tag="LMJF_24_0840"
                     /db_xref="GeneID:5652249"
     mRNA            <298725..>299438
                     /locus_tag="LMJF_24_0840"
                     /product="putative dynein arm light chain"
                     /transcript_id="XM_001683547.1"
                     /db_xref="GeneID:5652249"
     CDS             298725..299438
                     /locus_tag="LMJF_24_0840"
                     /codon_start=1
                     /product="putative dynein arm light chain"
                     /protein_id="XP_001683599.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652249"
                     /db_xref="InterPro:IPR019347"
                     /db_xref="UniProtKB/TrEMBL:Q4QAP9"
                     /translation="MTAAAPSSLVKYETPVLLSEALHKKSLASKRPVANNGKPQPQSE
                     DVLFSILPPREFEKGGQRWVQYPSSTPATRLDVIRLQEHLDTLLADRQARETGVCPIR
                     EELYGQVFDELIRQVTISCAERGLLLLRVRDEIRMTLDAYRSLYESSIAFGMRKALHA
                     EQKHVELEARVRALEREKADLQRQVEELVEECARIEQDEAQRHQDEQKKHDEEVAFFH
                     RTYETLTANLQTVVNPTKA"
     gene            <300571..>301326
                     /locus_tag="LMJF_24_0850"
                     /db_xref="GeneID:5652250"
     mRNA            <300571..>301326
                     /locus_tag="LMJF_24_0850"
                     /product="triosephosphate isomerase"
                     /transcript_id="XM_001683548.1"
                     /db_xref="GeneID:5652250"
     CDS             300571..301326
                     /locus_tag="LMJF_24_0850"
                     /EC_number="5.3.1.1"
                     /codon_start=1
                     /product="triosephosphate isomerase"
                     /protein_id="XP_001683600.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652250"
                     /db_xref="GOA:Q4QAP8"
                     /db_xref="InterPro:IPR000652"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR020861"
                     /db_xref="InterPro:IPR022896"
                     /db_xref="UniProtKB/TrEMBL:Q4QAP8"
                     /translation="MSAKPQPIAAANWKCNGTTASIEKLVQVLNEHNISHDVQCVVAP
                     TFVHIPLVQAKLRNPKYVVSAENAIAKSGAFTGEVSMPILKDLGINWVILGHSERRTY
                     YGETDETVAQKVADACKQGFMVIACIGETLQQREANQTAKVVLSQTSAIATKLPKEAW
                     DQIVLAYEPVWAIGTGKVATPEQAQEVHALLRKWVSEKIGTDVAAKLRILYGGSVSAG
                     NAKTLYMKPDINGFLVGGASLKPEFRDIIDATR"
     gene            <302711..>303745
                     /locus_tag="LMJF_24_0860"
                     /db_xref="GeneID:5652251"
     mRNA            <302711..>303745
                     /locus_tag="LMJF_24_0860"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683549.1"
                     /db_xref="GeneID:5652251"
     CDS             302711..303745
                     /locus_tag="LMJF_24_0860"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683601.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652251"
                     /db_xref="UniProtKB/TrEMBL:Q4QAP7"
                     /translation="MRAAPTRLAPSTVASLGRSHCGSQAYHLDAAGAAGWRRRRRLTG
                     VSMTTTHTVAPAVSALPFSLSTARRTYYWPYPENLVPEGATTSPFQSSPVPSVRERII
                     REYALGPLFGSRTPCCVLGFAGTARDVAACKRDVRRWVARALGKSEADVELGALVQAK
                     EMLLHRSGTDESPRLGDGPGSRPDAEQRRVTRYARLPVQARTLLEVYLPGEEHGEVDA
                     AADADATILAHGYFLQEQLHRHMTTTASSGSDPTGRRDSEDCQPEEPARKMQSHCQGC
                     SEPNDEADVKSSVAALHDVCGVIYCEVPVLDESDFAFDQLCGKEVDDETTERVTDRWT
                     RRAMQQQPQL"
     gene            <304443..>305126
                     /locus_tag="LMJF_24_0870"
                     /db_xref="GeneID:5652252"
     mRNA            <304443..>305126
                     /locus_tag="LMJF_24_0870"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683550.1"
                     /db_xref="GeneID:5652252"
     CDS             304443..305126
                     /locus_tag="LMJF_24_0870"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683602.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652252"
                     /db_xref="GOA:Q4QAP6"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="UniProtKB/TrEMBL:Q4QAP6"
                     /translation="MPRPASLCVLIALVLVNILSGGCSTGAQAFRFSVVPGKVKCFTS
                     EQPEGGRYELRYRMMRSLTPFVSVAVTSRGGRVLMEHELAKPDAKEIVSVGKDSLISI
                     CFHTSEKATKAAVSTNVTLDIVDAEDAELTRMKKQSYSTSSPITLGAGKGSGSMQQMQ
                     YIYETFASMRMCFVSLTRADEDIRYSLMEAERLSWIPVYIFLGLGVLMILGTFVRLHM
                     FMRKMKILG"
     gene            <306384..>306737
                     /locus_tag="LMJF_24_0880"
                     /db_xref="GeneID:5652253"
     mRNA            <306384..>306737
                     /locus_tag="LMJF_24_0880"
                     /product="hypothetical predicted transmembrane protein"
                     /transcript_id="XM_001683551.1"
                     /db_xref="GeneID:5652253"
     CDS             306384..306737
                     /locus_tag="LMJF_24_0880"
                     /codon_start=1
                     /product="hypothetical predicted transmembrane protein"
                     /protein_id="XP_001683603.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652253"
                     /db_xref="GOA:Q4QAP5"
                     /db_xref="UniProtKB/TrEMBL:Q4QAP5"
                     /translation="MNGWLIALIVMGCLSTLYLVIGIAVRYHSGLHHCPEVLPNYRFW
                     CSILNVFLRVATCGRCRVSMDRSNRASGIFVLPSRPGAAASPRRVQFELLASDADDNY
                     DINRAMQPAEVVVKY"
     gene            <308534..>312046
                     /locus_tag="LMJF_24_0890"
                     /db_xref="GeneID:5652254"
     mRNA            <308534..>312046
                     /locus_tag="LMJF_24_0890"
                     /product="putative DNA polymerase theta"
                     /transcript_id="XM_001683552.1"
                     /db_xref="GeneID:5652254"
     CDS             308534..312046
                     /locus_tag="LMJF_24_0890"
                     /codon_start=1
                     /product="putative DNA polymerase theta"
                     /protein_id="XP_001683604.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652254"
                     /db_xref="GOA:Q4QAP4"
                     /db_xref="InterPro:IPR001098"
                     /db_xref="UniProtKB/TrEMBL:Q4QAP4"
                     /translation="MPPKSARRGSVAHALVPPALTMEAAPSPPPAEPQLHSRRTRQES
                     ALLFWLEAACAAPVSRSSTNADRASASSSSTTAAAATPVAETKREPSVDLVSRPPPEE
                     QLKQQPRHGGASTQETATPEVSAAAGASVEEAPSTFLVQTVTTKPLPPPGEIRGGGDA
                     SGSRKTADAPPTPATEHPVPLPHLSWGTGPRRLVVADAVPLFDSLLAGRLGPVAVDVQ
                     LQGHTRLSRQPQQFEAVLQAYERQTISELREALSNVQPFFLLCNAGGGADMRVNHSEA
                     SGGGMDDEDHPQTALGAAVLSTSPVLYTMHPANNYPVLPLLAQLLRAPQVTKLLLHSR
                     LLYRLLFLFLGTDRVELSSVVDLPTWAALGQQSRPSLALLFHVPIEGVGSFPDIAAAL
                     PSEARQLLDEETQSMAQQQPLHATRPVGSESDSELDSVQEASTDGSDGAGDTEDDGDD
                     DGRHEGGDAQAVAADGAAEDAPADAVQLLQRIRPLAEQPLGGNKRNASGADFGSAVRA
                     VGVKRRLLRSRQRHRRRPYDSGPSLSSSSCADAPALADVYHGLKTITLFYAHVLSRLL
                     DVVDPGATGVAAPSAGIAALPLATPRCGGDAMTSPVSAAWYRFSPSELCALRTYADFL
                     CELMAYHGLFVNDTVAHGMLTALDVQMAAIDDVGMRVAAAIMATTEPAAPSATAEKAE
                     GCQWSIVIVHQCLARLNAAATTPEIPRAVNVQYLRVLAAQAKQSSGARAEQLRLGCQL
                     VCVWMAYLDRATTRNRLHDMFRKVADKLHVCVLEKPRDAAAEDGTAVPDAWTAQASQV
                     CYSMHPDWVLHNTSTGRIFSALPNVQNLPKQPPRTMFPIHALSATPSRNSGGDESLRP
                     YSHIDPPTEEDVERWLSLAEAAAVDQASPAQFPLFPENPQWTLRHLYCAPPGCLLASF
                     DFNQLELRLLAHLSGDAALQEHLSANVDVLALVTASVLRLPSIDRVRPQQRQAVKVVV
                     YGLLYGMGLESMDVRIKKINEEFAASEQQQHRGEASSSAPAPMPARDLLRRFHRVYPR
                     IESYLRETRQEALRSFAVETLSGRKSLIAEKDANRRKQRAIAQAVQGGAADVLHSAMR
                     AVHQQRHSFLPYLPAAPLALVMSIHDELVYAVPRVAIDEVVRGVQRILEDQARVLRLA
                     VPLPVSVRVGNCFGELAEFRSTGG"
     gene            <312526..>316290
                     /locus_tag="LMJF_24_0900"
                     /db_xref="GeneID:5652255"
     mRNA            <312526..>316290
                     /locus_tag="LMJF_24_0900"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683553.1"
                     /db_xref="GeneID:5652255"
     CDS             312526..316290
                     /locus_tag="LMJF_24_0900"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683605.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652255"
                     /db_xref="UniProtKB/TrEMBL:Q4QAP3"
                     /translation="MPVYACKGFVFSVHVHMSHMCHVVFATSPPPLLLLLLSPSPCPH
                     THTHAHPRSCSPPFRVSFFPFHCMFSFGSVGGATGSGAPPLIGEPGRGGGVLGNPFNA
                     AFHTAGGPVLMSGVGGSSGNTSVLHDRFDVQPISYSPFGGGSQAVPPPVLGGAVTVKV
                     GEGKANVSGPQRGVLPMSGSALPLSTMPVFGASAPLLSHSSGASPMVAAPAAAMVPLP
                     VSFATTPLSAVPVFAAAPPQSSMPALSGGGILGGGGSSAPSCANTSFAAPRGGQGRSS
                     GNSKESGAKGGADSRPSLPEPHSSHQRSQESLPRLGSTSALSSTPAPTTPFLDRGSAG
                     AGSGPRPFPAFPDVASTACSGDNKSHTSGNVLATAAPILPPAAPQNTPSASDAKGLIL
                     GSAFAAVGTSGKGGDAAGGPPPLPPTSCDFDTSVPSVSASAALLDRGAATPLFLQTTP
                     ANAAVKGSLFRGPAAAAAAGPASLAPAAVPPSSAFGGSVFSKTSVAAVTAPSAITLAA
                     SPPPAAAKTAATVANRSGSVFSELHSSFRAPPPTTAAPIFSAFGAASPVVPAPTTSAT
                     PPFGQQAAPRGGSHVPASLHASPFVPSLPSAGAAARPATAASVFGSAASGPGPGVGGG
                     SVFTAAAATPVRAPASSFGASAASAKVPPPPASSKPSGSRADGGGGDAAAAGRRRGRS
                     APRRDAAEGDGSGSGGPARPQPSSLAATASPSAQGSRLEIPAPRRGQCRPAPSATHTQ
                     KPPTALSLLDKLPIPPLPADEKKLCIAARVCKSLLMQLASAAALGGHGGGAAGSSREE
                     DVAKTLEQAFFGVVGIEGVHGNFGNTAGEMLALWNGQVRPMISGRGTQSGDGGGSAFP
                     GEMWIALFILGTYLNTILSALQSSKSGRHAASSSASASVTDLTAYKAGLRAHPTEALT
                     DACHYANELSELLQALFQRGGEADAPPYSVIPVVLRRVRSVFDEANARGVATVQSNLN
                     TVTSKLFAVLNRRVKTSAVQPLGTPGEAPRWLLTYDSKEKESLLHSFAYLIIEMIAAD
                     APKNDDVELFISAFHECFPSALAERCMLYYRRACALLRQPLRMSLVEEAAELLAKATV
                     VYPPNAPLNNRRVLLVKLLAAELALGRLPPDEDWLALDVPPLIDVVNALKTSRLDLLD
                     TALSMHGPFFVEIGVHNVLCLARQRLALLMVVKFYLTHGCESRLSVSEMVRYHSLPYS
                     TVDAGVVWLLPLLVEKQINGVLDHDYLILSAKTPFDAYPLKTLADAAAAA"
     gene            <317351..>319756
                     /locus_tag="LMJF_24_0910"
                     /db_xref="GeneID:5652256"
     mRNA            <317351..>319756
                     /locus_tag="LMJF_24_0910"
                     /product="putative minchromosome maintenance (MCM) complex
                     subunit"
                     /transcript_id="XM_001683554.1"
                     /db_xref="GeneID:5652256"
     CDS             317351..319756
                     /locus_tag="LMJF_24_0910"
                     /codon_start=1
                     /product="putative minchromosome maintenance (MCM) complex
                     subunit"
                     /protein_id="XP_001683606.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652256"
                     /db_xref="GOA:Q4QAP2"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR008048"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027925"
                     /db_xref="UniProtKB/TrEMBL:Q4QAP2"
                     /translation="MQSDLGTVHVTNFHGSGALSGDGYNASGSVDGDSEAGTDIRLLA
                     KEFVTQFRIHHEFLYMDMLRSNLSAGLHYVEFQMLHLQQFSGVLFGAVQHNPTRALPL
                     MEHAVWELAQERKLFPAYSRETTIQVQLFWGVPPMALRNLAQAAVAQLVSVSGIVVKS
                     SSTHARCVRAAIQCTSCRSKAYINGGRSIDLPPQCMENSGRGGVGGGGGTSSGKCRPN
                     PYVLLPMECEYEDQQIIKLQELPEDVPTGELPRHLTVVVDRYLVDRISPGSRVQIVGV
                     VSVQEKRGGFDSARGGGRGRAAAGLRAQYLRCVGLMFRTTQDANCAVVSVNQNFSSRV
                     RSRSTMTWQPEEEASFKAFAKQGGVFQKLSASIDPAIFGLEDQKKAIVCLLFGGTRKR
                     IGSNFLRGDMNVLFIGDPSTAKSQLLKFVEKVAPIGIYTSGKGSSAAGLTASVISNGN
                     GDFVLEAGSMVLADGGVVCIDEFDKMREQDQVAIHEAMEQQTISIAKANMTTMLNSRT
                     SVLAAANPTLGSYDPLRSNEDQMDFQSSILSRFDLIFKVIDPRNPETDQRLAHHVISL
                     HKSANGSGGRRGGGRAGASASAGSGAATSAAQSSHGEVVERCFFTKYISYARATCRPV
                     ISEEAMKVLLDFYVQVRRDAHQQTLATIGGTSGGNGSAAGGGGSSSNKTPIIQITARQ
                     LESLVRITESMARMRLDVLASRSDAEEAIKLFKIATVDAIKSGVADQILTEAQSELVL
                     RVEEALRRRVALGATVEHHRLLSELARMGFDSKLVERALYAMVKREELEWRKQRTLLH
                     RVR"
     gene            <320268..>321635
                     /locus_tag="LMJF_24_0920"
                     /db_xref="GeneID:5652257"
     mRNA            <320268..>321635
                     /locus_tag="LMJF_24_0920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683555.2"
                     /db_xref="GeneID:5652257"
     CDS             320268..321635
                     /locus_tag="LMJF_24_0920"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683607.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652257"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4QAP1"
                     /translation="MATSAKAEPPMKKSRVGTEKSAAAPCFCEAATTAAAAVDVDAVP
                     TSNTLLSARLQRELKSLWSARASATAAPSGTGWPSMNHGTLPKPADVASVVPSFKVGT
                     LEMYRRFPEAYDVLMAHHNCTAVRHTLLKDVLGRIARTAGVEVAPADAAADAAGQCTQ
                     PWVRVADFGCGTGRIESIVAQHPAVQAIYAYDSEVSMLRRCLVNTVRSAAQSGHYHSV
                     SLLPVAASAEKRSEINTASFPSHALPSPPALLCGEDESEATKSATAAVLQLCIRPVPF
                     QAIQAGFLTQTRHPRCSLVVCAWSLSYVMRMQWGEDHWHAAVDTVVQSLLDLLDNTRS
                     DAAVVILETLGNGSAEPTRQSTYTQRLEQCFGFTRTWVRTDYEFKSKADAERMVRFFF
                     GEKMLARLTSDNAGSGAGEHGATDGSESGGGCRLMECTGIWTYWKARESPTEPFRESL
                     ELSRS"
     gene            <322260..>325091
                     /locus_tag="LMJF_24_0930"
                     /db_xref="GeneID:5652258"
     mRNA            <322260..>325091
                     /locus_tag="LMJF_24_0930"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683556.1"
                     /db_xref="GeneID:5652258"
     CDS             322260..325091
                     /locus_tag="LMJF_24_0930"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683608.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652258"
                     /db_xref="UniProtKB/TrEMBL:Q4QAP0"
                     /translation="MKLLHSKSTAEPILAVTACPCANLFGLVTQSAVAVYRSTTLTTV
                     FTFSLKPFQCVLKGRGADGERRSGNSVCCCWSPSGRLFTLALPSALLLVLDVEGGALV
                     RFLTPDGTAPASGDGAGGSSSTPALASVPRVPTTLPPGRPVLAMGWCAVHSLSSRHVN
                     AMHADMQTRCLPVRTGVMAALLDEVAQGSPLSLLGAGDATHLLSSTAVMSSGYPADAR
                     SGSRSVSLLMVLGCDGSLRCLIGGLYEVQRLALLLPPGFSAPSDSGLSGRVASWEDVV
                     VEDMQVRQCAMPSGTLGGRQTRAQRRTGPPDWVCFGESAANGVRPAVAQQHRLYLTAT
                     GASSSGAAAHSLWEVDLQDNLSALAAPHWLALCYVREYTRITREMYEKVAREWHAVLR
                     GRLWAHLGLPAVAPLLSSAVLAQLTEPDPLALYKYAKQQLRRTAVTEDLEVMATEVQR
                     AIYEITHVCYRCCEVAMAYAAHLREPDTVTQHIGALRRLCESFLRRVTREAEGARDLA
                     LWVLQQSRHWARGSRFAMGAADERALAEAEEDQQERSSAVSSPSAAAAAAADMARPPS
                     SRQPPSVVDEVPLSATRQPALLSYLSSITAQETHPDGDPVIHLCAQLAIRVQDCAPLP
                     ASVAASLPVRVVLSGAQDTGAASASTASQLLCCVVEGVEESEQRRRLDEDNDEEKSVT
                     AASGNGGDGGGDGDEAAKGYYPLYEAGLEDVAFGEHNRDVARDECGCALITEGAHVHV
                     LRSAAAATNTIPALQIGTCKLVVRRDSDSGDDAADSPAASGSVLEASLTVDVDVSLIT
                     SRLKAELVGKHGSAIPCVYGATWYGYLEEDRHVVVCQPNTVTAGRSAGSDAWCRSAAP
                     ATFFVATVDGGGRLLMVDEEEPDGGNEDGDDAADSSAAAASSVRTALCEVTGMEGVPL
                     RVSMSRARSFCVIVGVTKYVVLSLYDDDY"
     gene            <325937..>326284
                     /locus_tag="LMJF_24_0940"
                     /db_xref="GeneID:5652259"
     mRNA            <325937..>326284
                     /locus_tag="LMJF_24_0940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683557.1"
                     /db_xref="GeneID:5652259"
     CDS             325937..326284
                     /locus_tag="LMJF_24_0940"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683609.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652259"
                     /db_xref="UniProtKB/TrEMBL:Q4QAN9"
                     /translation="MSAFMEKYHIDKALGTTLRAVQSVWGWTRERLWPIYSAAVVISL
                     FQMIAVASEKQILADHYYGDVDGKFEEHKDELVRDAKKLFNEEVAVAVKEHVWQLSPA
                     AFCREYNNRLGSA"
     gene            <327326..>328522
                     /locus_tag="LMJF_24_0950"
                     /db_xref="GeneID:5652260"
     mRNA            <327326..>328522
                     /locus_tag="LMJF_24_0950"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683558.1"
                     /db_xref="GeneID:5652260"
     CDS             327326..328522
                     /locus_tag="LMJF_24_0950"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683610.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652260"
                     /db_xref="GOA:Q4QAN8"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:Q4QAN8"
                     /translation="MANDGRIFEELLDAEVAVNMEKLREASRMGIPPAYRGVVYRYLL
                     GVAFTDKSSEMTMEELQDKDFQLLNTAYTRMLGNGDEDDDRGGAGGGGHSGGHSTGGS
                     VAALHTIRELLTFSTSSAAAAVSVTEGSGPLHCSSGFRGISSGDASGGTGGGSSGAGT
                     VATPFVYRGPSAVPAFGPSATLAAWEECVTALRYCEPYNADARQWARMESALAALQVM
                     YCNVSVDHVQLIVLLARQLDRVASSARDTFFTVHALFDVLTQDGNILHDAHTLQMHCG
                     NFLMLFRSVLLPLYEHFTVEGLTTWEWIPSLLTCFFVGRMHPDDVFALWDCYLADMSE
                     HQAMALHPYACLAMLSSMTEVLIEAGKIELLYCLEHLPRLDTAAIMRKAVLIRESVYS
                     KELLCG"
     gene            <329700..>332648
                     /locus_tag="LMJF_24_0960"
                     /db_xref="GeneID:5652261"
     mRNA            <329700..>332648
                     /locus_tag="LMJF_24_0960"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683559.1"
                     /db_xref="GeneID:5652261"
     CDS             329700..332648
                     /locus_tag="LMJF_24_0960"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683611.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652261"
                     /db_xref="UniProtKB/TrEMBL:Q4QAN7"
                     /translation="MLSPCAHRAALLDLLTSSAAESQEMENERAGLQADPMHVDPAQA
                     RHPYVPSLRLARRPSSSFVQEEERAVDNTTPGTFAAAAAAAAPSVHSYPPVAPVKGAA
                     PISASHCVIEDSVLRLGNAQARSGAASSHGLFTAHEGVARQPTSGVTVVEEETGRSLI
                     LSFIDNCICAGVPEAVIAEQVQFIVSSMKESLALHAALHAQQHKDRIREYEVSELTAM
                     LERQQLQFAQQHPQMAPPVLDAALSLSASSQILAASPSMSYAPLPQQQQHAPEVRSTA
                     EWKVGAKPLHYMSISRRLSDDLCVASATTDKPPQHCADNGRPLPSSRRARSQAAHMVN
                     DRDGSSSAVPVFSWRPRTPAHVSTTETPTAPVARSKENAGGGAAAVSSSTGHACAQPH
                     TRSPPSRATSASHRSSRARDSSCHHHPRHSRYHKLCSVYYPSSPSSQPPSTPVAQAAE
                     MAASPVDDRPASQRRSPMAEWRQWYTPSQRYMRPTHTSRARRESKPPSLSPSRINPPA
                     VTRGLRDEGHVKRSSLRWGSSDNAALSTQGAASAVTGHRATVQKLLVRSTHSSRLRAA
                     ATSRRQTAPSVLASRASCESEDELNELGSPDTPHAQESVAPCAAAVADHSLRATPAQM
                     PTSVVRVDPSSGPPPPSPSPGASNPNEPRRCARLSIDPESTLDTTGSTRGGGDGEVET
                     SLNAAAVTNAAPTRGGSETPPACSAAPSPASSSMPAAAVSASTAQRSAPSQITCAAVQ
                     EGQPEHHHYLKGQKPRPHRPPPPPQPRSSSRDAGSALSLAASAAAVVDDDCSDASVCV
                     TSPELQLFMELSQRQLRETKRVLAQVPTPSRTASVPHPCQSPSPMSIVDESHSGALRD
                     RTAVSSCAPYSVDAQQTPLLAKSWSDRSLDAVRARQQQRLADLRRRFSSYDTASSDTI
                     SKSPHALPQRVTRAPLSASVVAEAPHDLQEFSSVIFQPHYVHSASVENSPLVQISPTS
                     SDESMRDGCV"
     gene            <333212..>335503
                     /locus_tag="LMJF_24_0970"
                     /db_xref="GeneID:5652262"
     mRNA            <333212..>335503
                     /locus_tag="LMJF_24_0970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683560.1"
                     /db_xref="GeneID:5652262"
     CDS             333212..335503
                     /locus_tag="LMJF_24_0970"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683612.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652262"
                     /db_xref="UniProtKB/TrEMBL:Q4QAN6"
                     /translation="MRDTDITFCLFPLGVGDADVTVYGEAPLLLTASASIKSIETISS
                     PSVIDLGGGPALCGTARGVADSKALLSAQQRRITLTSSSSAAPDQDQNAAPVEAVVDL
                     TAAAESCFSAAAVNMHFIAANHLSELQCGAVLARSGAVKNQSAGAAITARSTGTAGLL
                     EPSTGYLECCGGRRCYYVCPVEDGRYAAAVMLPAVVWRRLGGGGDGAAYAEWLVHAAL
                     RGSVVSANRVISGDLTTTCAAHTPLHTRLLGSPQDVQCSMDSQVRLLAKVVLDGTAQP
                     RVFAERQLALRRLCREQQSPLRTHPRLWRRIEQLLRAATSSTDAASLRGVMPTMGLPS
                     TNTRYVLTASAVWYRGNPLYHSSSPIGAACRPAQAAKLLRSAALSAVLEELRNAAEAA
                     GRGKGSVGGVAYASADDAITRLTAVCLLTSAPNDNEGNAGTDTCVSGYVSAPMRITSV
                     AQSVVNSSSVTSTAALPLISLAFTSASGWTVALLLRGMRTPFLGAPLSSIFSGVQLLV
                     EEHFESAVFVSLVSEATASMRTTWRRPVTLVSPLMAQLEVAILDIRVGRRGGAAVAAG
                     APTRTRDVLLYYFNHHAAASKTAATADSPCSPPPSFLSRRCRAAHGDATSGVLRLRCA
                     LGEGEAFGPDGSQTVHGGGAAVEAVLQAAARYAQLAARVQRCCWGAGAKRRRPGGCGP
                     SPSSMYAQRRSQTVHSVLSGKDVIRVVQAVPHCASWGGGVAGHAAEYAVTYAVVVLEA
                     KKTPEVAHDEYRAFASWLLCRCC"
     gene            <336859..>341625
                     /locus_tag="LMJF_24_0980"
                     /db_xref="GeneID:5652263"
     mRNA            <336859..>341625
                     /locus_tag="LMJF_24_0980"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683561.1"
                     /db_xref="GeneID:5652263"
     CDS             336859..341625
                     /locus_tag="LMJF_24_0980"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683613.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652263"
                     /db_xref="UniProtKB/TrEMBL:Q4QAN5"
                     /translation="MFATTSLPSSTSSWRHHVQNQEEDLVRELMQASNVDAVLARMEG
                     DHFRHLSPIMRKLTSFDPDVSPAPAFPRAGAPPPPPPPPAREPSAPRTYGGGFGGSVG
                     WDAQSSQSILQPSDLYVPRSYQPASPASTSFHLGMRDGDAAAWALPTARQPPPPPPMR
                     TPSSSAYGGVARDLLDAYRRPAGEATAAASHLDHEMESRYQTTIDSWLCPDAEMQARR
                     AVRDEERPGAGRHASPPAASQQLHADPALEHTAAASGMLPPPTVSSSLPASAGRYHGS
                     TEGRLPHVTTRVTSASPHRPSASLVGEATGDVGGLENAAQSRIARQLQLLRNYRQLAE
                     LCSRTDNPSTDLFRALPSEELARMQVEQLKGLAQREQSPITVNNNYYFNGSDDRHGSS
                     RRGRGVDGGRSRGSSDDPFGVIHGKPNTGMAPGDARSVSEVFTGDSHLHGVTGYRPSG
                     AFLPHSQRPPLLHSPRAVPLQSPQPSSGPDSPVATPPLSQRGGNLAPPSPSRSQRGRS
                     HGSRLFDAHYTPTATTEEAGSSYDEGNAEDDDEDDYAGDCMDNGGSEDEEYDDTGTGY
                     RRPPPRIIEREQHRRFHNVSNGDDASPSSAAGGTTQPPLAPTTSQLEHQRHSSYSGDY
                     VNSQSLTTINEHVQDASNSAPPRMCSGSAMFAGGGGRNSTGGGPGSDGGRYSVSSAIN
                     VLSGDQELRANAQRQNGGSRGSHGDRRTSQHLAVPSPRSLQQQRRSLSTGSSPVAPRG
                     GGALTDPEVSPSYLPLHDPCRANREREGSTQGSLTSVSRRGGNTERRTRPTPTPEKSP
                     TGGSGTSGATAPCPQGNRQPKERGGPDGKSCSLWMDGAWRRGRRRGADANDDSNSDDH
                     DVDSVRSGTYGSDSDDSACDTPGNPQLQTHRPRSSAQRQRHTSRRHGESRSALGRGKR
                     GSCRRGYEDRDSDDAPTPRGKVRFGRKHSSATTRAYPTQRGRRAGGDGGGGSGVRRHD
                     ADGDGVDNVRSAASYSCSYTTSSDISDYVPGSYYSPIRSGHLGGGRRGARGGMINPGR
                     PLRASTQLLQPHPSSIRSPVGVQGRYNCGGREGATQVVYGGRGRGGAMLGPRQVGVPG
                     ASASGASNGNCQSLGSPGRYPALAGSGLPGGDRSPYRGGGVLSHQRVAYQQQQRLRGG
                     LHPAVGAGARGPSMAMAGGSAGLVGGLTRLPDGRVVPVASPEARWYQQAMRMMAARTP
                     GAHTISPMKMEQPIRYNRSPDVYPTGLPYAARLGGRPFSVTPSPVKVGRAASPSVAAS
                     VSMTAHSNYGAGDSSAHIQPGLLYGSLLPKARPKTAMVVKEEQGRSHSVDPYGDASHA
                     PLLDRGSVCPVQPVPSNGSQPWCLGSGDNSEVDAFPIAGVAVNGSASTSVLPLAWKSS
                     GSGRVVSRTGHVPVAPRGKLSSHYVPPGSLNQRNQPQQLPSVHPQQQPPRKATVTSAS
                     SPAASLSRLPSDAARPTVAAASVIRKPSPQKQQQQQQQQRYQPLNPTDAKRNDSVFSL
                     QSSRPRYNEAPTPAEMYSKAIQSRRGSLGGANTQQRYVPFPETLESAKRSRREAALPQ
                     QQQQQSLPNSSKRTAAVRSATLQHFRIRSLQGYNVQ"
     gene            <342390..>344375
                     /locus_tag="LMJF_24_0990"
                     /db_xref="GeneID:5652264"
     mRNA            <342390..>344375
                     /locus_tag="LMJF_24_0990"
                     /product="putative replication factor C, subunit 1"
                     /transcript_id="XM_001683562.1"
                     /db_xref="GeneID:5652264"
     CDS             342390..344375
                     /locus_tag="LMJF_24_0990"
                     /codon_start=1
                     /product="putative replication factor C, subunit 1"
                     /protein_id="XP_001683614.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.0990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.0990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652264"
                     /db_xref="GOA:Q4QAN4"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR008921"
                     /db_xref="InterPro:IPR013725"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QAN4"
                     /translation="MAAVAASAAGTANPEPSRSELWADKYKPHSIAEMCYPVCANKLK
                     AWLEAFTPIASPSDDPKKPHGVLLSGSPGVGKTTTVYVVAHELGRTVVEYNASDFRSR
                     KSLKENVSDLINNHAFSARATSYTNVILLMDEVDGCDIGGVGEVIEMLKSTRIPILCT
                     CNDRWHPKLRSLLNYVEDMRFSHPPCTIVANYLCDRVLAREGISLSKPLLQDIIKNSG
                     SDIRNMLNNLQLWCLSRTSLEQRQLAECAAQSTKDSDAGLFGAAEYFLLQGTSRGERH
                     SMAEMQACYYNADLVDMFVQENYLHYNPQPVDGRDWMEAVSQAATSISRSDAAQSIMY
                     YQQNWSVSRFHVLSSSIAPCVYTRGKYETFMTGQQKFFDMQRPVKFPTWLGHNSSANK
                     NRRLLRCVAMQASHPAKGVSGSQEDVVADYIPHGWERPLTVPLATKGKDGVAEVIAFM
                     DEYHLMRDDWDLVQALPHYKHMQSPSSMALPANIATAVKSAFTREFNKTHRLDSFAKS
                     TLRRGDGETQDDDEGDRGNSAGGNRQAGKVVADGVTAVRVTGGRDAAATKKNGKVAAG
                     AATTSTTAAATRKPRAKKSAPAEGAARPTAKKKAATSSTRATAKALTAKTTTKRKRAR
                     AAASESETESVSSSPSSSSSSSASSSSSSSSDASDSE"
     gene            <345086..>346732
                     /locus_tag="LMJF_24_1000"
                     /db_xref="GeneID:5652265"
     mRNA            <345086..>346732
                     /locus_tag="LMJF_24_1000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683563.1"
                     /db_xref="GeneID:5652265"
     CDS             345086..346732
                     /locus_tag="LMJF_24_1000"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683615.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652265"
                     /db_xref="UniProtKB/TrEMBL:Q4QAN3"
                     /translation="MKRRCDLLEVHSVAARPHKRGGTETTREHHFPLYSHPMFRAARH
                     NANAVQDAVAEQSDRVDPGALDAALENMVTQLVEQRLSRHEAEGDTSPTLAKKNFIVT
                     ESELLALLAEATHATPLSPRPQQPPSAFPPSRPEAIAALAAAAAASSPPPQQGPFIPN
                     QGYHTTHPPLQSNGDAERRAGPPPRTQASLFSGAASALGGDEPDELNVVSVGALQQAA
                     LRSLGHMDEQAAPRLPPLSESVASTTSGPTTKQRHPPTMPLYSLLPCLVASPGLTAAS
                     VLPAIVSSSLNPSPSSVTFREMDRCPGTGTGLVAQQSVDAQQLHQVPDAVFAAMDVLM
                     DGNNCCMRRRKRLVATNGNKAESLSLNPRCLPGSGGGASGGSCFAFGCGSKGASLNRM
                     YVPVAQNTLPAPPPPRTASEAKARRILEGQRRKQRLHDQQQHLVSNSFSLAGGGNTAP
                     LSSSLVEFRSDTTSLPTEPFRWRHIDRSGSRTHSSAHPAPLPAASSVSRSAAVVVGTA
                     STLPLTQEASLTFTLRDIAGEPVYMQAISAANRCWPASLI"
     gene            <347674..>348957
                     /locus_tag="LMJF_24_1010"
                     /db_xref="GeneID:5652266"
     mRNA            <347674..>348957
                     /locus_tag="LMJF_24_1010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683564.1"
                     /db_xref="GeneID:5652266"
     CDS             347674..348957
                     /locus_tag="LMJF_24_1010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683616.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652266"
                     /db_xref="InterPro:IPR005647"
                     /db_xref="UniProtKB/TrEMBL:Q4QAN2"
                     /translation="MSRAAAATRKGKRKGLSIDEKVVFVERWMAAHPHPYTLKELQQL
                     IPKHTPVIYQSVEECVQLLVAEGRIEEDRVGVSTLFWRFPPTATQLASRSSRQPERNG
                     GLGSTSASSAAASLCPMSYAELLRRLTASGAEVQQQKQQVSAETMERWCALTPDAQLR
                     EWHGMLQAENELATASLAQERERLGFLDNSDNGEQDSEDASAGEAAVLAELARLQQLA
                     LQRAQLLAEHKSMSSRQALPEVLEQLNRASFIALEAANRWTDNYYLAEEEVVGKAGFG
                     GSRRDVRKALQLPLDLSYLSDESDAESNIVGGHERREVGGCDGSHLSCTPAHDAAPRP
                     SSPPQQGSNLCDAGRPSSAQNKRPVITAPPGNDAFPVAHADVRGSDPAPAAVAAPSVP
                     DRDAAVPLSTAARPQKAKTAKPPSAKRSTGKRARS"
     gene            <350035..>353067
                     /locus_tag="LMJF_24_1020"
                     /db_xref="GeneID:5652267"
     mRNA            <350035..>353067
                     /locus_tag="LMJF_24_1020"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683565.1"
                     /db_xref="GeneID:5652267"
     CDS             350035..353067
                     /locus_tag="LMJF_24_1020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683617.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652267"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR006652"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="UniProtKB/TrEMBL:Q4QAN1"
                     /translation="MPGPSSLKLSAALEQRILAASSVLRLTPDAFLIRLLSQHYNTLG
                     GLPRDLLRYILTFLDYSTISATLARVCRFWQDCVLEDPLHFFSRLRQMHGIHLLDPVH
                     GLFYFPRALKRVAMDSRVGASSPPSVAVPAASSSSTGSGSLTTATASGAGGAHQGLIP
                     AVGSRTSAPSRAKQQQDASSAQVVPASSFLTVDIRTQNTKSLPWGNVRKAVQWAVAGE
                     RMVYGEVRSPGLQQSEDPVWSQAATVTYDRRIYMFGGETYEGVVLDRAYEYDPMTRHW
                     GVLPALSEKRAAASAVAYGGHIFVFGGYNTEGGVLDTYEVLEVETRTWISQTRPPQCF
                     FKRQQQQKQRRQQTHTRADAAAAPETVHRDDCVAHENNTGHARRTAWFSGATWPFSAA
                     PPPEWTGSGGRSAVSSQYRMPEKVCGTAVTVHGDVFLFAGGHQSCIAPEQTAVSYSAV
                     NSAATTPMHAVPLGIGGGASSDIASSTASTSTVNTPQRLPRAASTSAGGQPMAESFVW
                     IFCPRTGRWWTQGPRLPSPRAFGAMTVLELPVLGPCLCYFGGCAKADTPETAMFYIPL
                     CAAAETRALADAEPKDCADDATSRSRDVPSSPSAAVAKAARKRQDGTGAEGSDAAKPP
                     GATATTTVTGRRLRRTAATLAGEEDAAGAESRREAAGARGAVCKGCRGARAVPVAAVD
                     SDVVAHTGPSDAERGATGAPFRDATGESEGSVGCDRRTAHEPLQVTPTTHIPPRHLHH
                     SGVKCVRNFSRRVANADVGSAFGSGGDHDGAVLPGAEEDTRMIWQCFRNPKELPWQRY
                     VRIPIGGAFTSVVVLGAQHSRSLVLTGFYPAPNIGYCKVNHLLPHDAFLPLMGALSSP
                     PSARADTERLPPISHDVTVAHARGNTSLPPTSSPPSTTAGSPPGAVRAAAAASSVPTL
                     PLNPSLHDEAAVAFNHWHQEREWNHHQRQEIREMVRSAAHAATMRHPRNPQTAGEEHK
                     WSLAPVPEVRVASLNGTSLLRVSWKVQTLNAKVIVGIE"
     gene            <353670..>354302
                     /locus_tag="LMJF_24_1030"
                     /db_xref="GeneID:5652268"
     mRNA            <353670..>354302
                     /locus_tag="LMJF_24_1030"
                     /product="putative dynein light chain"
                     /transcript_id="XM_001683566.1"
                     /db_xref="GeneID:5652268"
     CDS             353670..354302
                     /locus_tag="LMJF_24_1030"
                     /codon_start=1
                     /product="putative dynein light chain"
                     /protein_id="XP_001683618.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652268"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR003603"
                     /db_xref="InterPro:IPR025875"
                     /db_xref="UniProtKB/TrEMBL:Q4QAN0"
                     /translation="MSSSTSIKEAIARFEENEYRRRLAGVPEAMQESVPRVAAAQEPK
                     VLLIGMLPPITKMDKEISTLKECVHLGLSTNAIEKIGPGLKDLKNLKVLSLGRNNIRK
                     LEQLDLPKLEQLWASYNKIDKLTGLDKLKGLRVLYMSNNLINSWTEIDRLANQCPELV
                     DVLFLNNPLCSSAASNQEYRYMMLQRLPKLTRLDGVPVDPEEKEEADRRR"
     gene            <355217..>357973
                     /locus_tag="LMJF_24_1040"
                     /db_xref="GeneID:5652269"
     mRNA            <355217..>357973
                     /locus_tag="LMJF_24_1040"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683567.1"
                     /db_xref="GeneID:5652269"
     CDS             355217..357973
                     /locus_tag="LMJF_24_1040"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683619.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652269"
                     /db_xref="GOA:Q4QAM9"
                     /db_xref="InterPro:IPR018527"
                     /db_xref="UniProtKB/TrEMBL:Q4QAM9"
                     /translation="MMAAVHPSADLSCDVAIHLSDTEFTSRIDYADTYVLPTTSTTAA
                     ASADAAQLPTATLVSPWLLVSPSVCSAYPSSSPSVAVTAAGAARSPAVETVPLAWRCP
                     SCGTLEVEQLYWRRPQRSEPAATDEASTAVAVRAALARSTRLTAPSPALQAKLERHRW
                     RRERREEMRWRPLHISARCRSCFLCPRCGGHGSLPFSEAAQVIDTSTAKSTAASSSLF
                     PTPANVLRSTQSVSSLDIRLTSNVQYYAVCMCCQWHSYRAFPTMEQLLGYLDAVMGDE
                     KAETLRERRAAQRSLNTALRAGLTGLLGVYSDLENHARSQHQQQQVTVSQAAWDKFRH
                     LRSAHICDRSAGPPSHSSSQQQKINGKMTQDAIMHLHPALALEQLRHQEQQRQEAARA
                     ASLLQGVSQAAPQAMRVVDLAREAAAKLPGAQEGEAKDRTPLSEWPPAHRSTSSASIT
                     ASSAKNDVEVNLIARTQHWLLGLPLEAVDTRRQSIQTWMQRYQPAAVVAQERKTAAAA
                     AAAMTSTSALMHTPTSAYLHSVLLREQDRPLGLPAYYITRVRKELLTALVWRLPPAFA
                     ARKPSAAEQSLPCTRFVLLDRHALSDAEVRQVCQHWVDERTAQVERHERKRRSELEQR
                     NSACSTTTTAGKQRNDGDGGFDSDGGDEEDDDDEEGIECPKGGASQDSMHPATAQHPP
                     PQQRIKKSVSSKLPLPLFLDGTDFSALSCLPFLEYVRSDRGSGGDGGDAHLCKWQFRL
                     MNLHMMHDVYLTRLEVVRTVVAPSCAVAAPHARPSPFLLSASAACVTVQLSSLSAPAV
                     ELPVVLAPRCSPEERAAALAAVLQGRDGSRVGDAGPSPPLSIPSIVTMGITTPPTRLP
                     ELHVTLRDTSATQAGEPSSPMRTPLRCVELLVEVLTALSDVEHAHPQYHAVRYGLVVT
                     LNSC"
     gene            <359532..>363356
                     /locus_tag="LMJF_24_1050"
                     /db_xref="GeneID:5652270"
     mRNA            <359532..>363356
                     /locus_tag="LMJF_24_1050"
                     /product="putative helicase-like protein"
                     /transcript_id="XM_001683568.1"
                     /db_xref="GeneID:5652270"
     CDS             359532..363356
                     /locus_tag="LMJF_24_1050"
                     /codon_start=1
                     /product="putative helicase-like protein"
                     /protein_id="XP_001683620.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652270"
                     /db_xref="GOA:Q4QAM8"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QAM8"
                     /translation="MEDVLFGLAPPELRSTPQSQTQQQQQHFPSSPLTNSVSDGTFVK
                     TEDEAESEMKECVAAQCSVPGGTPSADKDEEAVLYAGGSPCALPAVQSTPPPRTLAEL
                     RSMTSSDVREELERFFARKDAHAKHFKSVAAALLGGAAAVHKTGAAKASSAAVAGATP
                     EEGCTSSTTRPTREELLARDRCRRLVNVSNWDASVGGYSQWDVLLPSALLHDCVMAPT
                     DATAGQAAPASAASSERQSASSTVAPSRACRTLRPHQVEGIRFLWSVLAEGPVGQVPA
                     VGCILAHTMGLGKTAQVIVFLHLFMAAFPRRQEKAASSSLLRRARALIVIPKSTQSGW
                     KREFCTWSAYFPGEHRLHPISLDEGLPARQRVDMFHAWRRDGGVLLIGYEALVRLLRL
                     VEEDSMLRPHSGVDGSAAGVEVDAGGNGAAQAAVHAFHLANHATTASPQQRRNELQAR
                     RSDEGGMTFGGDADPFTELVVCDEAHRLKSVHLHVVTALRGLHPLRRLLLTGTPLQNH
                     LQEYWAMMDFCVHKYFSRKRFHEYFIQPIEASANTRASEKEVDLARKKTFTLINEVRH
                     FVQRVDSTPLRMELPPLHEYIVVVPLSPLQKELYLRFIQMVQRDSSQKLQFLPAVSYS
                     GKIAAHPQLLFQMREQLREAKGKATASSTQGVGAGGPGAQRSACGPHLAGAKRSSYGG
                     SNYWDASTTAGGLRRPQQRRHRQEAGKQRMAGTADSTVGDDEGDTRVGEEQEAVVIIH
                     SGADSTSSTSSDDGDDEEHAFARATQQSFSSVYPAASLTYEELCVPPSLNYTPLLEDG
                     VKLLVAIKLVAAAMARDEKVLLFSLSTQLLTFLEHMIAKVNIEWRRPVAALQRQRHPQ
                     LSRPIRYCRLDGSHSAAQRAAMLEDFDRPDGPALFLLSTKAGGVGITVTAATRVILVD
                     TSFNPADDQQAIGRAYRYGQTRPVYVYRLMCYPTLEYSIFVQKLAKEWLFKTVIEESS
                     VKRDGLSGMHLRELFSLLMKAAKVLEKPLSATRAQALSTQEVLSEDPMLGVAQAELLY
                     ARRYEMFLEHDMDDRYGAAEEAFYHDYCRNRLFDTADDEDSEKRRAAELQKRRQQRID
                     EAAQLQMQSKTLTAMVDNLIRSRAGADSQLARLLTAMGLHVHPVTGRVQLKRGGADTL
                     DPSGNGDDRRHAAAPLLLENSAERFAPSPVQLIGGADAYQVNEPLNPGTGTYAAHSTP
                     QTAVLLLDSDEDSHGILAQPHAHEERSGAALSAAASAERISATLARQPYAPYRPGSSP
                     AYAVDIDNDGSL"
     gene            <363855..>365639
                     /locus_tag="LMJF_24_1060"
                     /db_xref="GeneID:5652271"
     mRNA            <363855..>365639
                     /locus_tag="LMJF_24_1060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683569.1"
                     /db_xref="GeneID:5652271"
     CDS             363855..365639
                     /locus_tag="LMJF_24_1060"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683621.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652271"
                     /db_xref="InterPro:IPR019510"
                     /db_xref="UniProtKB/TrEMBL:Q4QAM7"
                     /translation="MSGIGQYVLPASPPPSLPRHFSRSRPSRCMCGCVRTVSAAHPCT
                     ALSRSSLTRRPHLFTRRPRTSADTAGETFTRVCDFAVECGDVMAHLIAPASSVQPMTE
                     EDIAVVQAEKRVDAATREQLVNVYGDSRAPHGRRVALTRPPEREWRCAACGKQSADIR
                     HVCAFCLSPEPGCSSHIAASRPRNAGGPAVVDKVVGPLTRVQRPGTCEDAGVRLLHVS
                     LTNRTYRVFTEPHTPAAKPRAAVSHRSAAGADSATTRPAVEDVDEVMVWNDEPNGGDH
                     ATGESCSPGDDNGGSECDEEGVPSPAPHAQRRPPRAEKVNGGFTHFVSIPFGKLPAVA
                     ANATSILADLRSFVAAKYDELAQQGDAAAAGEAAGPGGTAASSFSKSAAASELVTGAV
                     KLHMTLLLLTLPRREDVEFAKELLHGPFASAWAATKEKWAASKDTTYALSGDASLAPV
                     HRHPLVRLGGGLQVMRTGRQNEFYHPEKASVVYMGIDNAAGLATVQQLQRVLHESLAE
                     LIHDPEEAEKSRRVLHVTIMDKKWRKGRAASRPFDARPIMEAFQEAAIGAGEDGRQLF
                     EIPELELCSLRRQDPESSTYLAETTVKI"
     gene            <366675..>374345
                     /locus_tag="LMJF_24_1070"
                     /db_xref="GeneID:5652272"
     mRNA            <366675..>374345
                     /locus_tag="LMJF_24_1070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683570.1"
                     /db_xref="GeneID:5652272"
     CDS             366675..374345
                     /locus_tag="LMJF_24_1070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683622.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652272"
                     /db_xref="UniProtKB/TrEMBL:Q4QAM6"
                     /translation="MFPGYLPGAYSSHRPRSVASSTLSPRNAGVTTLSRDDGSRSGSH
                     PVAHDTAPTAPAAAAANLVEADSSPTASPSTFICPDSRVDTHFDLPPALITCLVQHID
                     GQHQPLATPAIVERCLRDLQRRLMPWVPVERVFGSTMQATVPIDARTSGTAHWRDSIV
                     SSPVSSAAPPPTTTLYTGSYLAGSRVRLQLAKTTDIAAVVSSTSVLHLLFYAVDESDS
                     RPAVLSHIAQDWRAALTRKGEGDDCLVLLVHSDLIAAAEVASRLAEEAQQSSDQLPAA
                     QSGSPPPTGSAPAPALSQARVDAAAGQLRKYYKELCDAKFLPQQMCAYMPNETPMRIL
                     ERLRSAVIKHGTRLRQALEACAAQKRLSPQDPFTKPGVSAAANASTTAEVQPPASVSS
                     PNIATSPTSAAGKVLHTDSSASLQMSPLKPPVGAAPPPLLAVHKYWSVRDFWRCGYDL
                     AVHYLQYGLVLDARAVLERLFLEYYNSSDDYGFLRTPVATLQRLGRVSNLFEAHRHTG
                     WAQSKSGYPRGLDTEAELLEGLLLVASSEMTCSLLLGDTAAAMTRYHTFMQVTREKFD
                     ELSAADRKEKSSVPPPPMPAEDSTHGAAPLHSATYQQFFLLQCYLSGLRMWWPMSGLC
                     RPRREVAASPGAATSPPPQLETLSGSTAEEPSSAHEGGMVAVAADVDNDDDGERASTE
                     SSWPSSSTAPTTADTANVHDVAPVLRTDTDRLDSLARLDSSGREGRYSITNPSFAAAP
                     SSVPGHYFRMNSAGPLSGRSGGEHSAMQRGLVEGSASEGAETTMCDPELTYLLTRCED
                     TVQGAATYLVGLATSTGLLPEHMELVALQDSVQAIRGAVDAGDARAVQALKQHQEHVR
                     RSCAEAATLLEHARDALAAVAHDLGYGNFSYPAMHPATVRLDTQAAQGPSGADATATT
                     AAASSALANIAELSSPEQALRLWRLLTAMAALAVRIAEQRRREFYLYVQLAVTFLTDH
                     PSVTANIVAERLLPYIKLQGWRRIELFVRRLYVEARERLMHHAGLLDSCSTAATVRSD
                     DVAQSTAVSGSDVGRWLRVFHTSGDYALYRECVLVLLSNSGGCGEDDERSSAGGSADS
                     VGGTADCGVAAECIVGSLDSRFFSIRTRTEQWRELVRVDALLMSTVLHGEPSEYPLVH
                     FTSPLTVKVEQKAAAAVSNGDSALVKSESSILVAPGVLKAVVGDVVQITFSSVYTINP
                     LVRPVFPAAAAGPKAMTRETEHAVWFQLTLESRKDWNSDEEATHEVSIRDADAVHYNE
                     QTHRLRVTFTFPVCHAGLYRVHRLRLCNGGMWLAYYPQCNVSGSCGASGWAPSLGTTG
                     SHAFSTPRPTHVMVEPLYQLVGRSALLQVPEQRSSVRLRLTLPREAHCFADSVDYVTL
                     DVELEDPLSISTPSAEGLGGVMSATFTDPQLVRGLAAGPEKHGRVAGEDGRCPVADCT
                     CSFKVSPGNLLLPLSASRSGFGGDQLAHPQRAELYVPLVVDGAEAHHDDASLRRASTS
                     SLTQHLLLPPPEDDGANSDGSEAHTPSGTPRLVAAVVLGTPNAYRQKSGAVGAGVARS
                     SLGTSIPSLSMALSGAGPSRVTAPSGVSGVWGSCGSFAVQTSQPVDALSLSRRVLPRP
                     AATAHTPSTSPADVHEPVCCGAAEHTQHSRSVFKSQHMGSLLGMTAMAASTAAHFDAA
                     AAVVPSTAAVMIYPGVTRSDTKVPQQQQRQQSSPHAHRYAKELHTPSERGAQDGWFTA
                     GDDGISGDERRSRRVTASISGLGFPGIPGGAAATPAPSLLRRVSEDTLELVLMHADTV
                     IRDDRSAAVTPPSAKTAAAMSAARTVVPIHLGCFLKDLPSPEVHLTPTKSDVVAPGTS
                     VLRAECCLAADPLRETVIRLLPSTSHAVAPAADATGSEKAGVAVRHMCLRLPLLPLLT
                     TPISAEALASQRPETVVSGRGAGKDPTPPAAVAANQARIAFTCLRGREPCTTTLNAVL
                     PFQAAISFNYAFKHLQGRVYCLVKMKNLLTSTSLWLRGAVLRVLDAEPSYEIVRVCEV
                     YNKLLLREWKPQEELSILYELDLIASFRPVQPECTHQVQMEAFYSSWHQAFLTTPPEN
                     RLVLRVTEVTAENVEATHNHVLPGGTGARTSDSAGTPQGTVATRVTVPPGKVVDVTAT
                     TGVTTSPLDTATTSCYHSDAGPAAAAQAVRRASLARSTSIDSRGGRSFTHVTHTHGSA
                     NSSVTGDKSSNECNGSGGRSSSGVKSQRAAPSAVHFNIVTLRHLEETCNTVWGPVAAF
                     RSKHLCVFSIVMYAESPWTMRFGAATNYAAQPPHPRTTSNISSSCHGSQLNYWSGGKP
                     SATLSFFGNAMVDQPSDVVFVAGEPVRFCVRLQPQAQNWPEDAEMDETFFIRLKYNPE
                     QWMVIGKQRDRRTLSLMEEVTVYFDAVPLLPLTSADGDRSAAGSPTAAGAATSRGGGP
                     GKGPPRRADDSENGSDEDTDEDKDVDAAIRTGRWQHRSARPLAGHAVKDEGILQTPTV
                     EMFWERKKPTTATDGAANLSMNSFGAGKSNTSAAGAEAGRSVVDGQSTCADAVMGEAV
                     LVDVVQFRTWVRVRKRGH"
     gene            <375459..>376769
                     /locus_tag="LMJF_24_1080"
                     /db_xref="GeneID:5652273"
     mRNA            <375459..>376769
                     /locus_tag="LMJF_24_1080"
                     /product="putative DNAJ domain protein"
                     /transcript_id="XM_001683571.1"
                     /db_xref="GeneID:5652273"
     CDS             375459..376769
                     /locus_tag="LMJF_24_1080"
                     /codon_start=1
                     /product="putative DNAJ domain protein"
                     /protein_id="XP_001683623.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652273"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:Q4QAM5"
                     /translation="MFLRTRTLCYTVHTPRGINFGLSADDAICRIQDKYGRRWLGAQL
                     DYLRLETPSKEFLPFYFCRGRIHASFVGNVSYSVNTTSGDGKSTRSSTRYVSTSLQTL
                     NSVFEENKTQIYAGYKYNIAHVHHALRGDQLSYSLRKMYEVDTTGAIINLFEQSTGTM
                     MKFVEMEVRQQAEKTARSLVRSFHPSADSVTVEFKEFTFHLDDVTPTFVPCFVVKAEY
                     DAERYTLYVSGLNGQVGGPYLLNSVYIARTTALATLSAALLLVPNKVAGFFFGSVACV
                     ATYYAAFFAARWYPVMRRNWNRQKRERLRRENLGLDQAGYRPSTSSQRIQQEYRSSTY
                     WDTHAYHQRRHTDSHGPRSASSSSSSSSSSSFSAHSVADPLGYYRALGLHGDESVNEI
                     RSAYRRIVLKQHPDVGGSSEAMVKANDAYRVLRDPKRRAAYDQR"
     gene            <378370..>379926
                     /locus_tag="LMJF_24_1090"
                     /db_xref="GeneID:5652274"
     mRNA            <378370..>379926
                     /locus_tag="LMJF_24_1090"
                     /product="hypothetical predicted multipass transmembrane
                     protein"
                     /transcript_id="XM_001683572.1"
                     /db_xref="GeneID:5652274"
     CDS             378370..379926
                     /locus_tag="LMJF_24_1090"
                     /codon_start=1
                     /product="hypothetical predicted multipass transmembrane
                     protein"
                     /protein_id="XP_001683624.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652274"
                     /db_xref="GOA:Q4QAM4"
                     /db_xref="UniProtKB/TrEMBL:Q4QAM4"
                     /translation="MRDAVVSFFQRSWKATKEELQNTVDNIRSTELNIAFLFAVFCVL
                     LVIVGNVILLIAINFWIVQFPTDALAHNSSQIAIQVVTMLLLTFLFSVMCAVFTAVYG
                     ALPLWHVLADRNRVGGPWYRLFLLFASGASNGISSVLAVYAMTHTPEFIQAVLLCCIP
                     FSAQAWTVIFIPIERKRDYLSMFFVASFLLFVAGVLLSSLSAFLHTNEQGEKASLAWA
                     LLYLASSVLFGLWCVVQRLYLDAVALKVPLEAAGAASCAQLKQSSRSPQREELGASVA
                     PAMDAVPECTQEVGDTCAEEGQRLFDVEDDGDELPLSPSAELLMKRQWGSQNVDDNAA
                     KIVLLVVGMLFQLLVSFVVFPVDAIPWFGTSDSVQHAWEGLRSSMDFIFASWLHVRHG
                     LLLTLGFAMSFIGCTYLNEHSPTLASVVLQLAGPITSLTIIIIPQWNVYQDSSSVGHK
                     VGGVILLLVAALLYHLWEQQSLRVLLAKAEEAKRRGERAAASGDRAAEQRVIDADNCV
                     TDEPVADNRA"
     gene            <381173..>384589
                     /locus_tag="LMJF_24_1100"
                     /db_xref="GeneID:5652275"
     mRNA            <381173..>384589
                     /locus_tag="LMJF_24_1100"
                     /product="putative pre-mRNA splicing factor"
                     /transcript_id="XM_001683573.1"
                     /db_xref="GeneID:5652275"
     CDS             381173..384589
                     /locus_tag="LMJF_24_1100"
                     /codon_start=1
                     /product="putative pre-mRNA splicing factor"
                     /protein_id="XP_001683625.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652275"
                     /db_xref="GOA:Q4QAM3"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QAM3"
                     /translation="MEKHGKLTPTSLPGVESAVTRTDRQAQRRIIDGEDAKRARPLQR
                     APAHTHHAMDAVPGDHGIKRPREAITPRHTSPFVSANDVTASLQEQAQRFISQLEMGE
                     VLEHDRDTTEAVMTGTDESAQWAYGSEYYLRHDGEDDKEHPSRSHTVGSTAAAAAAQE
                     SASDAQADKARKVVVSLTVAPPSFFTSGNDFETSVLSRRSAAAAHKDDNDDGGDLDRR
                     DGFATSRFLHEALRTSDVDIIVPVVSHSCSLAVSASKGSQTLAELKRLMDRERTNRDV
                     MDTSKSSLTQLLQKDTYGRVVNGEEKEVEGVGGGSAPGHAHSGRVSSFADDRCNDDGE
                     EEEAKYLKRQLCLEKERLAEMTQLRGTLDASSTASPPAAGGANSQWGSNQESRRQRKD
                     EQLARIEGRKAQMETLADDADEVERRDAMRRQRESLPIHHCKDELLRYVGESAVTVVV
                     GETGSGKTTQLVQYLYQRGYARHGKIIGCTQPRRLAAIGVARRVSDEMGCALGTTVGY
                     SIHLDDTTTADTRVKFMTDGVLLRETVNDPSLDKYSVVMLDEAHERSVDTDVLMGVLK
                     LALRRRGDLKLIVTSATMDVRKFSAFFGNAPCYEIPGQTFPVKIHYSATPVADYVAEA
                     VFRVCQLHLQMPLEAKHDILVFMTGREDVYGTCELIRRRLTELSPQHLSTLLIISCLS
                     EAAPARSTEIGVLEATPAGLRKVVVATNVAETSLTIDGVRYVVDCGFMKTNVYRPSIG
                     MNTLQRYPTSQAQANQRKGRAGRTTEGTCYRLYTEVQYAEEMLPNSVPEIQRSSVDSV
                     VLLLKSIGVHRLRDFEFMDAPPAANVRSSMFHLWVLGFLDDAGAITAPGQQALEFPMS
                     PVLAKLLLESATMGCALEMARIVAMISADPKNLFELPKGREKVAQQHHSRFYANDSDH
                     LTLLHVFTQYLDHGRSRQWAQDHFLHAPTLARAHDVFAQLIEKLRKLHLPIQSCGHAE
                     TDKVRHCLAKAFVLQAARRSDRRWTEYRPLLNAGVACAVHPASAVHARSEMPPYIIYN
                     DLLLTHKEYLVMVTAVEPEWLVESSRGIYEMRHGMTSSSTTTAPSSFAVAAATTPTPS
                     TASRASHASMSSSPTAPSASGSSTTVCAEAKAPTKKPAFGMLSSKRRPNI"
     gene            <386113..>389694
                     /locus_tag="LMJF_24_1110"
                     /db_xref="GeneID:5652276"
     mRNA            <386113..>389694
                     /locus_tag="LMJF_24_1110"
                     /product="putative formin"
                     /transcript_id="XM_001683574.1"
                     /db_xref="GeneID:5652276"
     CDS             386113..389694
                     /locus_tag="LMJF_24_1110"
                     /codon_start=1
                     /product="putative formin"
                     /protein_id="XP_001683626.1"
                     /db_xref="GeneID:5652276"
                     /db_xref="InterPro:IPR015425"
                     /db_xref="UniProtKB/TrEMBL:Q4QAM2"
                     /translation="MNIFRGIQHYFSSGGGDLKQLLDTRVYVWNIPAGSTTLTDRNLR
                     VGRSTTRSIESTCSYLDNAETNRYIIFNFSPLMMELVEGCRCGQVLDFSKQSVENYGL
                     LMEVCFTIRKWVYAGDTGGRSPVAPSAPSPIGGAASSSRHKHTHCAVLAFLEESPAVA
                     HPNYAAMIGACYLIFSGFPTYTGSGTFDFVERELGIPRSVYHAPSQESYINYFQLLFE
                     IPVLPNPKRLTLTRVSLHNLSSLSKNKLGLQLDSADGKAPRLFSDPKAWRRGDPSTLE
                     MYLDLNESVLGDFVLNVFLYDVQPIHNDSGGVMAGSSPSVGGSGLVGGILPPSMDGFQ
                     ALSAASNEKALVGLGSAASPPTTRFITGTSKEKKLVQKGRLLRLAFSTIFIHQATHRV
                     RVRDMDYAAANSLPDDFYAQLHFSECAPADADEDYVRQITQRVEQSPQRQIMLSRPDP
                     RDLLASAGAGGGYRSSSRYAAVEEECRGGVYYRSNGTRYDGGASTDPRVRQERSLPLT
                     GATMLYLPTPLHMESEDERFFDDEDDVAESEPTLVRVEPRPGPAARPRQPTPERMYGG
                     GYPVTSTPAAVVQEASPVPSSYAAAPPPHPPLSLPPPPPPPVKGIPLKHLDPSIITPG
                     NSPPPRAPPPPGGLPPPPPPPGKLLPPPAPPSKLPPPRPPPAPPAGLPPTAASTGVPP
                     PPPPLPGPLNSNTPPLPPPPPGLPGIAAAAAKPKPQYTGPRLKTFFWKKILKPSGIWA
                     ASDTDDVRRAVIDESFMLKLFKLKAVAQPSAAEGAAEKSEQERRSQLRSNVFTGQRLQ
                     NMGIALKRVQVPVEVLCKALITCDSAVLPPERREMLTAALPTTEDVTALTAEKQAGRS
                     VWTEVETYLYTAATTVKDVRERLQLWTAAEELEDTVQSISSLLSSVDAAVCAITHRNG
                     RFARMMRIILAFGNHLNRGTPHADAEGFRLESLNQLNFVKSSDGKTTVLMALVVSLMD
                     SGRGRSERGGGTTSAPGADNDDDDVRNALRFVEDVSCVRAVANSPLQDMGQQVSQLNF
                     TLQRMRRVVEEAKDTKAWYDKRLPSVKAEEVPDALPGLLREAVDRYLATVGQIALRYQ
                     QLRDDVSAMMATYGEDPNADETVIWGYVLQFSKDVQRCVDTVAAVHLTKRRLMGMPEA
                     TEQTQSGAREAAAAPPCPSGGVQSSGPQDGVRQTRLPKLVDDDDSDD"
     gene            <393942..>396680
                     /locus_tag="LMJF_24_1120"
                     /db_xref="GeneID:5652277"
     mRNA            <393942..>396680
                     /locus_tag="LMJF_24_1120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683575.1"
                     /db_xref="GeneID:5652277"
     CDS             393942..396680
                     /locus_tag="LMJF_24_1120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683627.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652277"
                     /db_xref="UniProtKB/TrEMBL:Q4QAM1"
                     /translation="MANVESPNIPFESQPGNESGLAREMPQPAPAAAAAIADNCRSTA
                     DAMAAAKSSLLHPIVDDSDPFALLYSTPANQPLSLARRAYGTESLFQYYALRGYKEVL
                     NEAATPEAAKAVQACLEGGDGAAAGGGVAATVAQHRLSDKKKNAPSLNTHIIDRCLVR
                     TAAAAASDSSAVALATDGAVSSVVPLYVPLRPAQAQDVVSSFRTQRADETRAAAERKR
                     RERLQHVPKAAVYLGRYYPEGSHIVADLRLQLAEEKSEPVANSGAAAKPGAHSPLCTP
                     VALLAPTAPNRGSRALSNPGLGRHSAVKTTESLAAPSIAPLLLRAPQEVAATTQMQQK
                     SRHALADQIENAFVEAYHLRDPAAAQRQHDREAMEAQRRSMQAAAALLAKTGAAAAAK
                     RCVTAGASKKAGGKKKKSKVAPAAPPKREGGMPANLEVFRTSLLLLCNEDGAVTLDQL
                     RALLASVPFHVGTLTATPAASSVGVAERIFHILHKGTRAPSAVDATDLLLAVASVTTA
                     IRGGSLSRQGNVSGDNFICTASHGPGNSFSRTSNAPAGARRGPGANALQVSNASVMSH
                     TTAAAEMGGSMSSEAHTPKTPSLTTGAASSWNEAGGAGGVGKQPLPHSIPADMHDGCK
                     CVLVVEVLDALNALLNSVETKRVVRWECFNVLAVEGNGYIHKSQLAKLRRCAYRDGSA
                     AEEQAAVTAAMVKALSDVFAVVATEEEAAYLKANRKRKKKGGAVALAAHQSSPIPLSV
                     MRTSHMDYAVFCRFFDEMPLMAAAFAHVWMPLLLNGRRHTAAAGGATVRLSDASKFSI
                     ASPLPGSAAGATSLLPPSPVSSADPAGERDGEETIGDRFSPSSQLQRRPAPAAEDDPN
                     ASPLELLGSTADARQAAVRQLIMDRQEQLHQACDAAEKLSVIQSDEPGSGGTFADS"
     gene            <398259..>400667
                     /locus_tag="LMJF_24_1125"
                     /db_xref="GeneID:5652278"
     mRNA            <398259..>400667
                     /locus_tag="LMJF_24_1125"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683576.1"
                     /db_xref="GeneID:5652278"
     CDS             398259..400667
                     /locus_tag="LMJF_24_1125"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683628.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1125"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1125"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652278"
                     /db_xref="UniProtKB/TrEMBL:Q4QAM0"
                     /translation="MSSYNDSDAAERPMRLNRYIPSPILSPIPTSPSYYSHREGRDRS
                     SNLQAGAGDAQQRRWRGERDPSRRPPVEPVAGHDSSSRHRAAEDFRSIPRAASSPRTP
                     QAHARSARGQACAEVDPVTEEQQSAEKCTSDEGLVAARPRPVAGDVRERPSFGTKACR
                     STADEDDVSAEPAARTQRVASDSVRSAHDSRRVRGALRREDEDSEGCRALSADPENWW
                     SRKSLPAGCARCNYRLPEDLIEYLQETSMYRSVPRPYCPECGTRLAPAVRDTRGDGDD
                     SVYDSPRLPPRPSPPRRRERRSKPVNAPQQNPHERRSSSSASSDIDIDVLDAGSGSSD
                     DPKHESQPSRGAPPQFSRPKPTTEKPVPPPPPCHPPTPVPPHRGGAHGDTEWTPREKS
                     VMVLAKSPYLTLDTVPCSLDYATRAAVASNDRRRGQEGISTLSPDGIAAPWVVGGCMA
                     CCQQASAGLAGICCCAMPCVLFRERQQLLLHKLRSRYICCAGAFPCCVPPASLRPELY
                     YTIGPDYLYSPAMDAAAGRYWDGVLDASTAVSQQRHWHDLCTVSNDKGEGRVTSSNLA
                     GGGRALLAAFRSVNGVASPASLVNPQTGLPLDGCYSNVPFYQSVRPSACCVTSSAPAS
                     VGTGCCGCISCACDSTRGCCLYCAHPTAHCLACPLCCLCCEMTCCMPCALWANRLLIR
                     QHYHLVPDTAVDGGAVCCYTCCVQCCTCLCTRAYAPKMASAAMDKRIGSIATPVASTA
                     KAAVSPTSLSCWFQLSTTVAACLAAVCCLCPCAACGLAQQRDQIHRLGYPLVVEVPPE
                     IDMM"
     gene            <402037..>404997
                     /locus_tag="LMJF_24_1130"
                     /db_xref="GeneID:5652279"
     mRNA            <402037..>404997
                     /locus_tag="LMJF_24_1130"
                     /product="actin-interacting protein-like protein"
                     /transcript_id="XM_001683577.1"
                     /db_xref="GeneID:5652279"
     CDS             402037..404997
                     /locus_tag="LMJF_24_1130"
                     /codon_start=1
                     /product="actin-interacting protein-like protein"
                     /protein_id="XP_001683629.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652279"
                     /db_xref="UniProtKB/TrEMBL:Q4QAL9"
                     /translation="MYRELHQRNFKSVNEELDFLRKDFVASRKTLALLHEDKVRLERE
                     LMARVFDMNELQRKLEDAQREAEQQTPSPCRRVCSSGGRGRICSGSGCEKQGLDDFGR
                     CEVCGASRTRADAGDTAQVRVDTAAEGGKGDGQQPCGSAQKNASAAKVPSPVSTLRAG
                     LALYAASGQRRRGAAAASGTSARDSDGADLQQLIRDLRANLARRDTALNEAQMELGSL
                     QHIRQTLETELRRLQGSLSDVKTQRDALQAQLTAQEELHSAKVAQVSGLEEQVQQLKK
                     EKDAVQSQLTTAQLLYEHTGPMSDGGSPASTTEVGGGRVHAHEEALREQLQLYRSKWQ
                     AAEDQMEHLHERISQLQRQLVAGGADDGATVGPLKPVASELCEADEAVALKAKYIADM
                     AALRRQHQEQVQLHIEEEQRLQRRLERAQENAAFHEDQLRQQRQDDARQHHSEVQALQ
                     AQLRTAQGELVKAQEDREHLARQLRRSTEQQTTVEVLRSQVDQLKQRLGEVGAELAQV
                     RGREKELSLQAQRERLERAKAEHDLEAAQEMLEREKTEAQYLREELMITREQLGVHEA
                     MGASATGAGPARPSPSSKCAPSATDAEGDAATLSSELKGYVGLMRVNASLQRRIEELE
                     AQAPTLCGRDKGECGSKFSDEGDTQQAQPTDPAREGPALPKASPDDASPPSALEQQQA
                     AHLQAELASALQSQHALMASFAEAEKERHQLIKDNQTLADGVELLEKQLRKYQAKLAC
                     RAIAVDPRATRAETPPSAPSADVKPRVHADVVEEESQRRCRRCSCAQQWDSRVRSRLQ
                     TARAQDHDAHARQSAGGTLPQPQLPQVNEREAAIPSLRPVCSGCRGSPGRPAATAHTT
                     RSVSAAPFAAARGIAVTGAADCSGVARCHSPPRTVGWVAELGPVPMSWLQSPLLSSPS
                     APSSPSLSPSQPSPRETQGRDTGPPAATQTTHESAEQHQGRIVPPTPRHRRRVHGSIL
                     PPVYYPSLVARSRD"
     gene            <405340..>406989
                     /locus_tag="LMJF_24_1140"
                     /db_xref="GeneID:5652280"
     mRNA            <405340..>406989
                     /locus_tag="LMJF_24_1140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683578.1"
                     /db_xref="GeneID:5652280"
     CDS             405340..406989
                     /locus_tag="LMJF_24_1140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683630.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652280"
                     /db_xref="UniProtKB/TrEMBL:Q4QAL8"
                     /translation="MRSPPARVCLACEIERVRHSSGKSAYALYLQRDRRNNRQRRLAA
                     VKLRWKTGGGGLAKRWSRMRLCFKLWFVCKGSSAISPPPPPHRTPPRRPCACGAAKSR
                     ATDGEKPFRTWPPPLSLSLLLLVSHLDPSTPMTGSCVPGGTRRLLASPIIVSVCARVH
                     GLHHCRRPHHRMPLLFLPPPLPPSPHLKGAWQLMKATVTRQLCSRGLRLPRVFSALPA
                     NVSHWDGLSRTMTSAVASAAPAARAHTTASLTSPLVCLRRFFWNPFASGTRGTVSATR
                     NSVQRQNTQQHASIAEKARRDADLENEQLLGACLDLLDMCSGNAAGSGPSSALDELAR
                     ARIWELVDVLLHDHHRAPAEQFDLVYTALCMPAAQDHRQVQRSLLVVLRSVVPEALYR
                     VFESVDLFVLRDDEQSLHQRDVLMKFAHAQLGNLHVPDGLAEEEVLSVYVYDMKAAFP
                     ALATCHAWQVVERDAATIALKSKLFTLLGRLCAEFDEEKTGKVKLADLRSTAERVLGT
                     DQASRLLEGAQVDKEGKIAYAQLVALLSRPPPKKRAPAEAA"
     gene            <407849..>412378
                     /locus_tag="LMJF_24_1150"
                     /db_xref="GeneID:5652281"
     mRNA            <407849..>412378
                     /locus_tag="LMJF_24_1150"
                     /product="putative mitochondrial DNA-directed RNA
                     polymerase"
                     /transcript_id="XM_001683579.1"
                     /db_xref="GeneID:5652281"
     CDS             407849..412378
                     /locus_tag="LMJF_24_1150"
                     /codon_start=1
                     /product="putative mitochondrial DNA-directed RNA
                     polymerase"
                     /protein_id="XP_001683631.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652281"
                     /db_xref="GOA:Q4QAL7"
                     /db_xref="InterPro:IPR002092"
                     /db_xref="UniProtKB/TrEMBL:Q4QAL7"
                     /translation="MRRCAVLRKALPPLRLSTSGRVDEEAQPATQPFAASLHTCTSNG
                     LPARCFDDVDADTRLTSPLSSAVTGAMTFLCDTIATASRPSGTLTCAMRWYTAPSAEE
                     SVCDGDAKTDTLTDAGSAVARAERPAGTKKASKRTTVTSSPAAITRPPIPAPLTSSSS
                     SFSAPPLRDTQQTEHLKATPQPAAHETKVAGGEDGSDAVTSTAYAGVRGGGSRLVKGE
                     AENAAAAAGDDEDDNSITFSEAASVADLFEIDELNRNAAGADSARATKGAHQHAGDHS
                     GVSGATERRGTLSAFALPANHSRSGSGSTAAGIEDTLLSDPFHVPSVDDDAFARDGDL
                     PASAAASYSAVSRPQNLNENVLSAVDVLCDDLFHCKTSVLRSFARTRSISAHKKVEVV
                     LRLLEKAHHDAHGESNDLSVTRRLLGDVFDENVRTSGLRMAWTNKSLEAAHIEEACES
                     HLSFDLLANSTKALMVRRHAGEISRVLRKLTRVFQQEQEQISLAAVGGVFRNYRAAAD
                     ELVRELPVCELLSPFAGYLVSYVRYGAAKETLTRADVNERLVQLGLVQPTVQEADDSA
                     LLHRLMGLLDPAVQQVQRRAECFRHAEQPRVVGMENSDVIASTIRAFSEVSHTKWNTQ
                     AAPDWVHDLARLFCNWEAILRTDLPRFEEVPRHFFDCILSGVVCLYIAQRVYGNSVGT
                     TVVPLYQRLAVKKSLRLHFNNDDNTESALRDIMSYVQAGVTEVRGGVRGEFFAGVLSQ
                     MQGAFQDAQEERSALHDERVAVILNAVCDMGTNCTRSAGLFNLLVKITEDLAFHFRFQ
                     RIYKRLSAPDRATIRTNGSIRMSQTLEYFEKELHVTPISTKAVGFLVVQLLYLSFRGD
                     GNKRPVLERFASVTGATELDMVGLTEMAATSVRDLHVAFPPQLSYNSWLNESDTREKS
                     VYGVLPSVAVKGSANQAMIVSQAPMLKALDAISRVPWRINKYMLHVQEAVVREGFGFG
                     KIRPGFYPLHYYYMSDGEIRYPSDRRRSALLNGNDDDDDSDLAAGDVFNLLQRRQCIL
                     QQKQDWKELSELRSSRIHYLLGLRQARSIVQFSHIYFPNSMDFRGRMYPLPGRLNHTG
                     SDPFRGLLEYAEPKPLGAVGLYWLKVHLANKMGMSKLSFDERVHYVDEHMEDVVQSAE
                     SPLVGDRWWQEASEPIQCLMACKEVADAMKCSQGPEKFLSRLPVAVDGSYNGLQHYSA
                     IGRDAFGAKLVNLVPSERPADAYTGILKEMLKSICIDADRDHQVAQRCLGTGRGQDKD
                     HIKRKTIKRPIMTQVYGVTSYGMSEQIFDELVKQNKSHGLWTHTDMKEMAAYLRDKVL
                     ESLGITFRETQNCRKWISEVTTLLWKVQPAELRNALCWTTPLGLVVRQPYKVRNECSL
                     FTPHGYSRVPGDSVAPASRKQLTAIAPNLIHSLDATHLAMTALEMQHQGLSMMAVHDS
                     YWTYACDMPKLSQVLREQFVNLYSKYDPLWELKEQWEETYFMDLRRHGVKLPDPPKRG
                     DLDLNVVLNSPYFFS"
     gene            <413562..>416705
                     /locus_tag="LMJF_24_1160"
                     /db_xref="GeneID:5652282"
     mRNA            <413562..>416705
                     /locus_tag="LMJF_24_1160"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683580.1"
                     /db_xref="GeneID:5652282"
     CDS             413562..416705
                     /locus_tag="LMJF_24_1160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683632.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652282"
                     /db_xref="UniProtKB/TrEMBL:Q4QAL6"
                     /translation="MNFSATPKGTEATPSRVPLKGLTPLHRSGITHLATPYYAQAAAS
                     ASASSLLSTSTSSAAHPAARTFTSPSSRGHRAPGASAASTRDVQRAASARCASHFSPR
                     QALGPYAASVRSPAWHGRSQMACTAFGNGSGGGDASSRAPWRHHVAAVCRRLQHTVQE
                     TEQILVPATASAASASSSTPLDENGSEGLPCTLAQLMEALQRYRSGCMAAMLELDALQ
                     QQPGFPASSAPSPTGEAEDPTILCSPIQSVHRRTAHEGDDADTSPPSLMDAAQLDRRY
                     HLIKAHLDDTLAAQSAYMQEITLQQQLREREGVMGEYMWTARLLVEQEAAERAHLVSL
                     WAYLTASAPKRRTASNARAGAGLKPTAAARTLHTLATAVPPPPEPARLVSYAAAAPLP
                     QPPTHGDTAAARLAAQNESLLHDLHHANERTYALLHEQQKYLQDAQERALAQLVARHD
                     AEKSALEERVHAAQEAAAQSQHCLTEVKQALAAAQSATCEMQRCAGLTYDGMHQQLKD
                     TTKKMWQLQLTNDHLDAKTRVLERELEELRLSPSWVRNGQGGNGTTSSAAEQASGLAS
                     LSTTGAAYSSNGCARNDAGSRTRSVSTVCRGQLSASSRHASAERAASGGRRGGKVQHV
                     SPGVWCAYEERSGLLTSATPVKQLSLGSSLSSGHALAVTRWTQELQHRNAHPRSPFIR
                     MTHPHASSLLVVSANSTTTNTNENASHMIEHDAAYAPTSSTHQWRPPSATGKVGDDDK
                     DSISSSRNRLFARTLSPARQLSLDRTPVQQSSVATALSYGGPRQDLEDAAAHPSCVEA
                     SEIDNERDSVAHDDPSQVQPNAARHCSSASAQTNAAESLRSATPRLNGVPATSSGYVQ
                     APSDTAYSCGHPPPLTAPHDMDNSTSGERATAKFAATVAEGEEVALQPSLASVCSSPI
                     ASGSRARLEAVHRDILRHAERLEREVQVVTSHYDAARRQRRRERDTLRVNASIHSGSN
                     SPATSEPRNDEGWHTGVVHADDADSEALNRALEELHIEQQEDDDELERFYAHVNEKRM
                     ELERCLRSVEDRLAALL"
     gene            <420433..>424185
                     /locus_tag="LMJF_24_1170"
                     /db_xref="GeneID:5652283"
     mRNA            <420433..>424185
                     /locus_tag="LMJF_24_1170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683581.1"
                     /db_xref="GeneID:5652283"
     CDS             420433..424185
                     /locus_tag="LMJF_24_1170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683633.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652283"
                     /db_xref="UniProtKB/TrEMBL:Q4QAL5"
                     /translation="MHPQLPSRALFLCQPLLRCTACALRGWFADAHTYKGTLIIAPQP
                     LLLPTDRPTPFSIPVSPPPTTLSTVLLSYMARVYLLDVSYLAPFEACLPRGLSEPPLS
                     WRCAAELAQWTSVAAVVAAWVAACAEATAATTATGVSAHETPVTSDVASCKPGREGYM
                     RLGDDDDCDQAEAAASSTVIPIEVGAPSHRMYVIHTFPSAVLIHSKYFSTTLTLVTGA
                     PLRPHSCYGHDRASPSDQYDITADLLRKCASSQSGSGASVSHVDDGGSYGGVLLAHIT
                     QDPAGVPWHTFPLSGCLFHAIMVFHNSETDVDMGEVAAAAPESLAATKARQSRQDAEV
                     LCRPLKDATMPTDDTLDDAPTSLLQLKERWKCFAAENGYECIFHATGCPPRAATHTEA
                     SMESGGRALGGSAEDVQLECVSADSGRRGLLEAPLAGSNRLYQILCNTLWPAGVRRAA
                     DVATAARSDGHGEQENNAVTQAPTPLTPHSGNGFVVVGNDEDAMWRLFQQQEDGCAHV
                     LRRRFRFFTSVVSLPADPAAPTEGPRTAEGNLGAAAARRTRVALVNRYYAAVVQPRLV
                     QTAFFDARMQELLDRYWEQHMTGEGGSGDLCPDAPAVVLWPPSSSASCAARAESETRG
                     AAAIPADADGDDVRASYPPLEIVLGSLARRGCRDVVVVVNKRRGGAVPSGLTEYEEQL
                     CRERNVEVVQPEPARFNAASVGAMGTSVADLPMPVIRDEDDTQATRGVGRLHELLHCV
                     QWGQTHLVKCAASPRMCLADRGSNSCLLLACGQTPFEEEAWVRDVLAALNAAPSSTRS
                     KSATVSAEDYLRLAAPTIAAALGAEHGDDSADLGEHPAGAAIGVDVSTSYFNARVEVQ
                     VEGGLHSYYAASPTQRSGTRTMQPGWENAHDAYVVVTTLCALQEAARAIAGPARRTTA
                     DNPSSREAVSGSHGTLGTVISTLARQQREIWMAEQINAYVARQTSQKASDVAADSPLV
                     LLYITDVPAADATRAEVVEQLVCALARPTAAPAAASLGENGSDSAEDADGYVPIELVF
                     ASERAGMITGAATMGHCDSLVLDGTARVREAFEQHLWPHRQSLSHHHRRVRNIPPTTH
                     AREEAASPQGSTEATSAATADFFANEVTCASPLPVEAAAVSATTRASAAVARETVTAD
                     ASWVAPVIGCALPNGYLVDPETLRSVPVRVVRGAPWNTAKIAGVEGRQGRGEASAQHH
                     ERLPQTHNDEELMQWMEKMKRYGHRLGEALRKEQAEVLALALEKML"
     gene            <424753..>425511
                     /locus_tag="LMJF_24_1180"
                     /db_xref="GeneID:5652284"
     mRNA            <424753..>425511
                     /locus_tag="LMJF_24_1180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683582.1"
                     /db_xref="GeneID:5652284"
     CDS             424753..425511
                     /locus_tag="LMJF_24_1180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683634.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652284"
                     /db_xref="InterPro:IPR007019"
                     /db_xref="InterPro:IPR029190"
                     /db_xref="UniProtKB/TrEMBL:Q4QAL4"
                     /translation="MKGRRSSKGSASLQGRRNGSANSNDDSDHRGARPFAPQGRGGGA
                     SSRAWSRKREATRPRVSVEDRMAQPIKHVVPLDLSFGNFEFQEMKSLGKRGGGVRELS
                     SLLRQARRKAAAHAGMLHTRQGAEMRSEDLLTAAMQRSAGMKVKDDPHRIAKALARRR
                     SKKRQSAKRWARRIRHLEDSVENVVKDRSIQKQTMKARKEAKIRAKEKKREATGGGGT
                     GRGSDRGKKTGAKKQKSFGGKQQRKGGSRGRTTR"
     gene            <426483..>427424
                     /locus_tag="LMJF_24_1190"
                     /db_xref="GeneID:5652285"
     mRNA            <426483..>427424
                     /locus_tag="LMJF_24_1190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683583.1"
                     /db_xref="GeneID:5652285"
     CDS             426483..427424
                     /locus_tag="LMJF_24_1190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683635.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652285"
                     /db_xref="GOA:Q4QAL3"
                     /db_xref="InterPro:IPR006214"
                     /db_xref="UniProtKB/TrEMBL:Q4QAL3"
                     /translation="MFQRMHSRVGATALASAFRMQQNRMSSCPAPSLPTAAACRNLPC
                     GASTAPATTAASFALQSVLRGYTTTTRAHQMRVQGRDSIQSKSTPMNWPGSSSGSQAD
                     SLTPFVRQHLARVYTLLGCACLTAGLGSFLMVATPMGRAIPYWLPMVGGFVPLLWLSF
                     APPANPSLKLCLFFSFALLEGMAIAPLVLMTSMKGVLTTSILLTAAVFGGFSAAAYLA
                     PRASMVAWQGPLFGALIGMVAISLLNVFYPTAFAHSLILYGGLAIFSVMVAVDTQAMI
                     ERARCGAGDHVQDALQMFLNVINIFVRIAQIMGNMDR"
     gene            <429229..>430203
                     /locus_tag="LMJF_24_1200"
                     /db_xref="GeneID:5652286"
     mRNA            <429229..>430203
                     /locus_tag="LMJF_24_1200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683584.1"
                     /db_xref="GeneID:5652286"
     CDS             429229..430203
                     /locus_tag="LMJF_24_1200"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683636.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652286"
                     /db_xref="UniProtKB/TrEMBL:Q4QAL2"
                     /translation="MEWADDVVNRPRRANAGNRLQELLTNGLDEEEEKALQALSDASS
                     DTSFTLSSDEETVDEVESDFDAEEVGGTLEGEDVETEASMRRAERQERQLERRKKLQR
                     SQNFSKVAARDRAQRLESTKRQEKRQRGTDDADEVPRQRQPRKDGAVPENGDEDGEEE
                     DDEDGSDDIIDLRQRVRHRPVPTIPCSQRLAEAHARAAALRAAQAAAEAPRDGNAEGA
                     SFSSGAGVMHTHRGLNVLKARQRARRPQHSSNSTTRRSAWEAREALSAPVEDTMSEPI
                     PVYVSPRIALYEGIPQRVGYSSGTSVLQRFRVPTVVSFSTALPPVLQP"
     gene            <430916..>431239
                     /locus_tag="LMJF_24_1210"
                     /db_xref="GeneID:5652287"
     mRNA            <430916..>431239
                     /locus_tag="LMJF_24_1210"
                     /product="putative translation factor sui1"
                     /transcript_id="XM_001683585.1"
                     /db_xref="GeneID:5652287"
     CDS             430916..431239
                     /locus_tag="LMJF_24_1210"
                     /codon_start=1
                     /product="putative translation factor sui1"
                     /protein_id="XP_001683637.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652287"
                     /db_xref="GOA:Q4QAL1"
                     /db_xref="InterPro:IPR001950"
                     /db_xref="InterPro:IPR005874"
                     /db_xref="UniProtKB/TrEMBL:Q4QAL1"
                     /translation="MEDTVEAIVNQQRETERAVLGGQKVHIRVQQRKGKKFVTTVQGL
                     NQKLNFRRINREFQRRWGCNGTVISTPDAGTVIQLQGNWSENIKQFLLDEHMATENNL
                     EIHSL"
     gene            <434151..>435782
                     /locus_tag="LMJF_24_1220"
                     /db_xref="GeneID:5652288"
     mRNA            <434151..>435782
                     /locus_tag="LMJF_24_1220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683586.1"
                     /db_xref="GeneID:5652288"
     CDS             434151..435782
                     /locus_tag="LMJF_24_1220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683638.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652288"
                     /db_xref="GOA:Q4QAL0"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4QAL0"
                     /translation="MPINPEYIPLPKSKEMFAIASWRDSPGLNATPAAHPGVSGSPHL
                     ASLDALRNGKGMAGMHAAATTTTTTTNTVTAAGGSLLPPAVQPAEDSKDAAKSKAPLT
                     VAAGKKKKRKPASGATTSTASVAGSGVRSDDVDDFFVHILLPSCVSMQTLEFELQAQT
                     TPLKSIEVGLPKVLFPRKPVGGAGGDASPPTTTALAPAVASAKIVSSPSCAPAVNPTN
                     NELSLPLMRLPPADLPEPAPSESSCAAPPSASAAAAAHVNGDGTASAAAASGEHHGGE
                     YQVSLLFAEKAEAEKTVTFVQRRWPTAAVSLASRSRSVLNATLVLKGMPNQAKTETVL
                     TEMQNLPHTPSYVRLLRSERGVFKGVVFVKYANCEIAEECKLRLEKFVLGSRPLKVEF
                     KKKSTAAASVSAAVIESKRSLQELVRELRVSAEHEGFHLSRSDVAKEALKVLKQLCQS
                     YGLLFDMNDQQVTVRRVLGSNGIGSEKPSPALRPQSMAPAWAPATPAPLRPMDFKGIS
                     HWKDIRSQASTLGIMRPLGPEDGKPAFSAGRGRPL"
     gene            <437771..>440059
                     /locus_tag="LMJF_24_1230"
                     /db_xref="GeneID:5652289"
     mRNA            <437771..>440059
                     /locus_tag="LMJF_24_1230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683587.1"
                     /db_xref="GeneID:5652289"
     CDS             437771..440059
                     /locus_tag="LMJF_24_1230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683639.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652289"
                     /db_xref="GOA:Q4QAK9"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:Q4QAK9"
                     /translation="MPRGRSHGRGHGGRGRGPAGAPEADPGDEIVSSSPQPLDAEAVV
                     RVLSTMRGRGARGRERGRGRLGRGSTTGGARGERGRGAVSLESVSGTSEASKLVSTVI
                     HSTPSAPSTLEASSLAASPAAPVVVVVPQGRMITRSLLRGTASLLLDSDSDATGSPLA
                     LPLNGRRRRRTESAAANASSFLPNSPAPRDGTLGSSALASTRISSASSPASALAGDTA
                     ATADSSGSGLSPLSQRVVIGGLLRCVCNAFLVSPSEILLECCRCRNWCHSACVGVDHE
                     ELRLRQRQRDFLCPFCTETATPASAPTGASSTAADSLPTEPRAFSSPPLPPPGSQKPT
                     SITTSLGESVKVLFSPAAAVVTAVNGLAVAQTGGSSGTGDATVAATSALPVLPPTSTS
                     GSSSSSYPLLSRQPPAPRQLPLKLREVPDRSPLAPLADELRRLIRMIENTAHQLGYNM
                     LHLPAHTLTEQQVAECLGCCAEAIQDATFSADYPAYCLKEVQNRRHPYVQGIALQSQA
                     NGRICSLILSSGRDLYGNLKPTITQLKSSLQRGLLEPSALTPFMAQCMAIADVADFVH
                     ITLSATHAQHQRKGLARLLMTMELLKWSLRGRHRAFLNMAIEKHLVDGGSRIEFASPV
                     ASKRLYESFGFVEVYPRYDPVTKKERWTAKEADMGRVMANLNFVDHVRAVAEAIPAKY
                     NVSGSPNGDGVGHGGGKGMDESAEERNSIASGNGAGRSRSGWRAGNTRKRGDSAASNG
                     GDDSDSEQRNGDSSCTKNDPGK"
     gene            <440923..>442749
                     /locus_tag="LMJF_24_1240"
                     /db_xref="GeneID:5652290"
     mRNA            <440923..>442749
                     /locus_tag="LMJF_24_1240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683588.1"
                     /db_xref="GeneID:5652290"
     CDS             440923..442749
                     /locus_tag="LMJF_24_1240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683640.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652290"
                     /db_xref="UniProtKB/TrEMBL:Q4QAK8"
                     /translation="MWATLARYKAKSLAQMFRKLKLAGAHPDVLWGIDAQKAQHNGET
                     MIRLETLMHERASQALGSSSSSPNGHGRDNAPQFFLFWMQPHRGSPAAGGGGGGKAAS
                     AAATGLKAIECAITPYSDSRIVKQQLTKLFVDAGIYEDFELSSDGVEMDLNSVLRYAD
                     EKQNEHLVQSGSLYIRGDKSVENLRRFSVLLVVEEDGVSYLVSLPETQSVQPTGAGQY
                     TSTVGGGGGGSTAPYVPSKTIIGPNGEVDPDVQDFMTERGLRPFDLRMAGSHSSVERF
                     VVAFERIERMYEVHRGRAFRPSVCIVLSLKSLDNFVAPDGSIVLSVQRMPSWEEFLLS
                     LPQPVWQECVQKHKEWRVGTAPKLQERKRQLTRVADMFHVYRVTMESPIAGSTQWQDD
                     LIARFMKEETTIRRAVAKYNLKSDLLKKCGEIRIVEHLYSALPGSAMRTTTSAGARKE
                     IGFRIGGDGRVTFNHSIMNTGQMLRVLKDNLKRMETFQRQHDSAIMALEHVSRHIPVD
                     FSVDTEWKNRAEGNLVLHLERFARTIKQNEAQLGSFLRSIMDGGMGTSSAGTVVVPAS
                     MPVKKRMVWVVSDRFDTLPSGVVFIPFDVDFDSIKRLLLTRQ"
     gene            <444065..>444625
                     /locus_tag="LMJF_24_1250"
                     /db_xref="GeneID:5652291"
     mRNA            <444065..>444625
                     /locus_tag="LMJF_24_1250"
                     /product="amastin-like surface protein-like protein"
                     /transcript_id="XM_001683589.1"
                     /db_xref="GeneID:5652291"
     CDS             444065..444625
                     /locus_tag="LMJF_24_1250"
                     /codon_start=1
                     /product="amastin-like surface protein-like protein"
                     /protein_id="XP_001683641.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652291"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4QAK7"
                     /translation="MPACLAYYTGAMCFTIIQFFAWAFALVATPTAQFQTPGHGCYTM
                     WGYRKFCGDVPYDLTGDAAFGCARRTSTMRCGAAFGVMASACGFAGLISAIVLNTQIQ
                     IPVIVPFVLAAVCIPCTMISWACVASVYNLTMCGDRFGSKYPYTAGFALMVASWGLEI
                     IAVVILACTNWTRPPKEEENAADAKH"
     gene            <447233..>447751
                     /locus_tag="LMJF_24_1260"
                     /db_xref="GeneID:5652292"
     mRNA            <447233..>447751
                     /locus_tag="LMJF_24_1260"
                     /product="amastin-like surface protein-like protein"
                     /transcript_id="XM_001683590.1"
                     /db_xref="GeneID:5652292"
     CDS             447233..447751
                     /locus_tag="LMJF_24_1260"
                     /codon_start=1
                     /product="amastin-like surface protein-like protein"
                     /protein_id="XP_001683642.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652292"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4QAK6"
                     /translation="MGTLRTFIGVTIAAVLQLAVFLFVIVATPISQFDVKNGSGCYTF
                     IGYKTECSLSAVSATGTAAFGCKQRRDSMGSGAAFAIISILTTLAALVFIALMLLRIP
                     CAVFPPLLFTCLSVFTILISWACVASVYSIRMCNDPFYRFVHYGPGFGLMVTAWCLQV
                     INVVVLFMLFFG"
     gene            <449655..>450179
                     /locus_tag="LMJF_24_1270"
                     /db_xref="GeneID:5652293"
     mRNA            <449655..>450179
                     /locus_tag="LMJF_24_1270"
                     /product="amastin-like surface protein-like protein"
                     /transcript_id="XM_001683591.1"
                     /db_xref="GeneID:5652293"
     CDS             449655..450179
                     /locus_tag="LMJF_24_1270"
                     /codon_start=1
                     /product="amastin-like surface protein-like protein"
                     /protein_id="XP_001683643.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652293"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4QAK5"
                     /translation="MGLLPPFVGALLFTVIQFLVLLFVVISVPISQIDSKRSRACYTF
                     WGMKSDCRKVHYTAKGKSAFGNCRQRLNNMSSGAAFAIISIFTTLVALVFGILMLIRI
                     SCAVVFPLIFTCISIFTILVSWACVAGAYTIKMCGVKWCSFAFEYGPGFGLMVTAWFL
                     QIANVLVLVLISFF"
     gene            <454236..>454796
                     /locus_tag="LMJF_24_1280"
                     /db_xref="GeneID:5652294"
     mRNA            <454236..>454796
                     /locus_tag="LMJF_24_1280"
                     /product="amastin-like surface protein-like protein"
                     /transcript_id="XM_001683592.1"
                     /db_xref="GeneID:5652294"
     CDS             454236..454796
                     /locus_tag="LMJF_24_1280"
                     /codon_start=1
                     /product="amastin-like surface protein-like protein"
                     /protein_id="XP_001683644.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652294"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4QAK4"
                     /translation="MPACLAYYTGAMCFTIIHFLAWAFALVATPTAQFQTPGHGCYTM
                     WGYRKFCGDVPYDLTGDAAFGCARRTSTMRCGAAFGVMASACGFAGLISAIVLNTQIQ
                     IPVIVPFVLAAVCIPCTMISWACVASVYNLTMCGDRFGSKYPYTAGFALMVASWGLEI
                     IAVVILACTNWTRPPKEEENAADAKH"
     gene            <458527..>462801
                     /locus_tag="LMJF_24_1290"
                     /db_xref="GeneID:5652295"
     mRNA            <458527..>462801
                     /locus_tag="LMJF_24_1290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683593.1"
                     /db_xref="GeneID:5652295"
     CDS             458527..462801
                     /locus_tag="LMJF_24_1290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683645.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652295"
                     /db_xref="GOA:Q4QAK3"
                     /db_xref="InterPro:IPR027307"
                     /db_xref="InterPro:IPR028191"
                     /db_xref="InterPro:IPR028282"
                     /db_xref="InterPro:IPR028283"
                     /db_xref="UniProtKB/TrEMBL:Q4QAK3"
                     /translation="MRLLPLSHSSSSAPIKQWPSGTRAVRSPQLRQMDSFYSNQVRRE
                     EAHALRAQLSAFVDHHEQQLFDAQQRLRHPTDATHWSRHHDVVTVQLADTPYHASFGA
                     HHQPRQRRAYQQSSIADLLGSTMASTDPLFFRLLVSLASSNAEMQALSDEARRCYAPP
                     LALVGDDNENCYKSRSTDREKGLGSDGSSSNIRRGGHPEMNAGGGNGPSSLQHQQLRR
                     QQEQEDILEEEKLLHSTWTLLPLLQDIWLWQQRVQDVVAHALFQLASIYHDARSKGSR
                     GEPTPLLRVRLTSFWDSLSDLLGAVLLVEEVLHQNASIRDGVEVMQRLLAQQQLDAKR
                     DDATGGDDDGEMMRLLLQKLQADILDSSLLASVSAQRFDQLFEASLAACEQRESRSTA
                     SVPSTQCDATAAQTAATPHPPPFREHISLCEEFIAVLTGRCNDFEATLSSPRALEHKS
                     SLAALCGLCYLLKGLFLSPLPARGGPAAGPTPVASTTVSKLVTATLGHVSKRVVAWQS
                     VVPLLQLQGLYVLCPLLWWRRAFPGELSAAAGALKDGTGALVRRTVVEACQTSDSEFL
                     SSISQWTQLVDRWAAVEMQSALPIDAPLCRSFIQRMVLLIQQGVALSRSVQDGVVQLL
                     LLHHHAEAALTVSMVHGILQGVLLLQRIADAYHSKMGILATAQAALVQSIVYVLEKHL
                     YNLFTRTCSSRPGTAAVPTAVAQEQLLALQAALQLLHKPFTADTLACLVLLLDVALNR
                     EALQQSKTSPAITEQERDDAFIALAQLKAILTYQQTLPCITSASFLFFHRETLYPLFL
                     KYCYEHTLAAVSLPQIVSALGDCRLLIMSARHVKNPSETLLSDYVEFVRDCVHQELVQ
                     PLCTEIENQLRLRTHDAVLGQPYRVLRPSAEAAGRDLTRYTLLQPFRFFDEWMHLEAQ
                     IEHYLSAQFYNLNALMPNDWKTYEEMRSLALRTYHLRIADSHLPSCILDQGLDVLVIT
                     ENIQQFVAYYTYNLNEQIFIQRPSLTPSKHLHTLNTRHIANSIRTHGTGVMNTAVNYV
                     YKYLLKKMAILSHFLHDDYVRSHLLKDARAMRQRKKEQQPCKYPVEQAEQLIREMDRL
                     GVAHDGVSFLEKARQLISEMGNALGFMRMMRSGGLRAVAERARFVPLPTTAAAAARSG
                     SATEASAAAGVPLSAYMVHGSRTSRPPRKSVDNTDDEEGEEEGTQNGSDNGDSDTVQQ
                     RQLNLRRSTVDAVSNLDRVVHSMLEQLSDGSQYYPLLLDAIGRRLRRSSAERYAHLQL
                     LYLLVPALANLQVAYTIQEKEKLLKKHKEEGVFSDDGFALGTTFLLVLFRAYELFDDL
                     HWFENKKTQYRGRLEALQAALSIATASGSPEFDNLHLTSSTLHTYLKEYTGLENAFTS
                     SRRFFDTVSSSSSASAAAARPTASDASRRHHAQEASDGEDEQESGE"
     gene            <463964..>466387
                     /locus_tag="LMJF_24_1300"
                     /db_xref="GeneID:5652296"
     mRNA            <463964..>466387
                     /locus_tag="LMJF_24_1300"
                     /product="putative DNAJ-domain protein"
                     /transcript_id="XM_001683594.1"
                     /db_xref="GeneID:5652296"
     CDS             463964..466387
                     /locus_tag="LMJF_24_1300"
                     /codon_start=1
                     /product="putative DNAJ-domain protein"
                     /protein_id="XP_001683646.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652296"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:Q4QAK2"
                     /translation="MLRRSYPWRVMTPRQALRVLSLSPTADLTPASIKKAYIRQTLQC
                     HPDLHPNNPNATENFRNLSDACRVALKALEAQRGGRSAAGRRSTNSGAVDLCDPQEAL
                     ESLRQAMIAYHRHQQSTEAPSTSSSSSPPYGKPESHAAGTFFTPTLEDVSSVCQREAV
                     AMRRVHTFCTELPAVLCGSHSAALFEAVAFFHTRYVESMSACVMRFAQNLPIIVRRVV
                     KQRRRYVDNGYSAVAQGIGTGSRPRGQRIEDMAMKPLVLMGALIFDLPEGASNERRQC
                     LGEDAVASGGTSSTCGASRPADVRVSDELKCIIYPADSIADITAKLSKWEAASFDRLK
                     LELAIVDVNRLMSAMLGLQDEESSGRSEAHLSVEPHLSESSAAAAMVLRTLQKLAGDL
                     CCHFDAAVDSGAVTEAVVEAMHLQDSCDIPASVQDDIAAQSLETPALVAQCRQLAELA
                     CPTIRGNIVLTWKAVATDELVKDEAELADVTPAPMPLVDASQTDSAGKEKGGGKDAPP
                     FFVGRHLTCSTAETLFFSVSVTLTRDLHAFLLRLRGALKSVVQSTNQSKRALFELLPL
                     RESIVKEEFTRIASDDDADTSPFRYRGPVNCFPRICNMDTRREHKLWKHLYVHREYVA
                     KHAPAMNPLNVFYECFPYDPDAPAHRPSSLDADGNVLAGWVSGGPDGCDNVVITATQL
                     DDPAHFTEWLEEVVVQSSLNRETEEILAKAGVGYVSRDPVLPLANYLSFVKAFAQSTA
                     VRAVLERKDGAPHKGTTTPDDIGLAIIVSPSRCDVRDGGRLFIPWYVDPAILLSLLDD
                     AKTPQRLDV"
     gene            <471077..>471841
                     /locus_tag="LMJF_24_1310"
                     /db_xref="GeneID:5652297"
     mRNA            <471077..>471841
                     /locus_tag="LMJF_24_1310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683595.1"
                     /db_xref="GeneID:5652297"
     CDS             471077..471841
                     /locus_tag="LMJF_24_1310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683647.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652297"
                     /db_xref="UniProtKB/TrEMBL:Q4QAK1"
                     /translation="MPPRKVDAQVSAVEKIVERPSVLDVTLAKIDVSKYDAAYPFRLR
                     VVLCGKKKRTSFDDAWEKLVAEVKLQCDKANPFCDASQSSQLGSLIMDYGEYFIQIVE
                     GPEGYVFRFAEEMKSVPLVDTNSVRILFLDDDVPNTICIGITLIDKVPPSSLVVSSAE
                     KSTEEVAQGVTHDLSSILELASQGNSQMGRMKSVFTENAKVNYPKLFPKVEMLETYIN
                     SDSFFTLDEFVDNFCKPAHLARDEEINHPAADPLKH"
     gene            <472093..>472821
                     /gene="CYP8"
                     /locus_tag="LMJF_24_1315"
                     /db_xref="GeneID:5652298"
     mRNA            <472093..>472821
                     /gene="CYP8"
                     /locus_tag="LMJF_24_1315"
                     /product="putative cyclophilin 8"
                     /transcript_id="XM_001683596.1"
                     /db_xref="GeneID:5652298"
     CDS             472093..472821
                     /gene="CYP8"
                     /locus_tag="LMJF_24_1315"
                     /EC_number="5.2.1.8"
                     /codon_start=1
                     /product="putative cyclophilin 8"
                     /protein_id="XP_001683648.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1315"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1315"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652298"
                     /db_xref="GOA:Q4QAK0"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:Q4QAK0"
                     /translation="MIALEFPLPPSTSLFLSVFVIDNRYSAFPESEEIRLVVLPEPQL
                     TMPPRKAIAKMKSHSAESVDVDLQNCLLRIDKGTDVYGMLVIELDSGRSPKACELVGQ
                     NIPASNTTDKSRGKQGVYKNCRFSRLTKEGIQTGEVVPAAKPIPAAELEGEIGRVPHC
                     YGAVSLCRSSTSFDGSQFFICLTSDSVELDHLNKKHVCFGRVVEGHDVLAALQSDLAE
                     YSGDMGLVRKDCPYVMAELSYASM"
     gene            <473377..>473709
                     /locus_tag="LMJF_24_1320"
                     /db_xref="GeneID:5652299"
     mRNA            <473377..>473709
                     /locus_tag="LMJF_24_1320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683597.1"
                     /db_xref="GeneID:5652299"
     CDS             473377..473709
                     /locus_tag="LMJF_24_1320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683649.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652299"
                     /db_xref="InterPro:IPR007194"
                     /db_xref="InterPro:IPR024096"
                     /db_xref="UniProtKB/TrEMBL:Q4QAJ9"
                     /translation="MWKAIFGKKVDSIKAIDSIYHLSDNDFRWLQGFPQLKGSDRVQT
                     LASSEGEGSKDDYMEEPVGPVSHRDVLLYTVGIIKGATHPLLRESSLAVTGTHTKEGE
                     TFFTLDFR"
     gene            <473994..>474251
                     /locus_tag="LMJF_24_1330"
                     /db_xref="GeneID:5652300"
     mRNA            <473994..>474251
                     /locus_tag="LMJF_24_1330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683598.1"
                     /db_xref="GeneID:5652300"
     CDS             473994..474251
                     /locus_tag="LMJF_24_1330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683650.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652300"
                     /db_xref="UniProtKB/TrEMBL:Q4QAJ8"
                     /translation="MSRVAAANAAAWMQRRAASLRSEKPCASLADKIVRGPPKSVYYT
                     HPSYVMSREKMLHTIWVDIGIFHTCAYVLLPFFFIAYFFKA"
     gene            <474688..>477366
                     /locus_tag="LMJF_24_1340"
                     /db_xref="GeneID:5652301"
     mRNA            <474688..>477366
                     /locus_tag="LMJF_24_1340"
                     /product="putative translation initiation factor IF-2"
                     /transcript_id="XM_001683599.1"
                     /db_xref="GeneID:5652301"
     CDS             474688..477366
                     /locus_tag="LMJF_24_1340"
                     /codon_start=1
                     /product="putative translation initiation factor IF-2"
                     /protein_id="XP_001683651.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652301"
                     /db_xref="GOA:Q4QAJ7"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR023115"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QAJ7"
                     /translation="MRRRAACYFHATGVALRTCRKGALFLLPSVLDSKTFAKLANRQG
                     AKLELQLYEEIRRASPHLHSSAFLGQAKEQARELCLPLTTLKREEVESTIAQKYKLTD
                     DRLVTCLVPYQLGANILLSRLPPKVREESLRELKSEEAARQSGSPPAPNKWIQWYEAD
                     VYVSTGRKYLERISTRRQRRIPVFAVMGHVNHGKTALLDALQGSRIGAEEPHHITQSV
                     RAFTMPRPGADNDLFTFIDTPGHRIFVETRFHVQLMADVIALVISVAEGIESQTHETI
                     KVALNVDKPVIVVLNKLDLLSDALTAEKAVRRILAELYSIGLDVHLLQREKDVEALAT
                     KASTACCSSRGRSLTDLRPQAEYFAPMKTVDPEYKGSKRHPQVQLLRKSYGVCVSAAT
                     GAHIPFLWRVLQLCRDCVPPTCLSNSVGHTEHNAAVQAVVLESSKHLFDEEGFRLNRK
                     RQQIQRSIDRKQEKRSKAFEQRSPRSRLNSVYNSVKTQSTRQNRTSSSSLVITAIVQE
                     GVLTEGMHFIADQAEGQVHALVDYWGNRVEKAYPGMAVTLIDKSSMSGCPGAGIHVLS
                     MTDLASRVRVQAYRQRLQWYAEIFTTKLHYLRPRGMDVSFSHLGDYGQLGITDSLECQ
                     LLYGPPQKPSEEQRQPEALPPGTSASDESIGAYLAERNRESESNALQVSSVGSVALPD
                     GATKRLTQAIMGEDDEEVLKATWQSAQLQRQLTSQKEYEEHVAQCVQVGVLIKVDSWH
                     TARMLHREISRLGTRKVYFQVVGARFGPLQVSDIIYVMQAVKIIVCFRTPLSASSDLD
                     SYIENANLWVLQTDHFSDVVLFMKWCAVATHKEKVLDENDGDVDHGDESGPRPRIVVD
                     PKKPEADSGAPRGSKSQRQRLLLYDDDNNDDEFWSM"
     gene            <477868..>480534
                     /locus_tag="LMJF_24_1350"
                     /db_xref="GeneID:5652302"
     mRNA            <477868..>480534
                     /locus_tag="LMJF_24_1350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683600.1"
                     /db_xref="GeneID:5652302"
     CDS             477868..480534
                     /locus_tag="LMJF_24_1350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683652.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652302"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="UniProtKB/TrEMBL:Q4QAJ6"
                     /translation="MDATHGHPPAGSAAVAVHAAFGSFSQARALAMTREQPLLALKAY
                     STWMRRRRVGASARAAALVDFTLYCNMFALQIWETEDVRPAAPLALARDYFQLVMDEF
                     SALYNVVLPDLDAPETDADLASISILDAKPDSVPDGLWAALLLTIGNQACVELRAGGE
                     GVARAERLFLLSRQLEGQMSDALSLGWTWKIVRDLNAAVYAVIHCDFSQGEEAARSAL
                     TFLETHIEDEPADALSSESVGENGYASHIALLLALTHYTLGVATESTSCESSLLDYDR
                     AIALASEGDTGSSLPALMSRARNRLAVYIEQRQTKAAVLAEEAAGAANAEKKGRKASR
                     LKTGKATSSRRAPQKAGNPRFSQSEQGPPPIVTPSIPDVLRGYLEKEGLTTALVRVGA
                     LKDLYEVLARSLPGYEDCKALPQSLFAGSRFEAGAHESIFAVLFCIDTPLQWTLRLLD
                     AAGNPVALRHSVWAPRPVLASLLMEMAAQRPPAPRSTAALQTRKEISDGNGKLRQQVI
                     QMFAPPAAAPTVKQKAHEWVDAAVELLGQRLSLLLKTERAFEEQWIATERIQSALHTF
                     AVPQDILRVKQELLKEKHLQERRQDRSARLIVHFFRHIVKQRTLRAEQTLVNRHRFEE
                     RVAAAVTLQKYIRRWCAYQETGRRHAARKEYVEKIVLLQSLARRRAAARAYAELRESR
                     CKEDLMKAHLILFSCAALQIQRMYRGHCARLRCYHLRGQMHAATLHHMRDSRNYYATV
                     IQKCVRGMLARCQYGRSVYASRCYGRNVYKTQLWERSCVVIQRAYRAYRSRRRLVGYR
                     AAPQICGVPQLSRPSTASSRRFLRVHADGAVTADKKQATAANRIQQMYRSCAAKRRLE
                     ALKYARRKELEAREEQPQWRARSTFSLKDCVF"
     gene            <482284..>484998
                     /locus_tag="LMJF_24_1360"
                     /db_xref="GeneID:5652303"
     mRNA            <482284..>484998
                     /locus_tag="LMJF_24_1360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683601.1"
                     /db_xref="GeneID:5652303"
     CDS             482284..484998
                     /locus_tag="LMJF_24_1360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683653.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652303"
                     /db_xref="InterPro:IPR019142"
                     /db_xref="InterPro:IPR026705"
                     /db_xref="UniProtKB/TrEMBL:Q4QAJ5"
                     /translation="MGSSSSTLETAKLVRTLLSEDAAPPESLTQLLNMTMTEEETSRV
                     FTVEKVRQLRHLYTRNFAALLYRCIGAISAVAVKRHEINTSTNSPSALLTTEVMTQYH
                     SAVRILLCILPIALESGTTPLEDAVDACPKSNNLVLPAGADDATPPPAALTRSRTAAT
                     AHFQQLFFVEGKTCDDANPEDTFSLLPRQNAPLSPTQPCAEPLPLGSFMVWSLVECCF
                     VRGLTLPEFPVLPTEASVSITHTEVDTGLMWCLGLASEDPIQALTINTSMPSFAWATP
                     RLPRRRKALLEVLFVALSSLVYHEAGFRDTIFLEPLLSTSTVPLTPTLSISMLNTILQ
                     FVPYGSFPYTSHLGVEEKELVVACARLLNATLCYMGAPLDAVLPSERQHSAADGAGPS
                     LDQRISQASDMSVREPANCTVADGPEPSTLSHPNGSHPICDSGGSSRTASSRTGALCD
                     VLVSNTLHSPFSSIGPSTTLLSHVGPPRFVHSVRKALRDITLTEAKALVQRMQVIIGV
                     NVYSSQTYLPASQGWFASLDDFMVLFWKILDLSPACLAQFGTSSHALDYVIPILDYAL
                     AVRRSPLYTYQFQLMLFVLTRLSEVRGFVLQCNQVCNATLPFRFPKMSPARTYNGLIV
                     LALCLVMEMKDLQALVPLFPSCTVVLANMAPFITSLGREPSIKLVSVFAQVTYRCLRS
                     TLPSSPGNSTAADALGGSFPSAGTSNSLVHQSQMVNLCEAIASLLQYQANGSLHLIAA
                     LVDHRAVVREAKDVYVVHRTKELAGGLPLPFLISTLDAAVAVALPVLESTDALRKITK
                     YYVDTTSEATVTNVTAAAETTRAFALQVGMGESGAGLAASDEAVDRLRSVTLVGVLPT
                     PHSIVVRKFQSTKSVEQWTATTFWTSAYIRSKVGLLGDRTSVKLMQFV"
     gene            <487535..>489145
                     /locus_tag="LMJF_24_1370"
                     /db_xref="GeneID:5652304"
     mRNA            <487535..>489145
                     /locus_tag="LMJF_24_1370"
                     /product="putative histone deacetylase"
                     /transcript_id="XM_001683602.1"
                     /db_xref="GeneID:5652304"
     CDS             487535..489145
                     /locus_tag="LMJF_24_1370"
                     /codon_start=1
                     /product="putative histone deacetylase"
                     /protein_id="XP_001683654.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652304"
                     /db_xref="GOA:Q4QAJ4"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="InterPro:IPR003084"
                     /db_xref="InterPro:IPR023801"
                     /db_xref="UniProtKB/TrEMBL:Q4QAJ4"
                     /translation="MSSPEQLPALSAAGSSSSRVASSHHSPHEASLPFPASAIPGDAS
                     AESPRASSMSRSSRASEESAATSPLQRKPDAPMPRLGGRKVLYFVDHSVTAIAYAEGH
                     LMRPSRVRALHALVHSLGLDNAECMTVCHARPATAEEMGAFHRSAYLECLRQAPVICG
                     NPLDEMSLAFQKEFDVPFASQDSDCPLFPEVWALVSSQAGASLACAEALVRGDATVAM
                     NWAGGMHHAAAAHASGFCFVNDIVLCIRRLLRYYQRVLYVDLDVHHGDGVEGAFYGNH
                     RVMTLSLHQFGNGFFPGTGDYPTRETADSFAINVPLPTRTGDAAYLLSFRTALSSVVQ
                     CFDPEAMVVQCGADTIAGDLIGRLCVTTLAHTQCVADVLSLERPTVLLGGGGYHVFHT
                     ARCWAIHTATALGRTAAQLPLYIPRTDPYYMDYRRECTPKRPTLHVFLDPDVDDPLPL
                     GDSLAFWRQLCCSIQWQMHTARLVRQGFTRTLQLCRQRRAALLRQFATQEAGRESGIG
                     VSGPKRPRSANATDRDANEGVEDRVVSA"
     gene            <491402..>492586
                     /locus_tag="LMJF_24_1380"
                     /db_xref="GeneID:5652305"
     mRNA            <491402..>492586
                     /locus_tag="LMJF_24_1380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683603.1"
                     /db_xref="GeneID:5652305"
     CDS             491402..492586
                     /locus_tag="LMJF_24_1380"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683655.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652305"
                     /db_xref="GOA:Q4QAJ3"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:Q4QAJ3"
                     /translation="MANLCLGEDFSEELTCAVCLDSWKDPVELMPCGHIFCKACATGL
                     KECPVCRDPIRSTKVPNRTLVNMALQIQVKCRRCQWRGTREQGMSHVCGKASCSSLNQ
                     ASCSPWVTKSQPQHHPTAAKFPSPYAQQSSISGYASSPGQTQQPTQSYPDLWERGAPT
                     QLRQQSAGYSTGCGNAYSGAAPPPSGGNAGSQGSYPTTNYSNQSGAGYSGYNQQPQPT
                     LSLQSRYRVIEPTGPHPWTLYGLDQSEYDQIVSLFVFFDDNESGNLEPNEVTRLARWL
                     NFANTPQDVKRIFDDMDVEGSGKLSLGEFLTWLRYNKPNPQALYGLTQSQYNTIMMQF
                     HTYDTNQDGCLEMNEFSRLVQNLGDVRDAVTAQRLFQMIDQDRDGVISLHEFLRFRAG
                     KG"
     gene            <494732..>495736
                     /locus_tag="LMJF_24_1390"
                     /db_xref="GeneID:5652306"
     mRNA            <494732..>495736
                     /locus_tag="LMJF_24_1390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683604.1"
                     /db_xref="GeneID:5652306"
     CDS             494732..495736
                     /locus_tag="LMJF_24_1390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683656.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652306"
                     /db_xref="GOA:Q4QAJ2"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:Q4QAJ2"
                     /translation="MADLCLGEDFSEELTCAVCLDSWKDPVELMPCGHIFCKACATGL
                     KECPVCRDPIRSTKVPNRTLVNMALQIQVKCRRCQWRGTREQGMSHVCGASGSGPCAP
                     PTTTPSTMRPPPAPASSSSAAYDYRAPVSSACASYGGYTAPPNLEDFWTSGAPVQPAT
                     TPAHPRVIEPTGPHPWTLYGLDQSEYDQIVSLFVFFDDNESGNLEPNEVTRLARWLNF
                     ANTPQDVKRIFDDMDVEGSGKLSLGEFLTWLRYNKPNPQALYGLTQSQYNTIMMQFHT
                     YDTNQDGCLEMNEFSRLVQNLGDVRDAVTAQRLFQMIDQDRDGVISLHEFLRFRSGKH
                     "
     gene            <497583..>498185
                     /locus_tag="LMJF_24_1400"
                     /db_xref="GeneID:5652307"
     mRNA            <497583..>498185
                     /locus_tag="LMJF_24_1400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683605.1"
                     /db_xref="GeneID:5652307"
     CDS             497583..498185
                     /locus_tag="LMJF_24_1400"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683657.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652307"
                     /db_xref="UniProtKB/TrEMBL:Q4QAJ1"
                     /translation="MSEVTAFSAYQTRSTLLVERERALDARRTAVAELRQMVATLTAE
                     NRTREEQLVAERSRFRDRKSAQDAKVSTKEAEARAQQNRVSVLEEEERQLGSTIAERV
                     EEVRRATAEVERRRDLEKTLCDAREALNKTKFALEENDAKVMRLETRLARQELATDKR
                     HAQLAGRVPQYWLPRVPEADKSASLEDTAGESVYLVDELA"
     gene            <500306..>503020
                     /locus_tag="LMJF_24_1410"
                     /db_xref="GeneID:5652308"
     mRNA            <500306..>503020
                     /locus_tag="LMJF_24_1410"
                     /product="hypothetical predicted transmembrane protein"
                     /transcript_id="XM_001683606.1"
                     /db_xref="GeneID:5652308"
     CDS             500306..503020
                     /locus_tag="LMJF_24_1410"
                     /codon_start=1
                     /product="hypothetical predicted transmembrane protein"
                     /protein_id="XP_001683658.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652308"
                     /db_xref="GOA:Q4QAJ0"
                     /db_xref="UniProtKB/TrEMBL:Q4QAJ0"
                     /translation="MPYDTEVQDLLAPALAMGLGPMGGSVYVSPSSSSTNASALFVCA
                     RADVKSMLAPVTVTTVDALFHSMTGVSGQLDVNHGCYMANTQDSVPQCVAALTSTAAD
                     CGGMAEDAVGPHLRDAASTADRRSTSSSALPGVVPSSAAMLAAYVRDWGQQRLKLERS
                     LRRTREATAAFARVHALVHSAATVPSSKEEARLLRARATVRVAEIASAAYDRVMDKYD
                     IFNTWIGPSLGIVLGGSSDGSSSGDGRGPHAAVGPDVAECPVETYLRLLLWGNESLSA
                     VLPELMGTTLKMADLVRAKVLQPAVRGLECVQVLTALAVMVLEDEPVRTVAAMLATGT
                     LKNTSVWSLDEFAMLAPGYNSDLRKHQLWSFAYAFTTVADPAVTHELVGGTDVAACMR
                     RAGLVVPGSITGTVPPSIYWCLYNTSMSEMTPSAVRQRSLATRESSAAAPNGQCLWGL
                     SVWDGLCGGAAFDPARCRDCPPGSVGDGEGHCVCGDASTMYATLTDGCVAKGPAHDTP
                     GVRVIHTGSSNIVPLSGDNAAVALLSAQLPQTAALFDPSAYLRVDVVCTDSGRGGGGT
                     RLVATPSGDRKASCASVVEYERRQERTGVAHTFGSGTQRFVTYAESLTISATGTAAFY
                     GETCSVTVTVDSTLYRASRSVTAGTWTFVPGATPLYLTAYSHASGSTSSEAASADLLP
                     LCVDILAAFSGPAASSTVHVGVCRASGEQLGVFVAPGSYSLFGLSTQEVAGARVRRSA
                     GAAQDAAFTSTVQSLAARTGMEVSLEGSGGAAAAVLWSATLQSRVTPLAVNAWRSGWY
                     ANISVGKLRHVRSLRVRLVDTWETFAFFPVEGVVPLHYEDGEGSDSSDSSGGGGGGSA
                     SIADEQYGFGYLAAIVIASVALAALLVLLGSLVYLLLMTDAWPKQLLV"
     gene            <504044..>508156
                     /locus_tag="LMJF_24_1420"
                     /db_xref="GeneID:5652309"
     mRNA            <504044..>508156
                     /locus_tag="LMJF_24_1420"
                     /product="putative mismatch repair protein"
                     /transcript_id="XM_001683607.1"
                     /db_xref="GeneID:5652309"
     CDS             504044..508156
                     /locus_tag="LMJF_24_1420"
                     /codon_start=1
                     /product="putative mismatch repair protein"
                     /protein_id="XP_001683659.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652309"
                     /db_xref="GOA:Q4QAI9"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR011186"
                     /db_xref="InterPro:IPR013507"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR014762"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:Q4QAI9"
                     /translation="MGSIHKLTDDVINRIAAGEVVQRPSAALKELLENAIDAGCSRVQ
                     VVAAEGGLEVLQVCDDGSGIHKEDLPLLCERYATSKLQTFEDLHRVTSFGFRGEALAS
                     ISYVSRMTVTTRRRQTCDESGNGASGAGSCSFSTAGAAVAWRCQYLNGTLLEDPQPCA
                     GNPGTTVRVEKLFYNALVRRRSLRASEEWGRIVDVVSRYALAFPAIGFTCCRDRAYGC
                     ASGGGGSSTGSLSRLGGGGNGSNSAGAPANPGGSAAGGLCFPPRSNTRQNIRLSHGTQ
                     LASHLRLVYAYNVETATALSCGAEPDTDSEPLASEVEAEDGALSAGDEPGQLPTSSSA
                     SSSTQALPSTLSTASRQSAAREARVFAQMEQRARRVRATCGSAGEGLFTLVGYTSDPT
                     LAQRKPYLCVFINQRLVESAAIRKAIDAVYSGVLTGGHRPFTVLLLSVPTDRVDVNVH
                     PTKKEVCLLDEELIVSRVAEVCRGAVLEAAAARQMDMLKMRHTAALVLRQQLPSADGV
                     GAADNSATAELSGSSIQHILEKLREQHQRGAPLASPLTSSSLTSTAAVAPAGAGVGGV
                     GPNVVVAPCTMVRVEPQKGALDKYFSQRLAAAAAPAAATALAPTSSPSSLSSSRTAQE
                     ILSRDSVPDQLRAEAEEPLKDGDRRQESAIQRAKKGDATNGQSQTTAAYEAPSWEAVM
                     ASLHGQRAPATSTTTAAADDDSHGFPFASPLRKEICSGESNDMATHAVQTSREAVDNG
                     GEGNAGLAVPHVLQVTMERTARRGAGGADSAKARAALLDEESADGCDNDEDEDDGMRE
                     FKRHRREVHERAQLLQRVTGGAAAAAAMDEAAVEHDASSAAILCPRDHVRPSSAAEVE
                     KAQLAVVHLGAVVRASDMLRSEAAAADASHFSYTVVSCEDSNMDEEKSQADASTNGAP
                     AGVMASLVDVAEVPAPALLSSVSMIVDRLLAEASPTADNLVDQLSFVGTVDSRAFLAQ
                     AGTTLLWCDTMALTRHVVFQRIFLRWCQPALPAPPVLAFATPVRLADLLLLALAYDGP
                     HLQPPSATLLAVVEECAKKRQQQQAVVAGGGAAQLATSSLTTDAVRQTGGATARAWRE
                     VLFNADMESKTLSPNDLHTESGAGGVFAGSESVLPQPEDATMRYVRRLVRRLCRWRGL
                     LKEYFYIDITADGLLVGLPYGLNRHWPPRMRAVPVMVWLLAEAVPYPGTAAPSSSTMS
                     GAADQTGPTSAAWQSNEGRGAEEVVACVATSTSPATSLAPTQTEATPTTTPQPTAMEA
                     EADGVAQEVACFTAVARHIAETLYGLPPPPPSTPPTSAEGPDTATADVAAGATDTASA
                     ELWREELVRHGLFACLKNPQLCRLPDQCLRDGTIQSLVSVESLYKVFERC"
     gene            <510137..>519964
                     /locus_tag="LMJF_24_1430"
                     /db_xref="GeneID:5652310"
     mRNA            <510137..>519964
                     /locus_tag="LMJF_24_1430"
                     /product="putative kinesin"
                     /transcript_id="XM_001683608.1"
                     /db_xref="GeneID:5652310"
     CDS             510137..519964
                     /locus_tag="LMJF_24_1430"
                     /EC_number="3.6.4.4"
                     /codon_start=1
                     /product="putative kinesin"
                     /protein_id="XP_001683660.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652310"
                     /db_xref="GOA:Q4QAI8"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q4QAI8"
                     /translation="MKRSTTVLQPAPANSQQVSESVSRRRVATSSNRSISLDGATSAP
                     TAVKVNTNTAAGASPPMPSRRCGGSADSSNGSPSPTRPEFSSFLTPRVLNAPALKTTA
                     ASPPFTPQQQWPHDAAQSPRPIPSVSGTPSRETLSRRRTQHIPVLSRGTPPRTATVAA
                     VTTASPSGSPRYEDAYDPRQVRRLTAVGTSPMLNLISKPAPSPTPSSATHPTDNFGCR
                     QAASEAADAAARPTSSAEKSESTALASAAAWDRAKKLAAPKPSSKAASRHGSGAPPTL
                     IPTKVSQIRLMSTREVTLANKPCTAEAVDAMLRAQHASASTRARSPFFQFQVSEATLP
                     LTFCAASRKSSVWSSDHTNRSIVLGASGATLAPSVTSPRPTWLENVDGEDTTVTGEEN
                     TPVSATASLTYPPAGGSSTALRSAAPVKSTPRTTAMSTTTATAPEPAAVKSFKKRSDV
                     KPTLASAAAAADAKSERRSLTQGSTSQVKKSRDVTRSAANAAPSPARSSPPQTPHKPT
                     AVAAGAQLHTPKMSSSASKTARSTSTRTAASPSRHPDALRGGLLRSATSTTGMPATSA
                     VAAAAAPVVSPAPCHATGAHSQDAATILSQTLSAVRPMVPVVHVRIRPVLPSIGENGN
                     NRRVYFLDHENVMVVRTRPGISAANVSLSAPSSSLNEFTATRRSGINGQVMPALQLPN
                     LDSRTLDSSSGARGAAAARNGGAAAAGGRGGCNAPALLTDAPRTAATTTACSACLCGG
                     DLALLRSPLSAESPMASKTSAAAAGAAVPGDPDGGIIDGVFSNTSPSLESLQPLSFPP
                     PILAMHHNRTISWTSQGSGEHSPSSRLSCGSPSTSVSPQQLGTGLAGGGTEACMTLGT
                     FASASRTRPWLTTFRSFTEDETPSVFTTPRERRAGSSSAGVCTSRTSGRDSSGSAARS
                     RRGISASQRRAKDPGIERKPRYGGISLSAVSLATTRRNSAATTTAGVSPRTTATTSAP
                     SPTSMRRRASRSILGASVSVSALSIATMPKASGRATNVTKLTEEDADAESDEARQHEW
                     QLQRQQTSIGSNSVSASGAATGAEQHYSFEFVHDEEATQADVFEESVLRFADEALLAQ
                     NVAIICYGPTGSGKTYSMMGSQAQPPSAALASSGATPLRAGGGAGHRSGGLSTSSTHS
                     PPKPDSRGHTLHGRANAGETQRRIIDEAAAGAYGRGVERDAHAVEDDGEGNGTDWPRL
                     GSSCQYDYAEHTCEGNGGSAATAVRRNHQRYPHSGGGGGLLLANSAMALESAATTGSM
                     AEMGILPRLVHTLLERRGEAITIRRDPGRDVASRSANSLQSTLRQKTTVKRAGGLLLT
                     LRDLTFYGIELYMDELCDLLDPGKRPIRAVSDTGGLAMLCQRINEARDYRTRGSRGGS
                     SRNPTQTARTGGGMAITSLADLRRAYRLAHGNRVTARHAKNDTSSRSHAIFLLQLDFD
                     LIESTNVPRGGAGGGIAAAGDRGAAAPPPPSECVQRVHSYVAMVDLAGCERVKQTKVE
                     GAALREAQYINKSLSALSSVVLSLHHHNAHVPYRDSKLTRLLRPCLEGGRVLTLVHVA
                     PCSSTEALNTLKFADQIRHIHIPTHALTPTSSKHRELLDVFADLIDPMQGQWEAQVRQ
                     AQLQLDRLCADVRLAYFSRAVGALSRRTAARDSLASDVVSELSAVSEEDDSVSFSSGD
                     VSQEEGPQPLTEAATEADKRRFALRTVMHRFMGPIHSRQRTTTRNAVRAIRRCAEQKV
                     LAHRRQVQQQIDELQTTVQKLTAANAKLAKENSTPLPRDPHALELSRRIRESTEELGE
                     YAKEQAALISLTTALRQRLATQDDLEAAVDEQLHKVQHRTAQAMRTLSAAVAAHPPGG
                     PPAESGTPLPTEPTLPADSSATAALAMNTKDDPELRDIAHQQLSLAKELAALRLEKAC
                     FEIGTGLWEGLWARAMRKEIITAVEVEVFEMERILLDRRALSVMMLMAGDADVDGEAN
                     TTALLVSPRSAACPRNRLGSVEWDERGMGATTAEHQVATPPTHSALEVSPPRVQHLSP
                     SLTPHSSVRGRLDSYVHGGAEPGDRSSGAATPQGSANKGEGGAAVPFSPSLPQRSRRD
                     RAVDLAATSTSDRSLSSATELFSAIASSSEGFRLRSALAAAAALPSPPPRRGLEGPMP
                     NPLTVLVTEEQQKQPPNHMASAASPPVSCKSSSVAAVMEALMPLSLAGSYEEEQSMQE
                     ACLQLMLREGIPCEVCCLGESASQTLQHYILPSSADAPLAEVAEHEEPMSNSSAAPAR
                     YRVTAAAAAALGATEKGGDASSLLSRHGHASAGARGGSSSVQPCERPDGPKVPFCTTR
                     HGRLRLVRMPRRPNCYVLEFVYTHHALPMTPRLQAAMLGKPEDKFTLAPGKTHLEQMV
                     DSLPTVQGVAGRGGGGGSSGSTAIRPQGPLREHRLFAIPLFEPTLHLHVHVLEEGIPN
                     MTTPVAATVCLPGGSDAHEIAGSTFEDASDHIGPSMLASPSSSLPALCVARRLENGPQ
                     LVIEVRGVPQTASTCRPVFTTDSKKPPKSSQQHQQKPHPLHKATARAGSTAGLGLQSG
                     KPQHAIGRSPSQPSTSPLRGSTSSASPAPKRAGTAVWSGLVLAKRLSGGGELMLPSSC
                     ILSNTGCCSLVLRFPAPFFASSASRVERVEAVVGALCGILRPSLKAPEVRASSSLSPP
                     KRAVSVRRRPSSSPRSTSAGGAEKGGSSCGGRRLSSVSRSPLPCARAPPELEVVNYAH
                     VPHNIFLPAASATQASAASAANLGDGVEGVGCEHHIHGHPCASSGHGAAPASTSSSMI
                     SSDSLDGLGAMGGGVLGHILQSSCSHAHRHHSAAVMPPDTRLPQHTTTLNGVLKPFRG
                     KSRSASPAAPLMDQQSGATLQVQFYWIPTPLNIEPPRLDAGRKSSGGTGCSSDNDGNG
                     EERAVRWLEASAERRRIDSSHLCRVNALTTTAADTAAEAAEVGMDRLVRLQVQTALSI
                     LAQLSYVFVDGRPLANVADDGEGAAASSLGSTLTESFGAHDVRRSLVLERGGRPRSRS
                     EARAAGFRDAVAVASLLRQIDTYRHRIRRLFRQQLYDAEDIIGDDMTPPAPQSWLTAE
                     LGRGAYLREVQGEVKRTIGLPASTVLGCTGGGAAPPLMTSPGRHPRCDDRGMQAALLE
                     PESGDAAPDTQITVAEAREACATRVPWTVWQWSYRWSRLNRLLRGDSVGCLGSGGAHG
                     TGRPSVSQAEAAAAWLPLPAGNSGSAASPTVTSSLLASCSMVALPTLATASSSSDEGF
                     VMEGDWLTEAKLAARSKRVWLPEVLATTVPSYLDNCASAGL"
     gene            <520639..>523392
                     /locus_tag="LMJF_24_1435"
                     /db_xref="GeneID:12981302"
     mRNA            <520639..>523392
                     /locus_tag="LMJF_24_1435"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721753.1"
                     /db_xref="GeneID:12981302"
     CDS             520639..523392
                     /locus_tag="LMJF_24_1435"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721801.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1435"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1435"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981302"
                     /db_xref="UniProtKB/TrEMBL:E9ACS9"
                     /translation="MSASADGGQPVVTVRQFRLRGGHDTDNSDSEEGKGGAVSRLRGG
                     ASAAATAGTRPTDAPQTTSLPTAAAAAPASLPPRAGSLSSLELFTSSSSRSSSPACSE
                     LPSGFMTSTAAAAATPAPNDLWGGKLSGSSSNNGRVSDTYQRGHRIGNHERGDGDTTQ
                     TRQQLRGTGSPVGALMTSARMRSAVEEERQTVPGKALAGDAAVVVEVSSMPSPTASAS
                     LALRTGAVQPRSAVAGFFKGKEASAPTAIEGVAFATSSTSFSADSAGGMSRPAASATA
                     TAVPSSPAPPTATGMGPIRTDAVPTVEATVASVYTGGPSGVIQESFQASAGSVASPTG
                     ARKASLAARSSSSSLDGDPVPLAPVQVASPTSTGLPSGGVATATLGLSTRKLTVPFTT
                     AAGVDTSPSSSFPRQPLPSTTRPSTAAAASAGAGRTAIPAAASTAASSAFTAVPDGRS
                     SALGSGSPVLFGPGSVVYNRVSAKGCGSVPSSVLEVPSRPKWCAPPGEYTASPSPPAA
                     AAQSAAISAAPPPLPGPVVSTRAAHAAEPTPAAARTSAFSTSQPFLDLLTRPHRQAPQ
                     LPGATHTPAVLSLIEDDGRPRCSSPPVSSAPSTEGNTAETGQPKTVRAQGRGPPSSLI
                     ASPPSPPTRHAASSAEGATSPLLSQSAAVTAAQRQREAAVVIYDDRVPPAKRRAKRQA
                     RPMTGQTVAIAPTDPMSVCVLRGLRTGAPQDGNREDPLTCRPILRIGGGGAGWRRNPV
                     DWFSERPPLDGRAVEADGCEGVDGSDNGTRGRLDHSTALHGFSGIPTGYDQYPGRRPG
                     EDRSAKLTMRSASKYTVQRLFNEPQPQHKACVDSYISGTGNGESVPCVVMHLGQQGAQ
                     TASDVTATHGDVSSAGLSSAKFSPAAASTRTAVSLLTDESVNVDLLNYCRSRRKQQQQ
                     QHR"
     gene            524402..525673
                     /locus_tag="LMJF_24_ncRNA1"
                     /db_xref="GeneID:12981303"
     ncRNA           524402..525673
                     /ncRNA_class="other"
                     /locus_tag="LMJF_24_ncRNA1"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460464.1"
                     /db_xref="GeneID:12981303"
     gene            <527879..>529495
                     /locus_tag="LMJF_24_1440"
                     /db_xref="GeneID:5652311"
     mRNA            <527879..>529495
                     /locus_tag="LMJF_24_1440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683609.1"
                     /db_xref="GeneID:5652311"
     CDS             527879..529495
                     /locus_tag="LMJF_24_1440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683661.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652311"
                     /db_xref="GOA:Q4QAI7"
                     /db_xref="InterPro:IPR005000"
                     /db_xref="InterPro:IPR015813"
                     /db_xref="UniProtKB/TrEMBL:Q4QAI7"
                     /translation="MRRLIGGMGGAPRCAGVLGGAAAFVHTPSLLHHFLRDSTAVATR
                     MPHRSLSSSSSSPSSAFTGSPRCGSAGGSVEKGVVGRLRQLYLDFQIYRDRQLDAVAA
                     EEAQAAVEQRFYENGNDVSRTTAAAAAEATTHGGQTGDAQTRGRRSPLISRNPTLCPR
                     SVLFVPGSKPRALAKIPTLPADCFILDLEDSVGAASKRRARENIQAFVEDLQKEQRIQ
                     RAAQATTAAVGGGEAADEAGDAYPRLIVRINSPDYDPATALLDLQLVGLLGPAIEGIA
                     LPKTTVGTHQLIKDYVYPCHQLWAFFESPLSVMQAPLICKQQVYQYAVMGYNDLSAEL
                     QLPMATPSTLPGATDGNPVSEAVKESLHIAARLPLWQSTAQVLLAARAHHMFVIDAVF
                     NDPTDKAGFRRSLQECRLLGLDGKTLIHPGQIEPTNAAYTPAEAEVTWAQRIVEAVKR
                     SGGDVITVDGTMAEDLHQRQARHVLALHRSAELEKTLRKTETPQGTAGIGVFKEAAEG
                     TTATGAAGGDRSETGRQPRCTPSRHRHVSW"
     gene            <530349..>532154
                     /locus_tag="LMJF_24_1450"
                     /db_xref="GeneID:5652312"
     mRNA            <530349..>532154
                     /locus_tag="LMJF_24_1450"
                     /product="putative protein kinase"
                     /transcript_id="XM_001683610.1"
                     /db_xref="GeneID:5652312"
     CDS             530349..532154
                     /locus_tag="LMJF_24_1450"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001683662.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652312"
                     /db_xref="GOA:Q4QAI6"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4QAI6"
                     /translation="MVTAIGGGGGVVVTCCGQCGTAFQKSSARFCSRCGVRRDIPAAV
                     AVAARKPKPKETVVSMPPLASVGKESVSGPPADGVKGTLRPLDLEKLSEKKRSSGGGS
                     VAPPPLTEVSPSALEFRDPSEATSITTPKRRASLATAAGGVLSSAVDASLTLSDQQQR
                     RREQRASSKYAKGGSLTGSPLASMADPDQLEHVLTSSLQENAATGGGAGNGVDRSRVP
                     ILPPEQRPPSTFSLSVALVRRDGGGAAVTDGADFTGASVKTTPPTWPADAQASTSNGG
                     DTEEAIASLRPSAEEEAQYTAWATLSPDDLTPEMLQTSNASELRQWRKGNLIGRGTYG
                     SVYLGLLPDGSFHAVKCVELGNRKAAADHLGALELVSLSREVNMMHRLRHRNLCTFKG
                     VYFDSESASVCMFMEYIGGGSLSALVKKFKPLPPSVVRSWTQQLLSGLHYLHSQHIIH
                     RDIKGDNVLVDTTADPATQSQIKLVDFGAARRLTDAVSQSSTVIGTPYWMAPEVVDAS
                     GDGSGYSYKADVWSVGCTVAEMLTGRPPWPCKTSAPAAIIMIASATGMPTEIPEEEAT
                     PGCLDFMRQCFIRDPEKRPTVQQLLQHPWIQLQME"
     gene            <534074..>536512
                     /locus_tag="LMJF_24_1460"
                     /db_xref="GeneID:5652313"
     mRNA            <534074..>536512
                     /locus_tag="LMJF_24_1460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683611.1"
                     /db_xref="GeneID:5652313"
     CDS             534074..536512
                     /locus_tag="LMJF_24_1460"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683663.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652313"
                     /db_xref="UniProtKB/TrEMBL:Q4QAI5"
                     /translation="MQPRCVRMAALATASASLPHRSAAAGLLTAPGQPAARGLRQRRR
                     AHECAAAVGTGTGPLRAAWRGEGRPTLTPTPLVARTDGICTIGTRGCMRDASAAVCTR
                     SLLAGLRVSCAALETPRRYCASLSGVAHAPPTPSHNSPRLRGSYRKRLPSSSLPSSAS
                     RYTTRSQQHRQRAQAPSGRPPRPRREPNGKTLRLRTPDDDNSGDAPPSQPEEMPTADD
                     VDGASVADGGMGASAADGAASSSAVAHDTNAGWGLEDVNSRTGRTQLEELYERNLDRI
                     RAILEQPLPAMPQDGSVDPDFFVGFASYSYQLRDQYRAILARELQVPVRAVRLSVAWS
                     GRFDVRRFGRVQKVCGVCLDRQALPAATHKERETNPGTGLGRKEGDFAAKTRITEVDE
                     AASSSSASALPLPETLHKRIHALVAAINGRRREDLLQVSFFQASPPIPEVEFALTRRE
                     HRLLYHLHEWIRRHVLQSAVVVVVYGVPPPPPSATSNDTRATSAALHFSTGLPERREV
                     THDTADATNGDAAQPDSYVQWQRICSTRTAAQKREVQDKWLRLLHRRKVVPLVISLTA
                     LATEVAAAVVRGEVPHIHFRHAKQETAEVKYADGAAAQGGEQHAAALATSSTSATASP
                     VELSASLQDVLVRIAAASLSSPPFTTDDDGTSAEDRGDHAAFPRRAQDVIAPPHGADT
                     ATATTVVTPLFRPASTAQKTATMRWVRLVCQALLLREAQGSTDCSGRTDAEQSTMRIS
                     HRASLPALFAQGVYAGGEEEVAYLQRNRAAMDALLLHPHEISFKKKFLSRMRNGHRRL
                     RMEDESAAPYAVNG"
     gene            <537256..>546534
                     /locus_tag="LMJF_24_1470"
                     /db_xref="GeneID:5652314"
     mRNA            <537256..>546534
                     /locus_tag="LMJF_24_1470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683612.1"
                     /db_xref="GeneID:5652314"
     CDS             537256..546534
                     /locus_tag="LMJF_24_1470"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683664.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652314"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q4QAI4"
                     /translation="MLSAIPSSLCCCFYRQRFLYLFISLDLLCLSLLLPVAAMRIRVF
                     ISLIRWDAHTHTHTHTRRRARLLQGGLEEHHRFELNAAIALVRRSVDPLPSPRRFALL
                     CACRLRTVCLRHRLSSLPPGTLPRRWLPPSPASSLLALSTRTISAGRGRVCASLLKTH
                     SVCTSWAVCPVMERTEFVDSTYRGGGGGRGGEALLMNESSSLQRTARARAHAAQYLMD
                     IENACMPLLPDDPEKRISLHRQLRGRYNPTQIPLSSLSCAAYLSASDVAQLAALFRQY
                     SLFSSEVVNTLDRDDSSGGGSGKTSAEGKGKAAVAAAATATSAKAPKSRPRSFGRDSE
                     ATPQSPSTVCPTVAAAPRPPVVLDAMHGKTGMGVLQCVARQRRPPASPPERPLSSASP
                     SAAGFVAAAAGAAVTPSFSASPSVRRAEGEPVARTLTEMAAADRRELAEPFTSESNDA
                     ALTTGWLVELLLEMVIENSAHSANASVGGGGAASAAAGVASGQTLTPPGASLPQPRPS
                     TGSHHHYNNGNVTHVAPACFNSATMVCQTRRHDARVDQLRCFKAELTAWAERLAQKCD
                     EREHRAAWHQCVAQEEVLQRYQACVLQSQASRLMGASSTGAPGGTAGALSSRPKMLSF
                     VNFEPAGTLANSKVGSSVSPCRNGGAGGRSNVSWGPSHVVKVVSPDATKTPTTRSTLC
                     PSPPGSAARLIEPSGDPQSNTLHAAAEQQPEISTHSDTSDADEVLSMHNNDNAGGLAH
                     PSFPVEMLHSTVSSLAGSMAVLPSNAAGLGASVAPPSMSVSVTGVNGAAADQSLLAAK
                     ARLTAPALKDLLQQPAQLYAYLWTSSAAARLAEGEERCQHHQRVRMVRGAQPPPSRGG
                     DKSTSGSSASPTESAVGTRRSRAAAVQHLVCWSDVASNLLMGLETTWLSQRHDAAYAR
                     VPTALLEDLSEMTAPKRGGSSHHIGAGSDAHTVPRSFTSTHEDGSDDDSDSLDDGVAL
                     GGGANSGAGVAGSGQACRRRLHKSGLGNDAVALQQRAVLFNSLGAAAETTLGALHSEA
                     ADHILASPTWKYTVTSSKDGLLKVWDTTSGQFVSTILNIGQSWVLTMTFLHSGEFLMV
                     ATSAAEITVVNFPAGGVLLKLRGCTSLATAVPQVKQPSTFFTKRYGLKPGECGRHKPT
                     CSDGGGWLGAAAAARLMEYAEGESEPIVARPIVGYVTPTSAFFDAEMGFFFFGTMSGM
                     VGCVDLTAVLSRTALHAAAAGAGWAYPLQVYGAVLAHPEVLPPEMGAASTPASEMPLP
                     SLDSTATYSRLPAVGHRKTRISSPFSLAAAGMTAATTSGGLPVNGLFFCGVGHCIISS
                     DPDGGIMRTSFTAAADTLDYALGTPTMVMATAKPIRFMVSCASGRRFVTVHSDRRAFL
                     WAVGRTLTECVHQYPQEAYDIIDVCFMPPHQQVAMLMSDHSIRIYDERGSRPLTSILP
                     PRGSSSRVEDMASMTLKCSANDVDGCLTYLQTTQRLVCGLRGPVLYEPAARAPARGGA
                     SISTVEALEMPAATDMPERNSNPTDAGAASSTEGMQVEEVTLPPSLSSLGSSLSLPPL
                     PQSALPFSTPTSTALAATQKATTLSPRRSRIASVSASMGSSTYGGMRGVGGDTAGIET
                     EKAKAAAAAAQEEVWRQRQLNAALHKCHQRLQPHQTHSSAVIGLLLDPGRGELHSFST
                     DTWCVWYYETGKRLRAPLHVPRAAEKELAVRSRRALLTCCSWSTEGRTRVLVGTRDSR
                     VLTLDARLVSVMSATDPFTRSVRGPTSGASSPMLLADKDVGVISSTGCRTLLCSGHVC
                     EVRRYEVTGPPKPSGEENFISMRVELPSTSTAVAPSPTHGGGTVATVAPAAAAVKDTK
                     CTTSATRGGCSDTTITACCVVRESHLCLGTADTQLFFYRMVDRSSPVHVEVLCDAHGV
                     PDVGRVVSLNYLNDLAHDMLLAVVDTGILFLYSYTLQRTLGRHTFPTLGSQMILTAVP
                     TFTSRGHTRGHQQQEHYITSVAVAREVVGAPQSSLLMMACGDSAGYVHVVPFAHLLAE
                     VLNTTSRDKGASSAARVPKSHELRVSASFRASRSGVSSLELLATNPSKPTVATPSHAS
                     TELPSTERTTAATSTAMPSTVQFSEPHLLVFAAGFDGNVRVFSLSPNTPQQDLLPLPH
                     FAPATSTSTWSAVTTSPQLPQPVATSANYTRVSHSRTVVPNLPERSSSFRTVGGGRAS
                     LPNHAVGAMCYEAKTVGLCGVDTWDLWDPHTFSDIEQAAVITQAHSDGHIGFVLPSIL
                     DDVDDSEGNVEGCGVAGNAVSAPGARIAAVGVDSTAATTESGAVLLYDILRRSKKQKP
                     GSPTTAVGTYAQQPLHQSRLAATTTGVAADGATPRQCGSAPRSRSPPSSTRMATPAAT
                     AAVADTRAAAAWSGKGDADTNDGPVRYPGCCTSAAPPLPPPLPAHFTPHTIGELVRDA
                     LPYSWSRSSSVRDVVAASSSPLGPPMQDAAGCVRDGHIYGVLSPIPRPRAMRNPLIRV
                     YPLALLRQMGLLHPLDTTPDVDPETGLLVLISAHDAFKPWKTRLLRTESASTATAAPN
                     LMATSPMTSVKSVHSALATAEASRLPSAAETNGTDTVINVPRCSYTLSSSHSFSEASG
                     FLCPRRITATAWPTPLSLTPNHTRSAGAEAEAGWRNSSTGADDAEPETSVFLTEGGVD
                     WTRPSFCTATPASSMCSPLCAVGTATLAGELSSASRRTTTEEEKTAVAGADGLQRVAI
                     RPPSTTEWKMVSDAVRDSGEASSRRSISSANPSSALAWSNRSRPPLLPPASLTSAQSL
                     AKQKLTYLRGALGGVDAEVLRMREDQMMLAHMAARLDCSRQVPLPAHGNATAAMDGTW
                     THSPPMSTPVLGEYTSRLIRLWRQRAGDAVVEAVAAALTALGAEEAAETHSSAAAAED
                     TGTTTSAGATTTSAMSHTAAARAREPKLGSGSFPTRGLKAGGKGAPGKAMLSPRQRDP
                     TVMVSSSRSERRSSHGGQANPQTAYASMLQAGASTTFGLELLALSLPNEPQAAPTRAR
                     RCTGRGAAASLSAGAAAAPPRRGARAAVSAAAATAVSSKAAPHLETRLPMIALQQDVQ
                     PIRVCLPSTLRADEGERMWLRRFEAAFNSVDK"
     gene            <549266..>551164
                     /locus_tag="LMJF_24_1480"
                     /db_xref="GeneID:5652315"
     mRNA            <549266..>551164
                     /locus_tag="LMJF_24_1480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683613.1"
                     /db_xref="GeneID:5652315"
     CDS             549266..551164
                     /locus_tag="LMJF_24_1480"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683665.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652315"
                     /db_xref="InterPro:IPR023393"
                     /db_xref="UniProtKB/TrEMBL:Q4QAI3"
                     /translation="MSYLLHSSSYAAATAAAERDGPARGAGGGPLNVVLSRVRSLLHG
                     EPSRVARATSIIDDGSSGSLKRAERHSGASSASRREVLLPLTHDSARVARVPEVSGFI
                     EHGGGFAIPAAKASPRTAPTPVAPPTTNESPVHRPPSARPVDAARDASLYERAVDYTD
                     LEEILRCPLPPVPGCPTPCAFGRHSAGLSSDGSVTAAATLSPPPAPSSARQPPLVFRC
                     IAADSDTGISVYSTPAEDCPMHLMRAYAVLPCSPGDVLQYMDNDIRPRWDSHLRRSAL
                     LRELTPPEQTKAVERQYRLSTSIGTAGAAVSQRSPTSLSAQSQGALRQRASSSPRTTG
                     AIHGGCGSAVVSGPATAAASSPTAFQYLPGQRRVAIHYLETRSPVPFVQDRDFEIVVA
                     EEVRPDDTAYVKAFSTPLGYHMPLGPHQSRYVRAVVVLSGMVARPLDAARVEEVLPPV
                     LLRHHRAAAQHGNIQVAGIATKKPSASATVCGDAAARAACVAAPHRYCVVEYVGLVHP
                     MGLLPAVLVNMIISAQLNAMRKMQAFIMQHPMSTLRPRSATHAATGEATGQPLQELLV
                     SLQSLSPSPRKSSRMGKSQESDAAGRTREVKPEATGASAASVSAPLAASPAPVWWRRQ
                     MHRFASNL"
     gene            <551628..>552932
                     /locus_tag="LMJF_24_1490"
                     /db_xref="GeneID:5652316"
     mRNA            <551628..>552932
                     /locus_tag="LMJF_24_1490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683614.1"
                     /db_xref="GeneID:5652316"
     CDS             551628..552932
                     /locus_tag="LMJF_24_1490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683666.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652316"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4QAI2"
                     /translation="MKATPILSTDTAEQARLKLRHQHPEYTEEEQQQTDSKKTWAASE
                     EAENEDDYVDDDDEDDLNANVDETLRVFAGGGPGALLEEVESDDEEELEDTTLKPTDL
                     VFTVACADAQAPRLEMYVYDEPEDNMYVHHDMEIAAFPLCSSWLTDGTMSMLAVGTML
                     PFIEIWALDVMDSVEPAIILGGCERRSYNYSKRMLRRNLKADSHTEAVLSVKWNTVAQ
                     NIFASGSADRTIKLWDLNQGGVCLGTYSEPEKVQSLDWHATEANLLLSGGFDASMVLR
                     DCRQPDQTAQRYELPGIIEHVEFVPLAGAAAASAPVVMASTSGGHWAAFDTRMTSSKA
                     GHCPVTPLWQLQPHQADMTFSCSRQVPGLFATGGKEGEIALWDGRDSSAAPKMVVSRS
                     YKTGSVLSLSFHPNSPHILGAGGASGAPLVYTITSDISDVFR"
     gene            <554358..>554870
                     /locus_tag="LMJF_24_1500"
                     /db_xref="GeneID:5652317"
     mRNA            <554358..>554870
                     /locus_tag="LMJF_24_1500"
                     /product="putative IgE-dependent histamine-releasing
                     factor"
                     /transcript_id="XM_001683615.1"
                     /db_xref="GeneID:5652317"
     CDS             554358..554870
                     /locus_tag="LMJF_24_1500"
                     /codon_start=1
                     /product="putative IgE-dependent histamine-releasing
                     factor"
                     /protein_id="XP_001683667.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1500"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652317"
                     /db_xref="InterPro:IPR011057"
                     /db_xref="InterPro:IPR011323"
                     /db_xref="InterPro:IPR018105"
                     /db_xref="UniProtKB/TrEMBL:Q4QAI0"
                     /translation="MKIFKDVLTGSEVVCDNDCPFDVEGDIMYVVNGRYIDVGGEDYG
                     ISANVDEDAAEGATGEVAEGKERVVDVVYNNRYTETSYDKASYMAHIRSYMKQLLEKI
                     ENEEERKAFQTNAAAFVKKVLKDIDEYQFFIPEGNDEDPDNGMIVLCRWDGETPRFYF
                     WKDGLKGERV"
     gene            <556413..>556925
                     /locus_tag="LMJF_24_1510"
                     /db_xref="GeneID:5652318"
     mRNA            <556413..>556925
                     /locus_tag="LMJF_24_1510"
                     /product="putative IgE-dependent histamine-releasing
                     factor"
                     /transcript_id="XM_001683616.1"
                     /db_xref="GeneID:5652318"
     CDS             556413..556925
                     /locus_tag="LMJF_24_1510"
                     /codon_start=1
                     /product="putative IgE-dependent histamine-releasing
                     factor"
                     /protein_id="XP_001683668.1"
                     /db_xref="GeneID:5652318"
                     /db_xref="InterPro:IPR011057"
                     /db_xref="InterPro:IPR011323"
                     /db_xref="InterPro:IPR018105"
                     /db_xref="UniProtKB/TrEMBL:Q4QAI0"
                     /translation="MKIFKDVLTGSEVVCDNDCPFDVEGDIMYVVNGRYIDVGGEDYG
                     ISANVDEDAAEGATGEVAEGKERVVDVVYNNRYTETSYDKASYMAHIRSYMKQLLEKI
                     ENEEERKAFQTNAAAFVKKVLKDIDEYQFFIPEGNDEDPDNGMIVLCRWDGETPRFYF
                     WKDGLKGERV"
     gene            <558694..>562152
                     /locus_tag="LMJF_24_1520"
                     /db_xref="GeneID:5652319"
     mRNA            <558694..>562152
                     /locus_tag="LMJF_24_1520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683617.1"
                     /db_xref="GeneID:5652319"
     CDS             558694..562152
                     /locus_tag="LMJF_24_1520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683669.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652319"
                     /db_xref="GOA:Q4QAH9"
                     /db_xref="InterPro:IPR003034"
                     /db_xref="InterPro:IPR006166"
                     /db_xref="InterPro:IPR011335"
                     /db_xref="InterPro:IPR020819"
                     /db_xref="UniProtKB/TrEMBL:Q4QAH9"
                     /translation="MAEPQSRAPAPLCAGATDIVVAASAGISVNARLCKHLLLQGSSL
                     TQPQPLTNSVFLDALARYPLPVVSAATAHDVAGSEQQLQLHQPSAHSPLQPPSEASSE
                     PTTAASAAPVRIRRSTASPLGERHMSFRGAAPHAASDLTSAINQFWALSPAPAAPHSP
                     LLATTEGDAQGPVHTAAVAPCGSAPQPTPPPPPPWVAFSPFRFCADPSFHAALQRLSR
                     HRSGTADTHQRRQRAVAPPSPPSRHMPGLSSLGPPVGGVAPASRPAGEGPHGTPSSGS
                     AAVAVNVSAPDGGSVSFDAPLGAPWTVMDAWCHGFAATAVDGGRSRKRARTASATAAS
                     PTSAEPTTFARLHVSDTYHGGSARMGSKNSPPPTVTTVAAHDTFRTNPSPDSIATLLP
                     WASPKTPHETVDVPQSRVPEKDDLLDLLLGVRQNASRSPEFAGGLPCSRAQLMEATGM
                     TGAEVHTEGEGERNALAKHNGSAMLSSSRTVSRLGTSAARAGADGLATSCVQRNQATT
                     SLALTAAATATAMPRGPALSASADADFSCGAVDPNNGEHVLVSTVRELRSTCARLGLL
                     STGSKTTLQQRLRFYYASAPASQQSGVRVPLAATAANLSAALHVPLDPGATRTGGEVG
                     ASRSTGSPPRTVFRYHSPSQSPGSVLPASAAAVAVGQPRTCATEAVSGPATRVAGPAV
                     WEHAAVSTSPAAAASGQRGRFVPSPTQFLHDLASWTTRTPHTALATLCDAHSPPSATA
                     ARAQQEELTSETGRVRWQWLVDFRERSSAHRGGGGSGRRQHEGMLDVFRKQHVPCTSM
                     MLPAGDFMLSVELSNEEAAAMHVYGVAASTEVDPGVPSASAPAEGAAPVLSHVCSLVV
                     ERKTAADLDASVKGARYTEQRRLLAASPFRLVVWLIEGVNVAGGSGSGFSRHGQRHYQ
                     GGDGTESDTQPGSRSPSPAPSSRAESARQRVDSACASLGLHGKGWLVVRTRNTTESVQ
                     FLKLLATHVARQLASYRLRRRCMGEGNSGMVAGTDGCAACQTAAQDPSAQRVARADGG
                     DVHCGNIFRSTGNGASTTSMAAAVALLQLTTTKTCLQSVSALQRHLRAKTAFPRMLMC
                     VRGCSAALASLLSSKYGTLLRFWRELRRRGQEVCDADPDIQRLTTAQKKVYILLTEFL
                     LAKDYF"
     gene            <564457..>569532
                     /locus_tag="LMJF_24_1530"
                     /db_xref="GeneID:5652320"
     mRNA            <564457..>569532
                     /locus_tag="LMJF_24_1530"
                     /product="putative ATP-dependent DEAD/H DNA helicase recQ"
                     /transcript_id="XM_001683618.1"
                     /db_xref="GeneID:5652320"
     CDS             564457..569532
                     /locus_tag="LMJF_24_1530"
                     /codon_start=1
                     /product="putative ATP-dependent DEAD/H DNA helicase recQ"
                     /protein_id="XP_001683670.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652320"
                     /db_xref="GOA:Q4QAH8"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002121"
                     /db_xref="InterPro:IPR004589"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QAH8"
                     /translation="MRFVAKQLREAQHHRDDLVFLEDEEHDASDELQQLDVRIAELEQ
                     RFAHFRVFQARLLSRPTPASTPPSFSSMSSSLVRSPRATSVMDFGGGIYGNAAAQISS
                     GAHGPGIGSSAGVAGYTGGGEQRGPLMQSTAPSPCPAAPTSGPPSAAGATGAPPPCGD
                     WPTTITEYSVNRGDIGGCAPALPGPWVSDGNGGTTSFRSAECSAFSARKGFSWEAYEQ
                     QVDPEALSRDALSRTAHVELPVNPTHQYGGERFPWSAELRRMMREVFGLHDYRFCQLE
                     IMNACMDGRDVFVLLPTGGGKSLCYQLPALMPNPAQVTIVVSPLISLIQDQVYALIAN
                     DIPAMALTGQTNDAARRSLFQEWASGHVVHTLVYVTPEYFGRSDHFVGTLQGLADKGL
                     LCRFVIDEAHCVSQWGHDFRPDYRKLSVLKRQFLRTPITALTATATDLVQQDVIKTLA
                     LRDAIIFKGSFNRANLKYSVQHVRGKQVIPVVEDLVLHRFSPSSCGIVYCLSRKDCEE
                     MAAALVRRGIKASYYHSEAASKNERQERWTRDELQVICATIAFGMGINKPDVRYVVHA
                     AMPKSIEGYYQESGRAGRDGLPSECVLLSTTTDRQRQERLIHGSKDWRASLTSLHRML
                     AYTLNDVDCRRRQQLHHFGEQVDVHFCLTQRAAAGGGAMPPLPPTSAASVSAVTQLCD
                     NCASKLAEGWTVKEVDVGNILLDLYAIILRLGTMTSKQLIGVYRGSVSEIGRAVEMRM
                     RVKGTPAEYKTGAKHSKVLLDRTLLEGMHLGLLEERLDSINDFAVCAFVELGGTPAAQ
                     QLHRDIKAGHRVITLRLRDVKARSGKGDASFGAVASAVSGATAKDDMPLVELFDSAQR
                     QAAVGDGRGTRASAAAPEKKRRKPAAKKGRRGSRYVLDEADGSTDDDEGAISSIEEDS
                     AMSNSMASFIDDESGSTATLSYISSVTTPQRDGTGASAAAAGRRQRTSLTARSQDGVF
                     STLSEDTQGQPQVHRPPRKRTRGDAADQRAAVAQRGLGGAAAALAAPASTVPAARLER
                     LKALLQEEMDRLVQTLVSQAVGCRSYNVMPKSTILRLTETLAIPGWGSVGDLIDLEGM
                     GKNKVKRYGADILRVYRHFRYIHIGDVEELSEAEAAEVKDVKTAVRPRNRLGRANASA
                     GELIAENDGEEECGGDGDRLASTTASGFAGGIDIEAGAMTGRATHQQAQRPILLDPAT
                     PEKARASVSSAAGTPSRDSGSGVALPGTLGDQPRQRRTMFTFSSTTAAAPAAVSISIG
                     SRSSSPRLSLQAHEGCAAAPPLPPPANPAAAVNGAADSYDQLTCDPSVANAHGNTRMI
                     AAPGAGAALPPHEPHPHQLPMPQFSAPLFPEPPAWQTPATAAAASVVPISGTPAPLLL
                     PHNSTAGRNAHLFSPSAPSFASASALLGGAGLPMAQRPCPQVPQQPSTMMTLAAPSDA
                     VRGGDPSLADTLRGSGQTGAAHAAENSELLIGSSPIPTQQQQQLRHTYFSNCQSAPQT
                     LSGSVGETGEGQQSSSGVVLLGADGPTQGPWMPPTSTAGRAHDAPPPPPPHAGKDMHS
                     VEYLMGLCNDARSRTPLSGRPSGSATRGGGGPSRSTMPVPARSAVYSTVAATANADHA
                     VSHSLPCPTAGGRPLGSGSTLSSSCAEESISFSERPLFQTSTPESAPQPKLQKQEDGA
                     AAGGDNGAGRDRQEVFTVDDDSE"
     gene            <570376..>570876
                     /locus_tag="LMJF_24_1540"
                     /db_xref="GeneID:5652321"
     mRNA            <570376..>570876
                     /locus_tag="LMJF_24_1540"
                     /product="putative adaptor complex AP-3 small subunit"
                     /transcript_id="XM_001683619.1"
                     /db_xref="GeneID:5652321"
     CDS             570376..570876
                     /locus_tag="LMJF_24_1540"
                     /codon_start=1
                     /product="putative adaptor complex AP-3 small subunit"
                     /protein_id="XP_001683671.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652321"
                     /db_xref="GOA:Q4QAH7"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR016635"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="InterPro:IPR027155"
                     /db_xref="UniProtKB/TrEMBL:Q4QAH7"
                     /translation="MIKAVLIINTAGKIRLLSFYEKTISLAQQQELVRSIHRAIARRG
                     DALCNFVDNFKEWPTPDTRVIYRRYATLCFVFVTDSSESQLAILDLIQVFVESLDRTF
                     ENVCELDLIFHSEKVQYTLMEMIMGGMVLEMSRDEIIRSLGEMNRLSANTVAENSTSR
                     TLSGYH"
     gene            <571532..>574423
                     /locus_tag="LMJF_24_1550"
                     /db_xref="GeneID:5652322"
     mRNA            <571532..>574423
                     /locus_tag="LMJF_24_1550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683620.1"
                     /db_xref="GeneID:5652322"
     CDS             571532..574423
                     /locus_tag="LMJF_24_1550"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683672.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652322"
                     /db_xref="UniProtKB/TrEMBL:Q4QAH6"
                     /translation="MYVMQQHAQEAEALNVHLLDDASQLTELGQYLPAHIFGTVLPLV
                     GDEIASGAAELNAQVEGTRQLLLQSAVLRRSTVLAPLLKQQLVTRAVQLQRRRAQLVQ
                     QLQRQIRHWRSASPGAGTASASSGGGPYRRDGPLRGSAAAAPAHTGEGALRETWATLR
                     EAFRFEEGKAHLVQAPLCPSAAALRALLAEVVAGGQRGLHRRVVEQVASTSPHHGQSP
                     TTASPFTGALGSSPKGDHDADVGGSGGSAEDAIEAALQLLLRYTRQARAGETRADRTA
                     ARGRAPRSGASLPTPASSVPLTGATAFRASEADGRLQAADLTGVCNVDVCSDDAEEQA
                     QDAEEDVFESSPALQHQSATTSAGEASGSGAASPPTRTTSAAGAAPEEASVWLRVPGI
                     LPLGQYCAELPWVADLADQRYTAARERKKHGNGGAGEVGYTSRHVQPGEQGSGEGVEG
                     REARYEAGYIAPTPAALQTMPPLGYFFAPSLAGGSVGSSCSSGESVVGRAMRHAVGGA
                     AGAPCAAPANFHADREGSSSAQEEERTWLARVVVKCVSAAVDAAWQNVEETVVAPFCA
                     QRRRGFASRVLPAKATLAAADTGALARGGEAADEEEEEEVITQFMEVLRVRYAVELAA
                     QVLAARHATELLLDSEDSVIFAERRLVSFVVGGGASAAAVCGGGRGTAAAQRASPFPA
                     PVLTCTVLSLPGVKEIFYVMAYCTGAALLCDVAAATAAFGDDVGGRWGGAGARQRQEY
                     LMVDVDAEESEEEDQQEEGHLVKHDNRLTDGPRRARSPSAAQRADLANEEDPVSRRQA
                     ALQAWATFFEAEYLRGCHTTVTFANAPWSAGPASVYSSWSLAPYYRLWLYMWEYVLVV
                     EAPAPSSANPLHSGGAGLTQLPVALRTARRWMEKVIRASVMHGCAEAGLLVSSATPAS
                     LAYEPTACLQAHLSVEQTERLMKATTVQARHALLQVSGAGGGAGTAPTH"
     gene            <575220..>577022
                     /locus_tag="LMJF_24_1560"
                     /db_xref="GeneID:5652323"
     mRNA            <575220..>577022
                     /locus_tag="LMJF_24_1560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683621.1"
                     /db_xref="GeneID:5652323"
     CDS             575220..577022
                     /locus_tag="LMJF_24_1560"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683673.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652323"
                     /db_xref="UniProtKB/TrEMBL:Q4QAH5"
                     /translation="MTTMARVDETLARFKGKSPRDSYKQVCGELDVHMQREIYAALPE
                     KPMAWHHIYTLDLEKALLGTKGCMAMLPLITVSTSMRKLSLRSCGLSDEFVIQLCAVL
                     QSHPSLRSVDISDNELVTVYSAPHIISVMRNNSNMVLFDVYNTHVGSNVGDIIAKLGQ
                     RNLDNVLHYYEDRYFRMKNLFNYMDADGTGWVVLKSLVLNCPYPVLQEQFVERIATKQ
                     PRKRSDNTISINTFLQLVYMNYKTEAEIGTYSNKTIDEPYVFMVANWKQLLYAVERYN
                     ARAAAMGDGQGPHPPVQLPDNFHRWRLRDYIITPDDADALVEGAVQLIEHSSAMAEGE
                     PELNESGERAEPDAEVDSDKETAENAAEAAPLVIPITILLRAAKSVLVLPPSVAKPSY
                     SFYTDRDAAYVPEILRNGSRLFSVSRLSCLFSGGASTTGDSASSPDVLQDSADRPHTF
                     SLPASVVKMVVDFFNKEHKKLPTKKQSMIPDSPQTRRDKAMEKAAIPVPTFLSAEFVS
                     DLERVCPRFLADYYSRHALLIEDGTITLQEMVNVLDEMYAQCRIDRIISLADIKAMPD
                     PMKDKSLVSFVTAHFADRDEDISFLEPFNDVVAY"
     gene            <587425..>589503
                     /locus_tag="LMJF_24_1570"
                     /db_xref="GeneID:5652324"
     mRNA            <587425..>589503
                     /locus_tag="LMJF_24_1570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683622.1"
                     /db_xref="GeneID:5652324"
     CDS             587425..589503
                     /locus_tag="LMJF_24_1570"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683674.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652324"
                     /db_xref="GOA:Q4QAH4"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4QAH4"
                     /translation="MQPTQNPTQTPQQDPLPDLNTLATNAFFPFPSAAGAASAEGGQQ
                     QMATANLYGASQLESIMKASAGDGKSASTAPEPAANNLLGRLTVSTLAAQSATPGTSP
                     QSQPCPVPQFTPLGAGACSNASRSSAPSYSSASVPIGCGPQMCSGDTSFLYPNFVNEM
                     SSVTPPQSVQGHTEGFVAGVTTPPAMPMNSSTMSNKGGSMNDNTSTSLSQATSSGIAT
                     SSGQPNDVEVRSNLFVCGLPVSVRDKELLELFEKHGEIESAKVMLDIHTGRSRGIAFV
                     KFKNVEHAENAVDALNGTTVNGHQITVRVANSRAAYLPGNPTNKTFVRNVPLTVSRTT
                     LFEYFAQFGEVTDLSIKSDTAQGRHNPSGRSASTTEDGADDKLNIVFITYSTKEAAAK
                     AAEATHTKTPFKECNGVPLLAKVAEDTVRRMERLSRRQRPATGAEGTREVSTSSSSTN
                     VASMSRFAAPSMGAALPTGMMMPPMMPMAGSFPPGTFVSVPTMGNTPDLTAPTMMPAS
                     VAGDHMTALRDASGNPIYSPAQPNPATATGGMAYAMPGNMAQPSIFFSAQPPPPAINQ
                     SPPQQSQQQPQAQPQTLYISTPNGFVPAPQQHQQQQQLPQPPPPQQQQPLQFFPAPPL
                     LPQVPQQSQQTMPMPGAAPGQLVYMQTPNGSMMPVMYGGAQPATASMLPTQQMNPYFV
                     MMGGQPPSNQ"
     gene            <598591..>599781
                     /locus_tag="LMJF_24_1580"
                     /db_xref="GeneID:5652325"
     mRNA            <598591..>599781
                     /locus_tag="LMJF_24_1580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683623.1"
                     /db_xref="GeneID:5652325"
     CDS             598591..599781
                     /locus_tag="LMJF_24_1580"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683675.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652325"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="UniProtKB/TrEMBL:Q4QAH3"
                     /translation="MILEGAPVTGLTLLISAVSSSMVRGQHTRYRNMAFAPDTLAAPL
                     TCFALAKRLLLQSIPIGPLGISVMDIFLAINLLYQFRTLERRWGSNTYMAFLFTSAVL
                     GVCTVQLFVTESGSKQLSIDAVRILSAAGTIVPLAALLTCYLREVPSRSTLAMRIPGT
                     NLIISEKALTLLPLMKLVLSPSTQLQAQTFRRAAVEADVGVWTRLWLALVGAIFAIMS
                     TRSRVVRWWLTVFTRYICRPLLRFLRPLTDVLFGPSFTVDHAKPRNARHHQGGNGSFQ
                     LGIGGARAGFDGADDAGVVDGGRYVVESLTGGDALQEVRARMRARRHGAQPQQQGSRG
                     GAVAAGAAAQARRRSPQEEAARNEAIATIEAIGLRASRDEVIAALDMTGGNLEMAVQI
                     LLGN"
     gene            <600667..>602337
                     /locus_tag="LMJF_24_1590"
                     /db_xref="GeneID:5652326"
     mRNA            <600667..>602337
                     /locus_tag="LMJF_24_1590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683624.1"
                     /db_xref="GeneID:5652326"
     CDS             600667..602337
                     /locus_tag="LMJF_24_1590"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683676.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652326"
                     /db_xref="UniProtKB/TrEMBL:Q4QAH2"
                     /translation="MDAAIAQLRGCLEELLTYYPHVLRNVFEVEPSPLAAPKLSQQRP
                     RDSSALADVIEDFLTELTRVLSIGLCDDDLGLWSVLELLECVPARMQAVAEATATAPE
                     TAALSKHGAQEPLQQLQRFRFASQLVYLVRSAFPATAPAVRARIFLRLTLNQGCLVAA
                     LELLREWCRSELLVFYAASDRGRRNGAAGSASSVALLVQSDTDSDMWNSFVAAIAPVA
                     GPPVAEIAAGAPKVAAQPFHLQLLVPGLDDNSAASHAYYTQVENYACGRQPTRPSALA
                     CYRAALRQHSGSARKHDRSFRAASAGEGAASSPKLSPHPAEQLVLRVESLSVDHRTAS
                     GKEVAPVSRGNVSYDSSSTLSSRPMTLEPLSFVHRERLRGAKKRRRRHPSLSTAGAVA
                     REEDAAGSPTPEGKTDNTTSDNTGSVAEAALHTSTVVTEAKECQGAPEAGEKAAPPYR
                     DDYASRDDDPQVAPTVGETGAAQAASRALDTVSTDSPASAPHCLSPALRAAESPNRTL
                     DSSSAPALSPELRNLQHRLWLCWLAVVTHAESEERIRITVRDVDANIS"
     gene            <603513..>603704
                     /locus_tag="LMJF_24_1600"
                     /db_xref="GeneID:5652327"
     mRNA            <603513..>603704
                     /locus_tag="LMJF_24_1600"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683625.1"
                     /db_xref="GeneID:5652327"
     CDS             603513..603704
                     /locus_tag="LMJF_24_1600"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683677.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652327"
                     /db_xref="UniProtKB/TrEMBL:Q4QAH1"
                     /translation="MSRSQQINDSAAEAMRRADDAAAESPTEESHPESGATQQQQQNE
                     AAAEAMRRADVAYTMDDDM"
     gene            <605064..>605423
                     /locus_tag="LMJF_24_1610"
                     /db_xref="GeneID:5652328"
     mRNA            <605064..>605423
                     /locus_tag="LMJF_24_1610"
                     /product="putative ring-box protein"
                     /transcript_id="XM_001683626.1"
                     /db_xref="GeneID:5652328"
     CDS             605064..605423
                     /locus_tag="LMJF_24_1610"
                     /codon_start=1
                     /product="putative ring-box protein"
                     /protein_id="XP_001683678.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652328"
                     /db_xref="GOA:Q4QAH0"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR024766"
                     /db_xref="UniProtKB/TrEMBL:Q4QAH0"
                     /translation="MSAEPTSTTAAASNAAPPQALMPGGRQLFTVEEFYPVYFSAWER
                     ETGLCSICCNQVEGPCVVCQSNAEATSAECSITWGECGHAFHTHCIEKWLKTRPVCPL
                     DNKEWKDRSDWNTSATV"
     gene            <606523..>607584
                     /locus_tag="LMJF_24_1620"
                     /db_xref="GeneID:5652329"
     mRNA            <606523..>607584
                     /locus_tag="LMJF_24_1620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683627.1"
                     /db_xref="GeneID:5652329"
     CDS             606523..607584
                     /locus_tag="LMJF_24_1620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683679.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652329"
                     /db_xref="UniProtKB/TrEMBL:Q4QAG9"
                     /translation="MKLDYFEGIFSHARQSLNNIVSTERQRIFPRSSKAAEKLHKAPS
                     RLTPSQRRLTIGAAVVVGAITAYATVSRLFTLFERRRCLRLIQQCEARETELFLFILP
                     RSPWAPSLSPACTRVETFLRANGIPYTAIETIDPLGALNGELPFLIYKRQRVDQLPKM
                     MELITSEFNVAMDSTLTRDQRAIGASLRCTLEYSVERLLYRIVFIDHASLAVAQIARA
                     LHMSHLRARLAVRGYVIKLKKRLAITAYGSLVSKQCENEFLQDCEAIEAQIGHKRYLF
                     SDTTMTSYDCAVYALLVSFAYMGSHASLSAACSTVADSAVLMAYINRISKRLFSDIGS
                     GFDVARISFSTSCMDRSDD"
     gene            <610671..>612494
                     /locus_tag="LMJF_24_1630"
                     /db_xref="GeneID:5652330"
     mRNA            <610671..>612494
                     /locus_tag="LMJF_24_1630"
                     /product="putative succinate dehydrogenase flavoprotein"
                     /transcript_id="XM_001683628.1"
                     /db_xref="GeneID:5652330"
     CDS             610671..612494
                     /locus_tag="LMJF_24_1630"
                     /codon_start=1
                     /product="putative succinate dehydrogenase flavoprotein"
                     /protein_id="XP_001683680.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652330"
                     /db_xref="GOA:Q4QAG8"
                     /db_xref="InterPro:IPR003952"
                     /db_xref="InterPro:IPR003953"
                     /db_xref="InterPro:IPR011281"
                     /db_xref="InterPro:IPR014006"
                     /db_xref="InterPro:IPR015939"
                     /db_xref="InterPro:IPR027477"
                     /db_xref="UniProtKB/TrEMBL:Q4QAG8"
                     /translation="MLRRTFTRLALSRAYPVIDHTYDCVVVGAGGSGLRAAMGVAASG
                     YDVACISKLYPSRSHTIAAQGGINAALANCEEDDWRWHVYDTVKGSDWLGDQDAIHYM
                     CQEAPCVVSELESMGLPFLRTKDGFIYQRAFGGQSIHYGGKQARRTCAASDRTGHAML
                     HTLYGQSFQYGVNFYNEYYCLDLIMEDGCCRGVMAMSIDDGTIHRFKSKYTVLCTGGY
                     GRVYFTTTSAKSCTGDGTAMVARAGLPAEDMEFVQFHPTGIYGPGVLITEGARGEGGY
                     LVNSEGERFMERYAPKAKDLASRDVVSRAITMEILAGRGCGPKKDHVMLQLHHLDPAT
                     LHKKLPGISESAHIFAGVDVTKEPIPIVPTVHYSMGGVPTLWTGEVVSPRNGDDNAIV
                     PGLLAAGECACASVHGANRLGANSLLDIVVFGKSCANTVIFNLTKEGRKQPELRADAG
                     EASIADLDRILTNKGDIPIARIRERMKETMALYAAVFRTEENMQTGKKIIEECYRDFS
                     HAFVHDKSPVWNSNLIEALELRNLLTNAMMTISGAVVRKESRGAHARDDYQERDDHNW
                     MKHTLAYLDDANGKVRLAYRPVHMEMLTNEVESIPPAKRVY"
     gene            <617712..>619451
                     /locus_tag="LMJF_24_1640"
                     /db_xref="GeneID:5652331"
     mRNA            <617712..>619451
                     /locus_tag="LMJF_24_1640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683629.1"
                     /db_xref="GeneID:5652331"
     CDS             617712..619451
                     /locus_tag="LMJF_24_1640"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683681.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652331"
                     /db_xref="GOA:Q4QAG7"
                     /db_xref="InterPro:IPR013120"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR026055"
                     /db_xref="UniProtKB/TrEMBL:Q4QAG7"
                     /translation="MSLDIRAGFSNRTVFATGGTGLVGKVLLYKILKEFPDVRRVYLL
                     MRGKRSRRLKKYLNAQERLDLEVLGSPCFEPLRQQFGDAKWQELCQKVKAIQGDITLD
                     HVGLSEEDRATLANEVNFIVHLAATVNFNERLDLAFQMNTLGGLRVLALAKTCRHLQA
                     MVHVSTCYVNYRRKGRHLVNEERLYPLGFDPEEMCKRVLAMNPNEVEIESAALLKEHN
                     FPNTYTLSKCIGEQLIYKYKESVPIVIVRPSIIGCSYCDPFPGWVDALTAAGGLLLTA
                     SLGVVREVLCDKNLIADVIPVDYVVNVILKALFKTQHHYKARRLRAAATESGEAGTPA
                     QAAAGAVRSSAVPVSVDAKAGAGGMNVETGSAAAAETSTLALVESPATDDLAGSGTTE
                     ADEGLPFIYQAATSSSENRMTWGRVHASIVDFMRGKRHPKGISSMKVTMTTNRQYYRI
                     RYYLLRYMPYIALRSLMQLPPPIGSPKKLELVKKLGRAVRRADLLTWEFLDFTLSEWI
                     YAFVNASHLDDELNEYSRKTFSFDPYSINWYTYAQVYAYGIFKHIIRETGDFEIPKLP
                     PSATEVFERASSL"
     gene            complement(621294..621394)
                     /locus_tag="LMJF_24_snRNA_01"
                     /db_xref="GeneID:12981304"
     ncRNA           complement(621294..621394)
                     /ncRNA_class="snRNA"
                     /locus_tag="LMJF_24_snRNA_01"
                     /product="term=small nucleolar RNA, U6 snRNA"
                     /transcript_id="XR_002460465.1"
                     /db_xref="GeneID:12981304"
     gene            621492..621563
                     /locus_tag="LMJF_24_TRNAGLN_01"
                     /db_xref="GeneID:12981308"
     tRNA            621492..621563
                     /locus_tag="LMJF_24_TRNAGLN_01"
                     /product="tRNA-Gln"
                     /db_xref="GeneID:12981308"
     gene            complement(621777..621858)
                     /locus_tag="LMJF_24_TRNALEU_01"
                     /db_xref="GeneID:12981309"
     tRNA            complement(621777..621858)
                     /locus_tag="LMJF_24_TRNALEU_01"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:12981309"
     gene            621944..622017
                     /locus_tag="LMJF_24_TRNAILE_01"
                     /db_xref="GeneID:12981311"
     tRNA            621944..622017
                     /locus_tag="LMJF_24_TRNAILE_01"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:12981311"
     gene            623339..623412
                     /locus_tag="LMJF_24_TRNAILE_02"
                     /db_xref="GeneID:12981310"
     tRNA            623339..623412
                     /locus_tag="LMJF_24_TRNAILE_02"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:12981310"
     gene            complement(<623934..>625538)
                     /locus_tag="LMJF_24_1650"
                     /db_xref="GeneID:5652337"
     mRNA            complement(<623934..>625538)
                     /locus_tag="LMJF_24_1650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683630.1"
                     /db_xref="GeneID:5652337"
     CDS             complement(623934..625538)
                     /locus_tag="LMJF_24_1650"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683682.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652337"
                     /db_xref="GOA:Q4QAG6"
                     /db_xref="InterPro:IPR029582"
                     /db_xref="UniProtKB/TrEMBL:Q4QAG6"
                     /translation="MSGGPNTVAVLPSLRKSMTASAVRGQRPRDGVSALAPPANSNRV
                     NIVGGYEARSKPVSGHPGTLRKSRAGTSDEAFLASLVGTDLASAKAAADAYYTQYKEK
                     ADENAMLRAALRQQEVDSVQVVQFLESKLRELETEAQTYKAGITQLLDNHRRAEEELQ
                     SKYGEMLRERDVELARYTSVTTKLHDDLRQASRYVQQRQEHTVELQQLQKQLEDLVVE
                     HEKEVAALHFQTVDRKLKLIALEKTMRAEFDELVEARAARALEERFQSVLERTRRLEE
                     EKASMTHDIHNLMQLTTDIDAERVQVRRHAAVQQQAHKELAHHALARRQQKEKADLKI
                     YELEERVGELTAQQQVVRAELQENYQSRIDALEAELKSTRTSLQSHRAELQRMRQLTA
                     RVVAERSELENFFHTALADCLRYRHDMSASYHVSTAASVTSASKGAIPLGNVDSGGGV
                     SGGAASRQTAQEFAPPIAAVASPAPSSPAATLKNSGVFFEELSWKDKEKVIKSLLFFF
                     NANYYKSSSPAPTMTGGSPREDACPS"
     gene            complement(<626325..>627881)
                     /locus_tag="LMJF_24_1660"
                     /db_xref="GeneID:5652338"
     mRNA            complement(<626325..>627881)
                     /locus_tag="LMJF_24_1660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683631.1"
                     /db_xref="GeneID:5652338"
     CDS             complement(626325..627881)
                     /locus_tag="LMJF_24_1660"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683683.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652338"
                     /db_xref="GOA:Q4QAG5"
                     /db_xref="InterPro:IPR001537"
                     /db_xref="InterPro:IPR029026"
                     /db_xref="InterPro:IPR029028"
                     /db_xref="UniProtKB/TrEMBL:Q4QAG5"
                     /translation="MIALSRCCLRYVPRRPPAFGTVVGGGTRPRRTGAPAPRQRNQET
                     AANTETVAEAEVVAASTSTWEDAKRAAADLPHRTQTSPPPHLQPHRAAASTSLPPHQR
                     FRTLSKPVVLEGVQDTYAITPTQEVHGQQLWTATKVLRSSKHIRKADATCVVGGASAI
                     RRIWRTYNIRPNVVYVPNTDSGVPAWCLEEELPTVIVRCSPVAVRRHLLSAEYSDGYA
                     AEFPLPVNCIRDATALLAPPPVPAQSETAVPSTGDASSSLSSKLSATGPPAAHPLHDP
                     FGHHAVGAMLVLVGLRIPSNVGTLLRAAADMGYDAAVLVSCADPTQEKVLRASDGTAL
                     SPTLRIYETETTEQACVSLLSSIAAQHNLMPFLAVPSQEVEPAFEVAKRFHVYNAKNK
                     EASTSQVGGGAAAGHSDGLCAPPPRQLGAMVILGSEAQGLRDLNGRWGVPYQLVTLPL
                     PNPVVDSFNVSVAGSVLMHLFRPSAASHFTRLVALSGEAVGDLLPTPVGDDDGSDKHA
                     ETDEAEASPL"
     gene            complement(<628489..>629313)
                     /locus_tag="LMJF_24_1670"
                     /db_xref="GeneID:5652339"
     mRNA            complement(<628489..>629313)
                     /locus_tag="LMJF_24_1670"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683632.1"
                     /db_xref="GeneID:5652339"
     CDS             complement(628489..629313)
                     /locus_tag="LMJF_24_1670"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683684.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652339"
                     /db_xref="UniProtKB/TrEMBL:Q4QAG4"
                     /translation="MLRPTRVSRLVRSGSVALTPSCWTTKPAGWYLVPSSTLPATEEL
                     RVGKCFDFLNHSAQYLFLGQVMALAEEVKCIPWLEWFYSELHFSLPPTKEAELLANYM
                     NDQERLRCGLRNHSEGGTSSSDIAWSRELKERVQRRAEEDFCWLLTHDQRKTEKFLQE
                     TFIQWHHRADYLVTRKSREKREFREDLTLQKVIQQGQERKRRMQRRRNRDEARQEAIK
                     SGKESEWDNFTHDVLPRELREALDRESDGMEDVRLSRAGTATGGWSRSMRSHPNFR"
     gene            complement(<629932..>631272)
                     /locus_tag="LMJF_24_1680"
                     /db_xref="GeneID:5652340"
     mRNA            complement(<629932..>631272)
                     /locus_tag="LMJF_24_1680"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683633.1"
                     /db_xref="GeneID:5652340"
     CDS             complement(629932..631272)
                     /locus_tag="LMJF_24_1680"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683685.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652340"
                     /db_xref="GOA:Q4QAG3"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR007198"
                     /db_xref="InterPro:IPR012170"
                     /db_xref="UniProtKB/TrEMBL:Q4QAG3"
                     /translation="MLRTVLLLDGSDAMNSSSDYLPNYLLAMRPPLLRFVERYLDSTP
                     LASLGVVVMRDGISHRLLPCTTNRNEIVDVLERDVFLHGGSGNTSMENGLRMAMSELV
                     DMREVAALAAATAKKSSSVAARNPRAAWKGSATQLNVIVLTASVTLIDPTDVFAVVNI
                     MAVLSIRISVVSLVGAVHVFDVCTVETGGTLYCPLNYDHLLHIMDELSTAHRAQVAVA
                     RKKRRQRGACRQRVKRCREEDDEDVEVDDDDSDGADAPYLIPIGCPVYLEAPLSDSAE
                     PSPAASSRSFYLGCPQCHLIQLTVPTTCSMCRLLLCSAPMLYSTFVSHNSLVPPAKVL
                     RVMRDASPPAPMADNLSAAATATAQEGGVVKTTMQQPVRCGLCMTSFIAEVMMGHARN
                     GGVGNPVSSSATATFVVDGAQVWQCSACASYRCNACNDFVLHTIGLCPYCLALQ"
     gene            complement(<632566..>633705)
                     /locus_tag="LMJF_24_1690"
                     /db_xref="GeneID:5652341"
     mRNA            complement(<632566..>633705)
                     /locus_tag="LMJF_24_1690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683634.1"
                     /db_xref="GeneID:5652341"
     CDS             complement(632566..633705)
                     /locus_tag="LMJF_24_1690"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683686.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652341"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:Q4QAG2"
                     /translation="MSVNAIKAAWHGAAELKRHCNHVINTLGPQTPPEAFLYRGNAYY
                     ALGQPYFALADYNTAASVLRLSGEHQRRCSKALESFPATQTGVYPSTDSHLHIFVKPM
                     LSKSCAIETVNEHVGRGVRATENMPRNSVVVQPTSPWLLYPTDEGLCSYCGTSLPERH
                     FACTNDDCHEEYCSRDCRQEAMAHYHAAVCRNKDYQSIELDVFAQMTEAAKAGAVAER
                     NAAAAQLLVLRVLSTGMQKHVVPSAMGQVRILSGRLTFSPQVLAGSMLHLYERLTRAL
                     HIATIVPYEEMIGVLARITANCFHRDGTVELNLPRSMLNHSCAANVAEDGQTGAMITT
                     RDVARGEELVINYYPLLKDLPYAERTAELERRGFRCMCAKCQRRE"
     gene            complement(<634549..>635958)
                     /locus_tag="LMJF_24_1700"
                     /db_xref="GeneID:5652342"
     mRNA            complement(<634549..>635958)
                     /locus_tag="LMJF_24_1700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683635.1"
                     /db_xref="GeneID:5652342"
     CDS             complement(634549..635958)
                     /locus_tag="LMJF_24_1700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683687.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652342"
                     /db_xref="UniProtKB/TrEMBL:Q4QAG1"
                     /translation="MPPANGSVKEDPVAFEQSGITGRNKVRENGISYTSPGGGEVYRD
                     GTASGFVRSIYEYLVDEHHRPSYSSTMIRGPDLHTRPPAWLEDKNTAIDGSPLTSVER
                     NAPGYWSTVYKKELEVAEAIQEVKRQRRYEQDNDLVGFINRARRYFGLSPQLDEAAAR
                     SQVESRYRLEDEARRLRASTAPGASDDEVAQGEEDCDTSSSPHPIGTLPRNGTAQLLA
                     NVPQQRRSEHGENGVRHTGGALTAPWLALMESIETGRPLTRVANEYRPRVDYYGLDPF
                     LDSAPSVVWFSTKCGIAIGLAHGTAKAVQAMNVDVQFLKASGVGVLSILNMSVFASVV
                     KWGGNMTIFACAFCVGDRLMRWIKSRMLPSHDAQCRSTSNYVMGLSFSGAMVGVLPWW
                     VLNDTGLAMRMAASGLAVGGALGLMVGLSVQHLVALNTARLDANNRQLRRYEALLARQ
                     REWAEQVRSKYTSSAYVWW"
     gene            complement(<637593..>638171)
                     /locus_tag="LMJF_24_1710"
                     /db_xref="GeneID:5652343"
     mRNA            complement(<637593..>638171)
                     /locus_tag="LMJF_24_1710"
                     /product="putative ubiquitin-conjugating enzyme e2"
                     /transcript_id="XM_001683636.1"
                     /db_xref="GeneID:5652343"
     CDS             complement(637593..638171)
                     /locus_tag="LMJF_24_1710"
                     /EC_number="6.3.2.19"
                     /codon_start=1
                     /product="putative ubiquitin-conjugating enzyme e2"
                     /protein_id="XP_001683688.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652343"
                     /db_xref="GOA:Q4QAG0"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="UniProtKB/TrEMBL:Q4QAG0"
                     /translation="MSLARLTRERKQLLEAQQCGETAPLTSANTTAASVNSFNAAQGR
                     IRADMQKLDGVMSEVKMDSMDWYVVHVSYTPVRGIWKGGTFNFRLVFSNDFPYSGPKV
                     RYTGPRRIFHPNIEGDDSKEDWGVCLGMQTEWRPTCTIKDMVVAIEMLFALPNYDDPL
                     PGVAKTAAQILKDEPSRFELIAKRWMGGNYII"
     gene            complement(<640161..>642677)
                     /locus_tag="LMJF_24_1720"
                     /db_xref="GeneID:5652344"
     mRNA            complement(<640161..>642677)
                     /locus_tag="LMJF_24_1720"
                     /product="putative cell division cycle protein"
                     /transcript_id="XM_001683637.1"
                     /db_xref="GeneID:5652344"
     CDS             complement(640161..642677)
                     /locus_tag="LMJF_24_1720"
                     /codon_start=1
                     /product="putative cell division cycle protein"
                     /protein_id="XP_001683689.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652344"
                     /db_xref="GOA:Q4QAF9"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q4QAF9"
                     /translation="MEFGTPPRAAHATTPGTTAATTETLFASPSSPAPRRPGNATPNS
                     VDSSHLRGPSSRSSPLDQYRRHAQSHARLSPPPLSSQASVDRYVSAPSRQATSIAHFL
                     LTSRERKTPMLIRAAQQQQQYHLAIRSPSRDPSFDVSSSLEDSYNSLVRYAADRSSSR
                     HATVASPRSHRSLPRVGSTAMTPSSARLSSVFAKMHLHPSTTVRSSRERSGSSPSFTG
                     VDTSGGCGGQLGDDGRSSPSSAMELEPYTTKLARTLFSDVEQTTVLPVNDTAARPLGM
                     AARSIGGCGHAEEAEEVSSPVKDGTTGLGSRSAFGCSGARRHRADENDGENDDDALEA
                     DWMCNEEDEQALPSSVAIRRHMASVPARVPLAMSEVNQLGMAEGARFDASLGVVFECN
                     RTRNFTTPSFRVIPHTPERILDAADMEDDFYMNLIDWSATSDVLCVALQNCVYLWDAK
                     TCGITELPRVVPTGGGLHGDGRSGDAQLVCGLNWAPDGCHLAVGGHSGAVEVWDVETQ
                     QIVHTYRQHADRTVSLSWEPLGGWLLASGSRDSTVVLRDVRERDTSTSASVASPSSSF
                     SLASATAVLRAHETEVCGLKWSPTGAMLASGGNDNQLLLWDRRSISTGSHSSDTSGAY
                     RHGECQPIFFLNKHTAAVKALSWNPTQPALLASGGGSHDKALRFWNSLTGECVHHINT
                     GSQVCGVVWNRAGTELVTAHGYTDNQLSIWRYPSLRRIANLIGHTSRVLHLALSADGE
                     TVVSAAGDETLRFWRCFPASELRESSPHLHRSSYKSTSGVSFSSSTYGGGVGMSPGGT
                     SASTSSIARARAVAIASGRCSSLSQDRGSRSLMNEEIELR"
     gene            complement(<646198..>650532)
                     /locus_tag="LMJF_24_1730"
                     /db_xref="GeneID:5652345"
     mRNA            complement(<646198..>650532)
                     /locus_tag="LMJF_24_1730"
                     /product="putative protein kinase"
                     /transcript_id="XM_001683638.1"
                     /db_xref="GeneID:5652345"
     CDS             complement(646198..650532)
                     /locus_tag="LMJF_24_1730"
                     /EC_number="2.7.11.17"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001683690.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652345"
                     /db_xref="GOA:Q4QAF8"
                     /db_xref="InterPro:IPR000433"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:Q4QAF8"
                     /translation="MGCSASTHASPEADKDAPLKRNVYSASRTSDQVVSDRQNSNKDQ
                     PNDACTAVSENPSRARSSSGTEGQAHGRGIGAIHYPNQLGKDECDGGEDEVVVIPSSA
                     DKSTRTRFTFPQRTLLNVGSHTPAGDSGERKLNSTTASSSSFTALQRRLSDGGHAHSS
                     LTTMSPVPPDAKETPLQLTQTRVLQAAATTPTACLSISPPQRLSIPASGFAGSSASAS
                     GAVALPSQKQHQIEPPHVNDGGFSIEWDEEDNTPKGRGIPASTTMDSGPYSVTRGMMA
                     PSGSFGIGVGGGWRSKSPKWIDLSRKRSQSTVSLLSLADTPNNPHVLSSGSDFGRDIL
                     GGSHVFGGLATGGGSSRPQSGYAMGRATRVERFDQQRHSNGLAVFCNQPRECALCRNA
                     TVAFACEVCDDFFLCEDCRFDLEAVRVVHDPTHAMLSIQDNHNNSSRTFGGDSIFSLS
                     GDGGVSSLFYNPCFKCKRVIDDVELVYRCDQCDYIVCQECFIQHEEPENAMERASSLS
                     AAMAAMREEQVSCKPLPIESAALVLASGPTHPHEHELKRFQRKSRSNSVHEGAVVTKT
                     RNSGGNKVINDYVVVRQIGHGSYAKVKLVQHVHTQELFALKILRRQKKVALPGITLGR
                     SRVKAAMAGISEDDLLREIAVMKFIDHPNVMKLKEVIEDVDSQKVYIIMEYCEKGPVH
                     VLGGPALPLEQVRQYGADILRGLLHLHSEFLYHRDIKPANCLVNRDSVVKIADFGTCN
                     SQIRTKLAEGTPAFSCPEQVRGEEVSGEVVDSWAFALTVYEMACGTLPVSTTSFVQHR
                     SLLMSKSPVPIPKIGDEPLRDLLAQMLEKNLSKRLLLPAATRHPFFAECHVDVHGAVP
                     GTAARSIFAVLATSGGGAAVQPQKQQLPLLAELYDKALESVHRGKNLKDCFHGVRALR
                     RVRKKEVETARHSGTNDQVGGGGAGAEKGNAYVMNSRDVYGGSDGSGSDGEDEEDAGH
                     LRVGRCAGHEEEAAAAVEEAVEHHLFTQEPKLELTQVTLTAPATLEKLNRLHQVTAEM
                     RLSHNALVRLAPLRLSTFSMLMDIAVTFNRLETIPQEVLEAPRLVRLDLSHNRIDSIP
                     GSLVTKALFLERLSLHHNLITSVGTTTITVVEPFPVTFRVPTPATATCIGPNTVAVPA
                     ASVVSSSTTRTSLRGRGGSSRSEVVSVLAAPCLRHVRLSGNPLERLPDALETTHKLQL
                     VLDAIPALMEQWDTHMQTDSNATTSTAAAATGGQSRLPAVIVWDDSFPVRIPSVEPAV
                     WLAVNNMAIYRAQTLRLCKTRHVVLCQCADPRFPNGLFLSEELEVYFSVLSKALQDRR
                     EQRQQLAAEAPFSLSAPAEAIPSEALPPIVGKAARNYVESYFFVTDDENEEEGGYHSL
                     VSYLYDSLSANIPVLVVVSSGTSCAVRTNIVAAISTCLTRVRGGDPEQLDAEQAELIV
                     STMRSLYA"
     gene            complement(<651391..>652497)
                     /locus_tag="LMJF_24_1740"
                     /db_xref="GeneID:5652346"
     mRNA            complement(<651391..>652497)
                     /locus_tag="LMJF_24_1740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683639.1"
                     /db_xref="GeneID:5652346"
     CDS             complement(651391..652497)
                     /locus_tag="LMJF_24_1740"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683691.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652346"
                     /db_xref="GOA:Q4QAF7"
                     /db_xref="InterPro:IPR006222"
                     /db_xref="InterPro:IPR013977"
                     /db_xref="InterPro:IPR017703"
                     /db_xref="UniProtKB/TrEMBL:Q4QAF7"
                     /translation="MKPLAPFVCRLPSRRILRVRGTDAHDFLQGIFTNDLRELHPAGS
                     MYGCFLYFTGRVLCDAHLYQCKQVHEGQASILVDVHERSATELLDHLTEMKMRKKVHI
                     DDVGKELVVLAALEETSADAQRSRDSASGCDARESSVTSLSPETLEERHTECFLDPRN
                     DALFPRPPPPSSSSPPAAVTSPSFCLRKCVVPATWAPPLSSPDSYTTLLYSRGIGEGP
                     DVFKCNKSLPFEGNLDFLKGVSFHKGCYVGQELTHRTHVMLVTRKRTVPLHFGPANVD
                     PPAAGIITDEGAVTKTWPVEVGEPLYSAAREKIGEVTGVCGQVGIGLFRLRYVDKATH
                     TVPGLQLKDGTPVQTHLPDWWPRKDVKKLLQNNS"
     gene            complement(<653333..>655549)
                     /locus_tag="LMJF_24_1750"
                     /db_xref="GeneID:5652347"
     mRNA            complement(<653333..>655549)
                     /locus_tag="LMJF_24_1750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683640.1"
                     /db_xref="GeneID:5652347"
     CDS             complement(653333..655549)
                     /locus_tag="LMJF_24_1750"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683692.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652347"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:Q4QAF6"
                     /translation="MMTGSASPDGGDTAHLGSAHPSNQGVCDSSSTSFPLQVKWVDAV
                     TGVGAFAAHPCQAGDRVLWEASSVFAQSYKTWNTCPAETQSHAAEPVSAKDVSKTVDE
                     GAAEAYGAVQHEPCAMGSSPRRKPGHCTPSVSTDDVEQGSRDSRTSEEGAATEKRLQC
                     VRCCFGCGAPLLAFLREECSRLDGLLQKLERSSDVEPGATSPRNINDDITPSTWELIH
                     HANVKHLAQAPGEAPTDAPLPAHYVQTAVEAAATAGSPRPYVTEVDMVGRHHCVYFCT
                     PACETHSLIEEGRRFVLTSRQPRHPPVNGAALEGAEDGMPSAVAAVMASTAPPSAQAP
                     LASLLRYPTADVIVTFAQHPPSIALRLGAWPTRLDALSSLHSVARRCNERIWLLALLL
                     AKHLHFTLASAPVTSTPPPQPQRFVAWLEDTVAPSFRSRLEDMLTSYAEGAMQLLSVE
                     QRALLRFSWHLLTWWWLLCCAEEYTAVVITASSVSGTGSTWLPSSDPRHSPLERLSPS
                     PSATTSEAQVLKWVTEALAVVQSTAFPLQLYLQLYWLTNANAHMYVVASPLYTLWCRW
                     LRSKAKGSDAAGTDETKVAGREDGTTAQAASSVMLLERLYKLFHTSNTGRADAAVGAK
                     AARSPGVENCLHATGVALYDVATKLNHSCVPNVIFQPTMGPVAASVVALRAIEAGEQL
                     FTSYIRVEDFGELTCAVAAALRRRYLKDHYGFECLCPVCTLAVAEKGVIHDKAVSA"
     gene            complement(<656445..>657257)
                     /locus_tag="LMJF_24_1760"
                     /db_xref="GeneID:5652348"
     mRNA            complement(<656445..>657257)
                     /locus_tag="LMJF_24_1760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683641.1"
                     /db_xref="GeneID:5652348"
     CDS             complement(656445..657257)
                     /locus_tag="LMJF_24_1760"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683693.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652348"
                     /db_xref="UniProtKB/TrEMBL:Q4QAF5"
                     /translation="MPLRIGGFNVCCYHDCTNAAAIHAELKRRHIDAAVVDHAFLISP
                     LQLAVALFRVEGSADMLTTRSPFTISPPLAEASSPSPTSTSASPSLPPLLQQQPTRRV
                     SNSRQIFAALSLSHNLDRILQVLPPGPQTTSVVIIYKRSGSARAAAVSFADDVGADSA
                     VASTVPDGDGLDATINACVQLTNSAAQAHTFALITEPFWTGAAFAFADVSKVALFYGI
                     SESMLLAAQRSMTRADVRRVCVGAESQEAPAQVLRWHALEVCVTTLLSACTA"
     gene            complement(<658912..>659265)
                     /locus_tag="LMJF_24_1770"
                     /db_xref="GeneID:5652349"
     mRNA            complement(<658912..>659265)
                     /locus_tag="LMJF_24_1770"
                     /product="inhibitor of cysteine peptidase"
                     /transcript_id="XM_001683642.1"
                     /db_xref="GeneID:5652349"
     CDS             complement(658912..659265)
                     /locus_tag="LMJF_24_1770"
                     /codon_start=1
                     /product="inhibitor of cysteine peptidase"
                     /protein_id="XP_001683694.1"
                     /db_xref="GeneID:5652349"
                     /db_xref="InterPro:IPR018990"
                     /db_xref="UniProtKB/TrEMBL:Q868G9"
                     /translation="MQPKMTAPLTMKDNNKCLSVRVGSTLEIHLEGNPTTGYTWTRVG
                     FVGKEMLSDEHLEVTSKYTPKPVSGSMVGAGGSYTVFVKPLRKGQHAVQLVYARPFEG
                     PKPDNERYTLHLNVE"
     gene            complement(<661159..>665094)
                     /locus_tag="LMJF_24_1780"
                     /db_xref="GeneID:5652350"
     mRNA            complement(<661159..>665094)
                     /locus_tag="LMJF_24_1780"
                     /product="fatty acid transporter protein-like protein"
                     /transcript_id="XM_001683643.1"
                     /db_xref="GeneID:5652350"
     CDS             complement(661159..665094)
                     /locus_tag="LMJF_24_1780"
                     /codon_start=1
                     /product="fatty acid transporter protein-like protein"
                     /protein_id="XP_001683695.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652350"
                     /db_xref="GOA:Q4QAF3"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="UniProtKB/TrEMBL:Q4QAF3"
                     /translation="MLTVSTEGVLEWCLGVQYALRTIGAYLQLGFSLGAVQARHACVP
                     YQLAVYKAACAWRYITAAPEDGPIYLEGPDDESSTQTSTGQAIKIVAPLCAQASGAVD
                     PLLFLAELLAKLDSLAAITHGEAVDVRLLQRLMHQDILVCEQRHAQIAAGVAVPSKSS
                     HASEENIVFRLSETDATYASVVAAGHPTTITYRDLVILITLLSEAIAWDLLWIHEGQD
                     RQRAQQQSKIVDAAAAAPVLLPPPPRPTEADCLALMLPNSVEYNAVWIAAARSGPLHT
                     LLDVLYRNSNSEQPKTERGTYRPCRTALLNTNLASNTMLYRAIECSGSVMIVMDVAYV
                     PLLFCSRTSDDADDESVTSKLELHVPPHVKRIYLWRSTNAAGQPVSSAMTAEMEELLR
                     AFNANAYGNAKSLKAAYASAGDSFVAPPSTPPLDLYNVVQPFFLRAQANPAFTVDDVR
                     HTYLISSPRVRLLMHVILSRPPPSWKSMLALDKPSSAKNGSVEPYATAAGSVKSRQQL
                     QHYKAKMASILSRLLRRFHHTQPILFIYTSGTSGLPKAARFSHLRFFATGFLSRVLHY
                     RDKIAETVVQQMNEVDYVAAHPAAAGAASVPGLPQQQQQSSSSPPTSLTRPPASGKRE
                     TPREKTDKVGMPTVASSIEYHCPAVPHVFGIESLDFTCRERNIVEAALFALWSASLWC
                     LRLFAAALGLEYFVTSAVEQRLYTPAQLAAIEKERRLITLYNCLPMCHTVGSVFCLGH
                     LLHALEEQQHAWAQIRRCAPRHTRLAATVPTVRMIIRTKFSASQFRKDLQRYHVTVVQ
                     YIGEVLRYAVLYERSHSPVQAAPPSADATAETASITTETDALAVLNRTAWRVPYAFGN
                     GLRQDIWLECMRRLNIAHPVEFYSSTEGNIFLLNLFGMPGIVGHIPRFPRPIEWLSMQ
                     YIPFFPFRVLRFNEETQQVYRDPKTGYCSHCDVGDVGEVVGEVIEGFDMFALRRFDGY
                     NKAHHGAAPADGASIGDSSGGTKAKVTAPADQEEDKAARESKIARHVLWPHRNDCYFL
                     SGDLMRTDRFGFCTFVDRIGDTFRWKGENVSTLEVSNALNSVHTTRVGVQEAVVYGVE
                     LPGREGRAGMAMLSLQPRHLCSSSNGCSNTSPSSSSSRRQSLTLAEERHFLQNDLYGF
                     LTGKVRRNGDGTENQAMLPASAIPLFLRMHDLVADDSQDGDNEVISSEVPLNKHAGDE
                     EATRTSTFKYKKGILINQGYEFDGSSTTCAEVPASAWGSNITGDEEATTTSYVRVYVL
                     VSSQAALKELALPPVGSKGASGVPHATGYVPLTAATRAILGANMENCGW"
     gene            complement(<668539..>669204)
                     /locus_tag="LMJF_24_1790"
                     /db_xref="GeneID:5652351"
     mRNA            complement(<668539..>669204)
                     /locus_tag="LMJF_24_1790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683644.1"
                     /db_xref="GeneID:5652351"
     CDS             complement(668539..669204)
                     /locus_tag="LMJF_24_1790"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683696.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652351"
                     /db_xref="GOA:Q4QAF2"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4QAF2"
                     /translation="MDSDLSAEIARIEAELAQDAELRQQQQQLAPQQPPASLFGFGQT
                     APVQPQQQQQQQLFQTQPPQPQQQPSNPFNVNASPFMPTPQQPDYSQQQQQQQQPIGS
                     AGQAAAQASAPTPIIHSFSKDTDSRSIFIGNLPRGTDGTPTTTPEELVQFFADCGNIL
                     NCTVLKDRATGEPKGTAYIEFADYTAMGKAIDTKNNANFKGSTIIVCVSTSPLFSLAG
                     FFG"
     gene            complement(<670376..>670696)
                     /locus_tag="LMJF_24_1800"
                     /db_xref="GeneID:5652352"
     mRNA            complement(<670376..>670696)
                     /locus_tag="LMJF_24_1800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683645.1"
                     /db_xref="GeneID:5652352"
     CDS             complement(670376..670696)
                     /locus_tag="LMJF_24_1800"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683697.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652352"
                     /db_xref="UniProtKB/TrEMBL:Q4QAF1"
                     /translation="MGLTQDQTQRVKTAFLSYAQGQPKVSEAMMDQLICGAIPGLSWE
                     QLQAKKAVRKVGADGYDLGAFFAMVNSDPAYIAFIQQHFPPAPPEQKEPEVDALALKT
                     AKGF"
     gene            complement(<671315..>672637)
                     /locus_tag="LMJF_24_1810"
                     /db_xref="GeneID:5652353"
     mRNA            complement(<671315..>672637)
                     /locus_tag="LMJF_24_1810"
                     /product="putative short chain dehydrogenase/reductase"
                     /transcript_id="XM_001683646.1"
                     /db_xref="GeneID:5652353"
     CDS             complement(671315..672637)
                     /locus_tag="LMJF_24_1810"
                     /codon_start=1
                     /product="putative short chain dehydrogenase/reductase"
                     /protein_id="XP_001683698.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652353"
                     /db_xref="GOA:Q4QAF0"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q4QAF0"
                     /translation="MFHHVSMFEGEHVYHYGRHTFTIMRDSAAMGMIPAGCILGYIVT
                     HISSSLVIPFEVQCVLMAALFVLSRLIAAGRRNRCTKDLTGRHVVLTGGTSGIGKATA
                     AQLAKMGADITIIAKDSPHAAEALLYVRSHAKNSVDQQIHLQPLNLDDFIAVREYCKR
                     ARQSNRSIDILVNAAGVLREKYVTTRFGDDVQLAVNFLGPYLLTEGLLPLVEAAHGRI
                     VYVACAAHVGVKGNVVQTYLSGRGVWSPRVAGKFDGLEQYGLTKLGNIFHAQQLALRS
                     YPVPAKSSVSSRLTRQQQVIMTPGERKQPASRRSGYAAAVEAAAASQASGTVATGATA
                     TVGIEPRFTCCACSPGGVITNLYRSTPFSGTFVYLYYLYILVMRTAWEGSQTVVNCCV
                     RDDFKNGGYYMNTCYQPAGLSKTACNVAERDQVMTWAHNKMKPYMKWE"
     gene            complement(<673702..>675225)
                     /locus_tag="LMJF_24_1820"
                     /db_xref="GeneID:5652354"
     mRNA            complement(<673702..>675225)
                     /locus_tag="LMJF_24_1820"
                     /product="putative short chain dehydrogenase/reductase"
                     /transcript_id="XM_001683647.1"
                     /db_xref="GeneID:5652354"
     CDS             complement(673702..675225)
                     /locus_tag="LMJF_24_1820"
                     /codon_start=1
                     /product="putative short chain dehydrogenase/reductase"
                     /protein_id="XP_001683699.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652354"
                     /db_xref="GOA:Q4QAE9"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q4QAE9"
                     /translation="MLHFGLRGRLVAMSAVSAAAPLNITARRLLTSSGNASSSAASAT
                     STSRSSAGTARASPSSSFASTPSVGRHKAVKSMSSPSAASAAADSIHKLSDDKAEASA
                     YVCSADDVPSYSSASHMGYLMLHSRRLWLPLVLYACYYTLSAYLNPVQAGLYATASVV
                     AQRLSVHGRRNKVHKDMTGYTCVVTGGTSGIGLYTAMQLLDMGAHVIIAAPSGKETET
                     MDFLQRNCRVAAPAATATVASSSASPECEPLENRVTFISMDYMDQLDVMAAAARIKAL
                     AHDRIDLLVNCAGVWKEEPTLTKQKLEEHIGVNFLGPFHFTEALLPSLRKSSHRCGRI
                     VYVTCASHNGVSRGNVVRERMMLLPGPNELQITARCYSASKLGNIYHAQSIANRRYEG
                     IPLNRQSDLHPVDVCCADPGFCFTSLQQANVSPFLGNSIVARTLRSLWIKDAYEGSQT
                     VVNCCVRDTIENGGYYAECALMPSGLSKRAQDPKSRDDVVRWAMAKTIAKYYTVRQE"
     gene            complement(<676124..>676846)
                     /locus_tag="LMJF_24_1830"
                     /db_xref="GeneID:5652355"
     mRNA            complement(<676124..>676846)
                     /locus_tag="LMJF_24_1830"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683648.1"
                     /db_xref="GeneID:5652355"
     CDS             complement(676124..676846)
                     /locus_tag="LMJF_24_1830"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683700.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652355"
                     /db_xref="UniProtKB/TrEMBL:Q4QAE8"
                     /translation="MRLTPLRCSAAAFHFTSLLLQGSGGGYRFFEDMYPKHDPAPRYR
                     YYEDQMQSPTVRSLEPKKQMTETEKLHHLHDWKKDKEGLTPPPEFGWPEEWGPEPGEE
                     GHSEWYRKNRMYMSYEEKSRYDLRVGVPVEKNSMRHQEMPYQKRMKAAYVNLEEKNPQ
                     YFDPRQRKYWAEYSYEDQRDTMAKARDDYIKEWLDEPGVTKENVAKKIGDYNGTAKNQ
                     NVKSVQRRPEWELAPRPEYDDD"
     gene            complement(<677392..>678228)
                     /locus_tag="LMJF_24_1840"
                     /db_xref="GeneID:5652356"
     mRNA            complement(<677392..>678228)
                     /locus_tag="LMJF_24_1840"
                     /product="putative lysophospholipase"
                     /transcript_id="XM_001683649.1"
                     /db_xref="GeneID:5652356"
     CDS             complement(677392..678228)
                     /locus_tag="LMJF_24_1840"
                     /EC_number="3.1.1.5"
                     /codon_start=1
                     /product="putative lysophospholipase"
                     /protein_id="XP_001683701.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652356"
                     /db_xref="GOA:Q4QAE7"
                     /db_xref="InterPro:IPR003140"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q4QAE7"
                     /translation="MTVPIDQLTNAQIKEELRTLYAVTDFADCIEHGDLQKKLQAIRN
                     STPITHGLRYGTLLEIGNKNPTGVVTLVHGLGDSAYGWESVGHELLRRLPHLLFLLPT
                     APSRSVTINGGMPMPAWYDIMDMCNSGLLRGRQDAASVRQSCDYVRSIAHVATKKYGI
                     PPQRVVYSGFSQGAAISLCTGLTAHIAPAGIACMSGYLAACTDVLPRIVQKAVPITMF
                     HGRQDPVVPISAAKETKEILEKDGGVAPISFLEYDMDHSTLPQEIDDITSFLSRVLPE
                     KF"
     gene            complement(<679356..>680594)
                     /locus_tag="LMJF_24_1850"
                     /db_xref="GeneID:5652357"
     mRNA            complement(<679356..>680594)
                     /locus_tag="LMJF_24_1850"
                     /product="hypothetical predicted multi-pass transmembrane
                     protein"
                     /transcript_id="XM_001683650.1"
                     /db_xref="GeneID:5652357"
     CDS             complement(679356..680594)
                     /locus_tag="LMJF_24_1850"
                     /codon_start=1
                     /product="hypothetical predicted multi-pass transmembrane
                     protein"
                     /protein_id="XP_001683702.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652357"
                     /db_xref="GOA:Q4QAE6"
                     /db_xref="UniProtKB/TrEMBL:Q4QAE6"
                     /translation="MQRGQERRLRCRDAVSWSARASVVVLLCALLCGCGLAGAAAEQE
                     PLVLHTSLVDLLNAENALWTVSLGTPNAANPPAVWTAMHEVRVETQPSESAASLLFTL
                     PPPPTSSRHRVEDAEGEKYDEDGAAMGKQSAVPGDDAFTQTQHRQPFGHLAQSFHGVS
                     CEEYRTGGRGQQGTVQGRCFFLRDDGEDFFVRYEVQSAGNGEPKKDSEEAAATKTTAA
                     VRRRQGRAPAKAVASPKATASSSTEASGPESRILRSASASGVWTEHILLGDSAAAGAK
                     ETSAGAAEEHVCVGDVTIDEYIREMADARRSKQVVLKLAIVVPRKTGASADGGQDDLM
                     HVRLECITDALYEAMVRRSTGAVKAARTSFFHRWVWPVLFVTAIYAMLAATARLVAWR
                     KASQGSAASATAGAAKTKQQ"
     gene            complement(680985..681056)
                     /locus_tag="LMJF_24_TRNAASP_01"
                     /db_xref="GeneID:12981305"
     tRNA            complement(680985..681056)
                     /locus_tag="LMJF_24_TRNAASP_01"
                     /product="tRNA-Asp"
                     /db_xref="GeneID:12981305"
     gene            complement(<682699..>684306)
                     /locus_tag="LMJF_24_1860"
                     /db_xref="GeneID:5652359"
     mRNA            complement(<682699..>684306)
                     /locus_tag="LMJF_24_1860"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683651.1"
                     /db_xref="GeneID:5652359"
     CDS             complement(682699..684306)
                     /locus_tag="LMJF_24_1860"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683703.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652359"
                     /db_xref="UniProtKB/TrEMBL:Q4QAE5"
                     /translation="MSDSHQLYEVAGRALPLPPKRTPPRYSTITRSEEQEYRIISRAN
                     SPSRAETLRDGKISPVPVALQRESQLGYRGQAAHPPPEDSKHLAPPTLQKYKAPLNRL
                     TGPSTPQQQSQKSTELELDDLSSCFSSHCNSAPDTNAKMHAASEFLAQGDYATPPHLN
                     MTAIVPEEGSSIDSRPSLNRTKFEAAVAAAEDQDRNAAPARSIEMSRTCRNQAPANPH
                     STPAAAAPASGTRSTAAQSTLSRYSHSKGYGAYSGDPRQHAASTHGAPQKHQQQQPRP
                     QGAAATDAAAHPAAAAASGMGSRRRGVPSHERSPSEASSYRRDKHSARIAPVCYVEQH
                     SRSPVRNNRAGLLSSPVPVDPHLTHEYSQQKIEERRASKSRVVPSSQSTAMVAVSSNA
                     WNSIRTSRNGEDPLEMSVPIAERVNVMSTLTRHCDISASVPMGTLEGTELLPGLPQLQ
                     GHRNDDNADRPYRTIVRFIEYQPQGERPGLEEMLVSYSGHEDVLCSALGEAYGNDFEM
                     LKLVCSRTPAVPLLADCPSVDKRATAS"
     gene            complement(<686043..>689927)
                     /locus_tag="LMJF_24_1870"
                     /db_xref="GeneID:5652360"
     mRNA            complement(<686043..>689927)
                     /locus_tag="LMJF_24_1870"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683652.1"
                     /db_xref="GeneID:5652360"
     CDS             complement(686043..689927)
                     /locus_tag="LMJF_24_1870"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683704.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652360"
                     /db_xref="UniProtKB/TrEMBL:Q4QAE4"
                     /translation="MFYSGWKLLAPAFMNVGALSAELRHSNATGDAAAAYLTQDLLLG
                     NDYTDGSASATPQRQHQQSSAEAAAHMSVSPGDGDDVARHTPSSPSPANKERLCALPH
                     RAHRRRTHSDVAKETGCVLHLAARPALSFKEMEQQLHRRTTGSSDCFHVKSNAPAMFQ
                     AAVVFMECVVTWPSVLQAADAAGAAAGAAERNTNRDNSAVSPTASATSKPTLPALVLG
                     VCQRSLEWYSLPGEAENSVGFYVAQRLIVKNGYEDGDAVKLPDDGRSRVGGSRVNFGD
                     HVGCLIDLVRHQLAFTVNKDIVSTLPLEPSLADGSYYFAIGLARRPQQATDVVVRFYS
                     GAQCLSQDVPLRRGQLPLPHQQQRQLPVFPLAKYVRELALQSVGRCTTFMSGQEGESH
                     IRRSAAALSSEQHPGGGSTVAAAHRNTKGKRPDVHTANASCGRQIPLAPETLRDTRVT
                     AVLRDYLSVRGMTGALQTLDAELHELAPAQSELYATAAGAAGGGPAGPSSSPLSAPVS
                     ARAHPSHVLWRPPTPGEAQEAWQCYAADMSRLRTALLQEVACNADGAPTPPLSALLGQ
                     LMLWRPSLAYAFASVFDSHMAAASAGGGVGASGKHPRSGAGAPMPLSPYDWVRRVVHP
                     SMFTLSMLGLRQDIRYLVQSYQAVEELWGILQTYLRAARAACQQTHADPHGHCPQQPQ
                     RLSFANGKEEVLPAERGTNGSNTTPGTTKSPVSRQGMAGKSSPHHSRIFSNASFAPTP
                     EAERQAQAAFTSYFTQLVWNPARVLPSPMTHVCRAPPLSGGAGAGAAARASSRDALAP
                     ASLDALAALAGRADAGIAPRSERTPSAPYGGRTRRRVGVDVDTDADAEDFRACAAACA
                     ASVRLDTSTAADGNSNASQERHRQPSSQPPQAQQRPLYIAHVEEAILVLYRGAVVPAP
                     APSRSSQVCLLQTLSSLHTHTVSTLRQIERFVRHGGGGIGFADRTALDSIDLLSTLLR
                     TVQHRYRQQVWRRLVHAVEDANQQLEGRLRSWGTVAQQPQRMRPSPSMPSSSQVPPVV
                     IAGPRRWHACLDGWLQEEGNAEDGEGIDRDAAVLEDDEATQRQSPARSLMTGFSSFRA
                     SETPTHEALVARKEGEGDQPSPAEATRQMPAFPSYEDLTTFMPSLRSLWRRVEARAAL
                     EPSFHLVTELFVQELRRSLDLAPALGWRERTSTAPCATSNPGPASSAAVPTEAVASPL
                     VAVKSEPKVMTVKRPLSVASGPSSVSSNTISAPPPRTARPSSMGDAEDDEAAEAAAPE
                     GDEAEVVARWFAEELYLSSMYMKRVFKHMSGS"
     gene            complement(<695194..>697992)
                     /gene="CYC11"
                     /locus_tag="LMJF_24_1880"
                     /db_xref="GeneID:5652361"
     mRNA            complement(<695194..>697992)
                     /gene="CYC11"
                     /locus_tag="LMJF_24_1880"
                     /product="putative cyclin 11"
                     /transcript_id="XM_001683653.1"
                     /db_xref="GeneID:5652361"
     CDS             complement(695194..697992)
                     /gene="CYC11"
                     /locus_tag="LMJF_24_1880"
                     /codon_start=1
                     /product="putative cyclin 11"
                     /protein_id="XP_001683705.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652361"
                     /db_xref="GOA:Q4QAE3"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR013922"
                     /db_xref="UniProtKB/TrEMBL:Q4QAE3"
                     /translation="MASLGAEHKLECKSMVLTLHTLFDIPRDLVSLHSRRESVELVLK
                     PTAKYYSENKRFCKLDLPEQHVAFSPSSIIFKHDRFVLDFESAPPPCGLSFARSSTPH
                     GAASFANSMPSNFVDLLAANTTLTAPGVASSTGKMPLHFESDARAGGALPPKPRLAFG
                     ESVDEDQDVNLRSPGSLKLRTSTTTLSSAMPPNQIVLRYPTRSDLKVIVEVMVGARQR
                     RHDSSAVRWITPSWADRSIPGTISTFAAADGEVMRHKLVNRFVGLTVGHLSCTMELPH
                     AADDLREVPAFAPTAIADAAERLCNDYERLRRFHTTDTEEQLNAVRSERPARLRDFVE
                     QLSTGASEFSIYRGLLLEVCPSFFVRRIRRICAMYPPIPQSSSWVRTDAETLAAEHTG
                     REMSLIRNLCAELGPDLSAISPRNRFLSYTNVQPLGDELWKWIKDNYAHQENDILDYE
                     PDMFMESLALHYGTPEPAPIQYGFSPISYELDRRAYFCDSLRFPVNREHHRYRDEAMA
                     ARQMRVPLQLTPCERPLRPIRPTSRSFGEIDILLEKYKPEFVQLVPSIADAMECVTQQ
                     NEHLLRELLRESQPAVGAAGANASTRERMHALPYEVCPHGFHLFQSERPSGSYVALLT
                     RFAEYTYISVSTLLASVIYLDRLCLRHPRLLLTTRNIEKLLVAAVRVASKIVDLRSVN
                     NKNFASVFSVPVQDMNELESEFLKLMNFDFFLSPKEFNNYAHLVQLPAAYMQMPSSVR
                     LSNTVSANGTVESSAPPPSASHDSADHVADVGHSGNGAALRPESNTNSSNTNKMLLNT
                     PAVATPAPPRAPSPPSQQQGRSSSGAYSVDTSVAAQRALLSSKPSSTADGSTATGVEA
                     GGKYTNGSGGAAGHRYIRSGVRGGGSGGGVRGSVSANGYGSSSSAGSAGGGGSGGTSG
                     SKAPSAEFASGTRVLSIP"
     gene            complement(<708327..>710300)
                     /gene="CYC10"
                     /locus_tag="LMJF_24_1890"
                     /db_xref="GeneID:5652362"
     mRNA            complement(<708327..>710300)
                     /gene="CYC10"
                     /locus_tag="LMJF_24_1890"
                     /product="cyclin 10"
                     /transcript_id="XM_001683654.1"
                     /db_xref="GeneID:5652362"
     CDS             complement(708327..710300)
                     /gene="CYC10"
                     /locus_tag="LMJF_24_1890"
                     /codon_start=1
                     /product="cyclin 10"
                     /protein_id="XP_001683706.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652362"
                     /db_xref="GOA:Q4QAE2"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR013922"
                     /db_xref="UniProtKB/TrEMBL:Q4QAE2"
                     /translation="MQIGLAGCSSSLHTSPSSGSAAGSGFYGARGQEAAASATVNSSG
                     ANGLCAGATMSSPSATPTLPPLPSTMDEPVDLFPLTPSVSMLQRHSKRSGRLLNESET
                     MQEKHGQEYRFLVPWLAYAIDCTIAAHEVLRQKHGIPAHVSSPASPSANTLNGATDVK
                     RSSRGSANGDPTYADTAGGSSGSGQAALPSPQAELNAFSTREVPAISVHDYLKRIVKY
                     TYVSPSVLVCGCLYLDRLLCMHPCMLLHPYNVFKLFLTSTRMASKIMDTRTLNNHDFS
                     VVGGVTNDDLNALEFLMVELLQNRLYFSRDTFDEYCRPLRLQAAHLTEEASDWGAETA
                     METPVETRSGVQHQPTRPFLARCNGSNTRSRRSSILSQNEYSVSIASQSGVSPLRSAS
                     RPAFPPSASTARSISVDTESIGPARAPASRGGSASTSAPRHPLGTSYSPALPHVPHTA
                     ANGGSSPALGAMGGLSGRGASGEDMLRVATHTNSIYQSSNGVWTGQTPPDSVTVLVGV
                     EERGDERARSISLSAPRCGATTSWDATGRPSRLLAASTSTMAGLCTAALNGGRGGYES
                     SPNVCAAPTYNRASASSSRGITASAEDFGAGSMVISYSDRTPTRRAFSHASREGIALP
                     PVVCSGRSERSASVIGVAAQGQRLPPPPDQPRV"
     gene            complement(<712458..>714944)
                     /locus_tag="LMJF_24_1900"
                     /db_xref="GeneID:5652363"
     mRNA            complement(<712458..>714944)
                     /locus_tag="LMJF_24_1900"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683655.1"
                     /db_xref="GeneID:5652363"
     CDS             complement(712458..714944)
                     /locus_tag="LMJF_24_1900"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683707.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652363"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR013535"
                     /db_xref="InterPro:IPR015155"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q4QAE1"
                     /translation="MCDEAFILQADGRAHTSDVRFVSSSPHDPLAVFTASRDNTAKLS
                     TVPTSGDTIEDGLTFVGHTAFVNYVLFHPGIELLDHESCVVTGSNDKHVALWNAESSA
                     VEAVLDGHNSGACCGAIMHFTPGSVDTEVEDALAGDIISGDWGGMILIFDHKSGQPKQ
                     LYEKHATAIRGVAQLTNTSTVVSGSGDKTIHAWDAVTGRTIQIFSGHRDVVQCICAID
                     STRFASAGNDCTVRLWCIGTECPLQVLDGHDSLIYSISWSSALSELYTASEDHTVRVW
                     RSNGADGKLFTVQVIQHPCVVWSVAPTSDGRLLSGGSDHTVRVWTRDYGHMASIEKLE
                     ALETAVSSQTVNIKIAKSSSAAAASGGLDVESMPFTHEIAQRRGTLEGERLFARNEKG
                     EVELYVWNAGQWEKIGVVVAGPDAQHYTGASEQQREKHFYNGQSYDYLFDVNVEGRML
                     KLPYNVGDSVVETAKCFIQDHAGVVAQDSQEEIQNFLMAHVSPEDLSRIPGLEGTKRA
                     SDSGSAAAPTPSAATAAPPPPAEADSLLPAWKVPQLFDTFNAAAAQTKVNTLLPEHTQ
                     FHHTVEAVSLNASDPSATCAGLLSLYAALPAGLRFPATDALRYMLTVTVDRPEIVGET
                     LTKLNTVWGSKAPQPPQPPTSAAEWMVALRLAASVFGRLCDARVQAPTMNEDAQEMLV
                     WLVTSLPSMTKLITSDTSATMRTNCRAATAALLRNVTVALCSPGSSLATAGPAGLAER
                     LAVAVVQQSAVLFVVERNDSPVVRDTLRSLRSLLLSSPPSPASWRAAVVAQVLNSLTP
                     SLKGIATGARVEGQSTAAWLLAQVGHPIAT"
     gene            complement(<715462..>717114)
                     /locus_tag="LMJF_24_1905"
                     /db_xref="GeneID:5652364"
     mRNA            complement(<715462..>717114)
                     /locus_tag="LMJF_24_1905"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683656.1"
                     /db_xref="GeneID:5652364"
     CDS             complement(715462..717114)
                     /locus_tag="LMJF_24_1905"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683708.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1905"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1905"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652364"
                     /db_xref="UniProtKB/TrEMBL:Q4QAE0"
                     /translation="MARGKPHDLTASRIVFLALFASCSLTHVTIFPRYGLLVLLHQDL
                     CAAAVHLREAPLLPSHFLSNQMEAGYTIIADAAKELDQILDAGADLYLQSIRTPGAPP
                     IRAAFGFSQQPLESNRVACLAEIPCVAASATKFADFPVLVDRRVAAAMRAFFVHSFQR
                     AKGPLSNVTDGVIQSPDSLDDSPHVTRAMLSDLHPTVVAVAWACIPQHEIFVSLRRRW
                     LRETCFTIDGKADSGQNLHCAMKEFVLLDLFLSLCPKLKSLWEHRQWLCSSMCDCGFL
                     IDGPKEGEEAALPTLQFEVQDDQLFFMAAHTHPMNYNAWHYRRLRLRTLHASPSNVCA
                     RWDRARIAIQMDSEQVIQFIREHNGDSSATSYLLFLLHEQDALDGKRDASLSEAGAVM
                     EDPHQAAGELHNSGTKEHFNVSKEGEGGTRVGEGCPRTALAPALWRNLMAVTQTEIRR
                     HSEKGHECMWHLRLGLIQWACTRSPQNRVRSLWSAEDELRWASTYAGLDLVDGIEALL
                     SPVSALPYAWSESSGSSAWTSLNASRYGCQLTSLLGNASSCK"
     gene            complement(<717431..>717796)
                     /locus_tag="LMJF_24_1910"
                     /db_xref="GeneID:5652365"
     mRNA            complement(<717431..>717796)
                     /locus_tag="LMJF_24_1910"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683657.1"
                     /db_xref="GeneID:5652365"
     CDS             complement(717431..717796)
                     /locus_tag="LMJF_24_1910"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683709.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652365"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:Q4QAD9"
                     /translation="MVLPIIAGILFGCGIYYASRVGPRIAQRVSASSAQNASPRFLKS
                     AKPYHKFEYGFESPMTEYEAYMLLGFKETEAGAIFCRPAPDEVKKRYRTMMKDFHSDV
                     SGTPYIATKLNEAKDILIK"
     gene            complement(<718417..>719985)
                     /locus_tag="LMJF_24_1920"
                     /db_xref="GeneID:5652366"
     mRNA            complement(<718417..>719985)
                     /locus_tag="LMJF_24_1920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683658.1"
                     /db_xref="GeneID:5652366"
     CDS             complement(718417..719985)
                     /locus_tag="LMJF_24_1920"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683710.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652366"
                     /db_xref="UniProtKB/TrEMBL:Q4QAD8"
                     /translation="MAESAVLTPLSARHTVSPRDRSALATGISTLSSPTEETIEVDGA
                     TTTPSLPPETRVNVTEKLSDDGAERWPGDPEPPSQGCVASSSAANAHLPISSPALVRD
                     EGHAHITAADYADRQRLLYHITYLSTQLQRAQLQVEDLTRTVCVLRGAVGDSAAATVA
                     KAAVKEDATSAAVLAAKEERDVHAALQASLALFDPVIAQTQIYRLDDALAQVGLLREA
                     ELAQLRKANAALQDHRTFVSRLSEELAQLRSKTATLEQEKQRTETQLTAAVLEVEQLR
                     YEERRLNNRVAGLEELAQDGTWMSNVRVVSAAAASTQASVSQQQPLVRLEREEQLARQ
                     ALLLHVFWDPVLIAFDAGLTWLSDSAALQAKGSAAQEQPVAPGGAKAFVGERDLISLA
                     QAGILVETPALPTDADLLLLQRQQEEVTQLRSRVQLLQERNRVGQLENERLQFLYEGE
                     VRRNERMAKDHAAQLQQAYDEVVRDRQYIMNKLKQEVEDQIRLAYEDGRAYEQSRAKS
                     RRSQKAFRAGNAVL"
     gene            complement(<721091..>723208)
                     /locus_tag="LMJF_24_1930"
                     /db_xref="GeneID:5652367"
     mRNA            complement(<721091..>723208)
                     /locus_tag="LMJF_24_1930"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683659.1"
                     /db_xref="GeneID:5652367"
     CDS             complement(721091..723208)
                     /locus_tag="LMJF_24_1930"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683711.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652367"
                     /db_xref="UniProtKB/TrEMBL:Q4QAD7"
                     /translation="MNRSASLPSASPSLSTMRTITVALCASSKKHQQSFDALREAGKL
                     HNERLLLMRQHSASRQAGCGDVSGEAGEASTAAPQEGCASGSRGMSSHSRSRRTSRAT
                     SEVLAHPARSRSTTEGSLSCAALSNCLFRFLSLNYDAQRHRMVLCIDGDIKEVHQSSA
                     AAFAQDGSKANAQQSPSVDEHAGTDSTVRGEGEPSQSALMDEVDVVLHKVATFGTPVA
                     IRALHQWYNGAQKRRSRQRRAPLIVVDPLEKVQLLMTRSMLCKLLNNVGDDGQPIALI
                     PRTFVWDCPSDAACRHARRTNGSSAATPLGIHSFTSMEEQEARANGTAAEHWWIAKPD
                     ESTGAAFTHHLVMWLTRDADVSVPTAVKAALPTEACRFILQELYVYALPVVLKVYCVG
                     SHISVKVNPTVSLLNYLWEHTRGSTLADVPVAMDSQDKAFFSTVASVSTSRSQPTLSA
                     MTSSTDDDALPATSPTMNATNAAGAPPSPTELPQGTSSESASAEQSLIAWESMVVPVD
                     YWNAFLAPGTPAYTAISKLAQDLSGDAGVGLSLYGFDLVLVPQYLAHTYQRKGARGIG
                     RTEGATVRYEGVAPSLSKVAHRSADTAKPVQRIPASHSMRKLPGAGASAPPSPVSQLF
                     RASDMFDLASGAPTSLLLDSIPVVIDVNYFPGYKGVAEVNQHMLELIALKSMHLQDGS
                     SNRAWHADTATGAEAKKRRCSMM"
     gene            complement(<724866..>725966)
                     /locus_tag="LMJF_24_1940"
                     /db_xref="GeneID:5652368"
     mRNA            complement(<724866..>725966)
                     /locus_tag="LMJF_24_1940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683660.1"
                     /db_xref="GeneID:5652368"
     CDS             complement(724866..725966)
                     /locus_tag="LMJF_24_1940"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683712.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652368"
                     /db_xref="UniProtKB/TrEMBL:Q4QAD6"
                     /translation="MPWWPRGSEGGRESPVPADAQTTQDVLASIFTPTNRALAPPSAS
                     LGGSDVRSAESSSSVVYTASAKARSSAVAPEGTAPAISESRHDGADASEGPSTWWASL
                     RKWQSSTPLPRSVDASAPESALASTTIITSPMRASENADKAAAGAATAMDAVPWQTLP
                     DCPLAGYELTRQGLVHRLIKPPHTLTATELRSLIKELTAVEQQAKYDVDRQFSSHIGR
                     RGLHGLELLINPGLWLTSIYLMTWKTARLYHNALPQNSVLFTRLLALIRLRMRVEQRE
                     LVAQRHQRLMRATNARVCLSFLSGVVLFALAWVSQPPANVMEEAADVQIAKELIGYQR
                     HLEASLKWCWYVYYHHPAYSPASGGSNKRSSR"
     gene            complement(<726861..>729227)
                     /locus_tag="LMJF_24_1950"
                     /db_xref="GeneID:5652369"
     mRNA            complement(<726861..>729227)
                     /locus_tag="LMJF_24_1950"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683661.1"
                     /db_xref="GeneID:5652369"
     CDS             complement(726861..729227)
                     /locus_tag="LMJF_24_1950"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683713.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652369"
                     /db_xref="UniProtKB/TrEMBL:Q4QAD5"
                     /translation="MRSTSALYRYACDEEGCVSHSELVKLFHGIDVALGTDADATAKA
                     DDMTPAPPPPALADKMLLAYAPNLCFPTHLTLSQSYLGDAGLAAFMRMLPVLRWVRAI
                     EARGVGAGPRTIEALSGALTAYLVEGCEEAAALPTVATMGDSVSGAEQLAGGRLPALE
                     LVDLRDNDGIYALSGQRLLTALRKRRLMLRAWCAAHAGVGDVVPALEVLVDLDALPPS
                     TANALHEWNEGAANLKYQRMLARETHRWQEQVQVFTVRSAVSEAMKCSDSDMPGTAVA
                     GAAAGQPVGEHVIFRLPSSADGDSQMTQMTCEVNACMSDFLTASCCLSSAKEAAPQPA
                     HVVSGSSSLACPLPTLDGVRAALQVCIDFGADTLAILPHTNATLWYVASVWQQQQKEQ
                     HATTPSSSADTAEYVQLNYWEAKANVAALLRGLQANPALETELETSSQAGGVVIQRHL
                     YRLRELYVQLDQNDAPHEDAICTARVAGVGATPLSEMVALYYRIVAALVTRRFSETHL
                     PSMRACEQHISDVTEHVLNHLVVGEVSSEALEARIERLRSSTDAGSVPSGRPSGASDF
                     SQSTRALPPVMAQCLYHLRRHQAEAEAWVKTYAGTAVAAPQPSSSSAAAAPIHAFHAC
                     HCADGLRRHMDECVAPTSSNEGLSSNLLPLPCTSCCYHALQAAQTLLQSPGEGSSGEC
                     ELCARWAILEPVRRALPRELRMFFLDMVIRHRSRVRGGCAYVPSLDSVTGVGAPLPLS
                     MVDWLAYTEHQSENWAKVLRVFGEWYRLRALESYGIAEARTLLRQPPT"
     gene            complement(<729863..>732463)
                     /locus_tag="LMJF_24_1960"
                     /db_xref="GeneID:5652370"
     mRNA            complement(<729863..>732463)
                     /locus_tag="LMJF_24_1960"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683662.1"
                     /db_xref="GeneID:5652370"
     CDS             complement(729863..732463)
                     /locus_tag="LMJF_24_1960"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683714.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652370"
                     /db_xref="UniProtKB/TrEMBL:Q4QAD4"
                     /translation="MVAELKSELRHVSRSLVQARQQARMSEETCAELRRRCQGLETEK
                     QGLRLELQEAQVRLQARQTQTEEQRREAAEAKLTVLSLTAERDELAAKVQEAWDRVAE
                     LSAELRRQETEMQRLQTGITAAQHSKELAMQQHSHVEQQLRILQEQLRAHETDKHASA
                     AARQRLSAALQRALERLAELLSNVAYDYQRSLACESRGNEEGTASEMFARVTANGEAD
                     PDEAASTQSHAGSIPHVVLFPANSHSTSAPTEQALMGTRPLQRRGSSNESARAHAENV
                     LHSAEAAVLGDLWGAEGLSQPSSASLHDGLSKVPASASADPAAVTPPERRPPSPSSSR
                     QALVQSYRPSTSEDAAGIAEATSQLSAITTLADEASLRTALTPLLLALKHVATMLGNV
                     RHERRRWVAEAMHFRQCYEEVQHRLEAAQHVSASQESQAEVSRTHMGALQRRVEQAEA
                     ALLEFLSEDMRRRGSLAQTLKCAEDWALIQHSVELLQVRHSELSKDLQLLQEQRQAAS
                     AVGIERMEQAACAAAAEVRYQQLNQQYRALKELVEATWSRASGDLPQMKSSERCAGSD
                     TPVAPPTAQTLSSPPPLPPSSGHGAASAPLDALPTAANADAPVAAQSRSSSTLLHCTS
                     MAPTTVSTSHQRGEKETRDPDVSPTHKDGSVRGGEASTAPSETASALSAVANGKTSTR
                     VQPCVGQTSSQLACSFPSSLPTTVEVENRVHAHASAPAPLPRTGAPAINGFAGPSRFA
                     TPPNTAYVDPLSGPSSTAARPLMGDSAYDAERILLASHHRGQGRSWSSVVAAYPAPSP
                     PSSSTARCASSDVVSPPGLRRSYVSEDTERGVANGAVDYSSMFTSEVLQVIEALDRRV
                     SGALDRTLHV"
     gene            complement(<733896..>736163)
                     /locus_tag="LMJF_24_1970"
                     /db_xref="GeneID:5652371"
     mRNA            complement(<733896..>736163)
                     /locus_tag="LMJF_24_1970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683663.1"
                     /db_xref="GeneID:5652371"
     CDS             complement(733896..736163)
                     /locus_tag="LMJF_24_1970"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683715.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652371"
                     /db_xref="UniProtKB/TrEMBL:Q4QAD3"
                     /translation="MRSNGAAHIGNNTFLAVTRDVTDTAFLFSSSFSPAEQLVRLPLS
                     RKTRFLPHASLACGEAERSEYAESAARAGPPTKDVDVKEAVASAAAASTPLFCHSAHA
                     SPDGHKIAFISNVRRHHYIIDISVLPAAVCELEMPEVVQSVCWHTVAHHALCVLFISG
                     DLTIYDTDQSYLGVIVPLYRRIALRPVIERRLADAEAAVHPSPSIPSTAPGTISPAKG
                     ATALDKEEVQSTRVKALAGKVSTTRLPPARQAHATTAEVAGFRSLVLHSGGGAIVAGS
                     DIAHSPSYAVAERIDHDEMVPVSSADEVGAEGAASCPPIPKPVMLPTSQLDLVDMYAL
                     PPTESIPVILLLSSSGDVYAVHLGDDCLPVVATAAATDDGRVRTREEEVLRRAEVAAA
                     PLSVEVYHLISGDSTGAAGDEAVAVGGCLVDEDAGTHAVFFLTANGLVKGAWVSKPDL
                     LARHRVAHVRAVGSPNISFTLHLSGSLGARASLAPAVPSITHSVSMTLSQNVCVVRSG
                     VAGETAFVMAFPRWDRRRQGWACWRPACADAREREREAAALPLLSTDAAPPSPVALRL
                     PYDTRDSSIAVGCTELLLVPEVSTMDGLCERGSILVISLAAVLRSALYARCGKLGLHP
                     SAGAGATSRLRDPHPAVLDLLNAVPECHRCWLRGVPEAEMSAATLNLVRRIEQLSGDV
                     NRREMVQAQRRRRLVARVANLEGRVAEMDGMLAEWRQIILDGIVHRRGGDAFRTANAR
                     LRKVSTMLNELEQQL"
     gene            complement(<737475..>738275)
                     /locus_tag="LMJF_24_1980"
                     /db_xref="GeneID:5652372"
     mRNA            complement(<737475..>738275)
                     /locus_tag="LMJF_24_1980"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683664.1"
                     /db_xref="GeneID:5652372"
     CDS             complement(737475..738275)
                     /locus_tag="LMJF_24_1980"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683716.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652372"
                     /db_xref="InterPro:IPR024963"
                     /db_xref="UniProtKB/TrEMBL:Q4QAD2"
                     /translation="MTQLHSVASLDYGDGRTCVCRICECGKHQCPGLRVPFVGETTYR
                     DEYVGKSIERERPRKARQTVFPSKAEPGHFKTTKQEAADLLKGKDLRPAESYKPREAA
                     AAPLPFEGTTTNRADFPGWMPDYNRTKRKEDPLPRLPGTYVTTKGAMEEPVRDLAEQG
                     RLPKPPKSFKADDTLQNSLPFDGITNYTAEYQPKEVPMTRSAARDVQPVALPENRDFQ
                     TTVSAAYQVPPMHMRHDCPAAFVPMRPASRDGHIKLSVYNIPSGDTMY"
     gene            complement(<739250..>740308)
                     /locus_tag="LMJF_24_1990"
                     /db_xref="GeneID:5652373"
     mRNA            complement(<739250..>740308)
                     /locus_tag="LMJF_24_1990"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683665.1"
                     /db_xref="GeneID:5652373"
     CDS             complement(739250..740308)
                     /locus_tag="LMJF_24_1990"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683717.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.1990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.1990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652373"
                     /db_xref="UniProtKB/TrEMBL:Q4QAD1"
                     /translation="MGYGGPRVEFYTANQYSNFAAAIDRENAARVRSILHRRNLPAEQ
                     EAQRQREAAFRAYERAQADEVARSHAEEAEALERRRVKDERAQRRLATKTRRRSLTAA
                     EVASRRSRHACLCRLAEPRKYQEAMYGSGMIGGAMPHQSGRDGKLPTVGRNGAVYCAG
                     VDRDRIVPSRPALEGTVPPWKGSYSTHHGPHKLDAQMAKEAAAYYCAHPAPQRSASEQ
                     DMRQQTLQSIAAEHSMAAQQDGADVGMADASGAKGRSSVADAVQWHRMGSDNVDDEAG
                     SIFSHGSSNGPIAATGNMHLSTTSTKHSVQLHLSRYGGAMTAPRPWRPSKAASENLTL
                     PELADRLVCIQMSKSVVR"
     gene            complement(<740705..>742483)
                     /locus_tag="LMJF_24_2000"
                     /db_xref="GeneID:5652374"
     mRNA            complement(<740705..>742483)
                     /locus_tag="LMJF_24_2000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683666.1"
                     /db_xref="GeneID:5652374"
     CDS             complement(740705..742483)
                     /locus_tag="LMJF_24_2000"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683718.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.2000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.2000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652374"
                     /db_xref="InterPro:IPR022035"
                     /db_xref="UniProtKB/TrEMBL:Q4QAD0"
                     /translation="MKRSSNGDAAEAHHPALAFHREVLIIQQWTKIRREFLQALEAVA
                     ASRVVQWREPRKLWRHAQEALGKWILSQVARVHLPARDEPHNDPSRGTPSAAHLREAE
                     IRFFPSADQLRYAMANARGAHASSAAATGSSAIKGKQDLRTYDEQLVRDLSIKSNGTH
                     DSAAVAALVQLVKNFSLAKRCVAAAEAIEAGMQGVTPAQALKPRIRRLEADDPQRTPQ
                     QQRIAGPIAEVSVQWPRHWRREQCRDCPPVSLPWAAMEKLRMCYDFFSEASEQARYDK
                     GVFSADAHQLRFQRRASTVILRYEGGLATGSLQLCADTQLKQHLHAAGYHVMDLCASP
                     INAYMKTPQPGTFRSAASDSDGAVAEEVPNHFCSAFYDTDQYFGSIGSAVAVDPQRIY
                     SDAVINPDGKPLLLTLDVPYDEDICELLFQKLVRDMRSAMSGTGAAAAVVDYVLVLPL
                     WWDLRLQIEKRFFGGPGGVTKSSSSSSPSAGPLDVAQLVQRRAAMLQEGYRVPYSWPE
                     ALAAAAGDARTPTAAAAAAPDAWVCFDGVFIDDDYGYFCTATNKWLHGVTATEVIGLA
                     QPRASPQLKQALDSFYAVPTASPPST"
     gene            complement(<742952..>746221)
                     /locus_tag="LMJF_24_2010"
                     /db_xref="GeneID:5652375"
     mRNA            complement(<742952..>746221)
                     /locus_tag="LMJF_24_2010"
                     /product="putative phosphatidylinositol 3-kinase"
                     /transcript_id="XM_001683667.1"
                     /db_xref="GeneID:5652375"
     CDS             complement(742952..746221)
                     /locus_tag="LMJF_24_2010"
                     /EC_number="2.7.1.137"
                     /codon_start=1
                     /product="putative phosphatidylinositol 3-kinase"
                     /protein_id="XP_001683719.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.2010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.2010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652375"
                     /db_xref="GOA:Q4QAC9"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR001263"
                     /db_xref="InterPro:IPR002420"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR015433"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="UniProtKB/TrEMBL:Q4QAC9"
                     /translation="MTSTSAALIASVLRQPRVGDDLQWMRYDALFRTAQDYAAAEYLY
                     RLRLCSLRLRSSLLSPSLPCTDLVSEVAHLLPHYPVQITAQLVYMDEPLSPVVESAAV
                     YASAAALLPSASPVGGDADTHAEMEVVYTFADEWLVFPLELCDVPLDASCKLHLWHRD
                     TRVAEAAFHVYSVAGELCVGQRQLALSTGGGAPSDEQLWSTSTHAAELLADFHRGMMP
                     SIPWLDTLSIQQLEAEHARHGNAVVRKGSSQSAKDPCGAQTAILTLYLPAATTAVFFE
                     PGVARVSDDMKSLLQCGDAADNPCDFTQRPFPDQYTFFKEHNLCEAKAAITSKTQYFL
                     SDSSAPPGPKERHQLASLLRRPPIQLDNVTGAVVTGAGAGGVGGVRLEETRLLWKYRH
                     FICRDGKYFLPFMRCVDWANTHSSERRAACALIHQWARPAFEDVLACLSFYFDHVAPV
                     RQYAVRLLRREGDGRLCQLAFQLVQAVRYDSAEAELANFLVERAVGCWELCSTLHTLL
                     SVEVALEKCRTSSAAGKASDDRHGGTTLFKPLLRRLSERLTQQCPHFVKRLRQQHAVH
                     RVLQLLSRQLQQSSLDRLGKTALGNKLIAKQACGLRALFSSVHHGMPSRRNVNGSFGS
                     SLMAHSSADVREEHSMSSARTGDSSEEADANGGDGVSAVEASDVDSAAEDDVRRLRFP
                     LLSPQSQGSAPQSSPSQSGAQQQCRSRHAAAVDVLDRYGVTTLATHPGIPITGLLPDS
                     LYIFKSAKLPMRLTFTALRPAGLAWGGGRGGEPLHGASPSPCVWTPLAMQPAPSQQRS
                     GGLQGMNSSGGGASTAVAAEEQAEGFLGAGEGDTVPLAMMYKYNDDIRQDQLIVQLIR
                     LMNDLLQQDGMQLYLTPYRVIATGPNEGLVEIVPQVTTFFSVQRDVLKYLRVYNNTAE
                     LLRQAMDRYTRSFAGYCVITFVLGIGDRHLENILITQDGRLLHIDFGYVLGNDPKPFP
                     PPMKINREMVEVLGGPQSTGFTEFKLYCCSAYNTLRKHAPLLLHILLLGAHTEGMPQV
                     TGEGGDPRVNLLKVQEKLRLDLTNAQATQYLQNVIADSVGSIFTNLWDVLHAAAQATR
                     G"
     gene            complement(<747171..>751508)
                     /locus_tag="LMJF_24_2020"
                     /db_xref="GeneID:5652376"
     mRNA            complement(<747171..>751508)
                     /locus_tag="LMJF_24_2020"
                     /product="putative tubulin folding cofactor D"
                     /transcript_id="XM_001683668.1"
                     /db_xref="GeneID:5652376"
     CDS             complement(747171..751508)
                     /locus_tag="LMJF_24_2020"
                     /codon_start=1
                     /product="putative tubulin folding cofactor D"
                     /protein_id="XP_001683720.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.2020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.2020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652376"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR022577"
                     /db_xref="UniProtKB/TrEMBL:Q4QAC8"
                     /translation="MPSPHMEKVPMNARADASDLAPAATMVSAGDVPDAEEDTGVAAD
                     AGMLDNNDDEDACDPSFFEEEAECVALLARAAELLPPTNKQLLPSVGQDPNGVAAMLE
                     DRFAKIVDRYQNSPHLLYPYLEMLIEPLVDLLLRYLPNSAEVWAHEAGSGAGESLTAA
                     AGAGQALTSFTVVGVASSPPASAAAMQTLVVASALGQDLTMFDADAPKTPLHVVCKAL
                     YSVIKTAGEKCCTSHFPNNVGHYEDVFYTLQLWVADATRQREWEVRYCLLLWLSNLVL
                     VPFSLALVDTNSGEEGSGSAAARRLSLSDATLVTASRFLADTSKCREAAALLVARLLT
                     RPDSARHRRLFFDFANFILESTSPTATVGSGGAATAVPPGAPWAFLAEGTQNTFSSLL
                     SQRFLLPGVLLAIAKTMKLGRREELVGFTPRLLTCVATVFEQHLNDSLLCKTATKVGQ
                     RLVLSMLKRRRAEWRYSRHIASLSANLGVAAAEGAAQLSARQGEEAGRDAVDEDKIDG
                     LDGDEESLETGIGLLLQAVGHKDTVVRWSAAKGIGRVCERLPAAFAEEVMGEVLEVFK
                     NAYSDAHWHGGLLTIAELCRRSLVGTALLAKVVPLVAEGLAYDLSRGTYSVGAHVRDA
                     ACYTCWSVARAYDAEDLVIHVRQLSVALVVTALFDREVNVRRAAAAAFQECVGRLGNF
                     EHGIELVTTVDFFSLASLRHAYTVVAPVIAQYDTYRDGMLRELVGTKLLHWDRNVRQM
                     AAIALGLVAIREPTATILEEVLPVLLRRVEDTTVATRHGAILAIAELIRNLTPSAWSE
                     GHIVQFIGMLTTLEASRGFSARGGTHIRQACCVMLQAIAGQSLPLPNTVEVSRVGGRV
                     DKVRTLAVVFAFLKDSWDNILDWVQHAAADTFWAVAQTYFVKFLPSFHGKVLTEMYEG
                     CLPAQRVLSRRGFLAAVGGLPATLLNAPWAPGATTSADGATSGASAPLAFEAFLPVLQ
                     RASLLSAEDLQNPELADAHVRRNAVRSLAQVLVRIDPGAPRVTLAWYTAVMEETVLQA
                     LQDYATDKRGDVGSFVRLAVLEGLPSLLTYGLTAAAAVPLCTAATEMRVLQGVVRCVL
                     EKLDRVRAVAGSVLARVLLDEPCDKALWAEGTDKDVCLSNYELSIKAEVALFRAHLRR
                     LVTHATGEGSDAGGERGEPLAWNNTQQVISCIGPFVLIHCPVSLAHAAMEGLVVAAGD
                     LSEHVRKPAAAALLSAFHGEHATSAEASAALPQRLSACLMDVLVAHEHEERILKPASR
                     VLDLLINESVFAVEQHRAVLEMLRKELKHFALNIIVLLAMVPLLTNVCRSPDVEVRRG
                     AWALALTMIASRYPKVRAKVASDLYASLLVLTSGALAPAGLPLEGCRRAMAHLMLVQW
                     DGSDAARTRAARNELYDMLEIDPPAARAASAGESANGDAQRGSMQPAQRQRSAVAATY
                     KSLVQETGY"
     gene            complement(<752837..>753616)
                     /locus_tag="LMJF_24_2030"
                     /db_xref="GeneID:5652377"
     mRNA            complement(<752837..>753616)
                     /locus_tag="LMJF_24_2030"
                     /product="putative 3-oxoacyl-(acyl-carrier protein)
                     reductase"
                     /transcript_id="XM_001683669.1"
                     /db_xref="GeneID:5652377"
     CDS             complement(752837..753616)
                     /locus_tag="LMJF_24_2030"
                     /EC_number="1.1.1.100"
                     /codon_start=1
                     /product="putative 3-oxoacyl-(acyl-carrier protein)
                     reductase"
                     /protein_id="XP_001683721.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.2030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.2030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652377"
                     /db_xref="GOA:Q4QAC7"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:Q4QAC7"
                     /translation="MHAKSIQSITGRPILVTGAASGLGAATARFLAQMGAKVTLLDRN
                     AAQGEQVSKEINGKFVATDVCSETEVQAAIKAAEVFAGKPLFGVVNCAGICPAAKVVG
                     KKGAHSLDLFNKAVQVNLVGTFNVCRLAAEAMQRNAAQIGADEDRGVIVNTASVAAYE
                     GQIGQAAYAASKGGIVSLTLPLAREFAGQRIRVNTICPGIMETPLLPPDLGAALGAVV
                     PYPPRLGKPEEFAHLVFFLFSNRYMNGECIRLDGATRMAAK"
     gene            complement(<754621..>754887)
                     /locus_tag="LMJF_24_2040"
                     /db_xref="GeneID:5652378"
     mRNA            complement(<754621..>754887)
                     /locus_tag="LMJF_24_2040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683670.1"
                     /db_xref="GeneID:5652378"
     CDS             complement(754621..754887)
                     /locus_tag="LMJF_24_2040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683722.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.2040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.2040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652378"
                     /db_xref="InterPro:IPR002634"
                     /db_xref="UniProtKB/TrEMBL:Q4QAC6"
                     /translation="MFRVAPRLLAAYTAADIQAKLESSEALKPVQSVRVVDVSAGCGS
                     FFNIDIVSPVFQGKSLIQQHRLVNSVLEEEISTIHGFTLNTKSK"
     gene            complement(755603..756395)
                     /locus_tag="LMJF_24_2045"
                     /pseudo
                     /db_xref="GeneID:12981306"
     CDS             complement(755603..756395)
                     /locus_tag="LMJF_24_2045"
                     /pseudo
                     /codon_start=1
                     /product="hypothetical protein"
                     /db_xref="GeneID:12981306"
     gene            complement(<757558..>757989)
                     /locus_tag="LMJF_24_2050"
                     /db_xref="GeneID:5652379"
     mRNA            complement(<757558..>757989)
                     /locus_tag="LMJF_24_2050"
                     /product="putative 60S ribosomal protein L26"
                     /transcript_id="XM_001683671.1"
                     /db_xref="GeneID:5652379"
     CDS             complement(757558..757989)
                     /locus_tag="LMJF_24_2050"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L26"
                     /protein_id="XP_001683723.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.2050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.2050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652379"
                     /db_xref="GOA:Q4QAC5"
                     /db_xref="InterPro:IPR005756"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="UniProtKB/TrEMBL:Q4QAC5"
                     /translation="MASIKCGSRRKARRAHFQAPSHVRRVLMSAPLSKELRAKYNVRA
                     MPVRKDDEVIVKRGTFKGREGKVTACYRLKWVILIDKVNREKANGSTVAVGIHPSNVE
                     ITKLKLTHHRKSILERKDRSSKSDKGKGKISAADKAMQQMD"
     gene            complement(<760083..>762098)
                     /locus_tag="LMJF_24_2060"
                     /db_xref="GeneID:5652380"
     mRNA            complement(<760083..>762098)
                     /locus_tag="LMJF_24_2060"
                     /product="transketolase"
                     /transcript_id="XM_001683672.1"
                     /db_xref="GeneID:5652380"
     CDS             complement(760083..762098)
                     /locus_tag="LMJF_24_2060"
                     /EC_number="2.2.1.1"
                     /codon_start=1
                     /product="transketolase"
                     /protein_id="XP_001683724.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.2060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.2060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652380"
                     /db_xref="GOA:Q4QAC4"
                     /db_xref="InterPro:IPR005474"
                     /db_xref="InterPro:IPR005475"
                     /db_xref="InterPro:IPR005476"
                     /db_xref="InterPro:IPR005478"
                     /db_xref="InterPro:IPR009014"
                     /db_xref="InterPro:IPR020826"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:Q4QAC4"
                     /translation="MAAIEKVANCIRCLAADIVQGGKSGHPGTPMGMAPVSAVLWTEV
                     MKYNSQDPNWVDRDRFIMSNGHGCALHYALLHMAGYDLTMDDLKGFRQYGSRTPGHPE
                     RFVTPGVEVTTGPLGQGIANAVGLAMAESHLAATFNRPGHELVNHYTYVYCGDGCLME
                     GVCQEALSLAGHLALEKLIIIYDSNYICIDGATNLSFTEQSHQKYVAMGFHVIEVENG
                     DTDYDGLRKALAEAKATKGKPKMIVQTTTIGFGSSKQGTEKVHGAPLGEEDIANVKTK
                     FGRDPNKKYDVDEDVRAVFRTHVEKCSAEQRAWEERLAKYTAAFPAEGAAFVAQMKGE
                     LPPGWEAKLPTNSSAIATRKASENCLAALFPAIPALMGGSADLTPSNLTRPASANLVD
                     FSSTSQEGRYIRFGVREHAMCAILNGLDAHGGVIPFGGTFLNFIGYALGAVRLAAISH
                     HRVIYVATHDSIGVGEDGPTHQPVELVAALRAMPNLQVIRPSDQTETSGAWAVALSSA
                     HTPTVLCLSRQNTVPQSGSSIEGVKRGAYAVVEVSDPQLVIVASGSEVSLAVDAAKAL
                     SGELCVRVVSMPCQELFDAQTDVYRKSVLAEGVPVVSVEAYVSFGWEKYSHAHVGMSG
                     FGASAPAGVLYNKFGITVEEVVETARRLAARFPNGTAPLKNSSFSKM"
     gene            complement(<763597..>764259)
                     /locus_tag="LMJF_24_2070"
                     /db_xref="GeneID:5652381"
     mRNA            complement(<763597..>764259)
                     /locus_tag="LMJF_24_2070"
                     /product="putative 40S ribosomal protein S8"
                     /transcript_id="XM_001683673.1"
                     /db_xref="GeneID:5652381"
     CDS             complement(763597..764259)
                     /locus_tag="LMJF_24_2070"
                     /codon_start=1
                     /product="putative 40S ribosomal protein S8"
                     /protein_id="XP_001683725.1"
                     /db_xref="GeneID:5652381"
                     /db_xref="GOA:P25204"
                     /db_xref="InterPro:IPR001047"
                     /db_xref="InterPro:IPR018283"
                     /db_xref="InterPro:IPR022309"
                     /translation="MGIVRSRLHKRKITGGKTKIHRKRMKAELGRLPANTRLGARRVS
                     PVRARGGNFKIRALRLDTGNFAWASEAIAHRVRLLDVVYNATSNELVRTKTLVKNCIV
                     AVDAAPFKRWYAKHYGIDLDADKKSTKAAVAAEKKGRKSAHAAADKYDVNKASPKLQR
                     EWTRRRRNHRVEKAIADQLREGRVLARITSRPGQSGRADGILLEGAELQFYLKRLEKK
                     KK"
     gene            complement(<765161..>765823)
                     /locus_tag="LMJF_24_2080"
                     /db_xref="GeneID:5652382"
     mRNA            complement(<765161..>765823)
                     /locus_tag="LMJF_24_2080"
                     /product="putative 40S ribosomal protein S8"
                     /transcript_id="XM_001683674.1"
                     /db_xref="GeneID:5652382"
     CDS             complement(765161..765823)
                     /locus_tag="LMJF_24_2080"
                     /codon_start=1
                     /product="putative 40S ribosomal protein S8"
                     /protein_id="XP_001683726.1"
                     /db_xref="GeneID:5652382"
                     /db_xref="GOA:P25204"
                     /db_xref="InterPro:IPR001047"
                     /db_xref="InterPro:IPR018283"
                     /db_xref="InterPro:IPR022309"
                     /translation="MGIVRSRLHKRKITGGKTKIHRKRMKAELGRLPANTRLGARRVS
                     PVRARGGNFKIRALRLDTGNFAWASEAIAHRVRLLDVVYNATSNELVRTKTLVKNCIV
                     AVDAAPFKRWYAKHYGIDLDADKKSTKAAVAAEKKGRKSAHAAADKYDVNKASPKLQR
                     EWTRRRRNHRVEKAIADQLREGRVLARITSRPGQSGRADGILLEGAELQFYLKRLEKK
                     KK"
     gene            complement(<766741..>767877)
                     /locus_tag="LMJF_24_2090"
                     /db_xref="GeneID:5652383"
     mRNA            complement(<766741..>767877)
                     /locus_tag="LMJF_24_2090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683675.1"
                     /db_xref="GeneID:5652383"
     CDS             complement(766741..767877)
                     /locus_tag="LMJF_24_2090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683727.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.2090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.2090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652383"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="UniProtKB/TrEMBL:Q4QAC1"
                     /translation="MPRPTPPFRHWSLVNCPSEDSPLGRIGHSFCANADGSKAYVYGG
                     VNDTDSVSIYLDDLWQYDVINKRWREIELRGEKQHPRAFHTAVWYDTCMYIFGGCNGR
                     GRFNKLFYISEDGDCHPVVVRGALIPMTRYCHSAVVFGNTMYIFGGKCGGRNSNKRLQ
                     DLYRCDLSDPEWKECNQLGTIPPPRSAHTAMTYERTMIVFGGRNSGGECCEDFFVYSF
                     DTSMWRRIDLPQVPMFGRARNSAAVHYGNIIVFGGWNGKKKLNDLFIYNVEANTFEFM
                     YDIDREYPSRRECHVAVVCRNTMVVFGGRFRGHFMNDTTELYLGSKTGVDSMRDWLIM
                     ADPQLTGLATHLPLHHFAALKAHKDYVVPEFPEEPMWPLIGHTP"
     gene            complement(<768640..>769572)
                     /locus_tag="LMJF_24_2100"
                     /db_xref="GeneID:5652384"
     mRNA            complement(<768640..>769572)
                     /locus_tag="LMJF_24_2100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683676.1"
                     /db_xref="GeneID:5652384"
     CDS             complement(768640..769572)
                     /locus_tag="LMJF_24_2100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683728.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.2100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.2100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652384"
                     /db_xref="UniProtKB/TrEMBL:Q4QAC0"
                     /translation="MSVTASAAAAAAAAAASPRPPSSALYTERLFYAVLKQGNPSEAR
                     VEALAALALRHLPKSAETWAALRKALMEQSDLDGAPNRTLWYVLDALIKHAPHVFVPL
                     VAPRLLEYTIQQLPWELAGHRGQTLLWFEALVLSWEKVLPQRLYSAVRQHAVQSRSGA
                     ELHDLLEAAENSVDDGTSASPADLQQLRDAWDAVQYMGEQEAGKSVFHARLIAAAVVV
                     ADEDGNSSLSPSPPVSGLYATPTGHNGRTAGAGTSGADIANTQQQQQQQEEDEYTPDF
                     IEGAKPRELPKLDLPKLKRRREGRRRPREEDLGM"
     gene            complement(<772686..>774191)
                     /locus_tag="LMJF_24_2110"
                     /db_xref="GeneID:5652385"
     mRNA            complement(<772686..>774191)
                     /locus_tag="LMJF_24_2110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683677.1"
                     /db_xref="GeneID:5652385"
     CDS             complement(772686..774191)
                     /locus_tag="LMJF_24_2110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683729.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.2110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.2110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652385"
                     /db_xref="GOA:Q4QAB9"
                     /db_xref="InterPro:IPR013528"
                     /db_xref="InterPro:IPR016038"
                     /db_xref="InterPro:IPR016039"
                     /db_xref="UniProtKB/TrEMBL:Q4QAB9"
                     /translation="MMRNTCLSLAGVSGMAVYAPHCRVDLEQWCKWTGNSWDKVSSVV
                     GQSFRITSHNENAYTMAANAVLRLIVNNNIDPTKIGFLGLGTESSSDNSAGAIIVKGM
                     VDKGLRAMNMPAMSRHCEVPEFKHACLAGVYAMESATRFVNADGKDRMAIAVASDIAE
                     YALGSTGEQTQGAGATAMVLEHDPKLFEVQLQHSGSASDYRGPDFRKPHRRHFMNLEE
                     YTKSSANGKMADFPVFSGPYSTLVYQEEVTVAVEHMLERLQQSPGKYYDDVTALFFHR
                     PYNMMPIQAMSFLYARGLARATSEEHKAHFAELCKQGKADPAAVVKELDVNPHYFQQI
                     ESGGEPKDAFPATGKVAKVLRKDKKFIDLLEKKMSMGSPAMGNFGNLYTASLPCWLAA
                     GFEEAYTRKLDITGKPMVMVGYGSGDASMSIPILPVPGWENAAANINVSKALENPVNL
                     DKAQYEALHTGAEKNDLAKDRRKMEFVIDRLGNRNEAAFQDVGIEYYRYIQ"
     gene            complement(<774942..>778538)
                     /locus_tag="LMJF_24_2120"
                     /db_xref="GeneID:5652386"
     mRNA            complement(<774942..>778538)
                     /locus_tag="LMJF_24_2120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683678.1"
                     /db_xref="GeneID:5652386"
     CDS             complement(774942..778538)
                     /locus_tag="LMJF_24_2120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683730.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.2120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.2120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652386"
                     /db_xref="UniProtKB/TrEMBL:Q4QAB8"
                     /translation="MKNVQAERDELLLYALRHPPPNVSLKLPDGCPSLEHVDPTNCPT
                     PTTLYAEAERAAQHAKGKKVPKFELDLTKCFTVIGSSSGGVQRAKNAAPTSRSKHSSS
                     LSELPASNEGKPHLPNAHRGSYSTIHGSGSSPHAAAKNDSSRSPDKRGDSGAPKLVAS
                     EQSPPRPVQPPSGANSSAAQEGSKGLLGFLIGALKGLGRVEGTAAAPDSGRRSSSSSA
                     LAMSDSRGSTASKRQGMRPASATGSSTGRILLSAWNPLSSSIQGARQTSPATKLPGAA
                     KEEPNVSDVARRMEQMQIPLCGTTPGTISSNIAAQFGPVFDAVAQQRKMNEEATAAAL
                     TFPRPPHIQLCEVLDSAPLAPFLDILPILAYESLLLATGVLLTQKRDKYAQELGNVYR
                     RVFNITEEQHTRSLANVTPPALWRVLDDGAAVAKEERRRYLSELRPNASTLRLLCDNT
                     NDDDFVSRAEQLQSVIERYPDLPGDTQVPFAIRAMVFAACLIPLYHRDLSTLSPIYSA
                     RDVESCLAALREYLSILPQTEHFCHLHAQLLANDKGGSVEAQAVFLKDLARSISHYGV
                     SGIVNAPLTPAVKYAYYVMQETFCLAAVPMPWLDSSFSDDMQRSATAAFIETCLALPP
                     CMLSAMVLVEDMPVLPPTSSSEDILLALMEVFVNSGVFRSYAELVDDNTNVQHLSAAA
                     LFQMVGNSLDTKQKAYCQMLTRSFPLAPMLIVPGRLRIGAYILLTRHWGGLYPGASQN
                     VPKDHKVSLDAFLDYLLDGCDGNRRASESKTLCVLLTRATQRYLAPLDTLAQYDEAAH
                     VKFAKQLMEEISLPWADTVECASTPLGDVMRYVQAVFGAPRPPPLGGDPAAQQYARMC
                     SWFDTVTALIEKCLEGFPTVPAAAPSDKMPALAAESKCVGMACAKLRKYPALLPSGVH
                     RLHTLVRVQGGFEECLMRSRQQYDLVRRVTGAPSVPTDEVTEKIWRNLYSALLKLCNG
                     LSIYILTQYSVKDLMSKFMQVDAKQYKSMKRSAAKLEDLPMPRLYPAVTMQRILDEVR
                     CVLDRVRETIDFEPAVRQLRYRLGHYFTACLFAVYVDGAEVFLSPADAPLILADLDTV
                     RAFFFEPNADTQGPPPTGGDHCDAFQTVAQALRAPSAELLEKLYSVVQYVMSKPSSEL
                     VTGGAGVPPLHTLPECSDNSPWCQYVVRRVLEHRKDFKSSMWESYKARVLVK"
     gene            complement(<779934..>780401)
                     /locus_tag="LMJF_24_2130"
                     /db_xref="GeneID:5652387"
     mRNA            complement(<779934..>780401)
                     /locus_tag="LMJF_24_2130"
                     /product="putative ubiquitin-conjugating enzyme e2"
                     /transcript_id="XM_001683679.1"
                     /db_xref="GeneID:5652387"
     CDS             complement(779934..780401)
                     /locus_tag="LMJF_24_2130"
                     /codon_start=1
                     /product="putative ubiquitin-conjugating enzyme e2"
                     /protein_id="XP_001683731.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.2130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.2130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652387"
                     /db_xref="GOA:Q4QAB7"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:Q4QAB7"
                     /translation="MHGGGSNSGAAARLQKELVEVMMSDAEGISAYPEDDNLFRWIGS
                     VKGVPNTPYEELEYNLLLVFPPNYPYEAPTVTFMTPCFHPNVDTRGAICLDILKEKWS
                     AVYSVSSILLSIQNLLNNPNNESPLNNHAAQLWHDREQFTIAVRATHGGAPGS"
     gene            complement(<781689..>782669)
                     /locus_tag="LMJF_24_2140"
                     /db_xref="GeneID:5652388"
     mRNA            complement(<781689..>782669)
                     /locus_tag="LMJF_24_2140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683680.1"
                     /db_xref="GeneID:5652388"
     CDS             complement(781689..782669)
                     /locus_tag="LMJF_24_2140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683732.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.2140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.2140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652388"
                     /db_xref="GOA:Q4QAB6"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="UniProtKB/TrEMBL:Q4QAB6"
                     /translation="MTTSSCSPCGHSTSTRDYLFRSLYLRREMLLLTTHGAASASTPA
                     EEDEDERQPSVANSVGSKTSALRDVLLLPPLYCLDGLSLTPSVNDGSAFGVDPMVTPD
                     HAWNGLVHVRSPSSPWHRGCFAFYVYFPSRYPFEPPIIELTGPLRSHPLVRERCLQHL
                     GQLSGAGDHLSGISSCAAQRDSPVKDASTATPSETVKRVFVPFEEVYSTIDPMRVSVM
                     MVLIRHMRLIFLPAEWPSSWRSSSMGADDDSGGVNRVLARRDVERRSVTQEVLLLKPF
                     EQYLGTEVMQHFLDVWKASKDDAGDDRTDTVTMDNAGWYTREVLPHLLHS"
     gene            complement(<787687..>788022)
                     /locus_tag="LMJF_24_2150"
                     /db_xref="GeneID:5652389"
     mRNA            complement(<787687..>788022)
                     /locus_tag="LMJF_24_2150"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683681.1"
                     /db_xref="GeneID:5652389"
     CDS             complement(787687..788022)
                     /locus_tag="LMJF_24_2150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683733.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.2150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.2150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652389"
                     /db_xref="UniProtKB/TrEMBL:Q4QAB5"
                     /translation="MGHAVSRKTPQAKKLEAKMSIDEAPLPIAAERGAPVAATAHEKQ
                     RGPDSQEGLTEEMIEGLTRSSVGSTHSKAKDAVNDWITTANYFVKYNTDALEQHEESM
                     RTLAALQAA"
     gene            complement(<791390..>792391)
                     /locus_tag="LMJF_24_2160"
                     /db_xref="GeneID:5652390"
     mRNA            complement(<791390..>792391)
                     /locus_tag="LMJF_24_2160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683682.1"
                     /db_xref="GeneID:5652390"
     CDS             complement(791390..792391)
                     /locus_tag="LMJF_24_2160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683734.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.2160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.2160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652390"
                     /db_xref="GOA:Q4QAB4"
                     /db_xref="InterPro:IPR004129"
                     /db_xref="InterPro:IPR017946"
                     /db_xref="UniProtKB/TrEMBL:Q4QAB4"
                     /translation="MKLVLFLGSVGAALGWSYLRHIQLPVGPSRLLWGGVVFGHRGCR
                     GVAGTPENTLEAFRHAAASGCGGVECDARLTKDNEVVIFHDAFVNGHLRDVPPTRRID
                     ELTLFELRQCTFTADPTGKVRVPTLEEAILFCRDNNMRMLIEVKDLKRTYLCTDKVLD
                     LYRRYPDYMYDHTTLISFHSGSLYHARKVDKRVAVCQLYAANMVSSYIALKVDTLPWV
                     LRLCPALWDCVLLFVHERVIPWLTGCSMVGPRNDLFTEASRKRWVTRNICMYLWGFER
                     AEQYTPAMRQPGVCISSDKYQGFGTPKPPPNYDIFDDRQRKLEGQQDATCKQLRIAK"
     gene            complement(<793835..>796885)
                     /locus_tag="LMJF_24_2170"
                     /db_xref="GeneID:5652391"
     mRNA            complement(<793835..>796885)
                     /locus_tag="LMJF_24_2170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683683.1"
                     /db_xref="GeneID:5652391"
     CDS             complement(793835..796885)
                     /locus_tag="LMJF_24_2170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683735.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.2170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.2170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652391"
                     /db_xref="InterPro:IPR019514"
                     /db_xref="InterPro:IPR019515"
                     /db_xref="UniProtKB/TrEMBL:Q4QAB3"
                     /translation="MEDVTESLAAAWKEAMKGVRIGYRKTKSVLKQIPVDRLKAISGT
                     GGVMSQGDIRRFFQIKYGAEVRNAEGVRVAADEASDVASSDEEPLTDAQVQEKVDKKF
                     FDKTYNPAIFELEHLDGFAYTDDEAEGRLMREAAEGKMRELRQKCNIVSTTLKRRVLA
                     HHHSFVSGTEKIRDINDSLLMTSSDCKKARAAIRKSKAAVASQVALLAQQRTKENMEA
                     AIQLLEAMKAMCGKRTQLMNLISSGKVHEAAGFLKREGPIDMESSLAKIYCMKRVMAE
                     WRMYRDNPKKLTDCIEVVLTDCLSNKFIVPRYRNALEASQDLGCASKTCTLVATLVWR
                     AAIQILCKSLTEVSFVKSEDAPLADIAEGIHPDYLTLGVRQMAAKLMDFLYLYSTVVR
                     LHEEERRTDSPYAGLHSQALQRVQDTGRKVGRDLVEKLTVVLSSARLASIDPDRVLHL
                     FVVVSMLTEAFGVLGLEKAEQAAARTQTKAVLLRHMQMHFQTPKAHEVLAFMAEDDWV
                     VSPVSPPSLNMVKPLSPSNFKSFIKEVNSYLHQSTDEGSLAAGAIPFMENPFLTQKML
                     EPADTSSLVQTQTFGAHWATAKTGCAAAATGDSADSASTMRDMGTGLEAAPVSAPVSI
                     QDTATLASSVDMPPSVLTSSAISVANAFLEYQARIAVRFPPLAADILGWCEELLCLYF
                     YTVVDSFVSVSRSVPIEHQGDFSAKAQRVLAEVRAAGERAVGAVNGQYTPKDHVRHVC
                     GGGGVGGANATTFRFPPAVWGRLSNEFTSAAQQFALGNRTVACQSVLSLIFLYEATIQ
                     TMSPLLPATTVQSYMRRCRVLYEAAHEVLHVCIHRLCQAICPMESVCKNIAKLKGGKD
                     EVMVSSYVAQLVGSMKELNERHVPMPTPALESVFLQRLIFAAQAVLVREYSKLPKKRM
                     SDLFVMQLQVDVQFFQQQVASVFGKSSVVVPDYVLRFVKAGFFADDKAQCLQWVRSNH
                     ALYYSVDLVNWFGAADKPFMLQLEDLLIRELKHQDILPMGCFAL"
     gene            complement(<797629..>801945)
                     /locus_tag="LMJF_24_2180"
                     /db_xref="GeneID:5652392"
     mRNA            complement(<797629..>801945)
                     /locus_tag="LMJF_24_2180"
                     /product="putative basal body component"
                     /transcript_id="XM_001683684.1"
                     /db_xref="GeneID:5652392"
     CDS             complement(797629..801945)
                     /locus_tag="LMJF_24_2180"
                     /codon_start=1
                     /product="putative basal body component"
                     /protein_id="XP_001683736.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.2180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.2180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652392"
                     /db_xref="UniProtKB/TrEMBL:Q4QAB2"
                     /translation="MVSDGAPKSGPVPSDHVDQLLEEYLRVINDKDDQLHRLLRQLQD
                     QEAAAGKREEDHTTKQRQLSEQLQSKSRKLKEMQAQSARDEEAVRKLVLNSEALKKQL
                     QESEEHATGHAVAAAEAAAKLCRLECDLSNAQATLAAVQAQKTKCDEGWAATQLQLEA
                     QTAAVANLKSELEVAMWTLGETRSHAQQLEARIQEMMPIHEHTSALAALEAKSASERV
                     KTNQDIEKLQDALSSGEIDHRTTKQALRKAQQDVEELTALLQTTTKALDTTKHQLTTA
                     DLTKQQTERELREEAARCRRAQMESAERVGELERSLVRSQEALQRTTAELQAACAQHE
                     RYKAVSEKAHEGVQAQNRTLQEQLRQSQDEADRVRRLLETRERMISDSADALARAREE
                     ATRTQAELRERLATVTAAAASRAEERDRLQHQLSRAQSELADAQRRTAADEHSLAQKL
                     EELQSGVQRLHLQLRDKEEETRRAELVHGKELQKLQHDHAFAVEDMRRRHESEVQDLH
                     ARLELARAELSERAGGSKGLEKELHHVAEVRQSMRSEMSRLQNAIEAKETVIQGLQRE
                     ADKQQAEVAQLTQRLAAHERSEGVLRQRIEEAERAQLDSKAARERAEESVVAIRKTAE
                     ARAATLAAVEAQLSEKDGAIAALRLEVRECVEAKQVAFKEVMQEKANCDKLTLSWKAT
                     EERADKAEMELRVALQEQQRLQRCVDERSKEVRLLKEEGEQRDAECARLARHAEDVES
                     LAKRTAEELRQTIHERDDTIQRLRSEQATVLPHLNEEKGKSLVLLEKLQHQQELSRMH
                     MDNAQQRIRSLEEAVSAREAEVAALQCDKARAEQQLLEVQAQVTTLTGTLDSREHKYQ
                     QRKEEVQKALQQLEEVKASTVASLERAEGQTAAANAIRERYKTEKAKMEALLQRMEER
                     VRASAKREKEDCQREADLMKKLTETEEALRRAQDIADTRVSEVKSRYEAMCRQQEESF
                     RDATNGAMAAEKLATSLQMQLHEAQRRALSVEGSYRELQRHVAASRALALEEYAEEAT
                     EMKRACMDLVLRAHSGTVSRAASVAKDSWSVAQKIAAELCEGARDTERHLVRLQLKHK
                     AELQAVEEAHQRRMEAAAAEHHEEVARVQRELAEAERCVLALKEAAQRSDSDREHRTH
                     ALKDSLERVTALLEIEKRQTASLQERVAADDAKRSSDARAAEEERRSLQHHYDKLKRQ
                     LDDRAVEQKHNEDELRELRAEVAALQRVLGEKRREAKQEADRATKEQERLVAAVEARE
                     VAEQRCGELQKQINFMRGQLETARLSHERVVTEHQATQRTRDMRLEGAQAELATAVAE
                     RRRYQREVESLEQRVKELTKEVQMLRQHEADILGQLQSYKAETSALRERCANVESLKN
                     ISEASLAETQARERDLMEKIEELRNAQQLMQLCFDKQQEQLEVGRRLRQQDALQGSRF
                     SS"
     gene            complement(<802753..>803496)
                     /locus_tag="LMJF_24_2190"
                     /db_xref="GeneID:5652393"
     mRNA            complement(<802753..>803496)
                     /locus_tag="LMJF_24_2190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683685.1"
                     /db_xref="GeneID:5652393"
     CDS             complement(802753..803496)
                     /locus_tag="LMJF_24_2190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683737.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.2190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.2190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652393"
                     /db_xref="UniProtKB/TrEMBL:Q4QAB1"
                     /translation="MAPKTRSGSNAKKRGRIRDAAETPQPSRGSASAAEKKSKQRSQS
                     ARAEAKRSVEGLEGKAAAFVRRYKWWFTALLAIVLVFAAARLAVLLSPSGDASPQERH
                     PCSCAVVASTTNRLAKAVLSRRTGVSGVHWRTEETGLDSLAFATQCSGGAVVTLPGPF
                     ESVDQLRAALMAPFKGRRNRCVVWVTTPEAVKRVANSLKELIENNALSGNTVVPAHSR
                     ATLMLKSPESREQLKSSLPHRVVHMLTEV"
     gene            complement(<804182..>804922)
                     /locus_tag="LMJF_24_2200"
                     /db_xref="GeneID:5652394"
     mRNA            complement(<804182..>804922)
                     /locus_tag="LMJF_24_2200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683686.1"
                     /db_xref="GeneID:5652394"
     CDS             complement(804182..804922)
                     /locus_tag="LMJF_24_2200"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683738.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.2200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.2200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652394"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="UniProtKB/TrEMBL:Q4QAB0"
                     /translation="MHPPSSGQGLFPRYGGGWMHQFGHVYALQQELLDPNANNWFRAV
                     ELWHTARQEGVAMNVSHFTSILRQCVQPGAWAQSLQVLKQMKRENVRPDVVGVGCALA
                     ACVEGKHYDEVENIFATFHKTMLLDSVCHLALIRARQESGNAKGAIAAGKQQQADQVP
                     FLPYTYTHLLEACNAEDDAAYAMELVRNMHSEQWVPSQCAMLAIEDLGRRHERLAAFS
                     RPLLSASDKADSALPSFDASRRLLPPEW"
     gene            complement(<808317..>808811)
                     /locus_tag="LMJF_24_2210"
                     /db_xref="GeneID:5652395"
     mRNA            complement(<808317..>808811)
                     /locus_tag="LMJF_24_2210"
                     /product="putative 60S ribosomal protein L12"
                     /transcript_id="XM_001683687.1"
                     /db_xref="GeneID:5652395"
     CDS             complement(808317..808811)
                     /locus_tag="LMJF_24_2210"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L12"
                     /protein_id="XP_001683739.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.2210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.2210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652395"
                     /db_xref="GOA:Q4QAA9"
                     /db_xref="InterPro:IPR000911"
                     /db_xref="InterPro:IPR020783"
                     /db_xref="InterPro:IPR020784"
                     /db_xref="UniProtKB/TrEMBL:Q4QAA9"
                     /translation="MPPKFDPNQEIIVVVRAVGGEVAATASLAPKVGPLGLNAKKIGE
                     DIAKCTKDWKGLKVTCELRVKNRVATVVVTPSVASRLIRALKEPPRDRKKVKNIKHSG
                     NIPFAEIIKIAKESQPKSMGSDLKAVVMEVLGTAVSIGCTVDGESPLDIQAKVREGKL
                     KVPN"
     gene            complement(<809544..>810737)
                     /locus_tag="LMJF_24_2220"
                     /db_xref="GeneID:5652396"
     mRNA            complement(<809544..>810737)
                     /locus_tag="LMJF_24_2220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683688.1"
                     /db_xref="GeneID:5652396"
     CDS             complement(809544..810737)
                     /locus_tag="LMJF_24_2220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683740.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.2220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.2220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652396"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QAA8"
                     /translation="MHLFTRILAVFVVVLVALLIPRFLEPIYVIPAADAVAPFCSEPP
                     LCARKDRTMKQQLLCTIRSAPLKPASPAYRQYVVSRLKRYVDGSIRGQSVAASVIERV
                     RYKLAHVHEPMVLHFAGDNGVGKTRLAELISLAMGQKCGDATCSIGDTTLVLSGTSYD
                     GMTVAEFRNAVVPVVVRHAQRYPDNGVVIFNELTSLEPNKVRVLSPLLGRGTSFPESL
                     GVSIAPLLVILTTDFGREGRTRGKSLFEMRAFINDEFADLYSKEAASHVRTFPFLPIS
                     LSTAGDIVRVVVREIGCSAQQPLCLAISDSAVVWLVERTKMLLSAENGRAVAFETKLQ
                     LEALLEQVMGNYTYESGIIATDELHLDVDGTCPYRRCTVFLEGDGTLAMTCQGTGTHT
                     RVSPD"
     gene            complement(<813304..>813831)
                     /locus_tag="LMJF_24_2230"
                     /db_xref="GeneID:5652397"
     mRNA            complement(<813304..>813831)
                     /locus_tag="LMJF_24_2230"
                     /product="hypothetical predicted multi-pass transmembrane
                     protein"
                     /transcript_id="XM_001683689.1"
                     /db_xref="GeneID:5652397"
     CDS             complement(813304..813831)
                     /locus_tag="LMJF_24_2230"
                     /codon_start=1
                     /product="hypothetical predicted multi-pass transmembrane
                     protein"
                     /protein_id="XP_001683741.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.2230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.2230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652397"
                     /db_xref="GOA:Q4QAA7"
                     /db_xref="UniProtKB/TrEMBL:Q4QAA7"
                     /translation="MNDLERKRRTFRIWLAIYIIFALAYLSGVLLFCFVHQNYWACGG
                     FVVVILLIALRVALLVTPQYRLYKIFPPCSFNRIAYQTFFLCGCLVGISLGVWLMAKG
                     IKHHQSWTARSYFCGMTGVWMAAKWSYIVTVPIYELREDTLEEDALIRLGLIDSEKNE
                     ASGNNEPVISKENCA"
     gene            complement(<814696..>815826)
                     /locus_tag="LMJF_24_2240"
                     /db_xref="GeneID:5652398"
     mRNA            complement(<814696..>815826)
                     /locus_tag="LMJF_24_2240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683690.1"
                     /db_xref="GeneID:5652398"
     CDS             complement(814696..815826)
                     /locus_tag="LMJF_24_2240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683742.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.2240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.2240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652398"
                     /db_xref="InterPro:IPR016030"
                     /db_xref="InterPro:IPR029499"
                     /db_xref="UniProtKB/TrEMBL:Q4QAA6"
                     /translation="MWSTGTRCTPRVTATVLAVMFLSALVYSTARRGVPRVMGGRFFS
                     CGAWASPMVTIDPVVAEENCIERRLPPEIKALHAQAVANGEDTYIDLRTGFTVFTRLG
                     LMRNMKCCGNRCRHCPFGHVNVQSKGLMTTKAGGPVGATSAASAATSADASSTVPTAA
                     SKDGKEVGVGKVLKHSMVYTKTGDNGASALFTGERRRKADAVFEALGAIDELSSHVGL
                     ARAMLRSASERHEHDEAMMSMLVEIQQELLNAGTVVATPTAKNLEVETAKHMTEILEG
                     YRFPEKTEELAKNIDIIDSRIAPLRVFILPGGGNLASAQLHVCRTTCRRAERRMVTLG
                     DLYGATYTDHLRQATVYMNRLSDFFFVAARSVAGEDIVRKYD"
     gene            complement(<818187..>819542)
                     /locus_tag="LMJF_24_2250"
                     /db_xref="GeneID:5652399"
     mRNA            complement(<818187..>819542)
                     /locus_tag="LMJF_24_2250"
                     /product="putative fatty-acid desaturase"
                     /transcript_id="XM_001683691.1"
                     /db_xref="GeneID:5652399"
     CDS             complement(818187..819542)
                     /locus_tag="LMJF_24_2250"
                     /EC_number="1.14.19.1"
                     /codon_start=1
                     /product="putative fatty-acid desaturase"
                     /protein_id="XP_001683743.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.2250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.2250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652399"
                     /db_xref="GOA:Q4QAA5"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR005804"
                     /db_xref="InterPro:IPR009160"
                     /db_xref="InterPro:IPR015876"
                     /db_xref="UniProtKB/TrEMBL:Q4QAA5"
                     /translation="MCCANSQCALATGFFFLLLTMTSVEKKGKDMTEETARRQPTYQE
                     GNYEINYVALAVLGLPIAGVLAAVFMGVPLQWKTFVTAVLFYMFNGCLGVTVGYHRLF
                     SHRSYTASTAFQWLCAFAGAGSFEGSAKWWGRNHRIHHRYVDTERDPYNAQRGFIFSH
                     MGWMIMKQDYSLLGKVDVSDFKYNYVIQFQHKHFFKMAMLSGVILPTVICGLGWGDWL
                     GGYFYAALAKIVFVHHCTFFINSLAHTNLFAAVQNYSDRHSSHDSFVCALFTFGEGYH
                     NFHHEFAQDYRNGIKWYHYDPTKWIIRAVSFLGGAKNLVRTPNDVIDANFNKMLLKQS
                     RKAMEQAQTRLDQLHIPVSEEWTWEKVQDEVAKGRKLTVINNDVIDLMHSIPTGAGYT
                     HSSKDVIWYSSHPGGQRILDMFVGKDATSAFTGGVYAHSCAAESYLEHLRVAKLKVAT
                     D"
     gene            complement(<820056..>821624)
                     /locus_tag="LMJF_24_2260"
                     /db_xref="GeneID:5652400"
     mRNA            complement(<820056..>821624)
                     /locus_tag="LMJF_24_2260"
                     /product="putative notchless homolog"
                     /transcript_id="XM_001683692.1"
                     /db_xref="GeneID:5652400"
     CDS             complement(820056..821624)
                     /locus_tag="LMJF_24_2260"
                     /codon_start=1
                     /product="putative notchless homolog"
                     /protein_id="XP_001683744.1"
                     /db_xref="GeneID:5652400"
                     /db_xref="GOA:Q4QAA4"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR012972"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q4QAA4"
                     /translation="MPVRKKQKRDVVCEVELHSDEDGDTAPKIMVQLLDEHGTPSSTQ
                     ILLPASATPKQLDELLSSLLQDEEAKTIPYAFFIDGEQINRSVQDILFRRQKDEYVAR
                     MLKEGRRVRPQDVEKLEFAAPEETVVEIMYKPQAVFRVRPVTRCAGTLDGHSEAVLVV
                     SFSPDSQVLATGGGDKEIRIWDMNTLTPVEELKAHTSWVQVLSWSPDGRYLVSGSKDG
                     ILANWTHNGEYGNFKCKKHKAHTQYVSHVSWEPLHRNPQCDRFVSASKDASLKMWNMA
                     TGLERSLSGHQSCVTCVKWGGEDRIYSSSQDRTVIVWDAGTGSPWCVLRGHAHWVNFL
                     ALSTDLVTRTGVFDHEDRKFSAREDMCAHARKRYDAVVTRFGGSERLVSCSDDNTMFL
                     WNPQQSVTPVARMTGHQGVVFHIQFSPDGTMLASCSADKSVKLWNAEDGRFITTFRGH
                     VAAVYHVSWSLDSRMLVSGSKDTTVKLWSVAKRELVEDMSGHSDEIYATDWSPDGQKV
                     ATGSKDKRVRIWVH"
     gene            complement(<822302..>823138)
                     /locus_tag="LMJF_24_2270"
                     /db_xref="GeneID:5652401"
     mRNA            complement(<822302..>823138)
                     /locus_tag="LMJF_24_2270"
                     /product="zinc-finger multi-pass transmembrane protein"
                     /transcript_id="XM_001683693.1"
                     /db_xref="GeneID:5652401"
     CDS             complement(822302..823138)
                     /locus_tag="LMJF_24_2270"
                     /codon_start=1
                     /product="zinc-finger multi-pass transmembrane protein"
                     /protein_id="XP_001683745.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.2270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.2270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652401"
                     /db_xref="GOA:Q4QAA3"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="UniProtKB/TrEMBL:Q4QAA3"
                     /translation="MTTWEDALMSWGAVYAALFLPAILMLGNFVFGKCFVSEAMCRSQ
                     HAPQSVHTRSRILGRAHVVLVTLSFAWQYYIVMFVARTKTGGNADARACNPLFFVWDL
                     VDHLPYLRDVQLSLLVQCHSSDVAYLVLVALFAFLYASCVFSVPQVTSRNTAAEGHDG
                     ISYCRRCDSHIQQMDHHCYFIGNCVGARNKRLFLCCLVTGVANLSYLLYKYALWALAY
                     GDAITNFGAILVFVFDVFLTTLLGFQMFALRRGWTTREFLRRRRHAKGPVVRFILWLC
                     FF"
     gene            complement(<824071..>826512)
                     /locus_tag="LMJF_24_2280"
                     /db_xref="GeneID:5652402"
     mRNA            complement(<824071..>826512)
                     /locus_tag="LMJF_24_2280"
                     /product="putative DNA excision repair protein"
                     /transcript_id="XM_001683694.1"
                     /db_xref="GeneID:5652402"
     CDS             complement(824071..826512)
                     /locus_tag="LMJF_24_2280"
                     /EC_number="3.6.1.-"
                     /codon_start=1
                     /product="putative DNA excision repair protein"
                     /protein_id="XP_001683746.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.2280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.2280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652402"
                     /db_xref="GOA:Q4QAA2"
                     /db_xref="InterPro:IPR001945"
                     /db_xref="InterPro:IPR006554"
                     /db_xref="InterPro:IPR006555"
                     /db_xref="InterPro:IPR010614"
                     /db_xref="InterPro:IPR010643"
                     /db_xref="InterPro:IPR013020"
                     /db_xref="InterPro:IPR014013"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QAA2"
                     /translation="MKLYVEDVLVVFPYEYIYPEQLDYITELKRGLDKGGHMVLEMPS
                     GTGKTISLLSILVAYLHHHAHEKRKVVYCTRTVEEMVKTMGEMRKLLKHWEAEGEQLR
                     PLRGLCLSAKKNLCIETSVASRIHPDEVDAGCRSITAPWQQERRCGYYDTLAQAPLEL
                     PPGVHSLDDLKDFGEQHHVCPYYLVRKALPIVDIIVHSYLYMVDPVVSEVTKEFLNEN
                     TIVVMDEGHNVDDVCIEAMSLILTKKDSLDAKENMKDLNKELDHLKATNRQQLQNEYD
                     RLVNGLAMAEMARDPEQRALVEAPAIPANVAEGAIPASLRQANHFLAFMQRLVDFTHR
                     IVARITRTYVADPLTFLTKLKEECALEISHFRYLSGRLKVLLTTLQIANAGKYRPVAL
                     IAQMYTLLSMHYTDDRYEKPGFVVVCEAFDPTRPQIPDPVIRTVCVDASLALRDTFAR
                     HRSVILTSGTLSPMDIYPKILGFTPAISKSFQMTLSRKCIAPVIVTRSSESVNITAEE
                     VTSSFKVRTNPTAQALVTSAYESLLLELAKTVPDGMVCFFTGYQYMGEVLLAWHSSGF
                     LQKLAKHKLIFVETQGVEETSVALANYRRACDIGRGAIFMSIARGKIAEGIDFDRHYG
                     RAVVMFGVPFLPPNDEPLRQRMHWMEVCLGISESEFRNFDAMRQASQCIGRVLRNKTD
                     YGMMLLVDKRFALNDKVKKIPRWIAQCLKNNTNLSVDAAVAVARGFFKEMAQPWEHEK
                     DLGTTLLSKETLRRMGRLSASAAKYASFSETLAAENVSTVTAPKTEQEENVGITAVRE
                     PGSGSRKRKRDDEME"
     gene            complement(<827249..>829483)
                     /locus_tag="LMJF_24_2290"
                     /db_xref="GeneID:5652403"
     mRNA            complement(<827249..>829483)
                     /locus_tag="LMJF_24_2290"
                     /product="cullin-like protein-like protein"
                     /transcript_id="XM_001683695.1"
                     /db_xref="GeneID:5652403"
     CDS             complement(827249..829483)
                     /locus_tag="LMJF_24_2290"
                     /codon_start=1
                     /product="cullin-like protein-like protein"
                     /protein_id="XP_001683747.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.2290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.2290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652403"
                     /db_xref="GOA:Q4QAA1"
                     /db_xref="InterPro:IPR001373"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="InterPro:IPR016159"
                     /db_xref="InterPro:IPR019559"
                     /db_xref="UniProtKB/TrEMBL:Q4QAA1"
                     /translation="MLEEDRQALRKMKADFEALADRANSDFQGYNTFERRMNHYNTVY
                     TAATRNTSKAAEYPGYDAGELLYMEYNEMLTTYLWRYRDLSGDSEQELFQKILDVWDH
                     YKILMKWNMRTFGYLSRYYIVYHSKPSLQQVGLSIFLEQVFKKNADVVSSIMQKLLLK
                     ERADRVVSTDAKQISTAIGLFSSMNIEDTQSIYVTAFLEPYLDKTKRDYERFLQEWDA
                     VADAAVFLRSVHDALTHERNICRRYFSTQDEERIMTCVEAALVDSPVTRRKLVDSPSG
                     VLAMLRSRDEAQLQMCNSFFSRRESGIALLAGLIKKEIEAEGLELCERFKGEEASVDI
                     VAYTTGMMHLQEVYPQLLSRCFQLDFTLSKAVREGLEACYNHGVAVTSSCGGGESRIV
                     PFCEWLSHYVNHLFQQEAGPASAEMDRIVATLAYVTERDRFIATSREHMADRILLPIK
                     KFSEANERALIQRFRQRCGPTSTACLESMLHDWETSNSFCAMEVLASKNVPRTFEVEL
                     LVAKKGIWPSRLSDEPDIVVPSFLQRVLEPLRDDYLAGKSGRVLTWSHECSSGELQGS
                     FKKGTQLFFACGIQVLILLCFNSSPVCTPQQIGDRCHVTFASLQRYLPPLIRCRILTR
                     KSGKALLQMDDELTVNDDFVCRARRMRIPPSLARVSVGESEHISKQVEEDRKPAIDGA
                     LVRIMKGRRSLDHAELVLQCQQQLSSRFSPDVKLIKQRIEELIRREYISRDPRSKGVY
                     HYIV"
     gene            complement(<830240..>830950)
                     /locus_tag="LMJF_24_2300"
                     /db_xref="GeneID:5652404"
     mRNA            complement(<830240..>830950)
                     /locus_tag="LMJF_24_2300"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683696.1"
                     /db_xref="GeneID:5652404"
     CDS             complement(830240..830950)
                     /locus_tag="LMJF_24_2300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683748.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.2300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.2300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652404"
                     /db_xref="UniProtKB/TrEMBL:Q4QAA0"
                     /translation="MERYESIAERAGFARSQVLPRGSGGSSSASVCYENAANYLQHAR
                     GADYATASCSVPVDIWDALCQGEASVLRVGQLGEGRQRLIAYESCTTSSHSGDLSSRL
                     ASLEKSLDKLLSEFPKTAEELVTLDYNASLCSAAARSVLTAVPSFLSISGLLRTINNK
                     LCSLDGFSREVLPLMRCDDDVSRQCLLVAGRLDTLEEKLRTTEALVAALGHTSAASNA
                     IFERIGARYGETTRAATM"
     gene            complement(<831357..>831848)
                     /locus_tag="LMJF_24_2310"
                     /db_xref="GeneID:5652405"
     mRNA            complement(<831357..>831848)
                     /locus_tag="LMJF_24_2310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683697.1"
                     /db_xref="GeneID:5652405"
     CDS             complement(831357..831848)
                     /locus_tag="LMJF_24_2310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683749.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.2310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.2310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652405"
                     /db_xref="UniProtKB/TrEMBL:Q4QA99"
                     /translation="MPPKAKKALTAGSKELYYEDQQLADDIVILEEKLKGLKRVYLDR
                     MTALAERKQQELVLSAELDARKAGLEAKKSEKIDVLTDGTRVYKVRERIALQEIATQD
                     AALHELQETKKKLQEQLETCTADFDSRIKSKKREFESLRERTADMEKEFAVLLSDVEQ
                     CSP"
     gene            complement(<832546..>833598)
                     /locus_tag="LMJF_24_2320"
                     /db_xref="GeneID:5652406"
     mRNA            complement(<832546..>833598)
                     /locus_tag="LMJF_24_2320"
                     /product="mitogen-activated protein kinase"
                     /transcript_id="XM_001683698.1"
                     /db_xref="GeneID:5652406"
     CDS             complement(832546..833598)
                     /locus_tag="LMJF_24_2320"
                     /codon_start=1
                     /product="mitogen-activated protein kinase"
                     /protein_id="XP_001683750.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.2320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.2320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652406"
                     /db_xref="GOA:Q4QA98"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4QA98"
                     /translation="MPPKRPQALEKLHVAPHDKAVSITDTMTLVVKGEGGVEMRVKQT
                     GIAQGPGSSSGSGQPKSDAVMNKIKFEDLRIGSELGKGSQGKVRVAQHKITGEKYAMK
                     YISFDGDSDDMRCALEAELRQVAAVKHHNVVSSYEAFFRDGRLYVVLEYMDCGTMNNL
                     IDRHPEGFSEDMLAYIARELFKGLEFLHHLNMIHRDIKPANVLANAKGEIKISDFGVA
                     KTLSGGDLQTLSAQGSVPYMSPERIQSKPYSFNSDIWSAGLTIAECAFREYAFASLKP
                     KLFELCQAIASGTAKINWDDRETKFSDEFKEFIELCLRPEATRPSATEMLNHSLIQKA
                     SNVNPLEAGKWMSAKK"
     gene            complement(<834475..>835251)
                     /locus_tag="LMJF_24_2330"
                     /db_xref="GeneID:5652407"
     mRNA            complement(<834475..>835251)
                     /locus_tag="LMJF_24_2330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683699.1"
                     /db_xref="GeneID:5652407"
     CDS             complement(834475..835251)
                     /locus_tag="LMJF_24_2330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683751.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.2330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.2330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652407"
                     /db_xref="UniProtKB/TrEMBL:Q4QA97"
                     /translation="MEVEGTKERARGVTTFTRADLELREAAEDHRALLAEPWASHALR
                     KGYSGREEHTKWITETWEAFERRKEDQKLYLERHDLCLQYKAAQLSETRRLSEQKSAA
                     LVEKMMALEAARKGALLQSRHFLFVDYYDYQQFLFRNQRSFVEDEEKLLRCKLSETED
                     DLMCLLVIQWHLSSHLHAAREKERVEEEAAAERLREFQYRQKLEEERLREEQRIAQEK
                     EASQAEKEQAELEKRLERKRRDAERRAKVRAEREQRRAQE"
     gene            <836490..>837905
                     /locus_tag="LMJF_24_2340"
                     /db_xref="GeneID:5652408"
     mRNA            <836490..>837905
                     /locus_tag="LMJF_24_2340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683700.1"
                     /db_xref="GeneID:5652408"
     CDS             836490..837905
                     /locus_tag="LMJF_24_2340"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683752.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.24.2340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.24.2340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652408"
                     /db_xref="GOA:Q4QA96"
                     /db_xref="InterPro:IPR001537"
                     /db_xref="InterPro:IPR029026"
                     /db_xref="InterPro:IPR029028"
                     /db_xref="UniProtKB/TrEMBL:Q4QA96"
                     /translation="MRAMFSPSLKRLAHKDFDAWGYHIQWPQNQILSPLTGKVDFVVE
                     DIKFAYNAWCLLRLAMFFGVKHPKVLSDMTKTTPSMDIMLSGNRLFFMHSHVKANLSR
                     SKVRIALTPNHPRAFPVQELTWNTHCRFHDHQSAGVELVLGMENGLSQEVADACDLCT
                     YIPQYGSVGSLSMLSALGIAAHSTWCAAMRENGHTSHTSLPLHRASHGHMPLSNSPER
                     VRDTLPHEMDLLACSNEAVKALLEERRRSYDLQVSVLIYNELGDRNIGAVIRNANAFN
                     CEYVAIVNRRRFNRRGALGTHKVMNVPFFETVNDKAARQLFEGYEVWLLYPYYPNLVM
                     YEAEQKGDASNSSSTFVRHEDPILQSWGATQHHLTSEHPLVVRYPHLCQQGVFLDDDR
                     SLASCVQDVKRRKLRGILLAVPEEGCSPHPCLCKLSHRVVYVTSPSFLPHQTQRGLNP
                     ALSTAIALERLRCAADSSCLT"
CONTIG      join(FR796420.1:1..840950)
//
DBGET integrated database retrieval system