GenomeNet

Database: RefSeq
Entry: NC_007267
LinkDB: NC_007267
Original site: NC_007267 
LOCUS       NC_007267            1091540 bp    DNA     linear   CON 16-JUN-2017
DEFINITION  Leishmania major strain Friedlin complete genome, chromosome 26.
ACCESSION   NC_007267 CT005265
VERSION     NC_007267.2
DBLINK      BioProject: PRJNA15564
            BioSample: SAMEA3138173
            Assembly: GCF_000002725.2
KEYWORDS    RefSeq; complete genome.
SOURCE      Leishmania major strain Friedlin
  ORGANISM  Leishmania major strain Friedlin
            Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae;
            Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Rogers,M.B., Hilley,J.D., Dickens,N.J., Wilkes,J., Bates,P.A.,
            Depledge,D.P., Harris,D., Her,Y., Herzyk,P., Imamura,H., Otto,T.D.,
            Sanders,M., Seeger,K., Dujardin,J.C., Berriman,M., Smith,D.F.,
            Hertz-Fowler,C. and Mottram,J.C.
  TITLE     Chromosome and gene copy number variation allow major structural
            change between species and strains of Leishmania
  JOURNAL   Genome Res. 21 (12), 2129-2142 (2011)
   PUBMED   22038252
REFERENCE   2
  AUTHORS   Ivens,A.C., Peacock,C.S., Worthey,E.A., Murphy,L., Aggarwal,G.,
            Berriman,M., Sisk,E., Rajandream,M.A., Adlem,E., Aert,R.,
            Anupama,A., Apostolou,Z., Attipoe,P., Bason,N., Bauser,C., Beck,A.,
            Beverley,S.M., Bianchettin,G., Borzym,K., Bothe,G., Bruschi,C.V.,
            Collins,M., Cadag,E., Ciarloni,L., Clayton,C., Coulson,R.M.,
            Cronin,A., Cruz,A.K., Davies,R.M., De Gaudenzi,J., Dobson,D.E.,
            Duesterhoeft,A., Fazelina,G., Fosker,N., Frasch,A.C., Fraser,A.,
            Fuchs,M., Gabel,C., Goble,A., Goffeau,A., Harris,D.,
            Hertz-Fowler,C., Hilbert,H., Horn,D., Huang,Y., Klages,S.,
            Knights,A., Kube,M., Larke,N., Litvin,L., Lord,A., Louie,T.,
            Marra,M., Masuy,D., Matthews,K., Michaeli,S., Mottram,J.C.,
            Muller-Auer,S., Munden,H., Nelson,S., Norbertczak,H., Oliver,K.,
            O'neil,S., Pentony,M., Pohl,T.M., Price,C., Purnelle,B.,
            Quail,M.A., Rabbinowitsch,E., Reinhardt,R., Rieger,M., Rinta,J.,
            Robben,J., Robertson,L., Ruiz,J.C., Rutter,S., Saunders,D.,
            Schafer,M., Schein,J., Schwartz,D.C., Seeger,K., Seyler,A.,
            Sharp,S., Shin,H., Sivam,D., Squares,R., Squares,S., Tosato,V.,
            Vogt,C., Volckaert,G., Wambutt,R., Warren,T., Wedler,H.,
            Woodward,J., Zhou,S., Zimmermann,W., Smith,D.F., Blackwell,J.M.,
            Stuart,K.D., Barrell,B. and Myler,P.J.
  TITLE     The genome of the kinetoplastid parasite, Leishmania major
  JOURNAL   Science 309 (5733), 436-442 (2005)
   PUBMED   16020728
REFERENCE   3  (bases 1 to 1091540)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 1091540)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire, CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR796422.
            On Jun 1, 2012 this sequence version replaced NC_007267.1.
            Data release policy www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1091540
                     /organism="Leishmania major strain Friedlin"
                     /mol_type="genomic DNA"
                     /strain="Friedlin"
                     /db_xref="taxon:347515"
                     /chromosome="26"
     gene            complement(<1667..>1942)
                     /locus_tag="LMJF_26_0005"
                     /db_xref="GeneID:5653202"
     mRNA            complement(<1667..>1942)
                     /locus_tag="LMJF_26_0005"
                     /product="putative Lsm7p protein"
                     /transcript_id="XM_001683955.1"
                     /db_xref="GeneID:5653202"
     CDS             complement(1667..1942)
                     /locus_tag="LMJF_26_0005"
                     /codon_start=1
                     /product="putative Lsm7p protein"
                     /protein_id="XP_001684007.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0005"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0005"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653202"
                     /db_xref="GOA:Q4Q9J1"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9J1"
                     /translation="MSAEAAHILKKKEGILSLEKYLDRKIVVSQKGHEVHGVLKGFDN
                     NVNLVLADAELWHRDTHVRKIGACVVRGGPVNLILSGDTTMIPNPFI"
     gene            complement(<2380..>3468)
                     /locus_tag="LMJF_26_0010"
                     /db_xref="GeneID:5652736"
     mRNA            complement(<2380..>3468)
                     /locus_tag="LMJF_26_0010"
                     /product="brix domain containing-like protein"
                     /transcript_id="XM_001683956.1"
                     /db_xref="GeneID:5652736"
     CDS             complement(2380..3468)
                     /locus_tag="LMJF_26_0010"
                     /codon_start=1
                     /product="brix domain containing-like protein"
                     /protein_id="XP_001684008.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652736"
                     /db_xref="InterPro:IPR007109"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9J0"
                     /translation="MSSVGGFKRRTAKNATTRRAVKRYEPKVVENPKRVLFLKGVSSN
                     DVVTDAMVDLMAIAKPYCKKLAKKNAFFPFDGRQHLEFLGFKNDCSLFCFGSSNKKRP
                     NNLTIGRQFDFHILDMVELGIVAADRLDMSQTVGLDAGSMGGKPFFVFDGSEFVSDPT
                     FMRLKNLLVDYFRGGNDVEINLDGCDRVLFFSLRSKNGEDACVAPSADCYTNKPPSEK
                     GNAVLCMRHYAVKKPSAATGVPKSIKNIQLYDVGPNFDFEIRRISFATPQEFKVACRI
                     PRQTLATLRSTTDNVQSDGLNNLRGQLHVGKQDVQELNLRRFKAYRRGISSAAGDSGE
                     AADDASKPRRRRARGETDAGESRPETDI"
     gene            complement(<4675..>5100)
                     /locus_tag="LMJF_26_0020"
                     /db_xref="GeneID:5652737"
     mRNA            complement(<4675..>5100)
                     /locus_tag="LMJF_26_0020"
                     /product="methylmalonyl-coa epimerase-like protein"
                     /transcript_id="XM_001683957.1"
                     /db_xref="GeneID:5652737"
     CDS             complement(4675..5100)
                     /locus_tag="LMJF_26_0020"
                     /EC_number="5.1.99.1"
                     /codon_start=1
                     /product="methylmalonyl-coa epimerase-like protein"
                     /protein_id="XP_001684009.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652737"
                     /db_xref="GOA:Q4Q9I9"
                     /db_xref="InterPro:IPR017515"
                     /db_xref="InterPro:IPR029068"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9I9"
                     /translation="MPADLWRLNHVAIAVPASRSLVEAGEMYTRIFHAKVSEPVKQEE
                     HGVITVFVELANTKIELLHPLGDKSPIAAFLERNKDGGVHHICLEVPDLAAAMQTCKE
                     ANIRCLGTVPKIGAHGNPVIFLHPKDCGGVLTELEEVKS"
     gene            complement(<6376..>9294)
                     /gene="GCVP"
                     /locus_tag="LMJF_26_0030"
                     /db_xref="GeneID:5652738"
     mRNA            complement(<6376..>9294)
                     /gene="GCVP"
                     /locus_tag="LMJF_26_0030"
                     /product="putative glycine dehydrogenase"
                     /transcript_id="XM_001683958.1"
                     /db_xref="GeneID:5652738"
     CDS             complement(6376..9294)
                     /gene="GCVP"
                     /locus_tag="LMJF_26_0030"
                     /EC_number="1.4.4.2"
                     /codon_start=1
                     /product="putative glycine dehydrogenase"
                     /protein_id="XP_001684010.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652738"
                     /db_xref="GOA:Q4Q9I8"
                     /db_xref="InterPro:IPR003437"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR020580"
                     /db_xref="InterPro:IPR020581"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9I8"
                     /translation="MLRRLLRVHGVPAPAGLARYTSTDAYLNRHIGPTRKETAEMLKT
                     VGKESLADLMTTVLPSDILRTPLNNFKCLSETAALSYLKSLGAQNKVLKSMIGQGYYE
                     CIVPSAIMRNVLENPMWYTPYTPFQSEIAQGRLESLLNFQTMVTDLTKMDISNASLLD
                     QATAAGECLYLALNQHRHKRRKFFVSRDVFLSSIEMIRTRAHPLGAQVIVGDVQSLDL
                     DDAELSGIFVQTPDAKGELHDFTTIFARAKANGVVCCAGVDLMASCLVKPAGEMGADV
                     VVGCAQRFGTPLGYGGPHAAFMATTDNLKRLSPGRIVGISKDNAGDPAIRVALQTREQ
                     HIKRERATSNICTAQALLANMNAFYAIYHGPEGLKQLAREIHQKAKLFAVGMESLGFS
                     PVNTTYFDTLSFSMEAAPMTAADYAQRCVERGINLFVDGSTNQVSVSLDEATTEQHIA
                     ALLQAAGMPTPKIEALTRVADTICVIPEALLRKSKFLQSTVFNSHKSETELMRYAQHL
                     QRKDYGLTHGMIPLGSCTMKLNSAAAMRALSWPEYTALHPYAPEDQARGYHTLLADLK
                     QKLCDITGMAACSIQPNSGAQGEYAGLRIIRAYHESRGEAHRDVCFIPISAHGTNPAS
                     AVLAGLKVVTVKCLDDGSVDMVDLETKCVKHARDLACLMITYPSTYGLYDQNIRKITS
                     MVHEHGGQCYIDGANLNALVGYTGPGFIGGDVCHINMHKTFSIPHGGGGPGLGPITVR
                     PHLAPFLPNSTYGPAVGGSQAFGQVSQAGNGSASIATISYAFMMMLGSHGLKTCTEYA
                     VLNANYLKKRLEEHYTICFLDHSQFCAHEFILDIRPFKKTAHIDAEDVAKRLIDYGFH
                     APTLAFPVEGTLMIEPTESESKRELDRLADALISIRREIAAVERGDQPKDNNVLTNAP
                     HTAKCVTADEWNRPYSRQLAAYPTRHQYREKFWPSVGRVDNTYGDRNLMCSCAPLEFY
                     "
     gene            complement(<10378..>11268)
                     /locus_tag="LMJF_26_0040"
                     /db_xref="GeneID:5652739"
     mRNA            complement(<10378..>11268)
                     /locus_tag="LMJF_26_0040"
                     /product="putative protein kinase"
                     /transcript_id="XM_001683959.1"
                     /db_xref="GeneID:5652739"
     CDS             complement(10378..11268)
                     /locus_tag="LMJF_26_0040"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001684011.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652739"
                     /db_xref="GOA:Q4Q9I7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9I7"
                     /translation="MDKYALGPVIGEGQFGSVRMATVKATGQTVAVKLLHVPRLTEGI
                     PHPVARELLIASRVDSPFLVKTIEITPCGSHMAVVMERCMEDLACVLRKCSPAHPLPL
                     LLTQSYLRMLLTALHALHSSGILHRDVKPSNCFVSVDGCLKLGDFGLSRPLGSDMSHE
                     VVSRWYRAPELLFGQRRYGGEVDMWAAGCVFAELLRGHGRPFFTGDGDISQIAKIFDV
                     FGTPTGATCSFYRQLPDWEKVYFEEKKGTGLRVLLPFVPPEALDLLTKMLALDPASRC
                     SAAEALTHSFFALSDTLLRA"
     gene            complement(<12052..>12855)
                     /locus_tag="LMJF_26_0050"
                     /db_xref="GeneID:5652731"
     mRNA            complement(<12052..>12855)
                     /locus_tag="LMJF_26_0050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683960.1"
                     /db_xref="GeneID:5652731"
     CDS             complement(12052..12855)
                     /locus_tag="LMJF_26_0050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684012.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652731"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9I6"
                     /translation="MDVSQFLKSFKKNVAAKSKRSSSVRQSDEAANSGAEEDVTEIFH
                     SASDSEADGEAEDGEVILGGRADKMAGKRYTRNMDHSKRNREFAALKVVETNSVPAVE
                     AGRFQRQRAALARQATDARKPPRTEMIASVRAELLRQREKLRGSNALDSANQLDASVQ
                     KMETTMIEVEDLLQASAPTAATSASVLDFLPAAPLPAPRQATLTTASRAASIAVALSE
                     PQPPSSSVTNGRAGTPTVNDPALEEPPKLPKKRTKFELAMAMAHDEVAS"
     gene            complement(<16516..>17424)
                     /locus_tag="LMJF_26_0055"
                     /db_xref="GeneID:5652732"
     mRNA            complement(<16516..>17424)
                     /locus_tag="LMJF_26_0055"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683961.1"
                     /db_xref="GeneID:5652732"
     CDS             complement(16516..17424)
                     /locus_tag="LMJF_26_0055"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684013.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0055"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0055"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652732"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9I5"
                     /translation="MIENGEDEWSGVRAQNATPSSRELLERIQYNRELSRASSLARRR
                     VGALTPSDAEVQAVYAAREAAAAHQLEEILHGDRHRRRVVSMRYYDALMAATTDDVFQ
                     ESQPLSDVEARRVVLGPLRKLVAVLATRQRFAGLLRCASGVGDALHTDRVSAQLAAHS
                     ALPPPSPLPNISTLLRGIALPDMGASRRFAGSGHGDPAFDFVEAPRSRPWHEPFAFRL
                     KHFTPVPMPSFVLDVAAQAEREVRRSDGESPSAQEGDDVPTLLAVQPSGALTNVSLLA
                     PCTTSGRPAKAAAHGRSPAGAAPATG"
     gene            complement(<17814..>18623)
                     /locus_tag="LMJF_26_0058"
                     /db_xref="GeneID:12981816"
     mRNA            complement(<17814..>18623)
                     /locus_tag="LMJF_26_0058"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721756.1"
                     /db_xref="GeneID:12981816"
     CDS             complement(17814..18623)
                     /locus_tag="LMJF_26_0058"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721804.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0058"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0058"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981816"
                     /db_xref="UniProtKB/TrEMBL:E9ACT2"
                     /translation="MDFAERACVIDVGRSMISVCVSSAGEVQRWHVAVSRDAAVTLTA
                     ADLLVPGGRHSVALDRLLDMAVTTMRLATMTQVVVLSRSWVHPLFYTYVMRWLCAGVP
                     STTCVSQVPQALFAVQCAGVKSALVVQCDNGVLFATPVLDGVISSELESVWGDLGTSA
                     TVGAPLVEDCFREVRDRLIEFMQRNDQQADCKGHSEATCSGTPQSTLLTCAEDLFLAV
                     EQHIAACRKRELRACIETVVLCGDDVIAPATRQLIALVLSASLPDSLLMWV"
     gene            complement(<19293..>19526)
                     /locus_tag="LMJF_26_0060"
                     /db_xref="GeneID:5652733"
     mRNA            complement(<19293..>19526)
                     /locus_tag="LMJF_26_0060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683962.1"
                     /db_xref="GeneID:5652733"
     CDS             complement(19293..19526)
                     /locus_tag="LMJF_26_0060"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684014.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0060"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652733"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9I1"
                     /translation="MPGRHGKQRVKRKKSKRQPVTDMERTLKDSIHGRKRKERSILKN
                     LIPPKVVPKVNKLALSSALPMFQPRTGKKPRSA"
     gene            complement(<20024..>21094)
                     /locus_tag="LMJF_26_0070"
                     /db_xref="GeneID:5652734"
     mRNA            complement(<20024..>21094)
                     /locus_tag="LMJF_26_0070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683963.1"
                     /db_xref="GeneID:5652734"
     CDS             complement(20024..21094)
                     /locus_tag="LMJF_26_0070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684015.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0070"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652734"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9I0"
                     /translation="MGKKGSLQQFHAMPPRLSHPDALAVVDLAVNGVVVRLHLASRCL
                     PCAYTVALPVEAVRADARRYNGFTELHFCVDVPQRSARCRGLFLALRLPWGTVHYLGP
                     LTHNAPVTSARFVREVPSLVTLLVDVDWCAPVEVGAPLPCEMLLKEHVRTVIENDEFC
                     GSIAAAHVQNLVRDLPFYDAAMQRFRNWSEYVIFFAECYRCWRIVQYEPEEHAALGLS
                     SRTPAGEQRMVANCYADDYARADVHRDRVKRRALQEFRDCLAARGAELSWPPRKDRKA
                     EPFFNLSRKVLLKLGCERSFRTLNSANYLHVLEGLRTSHSVLFSELHPVQVDAAVSTD
                     TSLGLLLRRVPAAKQPPSPLQG"
     gene            complement(<21865..>22533)
                     /locus_tag="LMJF_26_0075"
                     /db_xref="GeneID:5652735"
     mRNA            complement(<21865..>22533)
                     /locus_tag="LMJF_26_0075"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683964.1"
                     /db_xref="GeneID:5652735"
     CDS             complement(21865..22533)
                     /locus_tag="LMJF_26_0075"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684016.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0075"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0075"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652735"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9I2"
                     /translation="MALTTDQTLFILYHSNSYAANPVMLRSSKPMVMRDVFLTRSSAF
                     YPNPLSCLYVTNGTDCIVNCVMAWAVAKPLTEVLGWRHAMAVYVGAGLFSSFAYVFAA
                     QVSRTKTNSQFDCNATSNGAYAGYATLSLMMRGCYIPYLKRVPVMWAGVPYLLKCTYD
                     EYVSPRLVERRRAGDIELRNWGFVGGVFFTLIYSSLFFRTRNDFSLARKFFQNLPPRA
                     AMEK"
     gene            complement(<25554..>25787)
                     /locus_tag="LMJF_26_0100"
                     /db_xref="GeneID:5652740"
     mRNA            complement(<25554..>25787)
                     /locus_tag="LMJF_26_0100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683965.1"
                     /db_xref="GeneID:5652740"
     CDS             complement(25554..25787)
                     /locus_tag="LMJF_26_0100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684017.1"
                     /db_xref="GeneID:5652740"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9I1"
                     /translation="MPGRHGKQRVKRKKSKRQPVTDMERTLKDSIHGRKRKERSILKN
                     LIPPKVVPKVNKLALSSALPMFQPRTGKKPRSA"
     gene            complement(<26285..>27355)
                     /locus_tag="LMJF_26_0110"
                     /db_xref="GeneID:5652741"
     mRNA            complement(<26285..>27355)
                     /locus_tag="LMJF_26_0110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683966.1"
                     /db_xref="GeneID:5652741"
     CDS             complement(26285..27355)
                     /locus_tag="LMJF_26_0110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684018.1"
                     /db_xref="GeneID:5652741"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9I0"
                     /translation="MGKKGSLQQFHAMPPRLSHPDALAVVDLAVNGVVVRLHLASRCL
                     PCAYTVALPVEAVRADARRYNGFTELHFCVDVPQRSARCRGLFLALRLPWGTVHYLGP
                     LTHNAPVTSARFVREVPSLVTLLVDVDWCAPVEVGAPLPCEMLLKEHVRTVIENDEFC
                     GSIAAAHVQNLVRDLPFYDAAMQRFRNWSEYVIFFAECYRCWRIVQYEPEEHAALGLS
                     SRTPAGEQRMVANCYADDYARADVHRDRVKRRALQEFRDCLAARGAELSWPPRKDRKA
                     EPFFNLSRKVLLKLGCERSFRTLNSANYLHVLEGLRTSHSVLFSELHPVQVDAAVSTD
                     TSLGLLLRRVPAAKQPPSPLQG"
     gene            complement(<28126..>28833)
                     /locus_tag="LMJF_26_0115"
                     /db_xref="GeneID:5652742"
     mRNA            complement(<28126..>28833)
                     /locus_tag="LMJF_26_0115"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683967.1"
                     /db_xref="GeneID:5652742"
     CDS             complement(28126..28833)
                     /locus_tag="LMJF_26_0115"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684019.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0115"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0115"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652742"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9H9"
                     /translation="MPSYAEITGSIVAMALTTDQTLFILYHSNSYAANPVMLRSSKPM
                     VMRDVFLTRSSAFYPNPLSCLYVTNGTDCIVNCVMAWAVAKPLTEVLGWRHAMAVYVG
                     AGLFSSFAYVFAAQVSRTKTNSQFDCNATSNGAYAGYATLSLMMRGCYIPYLKRVPVM
                     WAGVPYLLKCTYDEYVSPRLVERRRAGDIELRNWGFVGGVFFTLIYSSLFFRTRNDFS
                     LARKFFQNLPPRAAMEK"
     gene            complement(<31149..>31862)
                     /gene="APRT"
                     /locus_tag="LMJF_26_0140"
                     /db_xref="GeneID:5652743"
     mRNA            complement(<31149..>31862)
                     /gene="APRT"
                     /locus_tag="LMJF_26_0140"
                     /product="adenine phosphoribosyltransferase"
                     /transcript_id="XM_001683968.1"
                     /db_xref="GeneID:5652743"
     CDS             complement(31149..31862)
                     /gene="APRT"
                     /locus_tag="LMJF_26_0140"
                     /EC_number="2.4.2.7"
                     /codon_start=1
                     /product="adenine phosphoribosyltransferase"
                     /protein_id="XP_001684020.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652743"
                     /db_xref="GOA:Q4Q9H8"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9H8"
                     /translation="MSFKEISPNSFLLEDSHPLSQLLKKNYCWYSPVFSPRNVPRFAD
                     VSSITESPETLKAIRDFLVQRYRTMSPAPTHILGFDARGFLFGPMIAVELGIPFVLMR
                     KADKNAGLLIRSEPYEKEYKEAAPEVMTIRYGSISKGSRVVLIDDVLATGGTALSGLQ
                     LVEASDAMVVEMVSILCIPFLKAAEKIHSTGHSRYKDIKFISLLSEEALTEDNCGDSK
                     NYTGPRVVSCGDVLSKHSQ"
     gene            complement(<32645..>34441)
                     /locus_tag="LMJF_26_0150"
                     /db_xref="GeneID:5652744"
     mRNA            complement(<32645..>34441)
                     /locus_tag="LMJF_26_0150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683969.1"
                     /db_xref="GeneID:5652744"
     CDS             complement(32645..34441)
                     /locus_tag="LMJF_26_0150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684021.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652744"
                     /db_xref="InterPro:IPR019140"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9H7"
                     /translation="MPTQHDMEALLRELSTTSGSIAEAVRYAHKYLQSPECRSTAIDV
                     FPPTQLAHSIGKLCRCRGMIQEVQPELHLFCASRQNFFSSSGAQEAADGDEVQYMDAV
                     SLYVIPVPGNLHFYTADEPPRTSGAAHEGTLRKRADRDEDAPTGVPTSSTEEECIRKC
                     VRQMTSESDTVTATAQSSSLSAFGPSLNFPHPSCSPQLQGACVVTVLLPAENGARQNP
                     FRINDVIDFYGFQHFPDDQLQVNDVDDFQRFSAWNATELSRGLVSRLLCLSYTPVSSL
                     QVRHHIATPPLIASPMTEARTNAIAYLTGTLTRGDALTAEYLILHLCARVNMHSASTP
                     VGDLPLLISSPQLVAAEWSAQLREIVPVAEILLTGEVLRALPQGRVTPKYNNDLNYLE
                     TGVLQVANGTHVTIDCASLGSRDEAWYEGMFALIHKQQLLLEYPYQTLELPVDVSTLA
                     VDGRDAPDAVHPLFRFAMSLRWSPDPKLPPQEAAQTHQVSSGAVRDYLDAVRCLDAPS
                     PVNDTLSERASRALFEMSRNLPGWNNRDPLLHNNSFSVAMALMRSHAASHGRRDVVAE
                     DIAAVCELERARMERLRATPSSVLPTASSAAE"
     gene            complement(<38467..>39339)
                     /locus_tag="LMJF_26_0160"
                     /db_xref="GeneID:5652745"
     mRNA            complement(<38467..>39339)
                     /locus_tag="LMJF_26_0160"
                     /product="nuclear lim interactor-interacting factor-like
                     protein"
                     /transcript_id="XM_001683970.1"
                     /db_xref="GeneID:5652745"
     CDS             complement(38467..39339)
                     /locus_tag="LMJF_26_0160"
                     /codon_start=1
                     /product="nuclear lim interactor-interacting factor-like
                     protein"
                     /protein_id="XP_001684022.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652745"
                     /db_xref="GOA:Q4Q9H6"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="InterPro:IPR011948"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9H6"
                     /translation="MSSAHKPTTQEAINFFKQYREKFQRSSSGGNSPSQNSVNASPQQ
                     NIVTQVQQVDVVPDLTTRSIIPMNRRNGTTTTRLDLLRKSPTNCSPCLVQEVEIKPLL
                     PPLPFASVPKVTLVLDVDETLVHSTFQPSSDVVYDKVLLVPSEGKTYTVSVKYRPYLE
                     DFLRFVSRRFEVVIFTASMRAYCDKLMDEIDPHGILGNLRLFREHCTFSERSYVKDLH
                     RLGRDLRRVVILDNSPAAYSFQQRNAIPIKTWINDPKDRELFLLLPLLDRLAMCDSVY
                     SELDPYNARGCDYL"
     gene            complement(<44813..>45571)
                     /locus_tag="LMJF_26_0170"
                     /db_xref="GeneID:5652746"
     mRNA            complement(<44813..>45571)
                     /locus_tag="LMJF_26_0170"
                     /product="putative 60S ribosomal protein L7"
                     /transcript_id="XM_001683971.1"
                     /db_xref="GeneID:5652746"
     CDS             complement(44813..45571)
                     /locus_tag="LMJF_26_0170"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L7"
                     /protein_id="XP_001684023.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0170"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652746"
                     /db_xref="GOA:Q4Q9H4"
                     /db_xref="InterPro:IPR005998"
                     /db_xref="InterPro:IPR012988"
                     /db_xref="InterPro:IPR016082"
                     /db_xref="InterPro:IPR018038"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9H4"
                     /translation="MATHSVYGNASDMPAVPAPESAIKRAAFKQQQTESFKKAVVARK
                     AAKAALKKTAYLRARKYSREYRGAEKKLVTLRRQAASHGNYYLEAKPKVAVVTRIRGI
                     AKVNPKQRKILQLLRLRQIFNTVFVKMNKPMENMLRAVEPYIAYGYPSLATVRAMVYK
                     RGYLKINGQRVKITDNQMIKDKYNNVDIVCAEDMVNQIYTCGKHFRTVTHGMWPFKLA
                     PPAGGMRQKRRHFVEGGDYGNRDTLINRFLARMI"
     gene            complement(<46561..>47319)
                     /locus_tag="LMJF_26_0180"
                     /db_xref="GeneID:5652747"
     mRNA            complement(<46561..>47319)
                     /locus_tag="LMJF_26_0180"
                     /product="putative 60S ribosomal protein L7"
                     /transcript_id="XM_001683972.1"
                     /db_xref="GeneID:5652747"
     CDS             complement(46561..47319)
                     /locus_tag="LMJF_26_0180"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L7"
                     /protein_id="XP_001684024.1"
                     /db_xref="GeneID:5652747"
                     /db_xref="GOA:Q4Q9H4"
                     /db_xref="InterPro:IPR005998"
                     /db_xref="InterPro:IPR012988"
                     /db_xref="InterPro:IPR016082"
                     /db_xref="InterPro:IPR018038"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9H4"
                     /translation="MATHSVYGNASDMPAVPAPESAIKRAAFKQQQTESFKKAVVARK
                     AAKAALKKTAYLRARKYSREYRGAEKKLVTLRRQAASHGNYYLEAKPKVAVVTRIRGI
                     AKVNPKQRKILQLLRLRQIFNTVFVKMNKPMENMLRAVEPYIAYGYPSLATVRAMVYK
                     RGYLKINGQRVKITDNQMIKDKYNNVDIVCAEDMVNQIYTCGKHFRTVTHGMWPFKLA
                     PPAGGMRQKRRHFVEGGDYGNRDTLINRFLARMI"
     gene            complement(<48867..>49352)
                     /locus_tag="LMJF_26_0185"
                     /db_xref="GeneID:5652748"
     mRNA            complement(<48867..>49352)
                     /locus_tag="LMJF_26_0185"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683973.1"
                     /db_xref="GeneID:5652748"
     CDS             complement(48867..49352)
                     /locus_tag="LMJF_26_0185"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684025.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0185"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0185"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652748"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9H3"
                     /translation="MRRFFECMSQALRERVLVPLSQLTWAEVLVAVSVGVLGGIFPVP
                     FVTSLATLVIGYYLRCTATELVLASTINFFCTPLQFALLPSLAHLAGFLTQAEVDAFT
                     AHALHESLRVDYTTFLRSCGRMIFYATVGWFFVAIPIVMILRSAQRCILHRHVHKEMV
                     E"
     gene            complement(<50385..>51107)
                     /locus_tag="LMJF_26_0190"
                     /db_xref="GeneID:5652749"
     mRNA            complement(<50385..>51107)
                     /locus_tag="LMJF_26_0190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683974.1"
                     /db_xref="GeneID:5652749"
     CDS             complement(50385..51107)
                     /locus_tag="LMJF_26_0190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684026.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652749"
                     /db_xref="GOA:Q4Q9H2"
                     /db_xref="InterPro:IPR001075"
                     /db_xref="InterPro:IPR014824"
                     /db_xref="InterPro:IPR017065"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9H2"
                     /translation="MLTDGALTGSSFAARAVQRRCIVVETNETPNPDCMRFFSMDLSF
                     LKPEFSMDITSPAQAYKSPLAEALFGVAGVQAVFLADEYVTVRKHPQADWAALIPIIK
                     EVIVEFAESKENVLSAAGEEELLGYNNDTEPDEDDDEVVLAVKELLATRIRPMLRADG
                     GNVRFIDMDEGTVFLLLEGSCKSCPSSHITLKSGIERMLMHWIPEVVEAQEVSDEVAA
                     DILSEKQLRKQLKEKGEVVEAK"
     gene            complement(<53139..>54359)
                     /locus_tag="LMJF_26_0200"
                     /db_xref="GeneID:5652750"
     mRNA            complement(<53139..>54359)
                     /locus_tag="LMJF_26_0200"
                     /product="cell cycle regulation-like protein"
                     /transcript_id="XM_001683975.1"
                     /db_xref="GeneID:5652750"
     CDS             complement(53139..54359)
                     /locus_tag="LMJF_26_0200"
                     /codon_start=1
                     /product="cell cycle regulation-like protein"
                     /protein_id="XP_001684027.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652750"
                     /db_xref="GOA:Q4Q9H1"
                     /db_xref="InterPro:IPR004405"
                     /db_xref="InterPro:IPR005140"
                     /db_xref="InterPro:IPR005141"
                     /db_xref="InterPro:IPR005142"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9H1"
                     /translation="MRLLSKAAHPDGSMEVRVSVGTAEDLWHLYNFILVGDLVLTKTR
                     RKVPRENALGTLAAEMKMLKLEVEVKHIAFTPDELRIQGVNKKENNFVKTGAHHTLTI
                     HANPPQEVRITKREWDSICEDRLKDACDESGKADTAAVLMSFGEAQVLLVTRSFVHIK
                     AKVEVTISKKHKSDGKARDKSIERFFKQSLDALVTHVDFEKTKLVLLCSPGHVREEFH
                     AYIKEVTQRADHGPLREVYLNLSRFLLVKVSSTTISGLKEALSDPGVAQRMESTKCVD
                     DIRMWEKFQDTMNKDPDRCVYTPQYVYYAAMAGAVGGLMISDDVFRSENPTERRFFLS
                     LVNFVRQSGSPTVNVFSSKHVTGEQLTQLGSVAAVLRFSCPEIDDMEVVPEFLASKEV
                     EEFIRANATARVTV"
     gene            complement(<55441..>56562)
                     /gene="SIR2RP1"
                     /locus_tag="LMJF_26_0210"
                     /db_xref="GeneID:5652751"
     mRNA            complement(<55441..>56562)
                     /gene="SIR2RP1"
                     /locus_tag="LMJF_26_0210"
                     /product="NAD-protein-arginine ADP-ribosyltransferase"
                     /transcript_id="XM_001683976.1"
                     /db_xref="GeneID:5652751"
     CDS             complement(55441..56562)
                     /gene="SIR2RP1"
                     /locus_tag="LMJF_26_0210"
                     /EC_number="2.4.2.31"
                     /codon_start=1
                     /product="NAD-protein-arginine ADP-ribosyltransferase"
                     /protein_id="XP_001684028.1"
                     /db_xref="GeneID:5652751"
                     /db_xref="GOA:Q25337"
                     /db_xref="InterPro:IPR003000"
                     /db_xref="InterPro:IPR017328"
                     /db_xref="InterPro:IPR026590"
                     /db_xref="InterPro:IPR026591"
                     /db_xref="InterPro:IPR029035"
                     /translation="MTGSPRAPHQEHALGEPTVEGLARYIREKDVRRILVLVGAGASV
                     AAGIPDFRSSDTGIYAKLGKYNLDDPTDAFSLTLLREKPEIFYSIARELNLWPGHFQP
                     TAVHHFIRLLQDEGRLLRCCTQNIDGLEKAAGVSPELLVEAHGSFAAAACIECHTPFS
                     IEQNYLEAMSGTVSRCSTCGGIVKPNVVFFGENLPDAFFDALHHDAPIAELVIIIGTS
                     MQVHPFALLPCVVPKSIPRVLMNRERVGGLLFRFPDDPLDTIHDDAVAKEGRSSSSQS
                     RSPSASARREEGGTEDGSSSPNEEVEDASTSSSSDGYGQYGDYYAHPDVCRDVFFRGD
                     CQENVLKLAECLGLREALAKRMRFSGAAPATARKTSNET"
     gene            complement(<57202..>58146)
                     /locus_tag="LMJF_26_0220"
                     /db_xref="GeneID:5652752"
     mRNA            complement(<57202..>58146)
                     /locus_tag="LMJF_26_0220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683977.1"
                     /db_xref="GeneID:5652752"
     CDS             complement(57202..58146)
                     /locus_tag="LMJF_26_0220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684029.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652752"
                     /db_xref="InterPro:IPR019363"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9G9"
                     /translation="MSSPNTIVAWRAPVAGGAVVDVLQSSSNLLQYLSTEESSNDGRR
                     LPSSHRKLLFFFPGNPGLVQFYEPLCAFLETNKFDVLVMGYAGHSLTELNEGRVFSLA
                     DQVDIAESFVATLMNKNTERKYNGNIYAAGHSIGGFVALQMVARYSVIKKCFGLCPVM
                     SHMRDSPNGRRLFYLSSTFVQCCLAMVAALLGLLPYKLRLLLITTLEPNLSFALGEAL
                     AHHFHRRCLTNSLYMAMTEFRMLLQPDAALLRCVQERLILYYVKKDGWAPLSFAEEIG
                     GICPRLGACVIEEDAGVPHAWCLNHSETVARNAILKHC"
     gene            complement(<59667..>60797)
                     /locus_tag="LMJF_26_0230"
                     /db_xref="GeneID:5652753"
     mRNA            complement(<59667..>60797)
                     /locus_tag="LMJF_26_0230"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683978.1"
                     /db_xref="GeneID:5652753"
     CDS             complement(59667..60797)
                     /locus_tag="LMJF_26_0230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684030.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652753"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9G8"
                     /translation="MEAEGVDELPLTEASFRALEEAYERQWCQTRLLCEAPTSCADVH
                     VVAAASSAAEHMRRLWADTVRLHRRFVEVKQHRDRSFTQEERASLRLLGFRSPPPASS
                     SALTHTMSPVPSPLHTPYETTASRQAGELVALRKECARLRHEGAQLLSILACYQLREA
                     HALGLDNGARISSPSQGTSTSASDAYAELAEVQRQYRLLLSPTAAEYTLTPLDGVQRA
                     EDVAIAEVLVECGFPRHVSVVRLGPEGLFLIDRPVWIGFASPQSATLMVRDPEGLHHG
                     CTLESYLTAVYAPLLRAFHWQKPSTGAQLAGGSAAPTSSAALSFPAVPVTPAPLPDAV
                     KRERSPSTRHSVLSQLTYEELVELKHTTLPRLGRTSEAASPS"
     gene            complement(<61861..>62409)
                     /locus_tag="LMJF_26_0240"
                     /db_xref="GeneID:5652754"
     mRNA            complement(<61861..>62409)
                     /locus_tag="LMJF_26_0240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683979.1"
                     /db_xref="GeneID:5652754"
     CDS             complement(61861..62409)
                     /locus_tag="LMJF_26_0240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684031.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652754"
                     /db_xref="GOA:Q4Q9G7"
                     /db_xref="InterPro:IPR001040"
                     /db_xref="InterPro:IPR023398"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9G7"
                     /translation="MADSNPTKEGTSSAPLHPLKDKWFVFYIPASKGNEYEHETKELG
                     YVSTIEEVYSTINTLPPITLLPNDDNLVFSRNKIEPQFESFPGGMRFSIFCKTKTQCR
                     EALTYVVAVVLGEAIGRDACKGECVCDIVRIGHKGSAMYKESVRIEVWAHQSPYNTAM
                     EKYLVSTLSAIPGITVSARPFK"
     gene            complement(<63198..>66578)
                     /locus_tag="LMJF_26_0250"
                     /db_xref="GeneID:5652755"
     mRNA            complement(<63198..>66578)
                     /locus_tag="LMJF_26_0250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683980.1"
                     /db_xref="GeneID:5652755"
     CDS             complement(63198..66578)
                     /locus_tag="LMJF_26_0250"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684032.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652755"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9G6"
                     /translation="MDTSSSARHADQLSVVHLSHLHEGVLQLREHLRSALLDDSPQTE
                     MIVYTRLYQLYRDFYLPFFVAKSHIPSRSPPGAGSAPSLGARPAASAEARFIMATYTQ
                     DVLAACVYLLDPASLPATYIVTLTPPACEEAHNEANASSVYISAAQRRFCGRVFVYTC
                     WSSAALPLHMVLQALYPLLDPGVSGTPPATATTLLTPTSPPRERQGPSLIENHIAADL
                     FSQERFASRKRLLRDTLTGLVLTRANGVRALFRVLLLNDRVTPEMTGEAAQLLVQLLT
                     SPVFTLWQQQQQQQQQLGETLGHRSPFSGAGEEECAAEVVVTHVTTALSVEDQVRLLA
                     PQLLALLEEHADATSAVSSESCTAARPRFLARLDAARLRLPAETLEQRLHLATAMLLN
                     ALTRLPPRDKHDFARSYRQFFYTNKFVLSPGFGCLSLRSDTDVVENDAIAALLRLRSL
                     IKGVSSGAGSGVMAHLLPATAAGLLSICAVLASSGDGDDNAAQFVSPSLPAALRSLFT
                     ELLSNPSLYDLCARALVNACGKAHAHCYLPGNAAQPRLRYTRDVCGRERLVTGLQWLL
                     LDVAATTPGFVHACVDVMVEACHLELFAAGVENVTVSPALRLTETTSLVNAPKTEGDT
                     SPLIALLERLSLEATPEALFGSRGASLASTLELLGRMLGLSGVLHRWALGLVEHLLAA
                     SSVEAHLGGGDTRAERWQNLSRLQRCGRNILASLTLLSTSTPRGGTWHSVILTDDAQL
                     SLIAGARQVLGAFLERIEEHLASCEAVAQLSHGKQHRQGEAITAVRAEWEQLAEKLRA
                     ALDSRVAIDVAVTLATLARGVDDVVCEVTDPQPLYDTTQRLLRLLVRVLFEADDVGAA
                     VRAVHCVTWLGMYRFDSKDSTYMADVMWSVLAENHLPPWLAASVGYTVTTQAATASRL
                     CRLRVRVLDILLSLTDYDEDDRTLRNLDDSLRRKHHASLYDVLVALCCATQDAFVQVA
                     ALHFIGTYALAMQPRVPVSAVCNLCRDVFRLSRHEMAKAACAAALGKIVASLCHPSDA
                     TLLVLSELDIDTLQTLALAMSSYRGRPYVEGNVSVTAPAISAAAEADLHDEVIRLHGR
                     EMLALLRRTFVGVGGTRADAAPAAADDLRVLSLRVSEL"
     gene            complement(<67088..>68917)
                     /locus_tag="LMJF_26_0260"
                     /db_xref="GeneID:5652756"
     mRNA            complement(<67088..>68917)
                     /locus_tag="LMJF_26_0260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683981.1"
                     /db_xref="GeneID:5652756"
     CDS             complement(67088..68917)
                     /locus_tag="LMJF_26_0260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684033.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652756"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9G5"
                     /translation="MHEIHGVCLALVKAAPESRPAILVEFASSLEVIWTVAKRQLREE
                     ERTQSATRFKVHAETLVAMLQRCVRDTADSGTVALCRSLQRLLEEQGFPEAEFGPLAS
                     YLAELLLEEDVHGYSYSERTSLVMPMPVRYEGDKRSEEEHSRKRAGFEVVLPLFHPHP
                     EVNTIVQLSEPKKRKPALDEYRIFSLPKKAAGFAADDFVVDDELLHRAYVVLATHLDA
                     YGSLKGLSPYARLLLWNLLDRNDALFSALYDQHVTSESMRQQLLKVRELLAVHKQAFE
                     ETRVTARQTASVVGWYATSAQWRDQALSRLDELEESDWYLLADVYRSGGKAIFPNYAR
                     SNAVAHLALGAVRKLDKIHGQELDGAPPMHTVVLQLLLPLLMGEAPELGECCFRHGAF
                     GANSPHWQRRRRKLKTAMDEVARKTTLPAAKTSASPQASVCTYLCASLIFPLQCLGEL
                     LELCSLVIFSPMGFDAFTRSFLATNWEEEDAILAYLLRREPANPSLVPLVGIPRIYKD
                     MVTSVQLLMADRMVPYVVEARRLAGEHAQVSVRHRSYPYWRALCTMFVEEDRFDDLCA
                     LQVSTKEDPTRLYTVAGFELVPKVWPEDLVELREEESCRCGAG"
     gene            complement(<70024..>71517)
                     /locus_tag="LMJF_26_0270"
                     /db_xref="GeneID:5652757"
     mRNA            complement(<70024..>71517)
                     /locus_tag="LMJF_26_0270"
                     /product="putative ras-like small GTPases"
                     /transcript_id="XM_001683982.1"
                     /db_xref="GeneID:5652757"
     CDS             complement(70024..71517)
                     /locus_tag="LMJF_26_0270"
                     /codon_start=1
                     /product="putative ras-like small GTPases"
                     /protein_id="XP_001684034.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652757"
                     /db_xref="GOA:Q4Q9G4"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR015946"
                     /db_xref="InterPro:IPR016484"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9G4"
                     /translation="MEDTARTDEQRRRVAGWTPVVKTLGDHRLRVAIVGRMNSGKSSL
                     FNLLCEDPTMPAKKNIVKDFNGITRDCVEAHAALDDLHFTVIDTPGLLGGKLVEEAFR
                     TVETADAAIFVTAVDEDVSAEEHDLIQYLAAKKMPTCLLVNKMDLVPEEEEALVLDVY
                     NRLGLGKAVPFSARKREGLDMLSALLEPLYHIHAMRKVENDWDIEDLAMAGDEAAMEE
                     IRDRNCTDRYIRVAIVGRTNSGKTSLVNRLVGYERNRAADESNTTRDPIEIACMYKGR
                     KLKLIDTAGLARQRYRTDREFLSRIHSLSLNEIRYAHVVIVVFDATEGHPNKYDMSIL
                     HKVAQEGRPFVLCANKWDAVLDQSATAEAIDFKIKRQVQEVKYSNAVVVSAHTGMNLT
                     LLMDQVLELYDTWNKRVRRSELTKFWRKLEKSVIIPYHVARVGRITQISTRPPTFLLQ
                     LQTKKEESQLPKALQEMMKNAITEEFGFRGVPLRLVQEVKDSNPDYI"
     gene            complement(<72619..>73227)
                     /locus_tag="LMJF_26_0280"
                     /db_xref="GeneID:5652758"
     mRNA            complement(<72619..>73227)
                     /locus_tag="LMJF_26_0280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683983.1"
                     /db_xref="GeneID:5652758"
     CDS             complement(72619..73227)
                     /locus_tag="LMJF_26_0280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684035.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652758"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9G3"
                     /translation="MGQRQSFEEKLHECVCNNNVDQMKELIRQPEFVGENMSDTLFLD
                     LVERCWDPATTMAFAKHANDHQLAILVSTAIIHSRVLPLGSLFDLMKDASATIQHEHL
                     DELFMTACDHIDTEAVKAMVTANCFDPTDGRPIVTVVRRELSKMAPDEELVQLVLDAL
                     PGHEDAATYLLETCVPTAKNVATKAMLTTKLKNYVACTKHAG"
     gene            complement(<74485..>75300)
                     /locus_tag="LMJF_26_0290"
                     /db_xref="GeneID:5652759"
     mRNA            complement(<74485..>75300)
                     /locus_tag="LMJF_26_0290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683984.1"
                     /db_xref="GeneID:5652759"
     CDS             complement(74485..75300)
                     /locus_tag="LMJF_26_0290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684036.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652759"
                     /db_xref="GOA:Q4Q9G2"
                     /db_xref="InterPro:IPR016706"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9G2"
                     /translation="MSLKAKLDVYPVENYTQTSVDVSNGHAGVAGNKVNLGAGSAAPF
                     RPPSAIEKLLSLKKRCEEEPCVHSVEGVLLVHLHRHPHILLMKQINSRTRDADGMRTV
                     PPSNTNAEVTYRLPGGRCRRGEAEESCLLRKLGRHLLNEAKTPAGAAEVASTGNSDTV
                     VDVGMTHTASKAGSCFRVGEVLATWYRPHFTPHMYPYVPAHIAAGSVREVRTIYLVHL
                     EPTVYFTMVQESVELVAAPLFDLYENSSKYGPIVASLPVLLSRVLINYCSTEY"
     gene            complement(<76073..>78736)
                     /locus_tag="LMJF_26_0300"
                     /db_xref="GeneID:5652760"
     mRNA            complement(<76073..>78736)
                     /locus_tag="LMJF_26_0300"
                     /product="aminopeptidase-like protein"
                     /transcript_id="XM_001683985.1"
                     /db_xref="GeneID:5652760"
     CDS             complement(76073..78736)
                     /locus_tag="LMJF_26_0300"
                     /EC_number="3.4.11.-"
                     /codon_start=1
                     /product="aminopeptidase-like protein"
                     /protein_id="XP_001684037.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652760"
                     /db_xref="GOA:Q4Q9G1"
                     /db_xref="InterPro:IPR001930"
                     /db_xref="InterPro:IPR014782"
                     /db_xref="InterPro:IPR024571"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9G1"
                     /translation="MAAVRHVLPSSVRPTHYHIALSPDLENATFSAEVAINVHINEPT
                     STFVLNAVGLSFFDVSVRAGVGGGGNDAPLAVQSITESTEDQRIFVQVDRAVTDAAQL
                     RFRYTAAMSDNLFAFYRSQYTYEGATSYVGATQMCPAEARRVFPCWDEPAVKATFALD
                     ITVLARLRVWSNDAPRKVVQLPDGLARWEFRPAMVMSTYVVAWVIGELETTEVVVPRS
                     AAAGAAQRGEPASSSSVVIRAVTPRGKIEQARFALTVAAQVLPLYEECFQFPYVFPKL
                     DLIALPNFVFGAMENWGCITFREQTLLASEEASAMQKERVAMVVAHELAHQWFGNLAT
                     MAWWSDLWLNESFATYMAVWAVNKIFPEWVVDTQFAHDEGSRAFQLDAMRSSHPIELP
                     VRDVREVDSIFDAISYSKGAMVLHMAAKFVGEKGFQRGLVDYLSRYAYASATSLQLWE
                     ALSGPAAPNLKEILHSWTREQGYPYVLAAYDAATGTLALSQRRFFVVSDVAADKDAPL
                     WKIPMAYTYGTAGGEVKTRSVVLADSTTSVSIDGAVWVKVNSGQIAFCRVQYTAEMLR
                     GLVCPLTAKVINSTDRYSILADYAAFARGGYCDTVQVIDLLSHYHSEDNYTVWCEVAQ
                     LEKDLRGILACSSPEVCVAFNDFCNRLYSPAMQRLGLQPRQGDGHRTQQARLLIFSRL
                     LSCSNVEATTVARDLYDKRTTSPISPDMLGCVYAVHINTHGAAAMAEVQELIAKTTYA
                     EERVQYLGALAAVAEPSIDVPKLMDYLLSDAVSSQDMFTVMLGLAEGAQTQTIFVQQL
                     MDKWPRLAQKAPSVLLARMLKLVEHSSDDALVAPLRRFFDSMPEEMQSRTRMSFEQGV
                     EGLLCNVAWAARDGARIAHYLLHKGTPVKTE"
     gene            complement(<79643..>81646)
                     /locus_tag="LMJF_26_0310"
                     /db_xref="GeneID:5652761"
     mRNA            complement(<79643..>81646)
                     /locus_tag="LMJF_26_0310"
                     /product="6-phosphofructo-2-kinase/fructose-2,
                     6-biphosphatase-1-like protein"
                     /transcript_id="XM_001683986.1"
                     /db_xref="GeneID:5652761"
     CDS             complement(79643..81646)
                     /locus_tag="LMJF_26_0310"
                     /EC_number="2.7.1.105"
                     /EC_number="3.1.3.46"
                     /codon_start=1
                     /product="6-phosphofructo-2-kinase/fructose-2,
                     6-biphosphatase-1-like protein"
                     /protein_id="XP_001684038.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652761"
                     /db_xref="GOA:Q4Q9G0"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR003094"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR013079"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9G0"
                     /translation="MSEAAPPPVLGTASSAVAPQPFGGSEASRKRRLKPISFQRMAMI
                     QEEIARIDKHLEALEASESKVVDPDSVGQHNLTTEDVIDPVVLHMLTVELCQLAASGD
                     AVGARILLTGGADPNSRDYDGRTLLHIACMNGRLSVVTVLLEFSADASLLDRDGNTPL
                     EVAEEYGFGDVAQVLSGYFDAGANAVPDSFTWKPPSFESTPVSIHQPDFSAVPQPMLG
                     SLIVIMVGLPGRGKTYVAEQIRRYFQWNGLTCKIFFHQACRRRVERAMTDRADRDADV
                     SSPTGATELEFRISKELAHDLTTYVCKTSGVAILDGTQTTHARRQYLLRAIRDTRLIN
                     MTRVVFVELVNNNKETIHRNILLAKEMFPNTPEDFVDRYYEVIKQHEAVYKTLNPLTD
                     CDMPYIRIEDTQTYSLNMITGWMPSRLAFMLHNLSPTPMNLYLTRAGEYVDLLSNRIG
                     GNSRLTARGRAYSRALFEYFEKEIPSTTALTVMTSCAKRCTQTVHYFAEESIKCQSTA
                     NPASEQAGGKPSLRCRVLYFPTLDDINHGDCEGQLLSDVLRTMPNTLQSMKADPYYTA
                     WPNGECIHQVFNSRLEPHIHDIQASTTPVLVASHLHLLQGLYSYFVTDGDKIVAPQNA
                     FQIDIPFEHVIKIRMVGLNRVAELIHLSDAVDAILQSDTELCT"
     gene            complement(<82502..>83398)
                     /locus_tag="LMJF_26_0320"
                     /db_xref="GeneID:5652762"
     mRNA            complement(<82502..>83398)
                     /locus_tag="LMJF_26_0320"
                     /product="putative C-1-tetrahydrofolate
                     synthase,cytoplasmic"
                     /transcript_id="XM_001683987.1"
                     /db_xref="GeneID:5652762"
     CDS             complement(82502..83398)
                     /locus_tag="LMJF_26_0320"
                     /EC_number="1.5.1.5"
                     /EC_number="3.5.4.9"
                     /codon_start=1
                     /product="putative C-1-tetrahydrofolate
                     synthase,cytoplasmic"
                     /protein_id="XP_001684039.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652762"
                     /db_xref="GOA:Q4Q9F9"
                     /db_xref="InterPro:IPR000672"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020630"
                     /db_xref="InterPro:IPR020631"
                     /db_xref="InterPro:IPR020867"
                     /db_xref="PDB:4A26"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9F9"
                     /translation="MPSAQIIDGKAIAAAIRSELKDKVAALRELYGGRVPGLASIIVG
                     QRMDSKKYVQLKHKAAAEVGMASFNVELPEDISQEVLEVNVEKLNNDPNCHGIIVQLP
                     LPKHLNENRAIEKIHPHKDADALLPVNVGLLHYKGREPPFTPCTAKGVIVLLKRCGIE
                     MAGKRAVVLGRSNIVGAPVAALLMKENATVTIVHSGTSTEDMIDYLRTADIVIAAMGQ
                     PGYVKGEWIKEGAAVVDVGTTPVPDPSRKDGYRLVGDVCFEEAAARAAWISPVPGGVG
                     PMTIAMLLENTLEAFKAALGVS"
     gene            complement(<85124..>86470)
                     /gene="CYC8"
                     /locus_tag="LMJF_26_0330"
                     /db_xref="GeneID:5652763"
     mRNA            complement(<85124..>86470)
                     /gene="CYC8"
                     /locus_tag="LMJF_26_0330"
                     /product="putative mitotic cyclin"
                     /transcript_id="XM_001683988.1"
                     /db_xref="GeneID:5652763"
     CDS             complement(85124..86470)
                     /gene="CYC8"
                     /locus_tag="LMJF_26_0330"
                     /codon_start=1
                     /product="putative mitotic cyclin"
                     /protein_id="XP_001684040.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652763"
                     /db_xref="GOA:Q4Q9F8"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR014400"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9F8"
                     /translation="MPAYVVAKQEAERMRKEAWRPLTFRMIQQRIRDHFVRDLDDETE
                     LRSSRYILTTAQVERFLFPLFQRADAKAVRVLGEVWGRSRDPSRKLSDQIVAVLTRRQ
                     HVLLQGTELTLMELKEKVLLAARLQEPLTACEVRQLAIQLGPSNRVWVEEWLRAHPAE
                     EAVDSLALCTALRDAVQQRFGAFTFSGAYYPTVLDDLIDMDELAQSSMVYPPKQGVPA
                     QSVRARACEELFIFTIFCGVPLSLDAYFLAVALLDRFLARRSTPKEQLRLYSMAALLL
                     ASKCDHSWPTLDPHFVSVKMKLAQEDVMTAEEEIVQTLQFDTTVSTLHHFCEALLLHQ
                     DPPASPEQRQLLEYLIASLSVHTYYGQYRQSCLAAAALHSSRHAARLATGEPSESVRV
                     LLPVVYAALQKNNVERSPGNLIKQIYAQPERHAVSLTPTAVLFPSLSCCSSLSASE"
     gene            complement(<87926..>88954)
                     /locus_tag="LMJF_26_0340"
                     /db_xref="GeneID:5652764"
     mRNA            complement(<87926..>88954)
                     /locus_tag="LMJF_26_0340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683989.1"
                     /db_xref="GeneID:5652764"
     CDS             complement(87926..88954)
                     /locus_tag="LMJF_26_0340"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684041.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652764"
                     /db_xref="InterPro:IPR001910"
                     /db_xref="InterPro:IPR023186"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9F7"
                     /translation="MDQIKEYYQRWCDVPQPRKIKIIQLVAFACYFLFLFLLVIYAFG
                     RTGQRTLTIVPTVLFTDGTPYNMQMIRYLAQRRDVVIGMIVVSNNALAVEKLRSNVGN
                     VEGILSALQAEGYTKTVPVYASHTSSPNNFEAPLGEMLAKRSVKFVIVGPCTEAAHFL
                     MAYPAHRSKIVDIFVAGGAFNKAGNANYLFSANVKAERNFYMDPGAAGYITEASHQRP
                     VTLFPIDVTVAWTEEAYAAIVSNPSSTAASAETVTTGLRWYYQTVDSTRSTTVGLMAA
                     AYASDAQVRQTALYTSIPVRVRTAETNMTNGQSYRPASGTPVRVMLSVAADIFFSHLV
                     SVDKLPVA"
     gene            complement(<90155..>92932)
                     /locus_tag="LMJF_26_0350"
                     /db_xref="GeneID:5652765"
     mRNA            complement(<90155..>92932)
                     /locus_tag="LMJF_26_0350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683990.2"
                     /db_xref="GeneID:5652765"
     CDS             complement(90155..92932)
                     /locus_tag="LMJF_26_0350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684042.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652765"
                     /db_xref="InterPro:IPR007258"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9F6"
                     /translation="MDLKQSDLEDLATIDLSDSFVEANLGTSKRFDERTSSTTLQDVC
                     AAFVQSFLVEKGEWISSLHVSLKECLTVLEGMETVLEKFIEQLDRIQHDIGEVRETLA
                     KTSIELSNARVTERVLWTAISHLVVPPELVQIVTQSNDGELGMLFQLTLRELLKYLNY
                     RKGTWQRQQPAPSELRGSAASPGPRSGTAPQHASQELRLPLTEFTIYTELLNILDSLT
                     VFACIKVRDFLARKLYVLTVPNTNVCIQQENSLKQYAVFVHFLRSAPPLLRHTFARGT
                     DGNHQLTLMPYRITRAIYNEFKQQYCLIMSSLYLRKFQGYILTLNAMEYSTAASASFG
                     SVGSNLLSGFTRVQPAAPETVYTLPSLTAVHSRGSLVDDRVFQLGQRGNIFARVFAPP
                     LIPTLEKAAGRWHSYEETLRSVLHLLSDTVTHEYLFTFEFFAGDTSVYVDVFQPTLQF
                     IVDYVSEAVLLQSSGSVRQLMNQHPHASVNQRAKDDTYGLLILIRICHEYRFYMKTVC
                     KLGCLDTFFDSLLVLLWPAFKRTFDAQLVALRCAQAPSLAAVTAHMRSVAERIATVHP
                     LVRNYTALSCSLLGIALGAAVAEERMAMAQSEQTNPAPQLGRSSSTTSSSSSFAGPIA
                     TEGNSGGGGRRRRRSSLRPAAPRNSSSLDVSCDTVTVLMDNAASRTWDDPEHAELRRL
                     AVQMMAAEDEEDAAESQSRFVALVGNIDFLRVQVIHYAEEIVKHILAHAGLTASSQSD
                     RGGGDAAVMRDAYVVNQLHYMLTAAQRVVFPGEERRGTTLADRFDLSQLRNMYSTYRT
                     RLLGELLDMHFYDFINAARSEEEVPPPVLLRIADHFLLSWKPALDAMRTQVMSLMYDA
                     QLAHEVIAQACMECLVCNTCFLKIISAAVESHPSAFAQRPIRTLIVSNQHILLHMRNY
                     SMHMDPSSLQR"
     gene            complement(<93912..>99392)
                     /locus_tag="LMJF_26_0360"
                     /db_xref="GeneID:5652766"
     mRNA            complement(<93912..>99392)
                     /locus_tag="LMJF_26_0360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683991.2"
                     /db_xref="GeneID:5652766"
     CDS             complement(93912..99392)
                     /locus_tag="LMJF_26_0360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684043.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652766"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9F5"
                     /translation="MRRARHRLGVRRFSDWTIATWRPNTEAASPLRRCGTAAEGTAPS
                     ASTTPSSTAPPRLPSSSLAASLAAPKILSDAAALFDHYFNDVSTTLDIAPIKRPHVVG
                     SLVCALEEYPISVILVEQCCGTSAEAVTESVRWRAIHSAQGMRGVSWKSTKTFLIHHL
                     CTPRPNMVELLDALDLTLRVRLLRQDDLAATATEEQEGTHRDERGGVSDASSRTTKKS
                     TGQRWRCSAELYDTWHTQPRFTPVEPAAGGGEESGGDEVGELLDVIERALTRVEAKLR
                     QLHMRYTRDSVEEACRFVKEAGGDFCDTQLTLRGLRACMEKDDHAPHNATRHCPWWGE
                     VRARRCWSLQCNADMIVKQSKAVAFHLCLAFKLHASCSGETNGESGVAAVLQSSEAHR
                     GLAQLVDNKAADGVSRRYTNPASGSGLLQDLYTVSALSRMLASGRLSPAKDWTCGPMD
                     LAGHLVSAAAVLSPTIAYDWIGATRGGSDSLAQETPCRAQETVSTAADAGLPACVRWS
                     TFVGRASLDDFVVHLRGAIGARGRSAATDSCALPPLWPQLGLLYPGTLEDRCAALREL
                     LRHEHGLRGLPRVSVAVCATPLFSLEYDAELIVKDSDANAKRVSPGTASELTSIQILC
                     GDCYADVAAAAQVHTPWAAPLCKAAPAPLPAAATVAPRGKGDQVDKGSVCSDTGNRTH
                     GATSPAFDAPQCISVDVLSIGDSMSAMGFTSATWTASTAKFVAERGASAAPAVFEGAN
                     TLSGYRRILRFCAKRPVYRTAYLPRRSTLQEALQRLLITMAASGSDADDVVDRGKRRG
                     DGWPSADTEEAATLREQQTRTGPAHLGRCGTLMLIFPFNAGAAALQSQTSAAAKKMQQ
                     ALFSAVQEHCRDSAPLSAWMPAHTSSTEATFFHSWPLTAQWLVPHGSPLHVSLTPVVC
                     EEAATPRRRHDEKVAEDSSGHGAAQYDLHIFTTASPSASSAPVCSGTEPCSSPSATTV
                     VMRLPASAAWLSTAHTAMRRALMLSRPDLFAYPGSRVAASSALGGEEDSDDTAGGHGL
                     LVRCATFTQVVEALLFTTTFGEPDALDTEDFLKELFGHNVYTKKRGAVTELWLIVASR
                     MSPVRLCTVNMNEGYLGGSTERKWSTLLQYVMDASCPEARATVEAMRHLRRRVAALAT
                     ENDSGRPPPQCQLACEWVLRPAAASEKEPVEWAQVFVAELVRSSPVPSTSASGPRWSK
                     ISMRRQRRGDAAVQSSDGATSAKVPTSVMHREEGPDSFGVLWRMLHSLALQPAETASL
                     PTTASGQEMSSAPIPSPGRFIKAAQRALARQRGVARVTHRYDKGLGGVVVEGWERLRQ
                     NGSEAPCETPITLVAEPMPLHCVPMHVMQLYHRLLVEAHELPRIQEAVWERLGAECEK
                     TSTETIVQSLCETLGCTPADLQSVEARYMKVWTARLELPLRVFGFCTPATPWPPSSPS
                     SQHPCCDAPHALYVYCHRSSKRQAIRSVYTLLYQWTRYPQMVAPVNGAQFRVTSDKSA
                     VWPSWSADSPSSPSAPLPCPATTAAAELRPPRMTESAAWASEACAAPTALRAPQTLRS
                     VLDAAHARMETSLGALLGCRVGRVTLRLSQTFGLQLTYGVGAAGVQAEVPEMDSVQLL
                     REAWVPLVWAPAQILSAEVSVLQRLLTHSTTTVGVGDTDDMRSVLGELVFPNDPAQRA
                     ALQSGRDVRAKEFCVSFFRRYFGWRVCERDDVEDISVGDDHGTVVIVQKAEQTLLSRG
                     GPHCTPKRFASSRRRGAAPHGELRSATATLQLTQIVPGGATSVRLGRILVEVTGATPQ
                     AALDALWEPCTAQIESVFGVSCSMPPREADDQILHFMQSQLE"
     gene            complement(<100345..>102906)
                     /locus_tag="LMJF_26_0370"
                     /db_xref="GeneID:5652767"
     mRNA            complement(<100345..>102906)
                     /locus_tag="LMJF_26_0370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683992.1"
                     /db_xref="GeneID:5652767"
     CDS             complement(100345..102906)
                     /locus_tag="LMJF_26_0370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684044.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652767"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9F4"
                     /translation="MRATRTTKGLVEAARQCLVEGTFAPEKAAELLQTAVQQDPTYVH
                     ALVLRSTLASRLGHLTSALADMSLAIEVDKGSNDPRRLASLYGARANLCFRMGRYTDA
                     VTDLRSALRWEPDNGMWCYELGRVHMQQGCVSLAQWCLQQALQEPMWSRVNEATRPKV
                     YALYGRSCLRSREYKKAKMLLGKSIEVGGEGPASVLHNMGLAYYFEGTSLVQAVECLT
                     RATEMDAQPLEFPMHLSLALVRRKRYAEALSRMNEAVLRGQKEHCLRFYRGCIEMELG
                     MGPQALIDLQASTATEAARQEPAGVTPQKTAAHACLAMGLTHIFCDKDLPSAAASLES
                     EALQQTREVSIRLYAGLLLGIVRHEEGDRRAALRALQSTLQVLRETACAHRSGGGDEE
                     PPSRMSELPVCVADVEILTLTHLGLVYSDYGYNDLAVRHFREARQRSTQHHRDAAQRD
                     ICFFRLAVSEVEVKDHLGALQTLQARPFSEGEPPVATADPPSPPLEDASQSNSTPREV
                     ADAREPSIESSAERPKHEPYTVRPTSTSHAACHHVLPGEVEHLHAVILRRLGRLELAL
                     SWATAAIEASQSVTGQTSHTASLARGRVVPAFLYNRALVFFSLARYAEALADVQECTR
                     ACSEVERAVALGAGAADPYYLQGRIHHSLGAHGAALDSLTQALKLDPSLQRTPPFAYA
                     YGVLLAIAGRLSEALAAFTAAIIAHTEEAAAAATARGEEHPLLGGGTECAPLGYYHER
                     AKIYQQLGNYADALRDYNVVLRCAPGTSLPLPLAGGTSTTACPSAWNALVNRALTLKE
                     LKRYDEAAMDWDAALRSDRSGLLATLTSHDVYELPYMHLCLPGEELTAVAVEEPA"
     gene            complement(<105361..>106164)
                     /locus_tag="LMJF_26_0380"
                     /db_xref="GeneID:5652768"
     mRNA            complement(<105361..>106164)
                     /locus_tag="LMJF_26_0380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683993.1"
                     /db_xref="GeneID:5652768"
     CDS             complement(105361..106164)
                     /locus_tag="LMJF_26_0380"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684045.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652768"
                     /db_xref="InterPro:IPR005061"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9F3"
                     /translation="MKGFLQNKKSSGGFDPVKVRANIRMAITRLGMQKNKLVNSVKTQ
                     RRSVAELLALEKYDSARIRVENCIREDVNIEGYEVLSLFLDLLANRVQLIAESKPLKT
                     DKNKKDPSSACPPELKEAITSVLWASARIGDSVPELTALRKMFESKFGREFVEMSMSN
                     AEFSVNQRMTERLSMYTPPNDKCVAYLTSIANEFQLANYDEERLRDPNGLVASAAAAS
                     GGGIVSSSAGAELKQQVRGSVRTPSGLYIPPMQPPYDAIDQRLLQLMCV"
     gene            complement(<106978..>108510)
                     /gene="RET2"
                     /locus_tag="LMJF_26_0390"
                     /db_xref="GeneID:5652769"
     mRNA            complement(<106978..>108510)
                     /gene="RET2"
                     /locus_tag="LMJF_26_0390"
                     /product="RET2, RNA editing complex MP57"
                     /transcript_id="XM_001683994.2"
                     /db_xref="GeneID:5652769"
     CDS             complement(106978..108510)
                     /gene="RET2"
                     /locus_tag="LMJF_26_0390"
                     /EC_number="2.7.7.52"
                     /codon_start=1
                     /product="RET2, RNA editing complex MP57"
                     /protein_id="XP_001684046.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652769"
                     /db_xref="GOA:Q4Q9F2"
                     /db_xref="InterPro:IPR002058"
                     /db_xref="InterPro:IPR002934"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9F2"
                     /translation="MHAPTPLYLYVAVTRGLCSSAVAASSSADAASSPSAASSSTSEG
                     VSYASHLVASNDHYVQWGRALLEENSKRIGPEQMFRTAIRAQQQLQMLADKWTPDAKI
                     YCCGSLVTHGQMEWGSDLDLACVFDDPYPDHSVQAKRTEKLWSVVKRYMPQFLRNNLL
                     ALTEARTPVVKLRYVNDDKVARGRYTVLTEEEDRKSRTTLWDIRNRHLDSKDLEYIAT
                     KMGRENIEGIWVERTTYGCRCAVQCTSREQAVEAVGFFPDGVIMTKGMREDYTRDMLD
                     LRYVPEMFMYKWDISFVAYGVKNSYLLRHYLHNGPPAARHAAMAAKAWGKASGVGLGT
                     AAMLTSYAVTVMFVHYLLATRQLAWIDPWSLAHPVHMPRFPDFSPLLDCDPAELGKLL
                     HGFFIYYASHFNYEKNIISLSRPRLSLRSDVNWNFPQSKQGTFSYLLGIEDPYEDVGV
                     GGLNLGRHLHPAKFNQVKQEFARAATTMERYVPSNAPEKTILGVRRGGTSNHHHHHNR
                     FD"
     gene            complement(<109028..>110716)
                     /locus_tag="LMJF_26_0400"
                     /db_xref="GeneID:5652770"
     mRNA            complement(<109028..>110716)
                     /locus_tag="LMJF_26_0400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683995.1"
                     /db_xref="GeneID:5652770"
     CDS             complement(109028..110716)
                     /locus_tag="LMJF_26_0400"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684047.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652770"
                     /db_xref="GOA:Q4Q9F1"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="InterPro:IPR027450"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9F1"
                     /translation="MSLAGDPLNHLLPLLKLPPRQMKKTHISCKKWLARFFRIVAPET
                     EIQAHDGDAFGALAARLLPPHEQATGFVALNGGTHAGCSPHDLRQTLEAHGLLRGAAA
                     ATPQNCSCASPTPASATPSPLNCVLQHSSTLPFVVCSVPLQLPRDAVEGAGTGVSASS
                     YSVSVMHVAVAELAQFAASAEGASSSPSGADLRDDEVPQTGALMHTSPASSPADNGAA
                     AGKASVVVVVLQVPPTVSLWKEGSTSTSSSSANKGCGLLYLVSCDAAAVRSRVAHLLQ
                     RPVIGIERLLLSSTCLSRAAAEEERGAQECSSRMRPTQSLSNGASPPARTCTSHALPD
                     VPGLFLVEDFVTADEEKAIWHELHHGRPRLQIEYLSRRRVAHFNRRFLYGVNALTAEG
                     DVTNARPSFYAWMRARLQNDTAAGGVRIEGDYPFCPGDYECDQLTVNFYDYSELGACG
                     IAAHVDAHNAFGDAVFIVSLGSYTVMEFSRWDAPAEVAAPVGVYLAPRSLVVITGEAR
                     YGWTHCISEKRTDTLSELLPTFSRGDRMSLTWRRGRTQRHTKAECPYPALCDGA"
     gene            complement(<111574..>111876)
                     /locus_tag="LMJF_26_0410"
                     /db_xref="GeneID:5652771"
     mRNA            complement(<111574..>111876)
                     /locus_tag="LMJF_26_0410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683996.1"
                     /db_xref="GeneID:5652771"
     CDS             complement(111574..111876)
                     /locus_tag="LMJF_26_0410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684048.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652771"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9F0"
                     /translation="MTDHLSKHHVFRDYYREAKQAASAPMKCPYCKRQGSFAANTYEI
                     AKRIPSVMAEGMALCHFCETPIGRQADVVLQLRSWYCGYCELCVCPGCQKKQRQRR"
     gene            complement(<114341..>116431)
                     /locus_tag="LMJF_26_0420"
                     /db_xref="GeneID:5652772"
     mRNA            complement(<114341..>116431)
                     /locus_tag="LMJF_26_0420"
                     /product="pseudouridylate synthase-like protein"
                     /transcript_id="XM_001683997.1"
                     /db_xref="GeneID:5652772"
     CDS             complement(114341..116431)
                     /locus_tag="LMJF_26_0420"
                     /EC_number="4.2.1.70"
                     /codon_start=1
                     /product="pseudouridylate synthase-like protein"
                     /protein_id="XP_001684049.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652772"
                     /db_xref="GOA:Q4Q9E9"
                     /db_xref="InterPro:IPR001406"
                     /db_xref="InterPro:IPR020094"
                     /db_xref="InterPro:IPR020095"
                     /db_xref="InterPro:IPR020097"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9E9"
                     /translation="MRGKTARRRPDPRRMMVGKAPKNCVHIGLCVLYSGSGFRGLQIQ
                     VHAPTCHTVEGVLIQALKDAGIIADVVRGRPAGEHHHFARSCRTDRGVHAIRNMVSLF
                     VPKEVFEKMGQAEGICEKLNRQLPATVRVANVMQLSGSFIPRHCCNRRVYRYMLPLYA
                     LLPPCDTWAAVDKYYPGCLAHVQALAEEAAAAQRTQYSIPYVDLEKMNAVARPADAQA
                     LPSSWLRDLKASADRCNQVLRSHFTGSRRYHNFSVDIDSNRSGVSAKVIQPTTDEALR
                     AIYRSEVCPRLFFFPCSTKGGAADEAPVPVHGESRTEYDMNLLRYPPRTPTSPEDTVG
                     GSAAASTTTTPTGTSTTPATCLSPNTTALPFLFFQIEGCSFLLNMIRKIIGSVLAVCR
                     GARESILEDAFSPECRVTTPLAPGPYLYLAQSTYHGYDRSIGGAGNAHQPGRLKTVQD
                     AWGGAVSEAAELFAFHKIAADIVDVDLNAMPPLDDILAARDRAREASRPHTAVEDAHL
                     AEMKEYKPVLPTRIPWPASSDMTVFLRLLRVHNWNVRPIQLDPACKALREIKNRKERL
                     TASSVAAAASPGAEASKAGEADGGDTRANEATVEQAATPTGDAWRIRSEGSSTGGVPE
                     GGEDGWLYVADTPEEASVQRQAYFASLWKRARPWEYDDATGKSLIHGGEVGTEDDFDD
                     GDGSTARPRRHRRV"
     gene            complement(<117671..>118597)
                     /locus_tag="LMJF_26_0430"
                     /db_xref="GeneID:5652773"
     mRNA            complement(<117671..>118597)
                     /locus_tag="LMJF_26_0430"
                     /product="nucleotide binding protein-like protein"
                     /transcript_id="XM_001683998.1"
                     /db_xref="GeneID:5652773"
     CDS             complement(117671..118597)
                     /locus_tag="LMJF_26_0430"
                     /codon_start=1
                     /product="nucleotide binding protein-like protein"
                     /protein_id="XP_001684050.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652773"
                     /db_xref="GOA:Q4Q9E8"
                     /db_xref="InterPro:IPR000808"
                     /db_xref="InterPro:IPR019591"
                     /db_xref="InterPro:IPR025723"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028600"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9E8"
                     /translation="MQSPSVAEGAAPPSGAGGSDAAATVASAGLFQVKNIILVLSGKG
                     GVGKSTVACQLALALAHVHHKQVGLLDVDVCGPSVPKICGLEGCDVYRGEKGWIPVSS
                     QAKAATAGSPGSAPGAAAPSGDLKVMSIAYLLPSDKDAVVWRGPKKDAMIKQFVTDVH
                     WGPLDYLIIDTPPGTSDEHLTLCEVLRSFRPSGAVIVTTPQDVSTDDVKKELSFCHKL
                     QLRCLGIVENMSGFVCPHCAHCTDIFSKGGGRKLAEMYEVAFLGAIPIDPNLSLAEDM
                     GRVFVKESPSQTVDAVTAVIDAIVQQVERAKA"
     gene            complement(<119610..>120608)
                     /locus_tag="LMJF_26_0440"
                     /db_xref="GeneID:5652774"
     mRNA            complement(<119610..>120608)
                     /locus_tag="LMJF_26_0440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683999.1"
                     /db_xref="GeneID:5652774"
     CDS             complement(119610..120608)
                     /locus_tag="LMJF_26_0440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684051.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652774"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9E7"
                     /translation="MHALVRFPMNAVAGVCRAPYTRAVRMRRVSVAVVEPQRTFVANP
                     PSSPFSLSSVGVATAEDAAAATSARCEGTVAGAADSPPSHNPPAQTARGFRSSTQFQM
                     SPAQVNEQNVPSAREVAQMIPTLQELRAQLPGAQELERTYIPRESALRANGVAGRSET
                     SGERAAATTASSAPSSLLQKTMVPLEALFFGSATDEVAAATEATPTAASPPCPPSREH
                     VLLAYRALFWGTAFALLGFSVTVATAMYLCGYHSLRDLQQGVRDKMRHDEERLHAMAA
                     PAATGEGAAVDTVKHYVVDVTHPTEAWRQLQEIWSALQRLSEEEEETANTAVTGAQ"
     gene            complement(<121580..>122934)
                     /locus_tag="LMJF_26_0450"
                     /db_xref="GeneID:5652775"
     mRNA            complement(join(<121580..122300,122300..>122934))
                     /locus_tag="LMJF_26_0450"
                     /product="conserved hypothetical protein"
                     /artificial_location="low-quality sequence region"
                     /transcript_id="XM_021483173.1"
                     /db_xref="GeneID:5652775"
     CDS             complement(join(121580..122300,122300..122934))
                     /locus_tag="LMJF_26_0450"
                     /artificial_location="low-quality sequence region"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_021338848.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652775"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9E6"
                     /translation="MMVNEAPYLTNRVVALLMLTVFVLCLCADRLQCQNNGWRSMCIG
                     RLAYKCSSEWCRSSVITPTSVSLASWCVGKGNAVVLIALVEVGPSVVSRRGENISKYM
                     ADELRRQMDAGEFQRAVRLTLAAPRLAPDSAGDDARSSLTELFREKASLRAIFDIPRN
                     QTRYMVVNDVVPLPAVDRLGDFSYTTWEEAVDAALPVSKVDDASQLPHYFPKLYAKLA
                     AFSNERAASAAPPSSKQCDVLVVVVCTIAHPLASVRGMWQTPRDAGAQLSLGHEYVRG
                     AVTRYLMTCRKLLRNVNGVHYLQYESRLPAWAFTAEVLGGQREEPSIIAATNATAHWV
                     RALGKTSSFAAAFCNPANATATSAPLPPCEQACRIYGRIASDLVAGDRSIARESFETH
                     HQFRSSSSTYNCYYEVLSAQGEAAINGTFDAKTVLRVFDDCLHLSPVGSRAYARCMLR
                     R"
     gene            complement(<124489..>125247)
                     /locus_tag="LMJF_26_0460"
                     /db_xref="GeneID:5652776"
     mRNA            complement(<124489..>125247)
                     /locus_tag="LMJF_26_0460"
                     /product="putative ATPase subunit 9"
                     /transcript_id="XM_001684001.1"
                     /db_xref="GeneID:5652776"
     CDS             complement(124489..125247)
                     /locus_tag="LMJF_26_0460"
                     /EC_number="3.6.3.14"
                     /codon_start=1
                     /product="putative ATPase subunit 9"
                     /protein_id="XP_001684053.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652776"
                     /db_xref="GOA:Q4Q9E5"
                     /db_xref="InterPro:IPR000454"
                     /db_xref="InterPro:IPR002379"
                     /db_xref="InterPro:IPR020537"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9E5"
                     /translation="MRSLAFPCSSSSLARVMWLLYCLSHPMLMQDAFVLLSLSLSRSH
                     ALSYMYLLFPPPPPPRLPSADPLPHDVRCATTCAAHHHDGNVVNCAFSSACPFLLKYL
                     SVPPRRSLSRSSHSQHACSWCPSLSPHASSRSLSHNNCTLLSPKMMRRAIAQPVARRA
                     AAASSALVVAPRQASTVALSVQGLHYVGTGLAAIALGGVGLGIGAIFGCLLIGCARQP
                     NLTKMLFNYAILGFALTEAIGLFALMLAFLMLFS"
     gene            complement(<125970..>128927)
                     /locus_tag="LMJF_26_0470"
                     /db_xref="GeneID:5652777"
     mRNA            complement(<125970..>128927)
                     /locus_tag="LMJF_26_0470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684002.2"
                     /db_xref="GeneID:5652777"
     CDS             complement(125970..128927)
                     /locus_tag="LMJF_26_0470"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684054.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652777"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9E4"
                     /translation="MHASTSAATRSTMDAVFEVLRSSVDNAARKQAAAQLRDLQERDP
                     EVFLQHTYDGIASQQLPPELRFFLCTLVIAFLDESWHNAVLKETQERFLESYVRLLLA
                     EANAPILLARKMSRIVALMAKRGSRRAQLGAMPPAIQHVVTSYVSELERATAAPSHAR
                     VTYVLLYLHVFLKEMQGCRIGNVFEGVCRACVAPLSGVFSLLQSETGMLEAHDLCLYL
                     FKCSLRTFGRGVFDPAFCHFFLAATWRLAAGLGQDAPDSPNAKRRLRLLEYALKTHEA
                     TVVFFPSRLHELGIPFFLVADEAAAAAPSASTPSSAPDTPEHSIFRLLSAVVSSPVGK
                     VVSEKAVCRALRFFTSLLSAEDGDAFIAHCLQRYTTSVYFAPLLQHIVSAYLADTTTP
                     EALSEWSRHPEQVAAGLDVDMDDETSTMSCAEQLFLAFTGSTACASASLAAAWAVVNQ
                     LLQEGDVGPVTAALHAIGIGYYTMASEDTSSYLDFLRGKLLRLLDPATLAQTSPFVAR
                     RVVWLVGMWCESVTSTEDRRAVLSALETVLQHAVATQKIVLVLVALKSTENFVSDNHF
                     TPSEVPPTMVNTVLRTVQELLSRVQSPTTIKGLAGLVHVLIEKGALQSQGDVLVQLFL
                     PPALTVIKSYEAQAANAGRTGGAGLAVDADEIGDEEGGADSLSSLNMLLECLGSSLRH
                     GDSDAVIWSLLPCVIVPCTSPMSAATAWVEDNAWELFLVMTQSSRTFFAPAAAEALQM
                     ALQHTTRDFGMLPLVFRVVYTLLLLRQDGAEEVVSPAHLKAWMTMLRESLSAELCSAV
                     AAATFAVWRTSAGPLSALLCQHAAQALVLSSDVQSEQHTIPLALILALSFASATGGEE
                     EQQLAAHVHAAVQSCAPSGSYSKLLEQVVLLLDVSPSTLVSRALARLLEVLCRTSTAP
                     LAGDDLAMVQRAMEGVAATSGATASVTGADDDDAEDRAAPEMLLELLGDEDIPQGCPH
                     FARVMRAFAALLS"
     gene            complement(<130570..>131547)
                     /locus_tag="LMJF_26_0480"
                     /db_xref="GeneID:5652778"
     mRNA            complement(<130570..>131547)
                     /locus_tag="LMJF_26_0480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684003.1"
                     /db_xref="GeneID:5652778"
     CDS             complement(130570..131547)
                     /locus_tag="LMJF_26_0480"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684055.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652778"
                     /db_xref="GOA:Q4Q9E3"
                     /db_xref="InterPro:IPR004130"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9E3"
                     /translation="MFGELVCGPPGSGKTTYCEGKRQFLSVYDPTRPVVMMNLDPANE
                     DIFPYPCDVDIRELVDHATVMQEEGLGPNGTYLFCAAVMQANVDWVLSTVEEAVERRV
                     QEVLATEMTATGAKTLRAPYLLIDCPGQVEFYVDAQVMPTLTRALAKRLQCSLCTVHL
                     VDAGIATRDLPTYVSSCVLSLATMIDHELPHVNVLSKWDTLPAEVLEDTGDDGETYLK
                     ASAMLSENMDRLWRRQLQRRRHEHRMAQHFVTAAQPVPQLTPEERAEDAQLTTIDLPK
                     HGGRVYRYTRLLMDVVEGYGLVGYVPLDVQNQEMMLRLTQEVDNAIGNF"
     gene            complement(<133107..>134546)
                     /locus_tag="LMJF_26_0490"
                     /db_xref="GeneID:5652779"
     mRNA            complement(<133107..>134546)
                     /locus_tag="LMJF_26_0490"
                     /product="DNA polymerase sigma-like protein"
                     /transcript_id="XM_001684004.2"
                     /db_xref="GeneID:5652779"
     CDS             complement(133107..134546)
                     /locus_tag="LMJF_26_0490"
                     /codon_start=1
                     /product="DNA polymerase sigma-like protein"
                     /protein_id="XP_001684056.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652779"
                     /db_xref="InterPro:IPR002058"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9E2"
                     /translation="MANKLFPHPAGHDAGKAMNERHPRSSHNGHSAVYSSRTHGAPRP
                     QDNRHLGSRRRRSGGSSADDEDGHCSAGSGARRPRTETGSVLVAAASGPSPVLSSSLG
                     ISSHIVQSLLPPSSLARCILAFDAKLIELLYCLSPTSEDRETKLRVIDDIRTTMQRAG
                     MDIQIYGSLCTGLVIPASDVDCVLMLSSDEHIASAMSESLSCAMLTIASAAAGSVPPK
                     SLKRPLSTAVRIVAERMRKSQSFTHVTSIAHAKVPIVKCRHRRDDVKVDLSFEQSGCV
                     SSNYLCKLLCEPGNEMARPLIVLVKALMNSCGLDEPSMGGLGSFPISLLVLWYLQQCV
                     RTRFSAELQRSIGALLAGFLKYYGTEFDFRRLGIDYVQQKTFTKPPADDLYIVNPIRP
                     ETNCAKAATLFATRVVPLFQRASATFVGLLDANASPSTMESQLLHYFAKATSDVRNWR
                     DVSRRAAREPHLVQNMWDAETNMYVGGVL"
     gene            complement(<136532..>137821)
                     /locus_tag="LMJF_26_0500"
                     /db_xref="GeneID:5652780"
     mRNA            complement(<136532..>137821)
                     /locus_tag="LMJF_26_0500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684005.1"
                     /db_xref="GeneID:5652780"
     CDS             complement(136532..137821)
                     /locus_tag="LMJF_26_0500"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684057.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652780"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9E1"
                     /translation="MQIPWRQISRQQLDSICGTLLDRESDTPIHTIDLMDNQLGPTGA
                     VKIASCLESSPVTEVFICYNDIGKEGCDGLAGVVNLSHSLQVLDIRGNQLSASDVHRL
                     LRSVSMSTALKRLGLASNRLGPEGAALTAKALERNTYLSSLDLSVNELGPSGAEWLAG
                     ILRNSVLALRVLQLHGNYLGPTGVMAICDAVKTNKELRRLTLGNNHATDEAAGAVAAM
                     LEANDTLEELDICLNTLTANGVRTIARQGLAKNTSLAVLSLSGNEVGPVGANELTQVL
                     TSHQRSVLKQLDLSSCGLTASGGARVASLLSTSMSLKEINLSDNALDDEAAVRLAQNI
                     TDGITISVVDVSCNKIGEEGASQLIDAAVRNAQLVALVTNGNNISRVAQKRLDNLLEE
                     RLANNRVAGPQTALYQQQQRPYQQHTALSAAAPTAAA"
     gene            complement(139756..142287)
                     /locus_tag="LMJF_26_0520"
                     /pseudo
                     /db_xref="GeneID:12981817"
     CDS             complement(join(139756..140826,140829..141650,
                     141652..142287))
                     /locus_tag="LMJF_26_0520"
                     /pseudo
                     /codon_start=1
                     /product="conserved hypothetical protein (pseudogene)"
                     /db_xref="GeneID:12981817"
     gene            complement(<145201..>148668)
                     /locus_tag="LMJF_26_0540"
                     /db_xref="GeneID:5652782"
     mRNA            complement(<145201..>148668)
                     /locus_tag="LMJF_26_0540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684006.1"
                     /db_xref="GeneID:5652782"
     CDS             complement(145201..148668)
                     /locus_tag="LMJF_26_0540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684058.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652782"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9E0"
                     /translation="METIAVETGPCDLYHALGSVPSSDSSRKDATLLCVASSACSCEA
                     APSANEAHDITAAGSSCGADAPAWLSATVTCTLDVLIQVHPSLSRGRFADLLGGCHGV
                     TVRKSEPHFARLTCCNARGLCELPDGLITLPLSPADVVATDVSTCSTRVKAATFSSAW
                     SGQSARGRSAQSSTVGGTGGLPMETAIASAAEANCCSADAVCCAPEYLAILSEMRSTR
                     VARSLPTVALLVRFPQRCRRALVLLRPSVSRRHKKYRVSYHASLRVVSESVQRVALMP
                     MGDAAVLLADAFVHDAALSACASTGDSGASATLVLRGSYLSLDDGEQQSGALQPLLLH
                     LGLRGAPARQRVLRSLLRCRVTGAWYRLRFPARGASRAPCCRPVVSELVLYTSEGHML
                     VFGPFMTDGAHEALTLAGKEDPSMTVVYTCRVGTRLLFSKLDASAAAESIAVSQPRDY
                     VCGGALLVAPPWGFADRWRHSPWIERALALATTPSVAVSGVLVSGEGSRRRRRHRPSS
                     VLAMSPNRGVWLLRTDSHLCVASVPTGTGAVGEHGDAEPTLISAVKLNSSHALHDAQY
                     VACGGHAGFLLLCRHRSVGAAEPWDMTSAMSPVTVTSAVGDRFVYCSRSQSPLQLLFL
                     SLTAMGTTAAAAFDAAISPLLPVPLISSSILASLPPSFAHPSSRLRLVCAVSAADTPD
                     SMVASENLSDTLYVAISSSGDARCAWTATVRLPSVWPSCTSLFQLCPNECSGVAGGAG
                     TATGRACQAASTLQWTAHALSALFPHACLMAGGNEVSMWRAAVQGTTASSLGKASPSA
                     VASEEESPLETALEAVLLEVNYPYKHGTTSAAAAAALDVALGRGPHADGAALYYPAAT
                     VAFHDALHALLHACFCGEAASTAGAVAVVAGFSAALRMSGLLAGCRDCPDARGGGVVA
                     TRRMVAFLHGCAQLLLHAMEDVAAVGNVSALQACASHLAQTVEVGAARRTSSATTATA
                     WKVWSLLLQPLFDFVWGVVQAYGVSAEVAAGLLEYCSPAVRSMVHARRHWWPDAGNAV
                     HGRNPGNAAPLNVPEETPRTTGLAAHAVSAGLSAQHDGAAPPSEQHTSVPTAMSVSPA
                     AAATASASSYTSAELYELVRRVFLAEGASAALGLLGELQRHDSTKAGMADMAQMLEAM
                     QRRLQGAAV"
     gene            complement(<150195..>151811)
                     /gene="LPG1L"
                     /locus_tag="LMJF_26_0550"
                     /db_xref="GeneID:5652783"
     mRNA            complement(<150195..>151811)
                     /gene="LPG1L"
                     /locus_tag="LMJF_26_0550"
                     /product="galactofuranosyltransferase lpg1-like protein"
                     /transcript_id="XM_001684007.1"
                     /db_xref="GeneID:5652783"
     CDS             complement(150195..151811)
                     /gene="LPG1L"
                     /locus_tag="LMJF_26_0550"
                     /codon_start=1
                     /product="galactofuranosyltransferase lpg1-like protein"
                     /protein_id="XP_001684059.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652783"
                     /db_xref="GOA:Q4Q9D9"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9D9"
                     /translation="MAPVPPSSLSPRSTEHATSGAPSFTLPFTDAPPGTLTSITTAAP
                     LPRPAVDERSNAAHATGEAPTGSTHSISDAPQPTEVPQRGADELHSRYVSELAQLDVL
                     DVFPLRPHERRISFIEFARCLGARLSVSPETGVEVERDDLASDRYAPFLISVTLENTQ
                     DLKALICNLTMPYRYIVLAQNGDTPEVTPFFRLLRRMFAFTTRLTVLQFPENIGFAGA
                     VNAGLREALRHPFSEVPFLHIVHNDVRFLFSSLEQAVAGAYKTTARDTDMIEALEKEV
                     ATEPNEYTPLIRQPDGLRTPLLPGTPLPQQHDRKPVVVTSALLPDRVRYMAPSRRAEL
                     MVGHTSFMFANSRGEYTSVFLSRLAVLAVGFFDENFFPILYDDTDYRWRAHLLGFVED
                     RNAAMNDQVISFDLDCVNQAMNDVDDDGNAEGRLGGLRKAATGPTLSLKGKALQRDCR
                     KAFYAGVQYTYMQQKWGVESMTELMQAHTRREPFSGEAFGGKLRLPLDAWVVDRNRLT
                     NLRTWLRDVGRRILDVDNYNTDVILQAVSP"
     gene            complement(<153070..>155175)
                     /locus_tag="LMJF_26_0560"
                     /db_xref="GeneID:5652784"
     mRNA            complement(<153070..>155175)
                     /locus_tag="LMJF_26_0560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684008.1"
                     /db_xref="GeneID:5652784"
     CDS             complement(153070..155175)
                     /locus_tag="LMJF_26_0560"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684060.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652784"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9D8"
                     /translation="MSKVKDGAGVGSLNDSIPLDIEESSMSIYSDEEDEGDYDPSSQI
                     SEDAASSLDYSSVSRTYVSHSRTSGMHVHSEDYTGTASYYSNGGAASNAFSYDDEDYS
                     SIYGSLSYGDSALRSPQSELSSTFASLYYENEYVVGIRSTLHFLRRPLYYFAFATAGS
                     GAVGSICRLATTFAKRFVDSGASIADSSLGACPGSAASCAGACSSLPSGYLNVPEWLR
                     DVRASLPSLMEVPAAWMLRRHGIPVLSEVMQRQERESAAAAAATVAEQVNTGVQEVWQ
                     SWQKTGPAIPVALFLPIFSIVVFKVAQHVRPNSANLTEILRPRQDADNVDAASTYVKT
                     PSPARPSLIMDASPIPALSSSAGNLSAQSASMNMLPTSRGTASATMSRHSATGDGSNA
                     QPVPFVVPPVNIATITSVSPAVPRVGESHTNGVSPSSPGDYPGDSHDRSRSTTQVPQT
                     HRHIADAAVPQNSEEGRKALAADVDVDVAHSSLVSVSPSRGPAEGNHKPAGETPGPAL
                     PAASPSVSPLPRMPQALSEVGRAGRLISVKDSTLRGEVVAAVAGVADVREANAVFIAA
                     VRYGCSVVVLPSALRDVDGLLEAPPSLTVEFTDDVVAASTVLADRRGLTMVGVTAQQW
                     DAQAEPLDTFAHPGNALYVFVAHESSSPAVVASVETAVAHKVFVGTSWAAVPVNQVFY
                     DRLLKEKAVRKQQQEAQPQ"
     gene            complement(<156301..>156753)
                     /locus_tag="LMJF_26_0570"
                     /db_xref="GeneID:5652785"
     mRNA            complement(<156301..>156753)
                     /locus_tag="LMJF_26_0570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684009.1"
                     /db_xref="GeneID:5652785"
     CDS             complement(156301..156753)
                     /locus_tag="LMJF_26_0570"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684061.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652785"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9D7"
                     /translation="MDAPGTAVEQYFNQLIHMCLLTQVVVSDKQGNTILACFGTPGAM
                     GGDVNGVSGSGDGQEDELPMESNVTVSGARYFQNLEQLQLGTPTYITAQYHDAVVVQL
                     MEPGGSILTLIGSRAKGHFTGGLLSLVPQIRSTAVYTELLRKVEKCTH"
     gene            complement(<157607..>159346)
                     /locus_tag="LMJF_26_0580"
                     /db_xref="GeneID:5652786"
     mRNA            complement(<157607..>159346)
                     /locus_tag="LMJF_26_0580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684010.1"
                     /db_xref="GeneID:5652786"
     CDS             complement(157607..159346)
                     /locus_tag="LMJF_26_0580"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684062.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652786"
                     /db_xref="InterPro:IPR007474"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9D6"
                     /translation="MHVARSAYRQLLRVGKEVSDRYADPNDMCFALFGVLVSRHDFIN
                     AGYGSTFPAILRTCFLRPSITGYPHDTASARTSAAFDALRRLNELKASNAAFRIRELR
                     RVMSDAADQGSASTVAAASASTDATPTPLPSSAAAGQATAPSLSFASQGRTHTTAVTY
                     PLDDEGVHLIRGSVLIERSSRRRIQNFTRHCVVCEPINMAFPPYRFCVPPEPSYLLAV
                     RSEFALYAITDVLLALSATSIFNAHRHAYMSHHQQQQSAEIGQSLTNSGIRVSGGDEV
                     TEDAPSRQEGAGNSSRRAKGVAVATAPLLKTRRFPTTREEVQELVRRIPTRTVIQTDV
                     LEVEITTEYVCSNPSAATAASPSAAEHLAKQSRDGVFSSTTPLKQGAAADGCGGSASA
                     RTAVQGDDAKAYLFLYYVYIRNRGPLKNPKRWHAQVLSHHLVVIDAAQAQVLEMGRPG
                     VVGNFPLLQPGASHCFESGATLSGPEGFLRGSIQVNLFNDAGEVMMLDAAIAPTRLTV
                     EVTSAIGFTSSKNAKEELVQRNRDPSAQPPSGARAPEDGADREGKHSLSADGAAEASE
                     NDRDSSSKPKGGK"
     gene            complement(<163471..>165582)
                     /locus_tag="LMJF_26_0590"
                     /db_xref="GeneID:5652787"
     mRNA            complement(<163471..>165582)
                     /locus_tag="LMJF_26_0590"
                     /product="putative spliced leader RNA PSE-promoter
                     transcription factor"
                     /transcript_id="XM_001684011.1"
                     /db_xref="GeneID:5652787"
     CDS             complement(163471..165582)
                     /locus_tag="LMJF_26_0590"
                     /codon_start=1
                     /product="putative spliced leader RNA PSE-promoter
                     transcription factor"
                     /protein_id="XP_001684063.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652787"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9D5"
                     /translation="MCEGATVALLALHPSSLGSKPPLSPPSTDTRTMRRSLRLWCSKL
                     DLDGNPSRYFPRFRPRRLVMPVDPSDLHSDKRQPNPLFMKAKAQKRQRRRAEMRGAVQ
                     LASVPKERSVGDVYRLLMDACETQNLFSDAALTPRTVRDLESLLQAYNAASAVLRRSV
                     QAQAAPPDGGAASVGESTTEQGSPRNDSAPQQSSPLYSLAFQASPPPVAASSFASAAA
                     ADTLSIREVDQMWSMLDHTPLNAPVHGALALRGDALVRSVLLELTYSAYPRLRSKHVQ
                     QLLHETTGLLPCGRVAMRIGLAEHCGVEGDIAMWRELNVLSERMRIARKEAAAHLQRV
                     EKGIAAQRRWYWRAVLRSAAARLKLFPVHKGDLQPRMQWVRSFLFAFVAFVEMAESSG
                     DAHARVRPLIYQLFASQLARHVRLRQIIEAAEAIVAATSEQDVCVDTAAAAPSATSPL
                     SLPLSDNEASVEALRRRVAEELARVKSRTADEEEVLEGRAHPMNCRADRRREQFESSG
                     GAHGTQMLHDEALERHAEDYGHLAPPLLLHALESSSPNAFKEAQLVLRYAPQVSEKLR
                     RSPIDVDQVVRRVVDVQETNNYASLHNAQQYRQVEYTVCRLYAGHYCLGEGKGETLMS
                     AMQDASMRMLLNYYLRFPLSAPSPLESPTRAEGSSDGGSHGNGRAATATAHLPDGEDG
                     NVGGVPAPRIRPPTTEEEVVL"
     gene            complement(<166138..>167136)
                     /locus_tag="LMJF_26_0600"
                     /db_xref="GeneID:5652788"
     mRNA            complement(<166138..>167136)
                     /locus_tag="LMJF_26_0600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684012.1"
                     /db_xref="GeneID:5652788"
     CDS             complement(166138..167136)
                     /locus_tag="LMJF_26_0600"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684064.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652788"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9D4"
                     /translation="MASTSGPASLEEAALASLGNYSPEQLQMAETALRAVLMEKVQAL
                     AAEHGDAFIQSLVQKEIARTRKMETELANVKKRLGVQERCVDSMRMDVRKVKAQEEKS
                     KYICQNLQETARRREQLTEKMQPEMEAYRSDVRERVSENVQSIWAECEKRRERVETVE
                     AEVTELEAGLAHKKETFERSFAEFQDGLKGRTAEYQELIVAYQEATKEVELIEAQLML
                     VRRERQSVETTRAALQQQLEVYEKQFDGFAEAVMKPEDVEALAKRQHDQAQMRITELE
                     AEKTNVHQQRLQMDKELTDLRAKHASLKREMQQLEKAKTAAEKKCRQAQQSRQEKK"
     gene            complement(<168628..>169812)
                     /locus_tag="LMJF_26_0610"
                     /db_xref="GeneID:5652789"
     mRNA            complement(<168628..>169812)
                     /locus_tag="LMJF_26_0610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684013.1"
                     /db_xref="GeneID:5652789"
     CDS             complement(168628..169812)
                     /locus_tag="LMJF_26_0610"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684065.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652789"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9D3"
                     /translation="MYRCGLPLSTRRHVPTALVHSGKGVARRNSGATWTARRSFTSSP
                     TLRSSPPVSELPSSTPAAPSPLPFPSAFTASNAAETAAVPSAGTSSPLGTGTDAAVTA
                     TVNDLHAGQVPSTPAEVEEAFACSVQARTVSNVQLRRYIDHLPPKDYSLALAAVKGAK
                     SAGLRISASTYEALLSSLMSGGQLRASMELYKAMIKQHVAPTPNMYAALMEMCLQRGM
                     PKACQSLFDDMQQRGVRPAARNYELMITSLSAEVPPQWARAIEVFDRISRERRSRITA
                     KTYNALMRVYMNMDPFDWRIVYNCYSEMRNRRPRVPLEWESYLILCEALRKGRAGYVR
                     RGMAYIDAWIAVTPLRSWNFLIGAMVYLAFMMVLKSIMGYFVVWYYESSVPSTSDSVL
                     PR"
     gene            complement(<171643..>171945)
                     /locus_tag="LMJF_26_0620"
                     /db_xref="GeneID:5652790"
     mRNA            complement(<171643..>171945)
                     /locus_tag="LMJF_26_0620"
                     /product="putative 10 kDa heat shock protein"
                     /transcript_id="XM_001684014.1"
                     /db_xref="GeneID:5652790"
     CDS             complement(171643..171945)
                     /locus_tag="LMJF_26_0620"
                     /codon_start=1
                     /product="putative 10 kDa heat shock protein"
                     /protein_id="XP_001684066.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652790"
                     /db_xref="GOA:Q4Q9D2"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR020818"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9D2"
                     /translation="MFRFTAPALKKLQPLGQRVLVKRMQAAKQTKAGILIPEQVAAKV
                     NEGTVVAVAAGSKDWTPTVKVGDTVLLPEYGGSSVKVDGEELFLYDESVLLGVLSS"
     gene            complement(<173410..>174654)
                     /locus_tag="LMJF_26_0630"
                     /db_xref="GeneID:5652791"
     mRNA            complement(<173410..>174654)
                     /locus_tag="LMJF_26_0630"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684015.1"
                     /db_xref="GeneID:5652791"
     CDS             complement(173410..174654)
                     /locus_tag="LMJF_26_0630"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684067.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652791"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9D1"
                     /translation="MYREEADGSAVVWGIPVAPFLPVQHMQINVSTLNRLGNYCFRFA
                     REHGWLQPPDEMALAAPYTQGNEARPPVEQVNHAYTGSNNTFFFAGVEEILDNPYPDF
                     ELPPRLSKLFAGAHLYLVHVGNSSYSVYSQLYTYLNDQGEAARGLVGSFKVTAVWVSK
                     QQRTPTTLPADVQSLLRSVIEKNASKMPSSDIARVQRLSVSDLLLQSGWFANASAIAS
                     MEIAAYSPLSAPPPDASLVSLPHVCTAAPLWLLHRRHFTLRETDIDFNLHVNQLVTKM
                     LVIDAFRGATADARCAYSRLLPPGVPPNRADILLRKFRIDYVREIPVSCVATEVFLFP
                     VDPARAKAQFSCAGSYAGGGNVAAPTTAVIPGSDAADAPAVDMIDIGFFTVGVPSLDD
                     GSSKDRFIATVGVMTAATCFLH"
     gene            complement(<176823..>177125)
                     /locus_tag="LMJF_26_0640"
                     /db_xref="GeneID:5652792"
     mRNA            complement(<176823..>177125)
                     /locus_tag="LMJF_26_0640"
                     /product="putative 10 kDa heat shock protein"
                     /transcript_id="XM_001684016.1"
                     /db_xref="GeneID:5652792"
     CDS             complement(176823..177125)
                     /locus_tag="LMJF_26_0640"
                     /codon_start=1
                     /product="putative 10 kDa heat shock protein"
                     /protein_id="XP_001684068.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652792"
                     /db_xref="GOA:Q4Q9D0"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR020818"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9D0"
                     /translation="MFRFTAPALKKLQPLGQRVLVKRMQAAKQTKAGILIPEQVAAKV
                     NEGTVVAVAAGSKDWTPTVKVGDTVLLPEYGGSSVKVDGEELVLYDESVLLGVLSS"
     gene            complement(<178082..>182455)
                     /locus_tag="LMJF_26_0650"
                     /db_xref="GeneID:5652793"
     mRNA            complement(<178082..>182455)
                     /locus_tag="LMJF_26_0650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684017.1"
                     /db_xref="GeneID:5652793"
     CDS             complement(178082..182455)
                     /locus_tag="LMJF_26_0650"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684069.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652793"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9C9"
                     /translation="MALKGSLPGVQFRRSQSKDAVQLAGLLQIGDAVQDGIPTPAVFR
                     IHSTSDFATLIQTAYLCVTAVRDTAATVNGAQAEEAVVGFIALSDEVQGVSHRYGTAS
                     NGDAGEKTLEMEQVTALAENTQGAVTGATLENSLWLRMLIASPSNTLAEASSATTAIS
                     ATDTSAVAASQHKPFTSEEMVMSLLRAALGTLSGIEHIFMPLGSGFPILESIPGMARL
                     SAKVASVLPVASSSAHHASTGTFLHLSRATVLPPLTIRQGRVEDYDDVVMLLIAGGPG
                     VITQLPQDFFLEEILQDQDTHNKVVVAENSVTHEVVGVACLRQLTMEEQQHTARLYNT
                     DALDRLKRVSADASGNDAQLDNGLSCTFSIFFLYFNRDFDHSAYQLLPYFFHEFPTCD
                     YATLRLSHTLPLPEPMILERFQYIPLRRYQPHNARGELVPAPDALWVCPRVSMAMDHG
                     VQARVELLTDPCNAMLRKKVLSQFPAPNHTSASTFASRNGRPAGSGVRAALHQQESRS
                     GASGALSLFPGVSVELLAALQEDLGASAPTASQLSDKESGVVTQNRTVFALTWGEHSA
                     GGTAGVLSSAAVVGVISVQALSVAEMYALRANYDLDRFLAFNAAQGFNYAATDISLSA
                     EEGPLRYRSSELPGIFVRFVYIRPVFRQHLKFFLREVLRQTQTEVMLLLTSTSAELYQ
                     TAVASFTFAPPRRVVEVPVERKKRDLNLFLSTVSNIVELPEVNDVTPPVTQNTAAAAG
                     KEETTHTGLELSSLFFTTRRFLGDERVRVHSRVVIVGASATALCMLYELLSVPYLVYL
                     SITVVSTDGMPLHPNQRPMRQWQVNGMELLEREYMRLHLGDGTRSAPSLSFGANIIRV
                     VRGTLIDIDTTMKFVHLENNIYEPYDQLLLATGRQYIVPPPIRALQQQEAHGARGGII
                     ALSNEASEARLRQTLAELSHSVSGSIANIVVYGSGLDAIATLSTMVSMGFPAQRLVLC
                     RPNAERTPFTDATCGQAAMALLRALGVTLLDGYGVSRLEFDEETLTSVLLASLSYERK
                     AGDAVELPCALIVCLEEKEIDRSVLMALAKRSIVFDGRVIVGSAYETSRPDVLAAGPV
                     AMFTRRYGATEAFEAFNPRDVGRDVARVLLARLGVKEFQERPTTANHPQQDLAGHTSA
                     DNSSLLSVMHNQPLDSTAVIGAPSSMLEGATQEHNKRGPILPSYTSPVSRRVRLPCGY
                     QYVSIVRGFAAFEAEECVPLQFSSTDMLSVPLDDVQPLRGSSAGRVAAASSLREMMTL
                     YVHARHRTIDGVVYFGNGTPEVHNYRSLIGMPESLFHLQYRYSEAISKRDSTGSSTYP
                     SIAALGGSGATTTPVGVLTVPLRNQQFDLISYLRLPTLKPLLTDRFSRFFSQLQRDVQ
                     TAEEVVAVRERVLAAQQAAGTLTPDDAASRVAELTGAKAFRYKVQLALLKYMHESKDT
                     RPQDMYLPNIERQMAGKRVVV"
     gene            complement(<184073..>185206)
                     /locus_tag="LMJF_26_0660"
                     /db_xref="GeneID:5652794"
     mRNA            complement(<184073..>185206)
                     /locus_tag="LMJF_26_0660"
                     /product="putative protein disulfide isomerase"
                     /transcript_id="XM_001684018.1"
                     /db_xref="GeneID:5652794"
     CDS             complement(184073..185206)
                     /locus_tag="LMJF_26_0660"
                     /EC_number="5.3.4.1"
                     /codon_start=1
                     /product="putative protein disulfide isomerase"
                     /protein_id="XP_001684070.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652794"
                     /db_xref="GOA:Q4Q9C8"
                     /db_xref="InterPro:IPR005788"
                     /db_xref="InterPro:IPR011679"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR017937"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9C8"
                     /translation="MTRRLSVVLALVLVVFVLAGSCSSEDPGAVMPGIVQMSKDNFDQ
                     LVGKEKAVLVEFYAPWCGHCKSMAPEYAALGAAYEASTNAKDLLLVGKVDATQDSDLG
                     KRFGVTGFPTILYFAPGSLEPEKYKGGRTAEDFAKYLSSAIAGLRLTIPIEPQFAMEL
                     VHTNFDAVVKDPSKAVLVMFYAPWCGHCKALKPIYNTLAKVFSNDKDVVIARINADDA
                     ANRKIATEYAVAGFPTVYFFPKGADEKPVEYKNGRNLEDFLTFVNENAGKHRLANGDF
                     SWECGVIAELAEAVALVATSSGESSKAAVEAVKAAAAKLAESEDAAYYIKAAERIAAK
                     GPAYVESESARLKRTLGGSVAGDRRDNMVRRLNILTSIQKHMK"
     gene            complement(<186280..>186783)
                     /locus_tag="LMJF_26_0670"
                     /db_xref="GeneID:5652795"
     mRNA            complement(<186280..>186783)
                     /locus_tag="LMJF_26_0670"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684019.1"
                     /db_xref="GeneID:5652795"
     CDS             complement(186280..186783)
                     /locus_tag="LMJF_26_0670"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684071.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652795"
                     /db_xref="GOA:Q4Q9C7"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9C7"
                     /translation="MASRKMCTFARLVPIFAVTFITAALIAIPLLEARHNFDGNNPSR
                     KMEGVEEVNSENYFDLVGRNRFVLLEFYVDWCRYCREFASLYDEFGKYVQARSELQQR
                     LVVGKVNALNEALIQRQYNVSSYPTVILVPPNKHTGVVFTENRNFNQLLNFVEREMVK
                     KEYAVTE"
     gene            complement(<187955..>188632)
                     /locus_tag="LMJF_26_0680"
                     /db_xref="GeneID:5652796"
     mRNA            complement(<187955..>188632)
                     /locus_tag="LMJF_26_0680"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684020.1"
                     /db_xref="GeneID:5652796"
     CDS             complement(187955..188632)
                     /locus_tag="LMJF_26_0680"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684072.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652796"
                     /db_xref="GOA:Q4Q9C6"
                     /db_xref="InterPro:IPR013784"
                     /db_xref="InterPro:IPR019008"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9C6"
                     /translation="MLRLTRLGLGAALLLVLVAVLSVSAEEGTVTYYGQLRLPPTYLR
                     HPDCFEALNDIQPGSVLMYNGQHRFVVPTARDGSFCVYKLPYGTYILQAEYHYFVFPT
                     VRVEVMYRDTGDDQKETFIRTSANDYPVRHLEGSGLDEESPAVIPFSGYHSYYVPRQQ
                     MDIVSLLKNPMVIMLLVSVSLMGLMKLFPEEEIRESQKMTREWQKKLVKSVSTDKTGA
                     KLQTITK"
     gene            complement(<189772..>190524)
                     /locus_tag="LMJF_26_0690"
                     /db_xref="GeneID:5652797"
     mRNA            complement(<189772..>190524)
                     /locus_tag="LMJF_26_0690"
                     /product="putative Qc-SNARE protein"
                     /transcript_id="XM_001684021.1"
                     /db_xref="GeneID:5652797"
     CDS             complement(189772..190524)
                     /locus_tag="LMJF_26_0690"
                     /codon_start=1
                     /product="putative Qc-SNARE protein"
                     /protein_id="XP_001684073.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652797"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9C5"
                     /translation="MNPATHSQGEAAVPLTVPATAVGSTREDPWPQMEKQVGAMLADL
                     NARMQRFRDTAMPTVIAENELLECVGGCSEAVEDMRFALDTAMEHPESFAITAEELQS
                     RAERIRGWERDMMKAQQVAEKVKAAQRKRIMAQDGDIGDSGVRENSDFLRQEHDIQRS
                     MMQQDDQTLDRLSSGIHRVKDTAVNIQDELNTQEHILDDIDRGMTRVQMRLEGAMRKV
                     GKLIDSTSDRGKMICIAVLFLILVILILFVLR"
     gene            complement(<191540..>193003)
                     /locus_tag="LMJF_26_0700"
                     /db_xref="GeneID:5652798"
     mRNA            complement(<191540..>193003)
                     /locus_tag="LMJF_26_0700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684022.1"
                     /db_xref="GeneID:5652798"
     CDS             complement(191540..193003)
                     /locus_tag="LMJF_26_0700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684074.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652798"
                     /db_xref="InterPro:IPR001646"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9C4"
                     /translation="MAAWTRPRYSTVHDRRSCGEQTHTRCHHCPPRSSVAGVHQRHHR
                     HHARSMEPCARFCGAAPSRERCGKSRTRSEAHFLHEATLRPSRSPTSMRATRKHDATR
                     TSPYALDRAQMLDAVLALSSALYEDEAATTAARVDDAKASCNAAEHPVSSLHVSPVTS
                     SGALGKLEGVTVTPENAYASLDAEDLMTSMDACSEGCGDKRDTRTLHIDLATNAPAPS
                     LSSAVIAQPSSTGTTSSSIVATFAARDVPLERKLLQFMDLCSNASATPHLSDDHSDAA
                     SQLPWNGGAGARAGDSRRDRTTSSAVTAWSSSAAAALILPGLDMKAILAHGVLENRHL
                     RGLSLVRCDFSLVRWSHVTLEDCDLSRSLFYGAKLGTVVFRRCNFTGCILKGVQCRSS
                     RSTTTRFEDCNFRLAAVGLTCIPHDSERAGTDANQGQGIIGSSSRRGGPSVCFLRCNF
                     DLSDFKFSQGLDKAKFVKCSNTRSASCFPLRARGGVG"
     gene            complement(<195601..>198408)
                     /locus_tag="LMJF_26_0710"
                     /db_xref="GeneID:5652799"
     mRNA            complement(<195601..>198408)
                     /locus_tag="LMJF_26_0710"
                     /product="putative sphingosine kinase A, B"
                     /transcript_id="XM_001684023.1"
                     /db_xref="GeneID:5652799"
     CDS             complement(195601..198408)
                     /locus_tag="LMJF_26_0710"
                     /EC_number="2.7.1.91"
                     /codon_start=1
                     /product="putative sphingosine kinase A, B"
                     /protein_id="XP_001684075.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652799"
                     /db_xref="GOA:Q4Q9C3"
                     /db_xref="InterPro:IPR001206"
                     /db_xref="InterPro:IPR016064"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9C3"
                     /translation="MHSLSSNNTPSPHPATHRHTNHSSTHTSSLLPPTASPVLQASCM
                     SAKEDHIGADAQGIPSSALFTPKPRIFAVPASTESPPSPGATCHHAPTGGINVSAATG
                     VSAAHHSDSGSNTAAPTASSSSPALQKQQPEHCVPAAYRGKLDDAPHAVDDNMEAVIL
                     SKGRICTLAYFPSRGSFRITHVSSNGKTRVVFNIPVRMIINIETAAERDARQRARQAN
                     DDTIKLVFAESGRNTRSLLCSFPSGAGEDNEGVVLAHSVNTASLTLSLLGGPPPTPTA
                     SHFGAHTAACAAATAAPSIRYYVHYVQQRNKENPSIRTLEFQSSGPAETVQHVVSTVV
                     QHIYQKGSKHIIAFISAKSGKGKGEHIFEKHVRPLLHFSRHTYQAHVTRRAHDCEDYV
                     ANLENPMDSNTVIAAVGGDGMIHETVNGVHRRKLALVRWLRSVTANVSTGNGSVVSPD
                     LSVHLNEERCAAVLLKSGSANKVVHHGEASVDSPSSPFIELGCEENKRDGYGGNGVTP
                     SAEATAREAYRLARCLVQGGWDALMPLVATVATGSACGLAKSLDVLSVTEAALSLVHL
                     STVHMDLLLLNFTPNEDMVEFHRCRMSSRRLDAAQREFSRYKEDKAAELQERSRLGEA
                     PQLPPRTLTAADCMTPFLKDGSNVYRDAVSCAMRMPELHSRVAFMSLSFGSANDIDHG
                     SESLRWMGNARFQVYGGYMILRGLKRYKGMLRYLPWGSKAGKTVEKLHTRCKMPSTDD
                     FPLCTMRESCPHCRQYVFVHCGAPSLSSIQGDDTHPGPTPNTSRSTAQPISAAEVLAP
                     YTDQQLLDEDVVDFKDERLPWVTVRGDFCIALLCNVRDVAQDMLMAPLAHMSDGAIDI
                     VYCRVDPITGRGGRMEMLKFVIGLESGSHVNLDFVNYVKARALEIKVDAGISMSDGEL
                     MPLSSVRVTKMRGSVQFVRSG"
     gene            complement(<200532..>203801)
                     /locus_tag="LMJF_26_0720"
                     /db_xref="GeneID:5652800"
     mRNA            complement(<200532..>203801)
                     /locus_tag="LMJF_26_0720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684024.1"
                     /db_xref="GeneID:5652800"
     CDS             complement(200532..203801)
                     /locus_tag="LMJF_26_0720"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684076.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652800"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9C2"
                     /translation="MPYGGFSKTRYGDSLEGWSAVEKVAKFSQAVGRVSGGRGTAILI
                     GLIDSEAQLIDASSIGRLGNSGNNGTNLSHGFTHWHRNDGCCSTQRAQQPSNSGWCAG
                     RPGASRGSTPPQGPPALGVLLTTSYVLRSPQDMTDASVCFLDQPIAGMAASLGREPKP
                     VHVGLCSAFGFVSSAASPKKERECTCRTSTAATACRSRLDDEPDYLHCAAAAGDSEED
                     ETEEIGFTLTYCEVFPTHDDAAYPKEPSPRLNSSQSGDSHGCSAESATSSPSGRGPRC
                     EGGAGLGKEADGTPASLSEFALPRERGAKGVASDAAHASGGPQANRFASDAARRRFCG
                     AQDSLCQVQPLHLPLLLSAIPAIKVGDVHLMITHVNDGRRSYRVQHVAAVFADYCLYE
                     PTSFGEVTCSGGPVFNMQGDFIGVQHERHGQSLCLLLKSIVRHLFDAGLLGMCRAPVS
                     EETVKQREVHIRPGHAVFSAMPTRLPALSGRGRMPSLKTNDCPASLCRTGAAAASDGA
                     ERGGYSASSSRLPAVSLGSKSPASLRAERHFTVDATGTTMAPSFAAMSSCGSPRTLHN
                     RPGNNATNSSCKSVRPAEDGAGVTDAVAAAALPLTLPSKPLSQCVPSFEEVFAEFFDG
                     ADSLPHILYAFPHCPPLVKMTIERLALLKREDELERIVAVGGIGAILEAIDGYPQEEQ
                     IVTSALAALCRICLCERNLAIFLHLDGVVTVMEIMKEYVRQQGVLQWGICTLLYATDM
                     SCPSAAASAEVMVRSSAPELLVNVLRVHGTAPRKTATRQSQSNHLIRWDCDLIANLLM
                     TNPRLTTLFLREDLLTLLLQLGRDDAGNAFLMEGFAHVFCAFVQCFTEEDEPPPSHIL
                     QLASAPGFKRYPAMSFPDNSPASRFCELSVHEGASNPNSAAHCGGGDHVCRGGREPPA
                     SPAPATSLPYSSNTIETSPHKVSFFFLCDTMSHDTDGCLARAVVDVCEAALDPKNSIT
                     AHRGRPEMVLMRCLETLRLLLTWGLVRLPRGEAMLSAVESLTVLGFPSTLAMPPTCFS
                     APSSPRSLPSFSEDTARLLLICERVRRESTSSELVASAEAVQRLLLRGSPMPGVVCAR
                     A"
     gene            complement(<204893..>210850)
                     /locus_tag="LMJF_26_0730"
                     /db_xref="GeneID:5652801"
     mRNA            complement(<204893..>210850)
                     /locus_tag="LMJF_26_0730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684025.1"
                     /db_xref="GeneID:5652801"
     CDS             complement(204893..210850)
                     /locus_tag="LMJF_26_0730"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684077.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652801"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9C1"
                     /translation="MSLSSLMDALSRLEVLFRASGEALCATTQPSAPDPRTENVARRD
                     HDEHAPSTEPKRTALQVSSTLDALATAAVRCDAEVGQQLAVLRRGVSALAQELSALSE
                     RYPSMNAKGSWAGATGGAGSPSSPPAATLRTPQIMASPPSAPGGGSTSGTAPAPRGSF
                     RDTSPSDPGPASPSPAHRSSIVNATTTPPQLPAGSAASRGVGSIAAVPSSGLGASSAA
                     SSVTRPATSAASTRSVSAASPPLRAAATPSRTAPPAESTASPPLALSLIDRPELQVPA
                     AQLPHAACVENVKKYLSNCVEWPPRPREQRRARLPQGVHGGRAWKREDSSDGGRGGGE
                     ASQLKGPDGQPTRSGLGGDSTHQRSETDEFLRQLTEESPYELSVPRSPLSNSRGSPAA
                     SSVRSGYNSNSGSYGSGGDNDLRFEEEEQQQQRQLSGSAAVDRRASSKAATTGSGKRH
                     RSHGPVQTTPTRRTPRRRTRSTKANGADAQPQQASRRRGRPTLQESVDALVLGQLRAD
                     GIALPAPMEAELRWCEEDDVNAVSRSAEAASGVAAAARSAKPAAKGAKRLSDGSSGRD
                     SSSATDDVEADFAVVLQEVRTLVRHGQRGSVCRGSLTTTAAGAAKELSTGVDNPRSEL
                     SRVSAQLSMRLPTTSTWLAQIHSFCALLEDMAIAAATGDADATVSAEEDRQEGSKKGL
                     TRRSQTSATSLTRERVSAAPKAFSFSSSAASSPNRSSSDAAAAASASDFSTVADELFS
                     SAEEVEGSNDGESGDGQRRRTKRTPVTSAATAAVAVVEAPPISLMTSLEHSVSIAQPS
                     LHSSQSSSAAPSSFRDTSRSAEPHQDEAGAEAEAEEGESSAPIQASRSLQATVALADV
                     WLGCFDVPGVRVDGSGATAVGAASSRRSAPSAPAPTISSSPAQQHLPLRQPRTPTTGA
                     RALAEQHSCSHEAQQHWQRTLQQRQDALLRRRCVRMRADTPESPAESPSPITVAAGAS
                     ATDDAVPQRTWAQCIGGGKVAPVMDHKAAAEHLRALCALLQTDLIVISTLQELSALMR
                     TTPVAVSADTEARNGKAAPQPSSPCSFFAAATHLLVSLQQHRTIQARSAQEACMLHDG
                     SNPAAISSHSAHTLTSISEPLTPPGRSGVAMTGGDGTGAAPLMLSVLHPMSALGYIPM
                     LRSVASTAMERLLSGDSDGAADTLSHEEHLTRYILAVAPYLLAWETGAAETGNCDGAP
                     HRRGSVSPVDGEGTLPLASALCAASASRLPLPVWVYVESLTTMLLEEARKLNAMYELY
                     VLVVAEATLQSRRSGPGCAADLSTATSTGFSLPPVWHGGTDETLMSYVRRRGRAASIA
                     QGTGVLGMAVSLDNGLEKYVKPISAYLLNSFDQLEGRHLLHSVFQEVQLSDVVARVRA
                     RREQKMGSSPAGRRRSPGAPSADDEEGLDNFSLPPGALSSPALRSAASARPSMRATEQ
                     RTSSGRGGGSRENDVDQPAEQQRRGDSESGATRQRRGRGTARRLINLSGPGQTRHAII
                     EGFVRYLTGDRRRSSTLSGGANSPSHGADQRSGTESGGSPSQQRASSHTASHHHSGLT
                     LDVPHTSSLLQEMDARLEAGASNVALIRSVERKVDTGSLIDALNAGKFLPHKHAELST
                     RHYFNARAATFTTRHTLPSYSAACVSVVQCRWQPVFQSTMCFCPVTRRRCLDPLVCGA
                     LLISATLPPQEIIYSAPDPSQSSTPTHGVSGGPAEVVTAPATGTAATTNANRQLPNTI
                     RVLRSRFERSTEASRPVQQRQIQASSPRSDLPQPQSTAVATNAPDMRTALPGSPRSQQ
                     QQQQYQRLQQLRPPAPPLPHAALPDPIRIISVSSLFPAFFLRGPSMMPDAITISRIMT
                     RAVTALYTDSAVPANDRDGGREGDDQAGGATTATAAAAAVTPLTNDAFHALRAVTVPL
                     DMPPVTRNLLASPHRAHASLLNPPTLLECGHVVSHKTYLDLRTTARRTNRNAAAVAAG
                     GTTTVVCCPYCSKVTAVKDAVTLSYLY"
     gene            complement(<215949..>218480)
                     /locus_tag="LMJF_26_0740"
                     /db_xref="GeneID:5652802"
     mRNA            complement(<215949..>218480)
                     /locus_tag="LMJF_26_0740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684026.1"
                     /db_xref="GeneID:5652802"
     CDS             complement(215949..218480)
                     /locus_tag="LMJF_26_0740"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684078.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652802"
                     /db_xref="InterPro:IPR000408"
                     /db_xref="InterPro:IPR009091"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9C0"
                     /translation="MQPVMETPGALYVNMENVSPATRKLVERYISGDGVIVGWGFCRN
                     GELGTNFRYNLVTPMMIGGHDKPIRMACGGLSSVWLGVRNILMAMGGGMWGELGVGNP
                     RFCPRVIANEANMPICPGQVDVIPFTQDDVVVDVAAGSAFYACVSLKGNVFTWGANNC
                     GQCHQDLNNTCCCYGQLRVVPGESVVEVACSNYSVLARTISGAVYGWGEVTLLGDRDT
                     VAEKLAAAGLELVQSPQSESRVVARVPVRIDSLDDKNIKLLSSGPWHYAAVSADGSVY
                     TWGIGNSGRLGHGDQDDHLSPEVVTAMKGKRVVDVACGSFHTVFIADDGNAYACGDNQ
                     GGQCGVVGEYSVPVPTKMNITGGRKVIHASCGRMHTTLLLNNGDVVVYGTGLGLGVGI
                     GYGMRMVRCQAILENYTVLWTKSGPTHGLSLTIPKNTTMLVLGVPHRGVPVSVTSIGL
                     KEGILSCGVGAGFTLMISRRGSCYSFGVGGWGQLGFDASQAKHFTQDRVPVYPQATRI
                     GFFSRTIITSVAAGFSFSMAITEGERVFAWGNNSFAQCGLGVDPKKYQRISQPREITW
                     LADKEIIQVSCGSYFALALSASGQVYSWGTIECCGVGLEPDPKVVPTHMIMRNVSGET
                     RGVVLSPLLIDSLKGIIQVAAGGWHGMALNAIGEIYAWGIGTGGRLGTGDCEHYYTPV
                     RITHGAFFTRIGCGCYTSYGIDDNARLYVWGVNDKNQLDMLGSKVVTPTPVLENVREA
                     CLGKYFSLALTHNNTFHFSGVMGFDSASYASRSFNDVDSLPEKLKPENIQAEHLRGLK
                     LFGGLEHVIALLEKDPIPEAVVTEAIVGLREQPERLVRKYAAQVR"
     gene            complement(<219323..>224587)
                     /locus_tag="LMJF_26_0750"
                     /db_xref="GeneID:5652803"
     mRNA            complement(<219323..>224587)
                     /locus_tag="LMJF_26_0750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684027.1"
                     /db_xref="GeneID:5652803"
     CDS             complement(219323..224587)
                     /locus_tag="LMJF_26_0750"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684079.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652803"
                     /db_xref="InterPro:IPR000408"
                     /db_xref="InterPro:IPR009091"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9B9"
                     /translation="MEAACRRLCQGDTSSLPDIVDCIEAGQQAPTGKLGARAYTALAT
                     LMLREGVVLRKSYASNSALPSREAFYALRILAVLGARHAQEGHDVKSVLLSLGLQQCR
                     DMKLDAYFALRRRQQYYVIMFVTLLIGVYGCRPQDLLQNATSLNVMTGSTDFGRLPPH
                     LEGQIEYTELIPALPHHTARVAAAAAGCSGGRTSLTAPTNHQPHGATSGSGSPPRCAG
                     VQNRRSLLISIPGTSTDLPLQPTRWYREFPRKPINVPYPVNPLYVNVALREGSSGATA
                     AGGTTCDDGDGDGVSPAFQSLVAEIPMTAQFPTPVVLFSVYYGVGCVPRLPTLDDLAR
                     LHAWRERKQQEQAASTPGTDFSSRTLLAEHRHGWGSILEAAVQIREPDVAAEGDDPHL
                     FAVRNEMAFMSPSASAVAYHRQCLGSSLLRHYLEEGKLLSWGSLAKGALGQHRQRHRR
                     SPHELRKSVAVSSDPAGSNAKVGGAAPASVNAKQQYSSSPDASALGSNEGEASLVGGG
                     SPTAGSLVSVSKVSLARRLSTMDTLSETRPGGRCVTDQFQASPSAGLPKATSTAFAGA
                     LAVSATSLDDTGATGYVYLPSYVHTAARVAQVACGLAVTYVLTVDGALYSCGRADNGQ
                     LGIGEGSARYSDAGVSKLQRVLLKDNERVTRIAAGTACAMALTGDSALYCWGHNVYGQ
                     CLTMPEASHVSTPVRLKAGVHKILDVCFGQFFGVLLFDDGVMGTWGVASMLGCNMSGK
                     RLEQSLASDQCKCSRQIVHLQLATPTPMAAVRAGPWHALAISQKGEVYTWGVGRNGRL
                     GHGTDNSEVKPRLVEGLRSSFVVDASCSNAHSAVLTSTGAVYVFGENAEGQLGLRGRE
                     PRRLPTMVPLPMKAVAVTCAREHTCILLADGDVVACGSYRTCGLGLGYGRQLCAASRI
                     LTNYVTLTLHCGHLQSMAGVVHRRTSVMVVGHSTIEKMSRVSSLIVRSGVRCAGSGAG
                     FLVVLSESNSLVAIGRGERGQLGIGDCMKPNRRDDVTVAAAFREVQIPSDVVIQHVRC
                     GPDFVLALDTSGVVYGWGSNDHRKLCQPADVAQVFSPVRIAAYTSERIVQIVCGGTFV
                     VALTADGEVLTHGEAIYCGLGAPTSPTKAKGSDVPVPMRVAGLSDIVAVAAGLHHAVA
                     MTASCSVFAWGVGVLGTGSTADVSDSTLFTSVTPAPVRVALSQTIRSIGCGPNNSFAI
                     SDEGELWVWGVNRFGECGMPTSGKGASIGTGGGALQRLAARQKQGSDAAADHASVIAT
                     PTAVARQVRDAAFTGEFGVVVFEDGQVSVSGRIRYGGQRYLLSSFHSTPQPPFSIDVN
                     ESVWRSPTEPRTSFSTSLLGSGGGGASAAVATEPRQQEHQGNADADGAFKNDREPSPS
                     SYVGLPAAGKSAMLPTDGQHQHRPQPPSPPRSYAAGMGMAAASPTSARASKSPPHRAS
                     LSLPLMTRGRGSPTVPSSRAATIVGEPAPLAAPSNPLLSIPSPRLGARDATPLDHGHD
                     MMSAYSLPSISGLIPSAQGSMPQAATAVTLGTMDAEGVRSGTDSGVYTVDEEAQTNLA
                     SSGAYLNSGEYSAADTMTLLSNAEVSSEADACTPMPLRRASDGATPSPVRAKTSRVAR
                     ARKPLSATWDTLDTRAPPMLPLSPDHSVAQSADVGVAAASSTVTTARATAMAQVRAQT
                     PSRIHPAQRGPKVRAAATSKLPKPSLSSPPPPSAADERIVGIRCFAGWEQICIVMEKY
                     RPSAAEVGMAQTGLQVLLRQSENAVREA"
     gene            complement(<225419..>225895)
                     /locus_tag="LMJF_26_0760"
                     /db_xref="GeneID:5652804"
     mRNA            complement(<225419..>225895)
                     /locus_tag="LMJF_26_0760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684028.1"
                     /db_xref="GeneID:5652804"
     CDS             complement(225419..225895)
                     /locus_tag="LMJF_26_0760"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684080.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652804"
                     /db_xref="GOA:Q4Q9B8"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9B8"
                     /translation="MKKYRSGNSGPYTPDYHALLGSAPWIIIRRLLSQPPKDAGNDNS
                     IPQISEGDIVTVFSQFGEIVDVRFVRHRKTGRFLGTAFVKFKDYRSGILAADELNSNY
                     DKGEHFFLSESQEGSMSSGEQKGITVERCEEVVVPQLYNDEVESYAQWLCRHNITL"
     gene            complement(<226706..>228337)
                     /locus_tag="LMJF_26_0770"
                     /db_xref="GeneID:5652805"
     mRNA            complement(<226706..>228337)
                     /locus_tag="LMJF_26_0770"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684029.1"
                     /db_xref="GeneID:5652805"
     CDS             complement(226706..228337)
                     /locus_tag="LMJF_26_0770"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684081.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652805"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9B7"
                     /translation="MDSSHFKRVHYDLPQEQLEYFGSRARTSPSFVPSTPVRIVCDKA
                     TLGCNHEMLRRSQERPENAKNELHAVTQLGSLAEKYHQYFAQHLQADIESPWLKTDSA
                     VSGFHPVKESQRHETPAPRTTAQKPASESPSHVSSVQRAHPPVRANSSLQPRFHGSIP
                     QEQSASIIDHATWHMTQSTENYPLLSRNHYEQPQGEHAPVSKLSASCDSPVSRDLPIG
                     MSTSARSQHEESAVPQQTRERPSEACSYMPQQVDTIHPVLKAQDHQESNYLARRPASQ
                     GHLDEYERMCDDEENCTFHPKVNNASWRRKMRMQRSTHRESERANSLCASRGDHEANV
                     YDRMHGDADAVKRRSDSRRAQKEIDNTQVERNASHGSRSTFVNPHRSAVDSQAEPKEV
                     FLRLYADAQRYNKEKAEQERLIELKRQQERGEAPYDRENGSKARDGSQGQDDGIGVSE
                     DEKSLTAKPRGSSSRRKGSATRDLFERLSRPHTVTIKFEKQKEQAEQEKREKEQRNIE
                     AKRSETEKITACSWRIPSKSFTFSDLESQNALYVS"
     gene            complement(<230300..>230764)
                     /locus_tag="LMJF_26_0780"
                     /db_xref="GeneID:5652806"
     mRNA            complement(<230300..>230764)
                     /locus_tag="LMJF_26_0780"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684030.1"
                     /db_xref="GeneID:5652806"
     CDS             complement(230300..230764)
                     /locus_tag="LMJF_26_0780"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684082.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652806"
                     /db_xref="GOA:Q4Q9B6"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9B6"
                     /translation="MEATVAPSTGLRQLRRVRRARTQYERLQRPDDIQPGYPIPSIEG
                     WVLFFSNLPETTTQEDIANYLVSFKEGDPDYFGAITDIKIPLNADCFCAGYALVELED
                     RAGYERAIAELNGTVFPSADKPLVVAPTFLGEEEEQEPQAEEVAPGEKRARD"
     gene            complement(<231367..>231765)
                     /locus_tag="LMJF_26_0790"
                     /db_xref="GeneID:5652807"
     mRNA            complement(<231367..>231765)
                     /locus_tag="LMJF_26_0790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684031.1"
                     /db_xref="GeneID:5652807"
     CDS             complement(231367..231765)
                     /locus_tag="LMJF_26_0790"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684083.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652807"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9B5"
                     /translation="MLRFSSRAVLRAPVFCRIVDVMRQHEPYARAGILYPIRVELGEG
                     VESCTPAELQEKIDAMLSRSQRFATVKTGNVYSRNNSVATVIKAYGQYVVTGNMRGGY
                     VKGDHRYGPRLTGYGGATAKPGLLWNGDNL"
     gene            complement(<234130..>234681)
                     /gene="TDPX"
                     /locus_tag="LMJF_26_0800"
                     /db_xref="GeneID:5652808"
     mRNA            complement(<234130..>234681)
                     /gene="TDPX"
                     /locus_tag="LMJF_26_0800"
                     /product="type II (glutathione peroxidase-like)
                     tryparedoxin peroxidase"
                     /transcript_id="XM_001684032.1"
                     /db_xref="GeneID:5652808"
     CDS             complement(234130..234681)
                     /gene="TDPX"
                     /locus_tag="LMJF_26_0800"
                     /EC_number="1.11.1.9"
                     /codon_start=1
                     /product="type II (glutathione peroxidase-like)
                     tryparedoxin peroxidase"
                     /protein_id="XP_001684084.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652808"
                     /db_xref="GOA:Q4Q9B4"
                     /db_xref="InterPro:IPR000889"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR029759"
                     /db_xref="InterPro:IPR029760"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9B4"
                     /translation="MLRLPPFPRAAAAAQASSIYDFKVNGSDHQPYDLGQHKGHPLLI
                     YNVASKCGFTKGGYETATALYNKYKHLGFMVLAFPCNQFAGQEPGTEEEVKSFACTRF
                     KAEFPIMEKVCVNGEHEHPLYHYLKNTCKGILGTTLVKWNFTAFLVDKDGHAVCRFAP
                     GATVSEIEKKLLPLLQAAASSKI"
     gene            complement(<236435..>237007)
                     /gene="TDPX"
                     /locus_tag="LMJF_26_0810"
                     /db_xref="GeneID:5652809"
     mRNA            complement(<236435..>237007)
                     /gene="TDPX"
                     /locus_tag="LMJF_26_0810"
                     /product="type II (glutathione peroxidase-like)
                     tryparedoxin peroxidase"
                     /transcript_id="XM_001684033.1"
                     /db_xref="GeneID:5652809"
     CDS             complement(236435..237007)
                     /gene="TDPX"
                     /locus_tag="LMJF_26_0810"
                     /EC_number="1.11.1.9"
                     /codon_start=1
                     /product="type II (glutathione peroxidase-like)
                     tryparedoxin peroxidase"
                     /protein_id="XP_001684085.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652809"
                     /db_xref="GOA:Q4Q9B3"
                     /db_xref="InterPro:IPR000889"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR029759"
                     /db_xref="InterPro:IPR029760"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9B3"
                     /translation="MLRLPPFPRAAAAAQASSIYDFKVNGSDHQPYDLGQHKGHPLLI
                     YNVASKCGFTKGGYETATALYNKYKHLGFMVLAFPCNQFAGQEPGTEEEVKSFACTRF
                     KAEFPIMEKVCVNGEHEHPLYHYLKNTCKGILGTTLVKWNFTAFLVDKDGHAVCRFAP
                     GATVSEIEKKLLPLLQADSGDAKVLPSTQS"
     gene            complement(<238761..>239285)
                     /gene="TDPX"
                     /locus_tag="LMJF_26_0820"
                     /db_xref="GeneID:5652810"
     mRNA            complement(<238761..>239285)
                     /gene="TDPX"
                     /locus_tag="LMJF_26_0820"
                     /product="type II (glutathione peroxidase-like)
                     tryparedoxin peroxidase"
                     /transcript_id="XM_001684034.1"
                     /db_xref="GeneID:5652810"
     CDS             complement(238761..239285)
                     /gene="TDPX"
                     /locus_tag="LMJF_26_0820"
                     /EC_number="1.11.1.9"
                     /codon_start=1
                     /product="type II (glutathione peroxidase-like)
                     tryparedoxin peroxidase"
                     /protein_id="XP_001684086.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652810"
                     /db_xref="GOA:Q4Q9B2"
                     /db_xref="InterPro:IPR000889"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR029759"
                     /db_xref="InterPro:IPR029760"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9B2"
                     /translation="MSIYDFKVNGSDHQPYDLGQHKGHPLLIYNVASKCGFTKGGYET
                     ATALYNKYKHLGFMVLAFPCNQFAGQEPGTEEEVKSFACTRFKAEFPIMEKVCVNGEH
                     EHPLYHYLKNTCKGILGTTLVKWNFTAFLVDKDGHAVCRFAPGATVSEIEKKLLPLLQ
                     ADSGDAKVLPSTQS"
     gene            complement(<242069..>243130)
                     /locus_tag="LMJF_26_0830"
                     /db_xref="GeneID:5652811"
     mRNA            complement(<242069..>243130)
                     /locus_tag="LMJF_26_0830"
                     /product="putative aspartate--ammonia ligase"
                     /transcript_id="XM_001684035.1"
                     /db_xref="GeneID:5652811"
     CDS             complement(242069..243130)
                     /locus_tag="LMJF_26_0830"
                     /EC_number="6.3.1.1"
                     /codon_start=1
                     /product="putative aspartate--ammonia ligase"
                     /protein_id="XP_001684087.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652811"
                     /db_xref="GOA:Q4Q9B1"
                     /db_xref="InterPro:IPR004618"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9B1"
                     /translation="MSSDPQAYIDLQTRILRVKTIFAEELANALNLIQVEGPILARVG
                     DGTQDNLSGVEKAVQVHVKEIPGENYEVVHSLAKWKRMTLGNHKFPVGRGIFTNMHAL
                     RVEETLDSIHSVYVDQWDWERVIAPADRCLEYLQATVRSLYEVLRETERRLCTEFPDI
                     APILPDSITFVHAEQLLKRYPELDPKSRELEAVKQFGAVFLIGIGCKLSHGDHHDARA
                     PDYDDWSSPVSVDSSKIGFPTADDEKPSVNTIMSLQGLNGDILVYNPVLNDALELSSM
                     GIRVDQEALRRQLEITGTSDRLKCRWHQCVLNGDLPQTIGGGIGQSRTVMFMLRKRHI
                     GEVQCSVWPYEVTTQYSLL"
     gene            complement(<243985..>246825)
                     /locus_tag="LMJF_26_0840"
                     /db_xref="GeneID:5652812"
     mRNA            complement(<243985..>246825)
                     /locus_tag="LMJF_26_0840"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684036.1"
                     /db_xref="GeneID:5652812"
     CDS             complement(243985..246825)
                     /locus_tag="LMJF_26_0840"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684088.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652812"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9B0"
                     /translation="MMVGQVVSCAAATTSTGSPMSVTARLAAAAEARAAASRARFGIF
                     ENNANDTARQLLFRGEKRRRYCVIVGDLQNNTRQVTLKLFGHKGAKPFKLQNKLIRLV
                     NLSIGKPRRGTLQWRVAHGLLDDDDVEGQQPGEEQRTDSDEEEEQPREQDESTADSDA
                     VSTVDDDDNDMDRDGEDAAAAAATTDGKGGNDGATPTTEAQGRDAAYATPAAALSALN
                     GNTPPPQAMDSTQTAAERAFQNQTHAAAGFDVEEIVPFSSSSSCEGDDSEARQEARQR
                     KSIALAEAAGAIERAAAAVPIPESNSDDDGEDKGLKVIAAPTPLGGGGPHVLASPLAL
                     ASDVVKTSATTGGNRGAGNASAAAAHADPIAPAPAATSTEAAATAVKRHAGSLDHHSK
                     GAEAEGEDVDHYLDNDDEVVPLTVQQAGAGATVMYETSLANSPVLTAKRFASLRDYFL
                     REFRFLLSLEDVRSQNVSVKINLGAAYCCLARQGSYSTPLKHATFGEFVERMNTESMQ
                     LYFIKDCPACVSRAVDMESGSLHFPASSTTVKINFFSNERQSRSIARAVWDSDADQFR
                     LLDVENIGVTFNWSVFSLDETFVRRKNEVHAAAAEGSGMGSTGAPGTAIVSPRAAPAP
                     APAVGAGSASAAATEAPPLLPVPTANKVRVGPAPVAIGVDPDRPFQNTSVLEAKEAGT
                     EDEASAETVAPAAEEAKSSYKTPIDDDEDDLARNKTVAYPFEVEFRAYRRWKQQGDNP
                     AAPLAKAILEELSLAEHNYLIHGSTAMYERMDLTNVCEVDYAAEDLNVESIVVEHTSR
                     VKPEGTDLLVDNTTSLFIENFAAARQLKEKVTTYGPIKVAAMQNPSNNNFMRSVTAAR
                     RAAGRGGGHGARDALHLTPAEMAEVLKPTSKLTFFRSRGSTIHWKLRPNSSLEENIAP
                     MTEALSFLQQVLHTANEIERNSARGGAAPDAL"
     gene            complement(<247773..>248738)
                     /locus_tag="LMJF_26_0850"
                     /db_xref="GeneID:5652813"
     mRNA            complement(<247773..>248738)
                     /locus_tag="LMJF_26_0850"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684037.1"
                     /db_xref="GeneID:5652813"
     CDS             complement(247773..248738)
                     /locus_tag="LMJF_26_0850"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684089.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652813"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9A9"
                     /translation="MTGVRHDAAVETAKKSLESIVEELAPPNASSEVLAKIRSYLQQH
                     PVDTLILNTEVQITHIENPDTGVEERVHLSPMDIKDALKQAQLRNMNLVRMGARGDDL
                     AYCRIRRERPWVWRLVQPEMDLVNGLTGTPATDAAVAAQKQEQQVRDACSGDGQSNHL
                     RQYVGKTKELIDHVFRDAVDAHFVGWRSKKIAQDIRKGHPVKLTIRDFQNPEAAVHKL
                     REMSNAVKKYAEEQHIFHHFTSIVANDREASLTLSPPTANKSGTISKAVKHPSEKEWT
                     HTLNKMEDACRKAGRSGTYLKSGKLKMRNVGATTYRVDKYGRRID"
     gene            complement(<250030..>253011)
                     /gene="MP100"
                     /locus_tag="LMJF_26_0860"
                     /db_xref="GeneID:5652814"
     mRNA            complement(<250030..>253011)
                     /gene="MP100"
                     /locus_tag="LMJF_26_0860"
                     /product="putative RNA-editing complex protein MP100"
                     /transcript_id="XM_001684038.1"
                     /db_xref="GeneID:5652814"
     CDS             complement(250030..253011)
                     /gene="MP100"
                     /locus_tag="LMJF_26_0860"
                     /codon_start=1
                     /product="putative RNA-editing complex protein MP100"
                     /protein_id="XP_001684090.1"
                     /db_xref="GeneID:5652814"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:Q6T443"
                     /translation="MRGALARSACRLASLQKGTQLADVYQLLITKKPVEYDYIAIDVN
                     AFVGGAMRITKNMSPEQRRSKEASRHVLNSIMQILRRVVCRHSLLLAFDGPDTFAKAY
                     KLRTTSSTRRLDIRTQRLPGGALMRAVEDRIVKAMPLGRGLIPGEVVVSGVNVEGPVE
                     RKVTAWALDLACRDGAQHTFKSICLIGAGELWMNVLALTPYFQGTSILHGSSDLRHMT
                     LNDSLTWLQLGDDLLTGDARVITAARTDALLLYLLCHGCSATDLSPLSGSNFTVLMEA
                     YHARRREAAATAGAAAGAPTFQLIRGQPNGALMLDVQALYLLFVAEKDTAAAIESLAA
                     LVVPAKDESLHAAPLRTFSMPLSTSGGSASDEKMRDANMPDMLHGSYLSHLLNSHHLF
                     CHGEMLGRSRVPAYMEAEVKMGSLDRSGAAGVRASVVTVGDWTRFLLRCLQRGGRYAF
                     ASDAGAELSYSTSKCAPSAATTAAASAASSLTAPGTTAYYPFWSSAQPLTAAEYTILS
                     TPNPGILDPLLVDYVPGFTPALRSELPRALTSVQANLHELRSSLQYFFAYATADRPHP
                     SLCLAPSYHWCQNEKSKVWSMRYVDLGVVARQQGVRHARSLLPGMSMEQEAPTEGAAV
                     YDAESQTWTSQPRSFAVFTASEQLPGHQEQAHANGSSSSSMAATAAASADAAEVSTLR
                     VLTWNVMFDRYSNQPTPLGMPGIDWCSPKRYPVLAKLIDAEDADVVGMQEVERPFAEY
                     LAAQPWCRERYIMSCSPQSPILDPWGVLLLVRRGGRWPLQQLKHLNVPAWSGHVSLMP
                     VATLDLSAAAAHSDNSGTGCGSSAGKSGIRKLAASPRVVNVCSMHLLAPFVKVNEVAR
                     TGQDQALRHALTRQLQGDTLVMGDFNDWPSNEFLMPPESRYVECWPIIHPGDYGKTMD
                     ESNTFCKLKIEEIFFGRSDKVFLRTGTATASSPTRGVLKPVEAHLVGTRSVNDENGNQ
                     EAPAYLFPSDHYGVSMQFQVL"
     gene            complement(<254804..>257227)
                     /locus_tag="LMJF_26_0870"
                     /db_xref="GeneID:5652815"
     mRNA            complement(<254804..>257227)
                     /locus_tag="LMJF_26_0870"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684039.1"
                     /db_xref="GeneID:5652815"
     CDS             complement(254804..257227)
                     /locus_tag="LMJF_26_0870"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684091.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652815"
                     /db_xref="GOA:Q4Q9A7"
                     /db_xref="InterPro:IPR003888"
                     /db_xref="InterPro:IPR003889"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9A7"
                     /translation="MLNITCIGTVVQTSTHHGAMFGKPVIYPDNYTVERAVFSSSQQP
                     AAQASKPTFTYKAPFTTSALASRDEPYFTATIRWVKGQPTFTITRSDNPTDKTYTDSK
                     SATTAWRKALEDAIKDFPGRQAQLPAPADSKSKLQVNGIRLYGLHLKDVHDELLALPG
                     GQAALDAAAAAASSTAALATSTVTAVAAELDACSTSLLSSYGSQSPSQSQAKTQRRHT
                     ISPTPKSSAKPPAEAHSSARSSKRRTTPSCRASVDKDASPAASTAGLGTTAIIRSQPL
                     TDGAAIIPEKRRRTRRPKGLDEATATPESIAAIGGEAAAIMAAPPVKRRRTSSKKSLE
                     TARAPAVAPAPVSVTVVCPDCGSGDTPFCATTGRPHLPPPCTSCGLTTAFCPVAGQPH
                     AGAVQRANRQRGEVHLPGAARKPRRRVSKQPPGANAAAGARGEVTAVTVAGTEDADGS
                     AVDAGNGAVAARKPRRKRLRADDEAKQASVNGADASAVGAMEKPARTRRARKTKDWAA
                     AAAPSSESFAEGTKAIRGDTAVASPAAVVVEAPPAPAEEPAYTYPLLRPPLTLREHHK
                     ATHLLQESWKVHYGDGPVLPAAVAAVPLGLVPAKRVAAAGANRRRKGHGGAAGGGAGG
                     EEGKQSDDDEDGEEEETGGTRAKDGDDDGDSNGDRDTAKSGLSSAVGSPTSTAVAAVA
                     VPTMVHPLEVTQLSTSVAGKRLSRFLVQYTSERTFLDLLKNSSSAADGCAGRKAPKRP
                     AQQTAAGGDTGAEGEGDGGARTTADDGDGKHVVEASGASPTEEQQESVMREADAVDDA
                     VPPTATASS"
     gene            complement(<258727..>259176)
                     /locus_tag="LMJF_26_0880"
                     /db_xref="GeneID:5652816"
     mRNA            complement(<258727..>259176)
                     /locus_tag="LMJF_26_0880"
                     /product="putative 40S ribosomal protein S16"
                     /transcript_id="XM_001684040.1"
                     /db_xref="GeneID:5652816"
     CDS             complement(258727..259176)
                     /locus_tag="LMJF_26_0880"
                     /codon_start=1
                     /product="putative 40S ribosomal protein S16"
                     /protein_id="XP_001684092.1"
                     /db_xref="GeneID:5652816"
                     /db_xref="GOA:Q4Q9A5"
                     /db_xref="InterPro:IPR000754"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR020574"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9A5"
                     /translation="MPADKSYALKQVQTFGKKKTAIAVATVTKAAQCNIKVNGVPLQQ
                     ILPDTLRAKIMEAITVVGSKYYSRLRIDVAVHGGGQVSQAYAARQAIAKGLIAFFQKY
                     HNEVEKAALKDKFLAYDKFLLIADPRRCEPKKWGRHSARTRFTKSYR"
     gene            complement(<260267..>260716)
                     /locus_tag="LMJF_26_0890"
                     /db_xref="GeneID:5652817"
     mRNA            complement(<260267..>260716)
                     /locus_tag="LMJF_26_0890"
                     /product="putative 40S ribosomal protein S16"
                     /transcript_id="XM_001684041.1"
                     /db_xref="GeneID:5652817"
     CDS             complement(260267..260716)
                     /locus_tag="LMJF_26_0890"
                     /codon_start=1
                     /product="putative 40S ribosomal protein S16"
                     /protein_id="XP_001684093.1"
                     /db_xref="GeneID:5652817"
                     /db_xref="GOA:Q4Q9A5"
                     /db_xref="InterPro:IPR000754"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR020574"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9A5"
                     /translation="MPADKSYALKQVQTFGKKKTAIAVATVTKAAQCNIKVNGVPLQQ
                     ILPDTLRAKIMEAITVVGSKYYSRLRIDVAVHGGGQVSQAYAARQAIAKGLIAFFQKY
                     HNEVEKAALKDKFLAYDKFLLIADPRRCEPKKWGRHSARTRFTKSYR"
     gene            complement(<261943..>264777)
                     /locus_tag="LMJF_26_0900"
                     /db_xref="GeneID:5652818"
     mRNA            complement(<261943..>264777)
                     /locus_tag="LMJF_26_0900"
                     /product="chaperone protein-like protein"
                     /transcript_id="XM_001684042.2"
                     /db_xref="GeneID:5652818"
     CDS             complement(261943..264777)
                     /locus_tag="LMJF_26_0900"
                     /codon_start=1
                     /product="chaperone protein-like protein"
                     /protein_id="XP_001684094.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652818"
                     /db_xref="GOA:Q4Q9A4"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9A4"
                     /translation="MHRHVFRRSTALLQMANPGMGGMPGMPPGMGVPGANSSVGSSPR
                     LPNRPGKTVSYQNAIKMEAERRRKLEEDTRSRYYVVKEDTREKRGRGRVIGIDLGTTN
                     SCICYIDAATRRPKIIPSPTGSWVYPTAITFDKNHQIRMFGEEARACARTSASATLCS
                     GKRLIGRGFGELGRVQSNLSKTNILTVNEKGEVAVEIMGRTYTVVHIIAMFLRYLKSE
                     AEKFLDEEVQQAVVSVPAYFTPQQKVATEDAALCAGFDVLEIIDEPSAACLAYTVLEK
                     LKREERDAKQRAAVSPLASATATDASAAQTSSSGGNSEAVAGVSSSSTPEADAYGNKR
                     YVRSLVFDLGGGTLDCAIMEHDCYRQMLHLVATHGDPMLGGNDWDTVLSQHFAKQFES
                     KWRVPIEEEEGNVGQGVAAFRNLILEAEKAKIHFTHSTETYYGYNRAFHFSDKLRDIV
                     PLEATLTHEEYVTFTRPLRVRCLQCIEKLFEHAGYTAADIDNILLVGAMTRDPPIRHL
                     LEEYFGKKVVQEDTCPADYAVALGAGIRGGMLQGSFPELTASTRFVSGTVQSLREGGG
                     IVRRLWRNLKLMTSTVNPNAIGTRWRGRAKGLSDDEIANYAKELVEFEATCARRLLLE
                     RAESEANFVMRRVTADSNRKQGMQEKRIMQLSEQLKFWQYMVHNFHDHEEELLRVVKE
                     LQEALDELDGLATDNVAGLTKAGTIDFSKTLARTLRGVSGTAAEREDDNETGDDCTEH
                     AAANTAEKLSCTRETETQAGDAAPNTAAGPKILRRRAPLPAAASAAQELVEAGHPALM
                     HADIDVAESARNSFLQAQVEERAWHEPPAPPGEQGSWTEVKAAVDAGEVVGEPVPLRD
                     LLRPMTMIEMKAALQTHYPVDDPPSAEHIAKRDLAVDLQTMTITEGAVDMVQLQADLD
                     AAEQKAVEQAKEEERMVQERQKEMSARLFR"
     gene            complement(<265943..>267145)
                     /locus_tag="LMJF_26_0910"
                     /db_xref="GeneID:5652819"
     mRNA            complement(<265943..>267145)
                     /locus_tag="LMJF_26_0910"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684043.2"
                     /db_xref="GeneID:5652819"
     CDS             complement(265943..267145)
                     /locus_tag="LMJF_26_0910"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684095.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652819"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9A3"
                     /translation="MELHQQQQHCCEASTADEAVEGDGQRRTDAAEHHPSVRFYRGMW
                     SLTQLTDPIFDDVISSTDGSNGDKAVSAPASETPAEVPSGSPSPLSRVSPLSVVGLHQ
                     TLLPPAAVNGLGDVADENYAVQLASSNGLEFLRLHWHILLPLLFPCCRWGDEAGAIDP
                     TVSCSGRDNSSGQCSSHVQQDFSGSEEGASSPVESSCSASELYELLLRRPLLESDLAI
                     VREPGLMDRVYYSYVVLLRFFGWRVHEEERGLLDRHRAWQERYALLELYRASTTAAAT
                     TQLATGPTAAGPCSHVDGDDFEGNNVHQARHACPRPPPTYHSFNFYESGVPRVLRSLL
                     DIGFLRLAVRLVEFLLEEMSYGRLLFLLPLVEVTLLPILVQQPHVESSHKTRLKKRLY
                     RLTHSDSD"
     gene            complement(<267905..>268420)
                     /locus_tag="LMJF_26_0920"
                     /db_xref="GeneID:5652820"
     mRNA            complement(<267905..>268420)
                     /locus_tag="LMJF_26_0920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684044.1"
                     /db_xref="GeneID:5652820"
     CDS             complement(267905..268420)
                     /locus_tag="LMJF_26_0920"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684096.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652820"
                     /db_xref="GOA:Q4Q9A2"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9A2"
                     /translation="MSPHGLRGADARFRPFLSSSLDAYLKRYWAIVFTVGSQAIDTGH
                     MRHYVSWYATRLKVVELDHHMHAISLREQLIIKAGTPALPLLFVNQKLVGTIADVRSY
                     EERRLLKDIVQFGFQWKTGAALDCAPQPLNTLPSPYSDTELFRGRYRGTPVARPVVQL
                     PQLHPYRRQED"
     gene            complement(<269539..>271608)
                     /locus_tag="LMJF_26_0930"
                     /db_xref="GeneID:5652821"
     mRNA            complement(<269539..>271608)
                     /locus_tag="LMJF_26_0930"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684045.1"
                     /db_xref="GeneID:5652821"
     CDS             complement(269539..271608)
                     /locus_tag="LMJF_26_0930"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684097.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9A1"
                     /translation="MFQRSLWRFFAHLVREVDTAGFAGDFRRLHHVGAASTQTQAREA
                     RHAACNVLFCGHHGTGKLNLLKAIGLQCEKKGQRVAFVSADNQRAARLDGYLINFFIG
                     MRVSRDELPSQEQLEGTLERHVRLVESTFASSFPSLRNIDVLILDALELVQPTVLLSM
                     DAVARRLRGQPRTPFGGLRVYAAADFWRLPVHPTSDTGGYLFQLEQWEVLFPLQTLLR
                     KSHVQKEEELRRLTELAFYGALTLPQMKELEKLSMKEKPESRLFSWSSSTMEAEKSTA
                     TATEGEDEEGEIEEEDAMSIAQWTSFPGESAAADLPDGPEGALEATKDDEGAVNDPAA
                     GQTSLSSSSSALALLNDDMASNSFVATRMMLRFPRQPAVKEMPLRYRQLKRTEMGNFL
                     VNMLVHSSSATSVGLVDSLSVDVGSRVHLLLDGQEHYGVPGGAVGEVMQVGPHFLSIH
                     FPREHRTVDIPRMRVVCYHPFYPEIRYELQQFPVFPRKRICPMNILTYPHAFFVNLNG
                     RRMADTNDLGNLLAHQRSFADFTTRNTSDFANLDGMVHEPTRIYYHKISGKPISTARE
                     QWCRNCKQFVPTDSFFEHWATCVHSVRWCIDCNQTVSLELLGPHREKHQVVLCLDCGR
                     PVEWRHWEGHRLSCGPMMREVSTDNQFIPLRTRQLALEMGLDKRDLHTVASITKSSLP
                     KPREGVL"
     gene            complement(<273365..>275896)
                     /locus_tag="LMJF_26_0940"
                     /db_xref="GeneID:5652822"
     mRNA            complement(<273365..>275896)
                     /locus_tag="LMJF_26_0940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684046.1"
                     /db_xref="GeneID:5652822"
     CDS             complement(273365..275896)
                     /locus_tag="LMJF_26_0940"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684098.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652822"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR024586"
                     /db_xref="UniProtKB/TrEMBL:Q4Q9A0"
                     /translation="MDDEDAIRAAKLLRDDDGTDGSGLDSVRAPTADPSGYYARLGVS
                     PKATQQDIRRAFLFLSQRYHTDKHASQGDTVQNLMNERFQELQDAYIVLSDERQRAAY
                     DAGGDKGIHRLALVPAGVFRREDILKYVLSLDREAQLLRTAQMLSATSQTTVSFSTAH
                     LFSFPGPSEGIGSSSSSSAVEDGDDAESSAHGGRDSTEAEKPPSEQPHPAPSSIHEQW
                     TARQPMTASAATSFPAGDAAATAPSTPAPAAALLQSATPPAHSTAASVVEKGAPPASA
                     AAVQAQFTAKEVVIDGQRHIVLIPNEEVQQKLRQRMRGLVAGEASAPSLSGGSGGALP
                     RAAPRLHRMPVSQALMFAVVPKSMTFRSSFRHLIAPRLSLTFRTDSTSRMQKTTTSFT
                     TAAEYRPDDVRTYETSLRMAVHGLKWRVMQARALNPLWTLKAKLTVLTNSALLQKLEL
                     TLTRKMSATAELENVLAMSLTEHGYFRSSLNDLTEDVQQGLSTYMAFHNMYVTAFTGK
                     KVVLGVDTKDPKHPPVYGRVQYSVNCSPLAGQSTFGIEAWYLPSKTQRYGLAFTAVVP
                     YAVSPIAPPFFIVRSAQFAVVNQVSILYARGRHRISVPIIVFISPKVSHALMWLSAPL
                     TLYRIGSMLYRPYARAKAIRYYTEQRKLHIAEMDVARERARMEQLALENLVLISRAKE
                     ERKGGLVIINARYGVIEPQFAEIMPPVSPGVNRSPSGWWPSQFMARAVKRLVQGWMRL
                     RGTAKASSEAEADTEARHSSMRSDVIPLSIDVTIAMQNLVRDSALTLPAGTKSSLVGF
                     CNPDPYTPELQNLKIVYWFRKRKHMAVFNDDEEVELPQREHLIKF"
     gene            complement(<277746..>279599)
                     /locus_tag="LMJF_26_0950"
                     /db_xref="GeneID:5652823"
     mRNA            complement(<277746..>279599)
                     /locus_tag="LMJF_26_0950"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684047.2"
                     /db_xref="GeneID:5652823"
     CDS             complement(277746..279599)
                     /locus_tag="LMJF_26_0950"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684099.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652823"
                     /db_xref="GOA:Q4Q999"
                     /db_xref="InterPro:IPR024774"
                     /db_xref="UniProtKB/TrEMBL:Q4Q999"
                     /translation="MSDPVRRRYVDSGYPSYARPHAFDAYDSFPREADVVEQQQQQQP
                     SHQPLRRRGAPVPAPQLLLSARSTPLAKRPAPVKTPYKSASTTTTSSLIESAPCTNSS
                     GSSDTATASPPHDDQPTHLNKTQRPLLASASSARTSASVMSPLQQQVARERRQNEYRH
                     SSSLLQGGQSPAMQMTPLPAPARSSERSASAVPPPVSRRAHQRSSLSTTPGEQRRADG
                     HSQRLPTSRAPGSSMLTATEQMTIGHSHPAAVSLHSASPIRGLEGHKGRVDQARSPAP
                     RTSSSTPRSSTVANNVHPGPFYKRQQAQAPSPTGHSPTTRGSSTVVEEPARATADRRV
                     VAEPASNKADAQLVAPKELRRQRGQGEIRGQGYVAQTAYTQRNPFRRQDFAEFAGNPQ
                     YLPPHGFHVYPQAMATRVYGLEVSRASQGDCMMQSLLDAAHPSTAEERAEMEALLSAT
                     LEKLQLGDWFYKWTRIKRVHQRYVWLNLQRGTLMWSVSPKKSAVLSSEVKLSTVTSVT
                     PECLQLEAPVRFFYRMNINTPRRCISLATEIREKFDVWYHVLQQLAAPNSMYGVPGVW
                     GRPSSSVNAAGWGAASRWASRYSPLSAVVDNATGPTGYNEAYAHGAVSSSD"
     gene            complement(<280425..>286154)
                     /locus_tag="LMJF_26_0960"
                     /db_xref="GeneID:5652824"
     mRNA            complement(<280425..>286154)
                     /locus_tag="LMJF_26_0960"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684048.1"
                     /db_xref="GeneID:5652824"
     CDS             complement(280425..286154)
                     /locus_tag="LMJF_26_0960"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684100.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652824"
                     /db_xref="UniProtKB/TrEMBL:Q4Q998"
                     /translation="MPLLTGRHTQTNAYACTSPDCWRRRNAVRAHVQGSCMQPLVWVR
                     GCSDKTRSVLVNDSSRSSLLSRRGRLCAEHDVRVREKRVWRRQQRSPDFCVSVFALQA
                     DGDAFASHPLQKQTTTTTKGGVETGRTEAVEGDVTSPSRRRCDRVQATVSTRGVFPSS
                     PSRRRRPGCFIMAIFLARWHSRWRLPARTPPRMPMGACRRMAATTSSGTFAPLVSKSP
                     RGFASWRYSGTDCRPHRRLADVYALLEERLPVAPLCPNDALDTLLCLVPTDIHHNGVV
                     DHLVRIVSGNACCIDPSLCLAVMERLLVPALPSWLRGSAVVTDSSSDGDDLPGAEISD
                     AALLIALEPLGRVLSRCVVVHVRLWLGESGHVTDSLCRLRDWHTLRTGPFCRRSPHDS
                     GEGDDSSSSFLLRGAAVLMSFTAQRQFWDCSGSARGAVMNSCTKQHLGRRESNDRWHA
                     CSLIAVAYPVVRYLYSAQSQANERERLAARTGIRASVPTAGTLQPSRSCGGAASGDRC
                     VFDPSRWDTVRSLGQQCWWWSTVVCRAIPAIPSAAGRAFAVHSLVDVVHELHRTLASC
                     VVPCGSPLLWACSEHPPQLPSPETLQQCLAMLEWLLVDSVPVLRDRSDADASWLSPAD
                     LKTSVQSSRPSAWTAELRRGWRHLGADFARLSAAALEGMVNGSCTASDACGRRAAAGD
                     AAGKRDFAVPRYASPPLGLSLTGARACSYLVREMANVGYRLALQWAAVVTPLTTAVAM
                     SALVEGTLDAQLRCCTFQRPGFLDKCQRQQQEQGRASPACELDVVLRLLHAIRSVRPA
                     LSSAASTISSGSSSAAELVFVEETTWCKLACLVNLVRCHPVDRAERSQGRAGTVGAMH
                     EHQKFVQLHEQRLLHCGLVHVLACAAISTSEAASCGTVGAAMTEGVVALGHCGTSPQS
                     SAHTPPHALPESSAEFLCALLKCWCTWTMDWPLQLYATWLQELESAAAVVATRAGAGA
                     KGADERESTGGTSFSTRATAAHAEAAMAVPNFPFRGVADDPCDQACRSMHRRLCSLLT
                     EAWAATMDTRHDRDPLDVCACWYAFSAVSRPLCCPSATGASLTARAGMLSPTCCASSH
                     LSQQRSCVYESPREDKLREQLTLMTAASEDRFCRMCESWFKQLRDLPNTRVMGSILQL
                     MEQRPMPLHRPSVQRQKCDVPAFCWCPISLPSIVSHLALRVLYRSRPEGMAGTTPAIL
                     DGNGVASELPRVSDSFVAMVHAALLTPATAELAAFQLSVVCRYAEWCQSAGVHIGWCA
                     CAVQAHRTAGGAGVSYVSCMPVDDLVGPASGTTGMPWWVLTVDGMGVRERRQGGVSVT
                     TILFLWEHGAAAATGMEASRFFGPHACHESGCASAIRPLMPPRPGTTGDSALAELSEA
                     SPNEMKLDTLGAPPKATAELDDEVGGCNGFSDEHRSMRQSIVEWGHRYALRLVLFEVG
                     EGQWHRSRGAALARRSQQQLARRALCHPWRQRRRTLAAIHEGSVEEDAKSVAGARLNY
                     AAPAYRSAVSGLGITPRFVWHSDAYQPLVQLVAGSAACMVDQLAAEVLAFACTTAAHG
                     EASNSKVKADEPRTAGHAVAGALVTNLFKAEHPECWTARLTAHLWGELCRSLAQATVA
                     QPSRTFPYAHGTSFHGSRHRPSPTPVVRCSLGQHPQSRGLASSDPVSRLEQLLCGLGL
                     VAASENPLVYHAPGGVVLTEGVAEESHALLASLLLSPELVCASSIVAHFANAVLWQKC
                     WASLTTASSAAAHHNGGGMPGSLGGLGDVTAQLDELVAFRVILRCFEQVQRLVHELVE
                     YLCCVFVPAVQADHDAACLTATPVEAMRRLACTFSSSASRSIASPTTHLEHVATAQCT
                     RRDVRNLRGHFRFSSATVRAFEVLCLGRCGDERRAPRVWQQWTRELLRSDRVLREHPL
                     LRSTSQWCS"
     gene            complement(<287355..>289046)
                     /locus_tag="LMJF_26_0970"
                     /db_xref="GeneID:5652825"
     mRNA            complement(<287355..>289046)
                     /locus_tag="LMJF_26_0970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684049.1"
                     /db_xref="GeneID:5652825"
     CDS             complement(287355..289046)
                     /locus_tag="LMJF_26_0970"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684101.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652825"
                     /db_xref="InterPro:IPR007064"
                     /db_xref="UniProtKB/TrEMBL:Q4Q997"
                     /translation="MELDHDEQHPDRKTVPQVQCCVCGLVIDSNISNMCANCLRAHVD
                     ITDDLQREYILIHCPECGRYLQPPKYWARAELESRELLTICLKRIKGLNSSAGSNSNA
                     NKAKLVDAKFLWTEPHSKRIKLRLTVQKEIFNNIVIQQACVVEYVVTWQQCTMCQRVA
                     TGQPQWDACVQLRQKVNHKKTFLYLEQLILKKRLHENFIRIEGQPDGLDFFFAHKSHA
                     MNFLEFLNKTAPVTRRDAVQLVSHDSKNNTAVQHFTFALDIAPLCREDLILIPYKDYY
                     LKSLGGMGPLVLVHKVFSSIVFMDPRTLRAGEITGALYWKKPFASLQTSRELVDFYVL
                     ECQLMPVTNGTYQLGLVTVCLSDEVGKGREWIVQSHLGGVLHPGDLVKGYLLEGRILN
                     NEDLDKNRYKPEQLQDVIIVRKFFPSQRARRNRRLWKLKKLDIVTSQGEATSISGPAR
                     RGGASANSGVNEDECEFEDEIERDADLRKEIAIYRMMDEEIAARRGAAATAAGAAENE
                     YEGDDEIPEIALEEMLDELQIDDGAEPAGAEENLMANEDSDNEAVADIHKKVRIE"
     gene            complement(<292344..>296279)
                     /locus_tag="LMJF_26_0980"
                     /db_xref="GeneID:5652826"
     mRNA            complement(<292344..>296279)
                     /locus_tag="LMJF_26_0980"
                     /product="putative protein kinase"
                     /transcript_id="XM_001684050.1"
                     /db_xref="GeneID:5652826"
     CDS             complement(292344..296279)
                     /locus_tag="LMJF_26_0980"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001684102.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652826"
                     /db_xref="GOA:Q4Q996"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q996"
                     /translation="MYTVCPATPDGSASPYHRASPPYRSHASPHSRLGDSASLSSAMT
                     EAGMYESNSDLSAVCPTWFNRCAASSPSMSSVMASRDLPPLQAHSPDPKSRRQQPFNS
                     IAAAVSYLSPLGVASNESPHLKTAPTSFDDTSCGGLTSPNSNRGGMMTSVPQQQSRGN
                     CCSNVGHVMLPEEVSHPNKLAQSGMLTSSSPSHSGGTGTARVSGASPYQCASDGLASQ
                     QQEKQQQSTLQRYAPGNVTTSVGASSSAAAGGASSGSVPTGDADADTIVPRQHGDNDS
                     LALNSLLEEQLTITAASVPHDAFASSPFSRGALPSFHLHPRAAISPARESTPVIPLKT
                     PPATTSTPLRADDSAPRGVAADCASEARGSQTSPPRPHAFAQHQSPEKGFDSQSTGTP
                     HPQPQQLHPPAPTSSSPQVLKPPAMFGVIDLSYSRTDASGSKATPPMSTGATSVGAST
                     VVKTRTQVRASSRAPAVISVRVPVSSLPSNNSTTVTSVNHADPTAAATPLSSTAATAT
                     AVAQLNGGSPCSELTAHSSTTILRMVHSAGQTDSSYPTLHTTLSHSRDATTATATTTA
                     TTTPGYSLRADSQTPVHTATIASQRGTFFTPLSPLLAESDDDAVEAEQQQQQRKAVQP
                     QQHMKSVASTALMVARVRKTAASSPTVSVDAVRNPERLSQPLMLTADTVLPVAVQEDE
                     ARCSSSAATTATRSSSNSRAQLSSSASLSRSINGTTMTAPKGGTAGVAASGTGRLERV
                     RTVVRAGSVSARNVASRQRGPREKFAATFAGGSSFSSKVAASASSASASMDMSVVAGA
                     RGAHLRRQTSVSTASTSSVSSDMPRALPALASYSFVSSRAHMQRYIDQWRDRFEEDKN
                     AYKEGGYLTVTPGRIVHSRYVLIQKLGWGEFSTVWLGYDTKHATLGRGLSQAFVAVKV
                     AKCRSSVQEATRYEVSLLRYLEARLPRHAAITNIIDCFDVQGEFGMHTCMVLPLCGPN
                     LLSIIERMKADRSRRNAEDLRMIKEIVLSVLISLHELSELNVVHTDIKPENVLCSAVD
                     SKLVNSMEKFCSYNQERSHMISLEDFKKSMAQQSTDHLVYLADFGLSALLEPPGSAQL
                     WMSACSNVDASLLAPLMRCKKNFPVTRSGVVDNHRGTLIQTREYRAPEVLLGLDFTSA
                     TDVWSVGCMTFELLTGNFLMDPKRKTREPRDMDIEHLAMMMQILGPLPSEITSIRVRN
                     NDYYDAIIQGTPVPKSGFHPPPEYLHRFLDRNGKFIYASRYYSYPRRNLEMELEPYLG
                     FREAQLAANFILSCLHSYDPKKRPSAKKLLSHQWLHGVGVAPKEKTSSR"
     gene            complement(<300945..>302717)
                     /locus_tag="LMJF_26_0990"
                     /db_xref="GeneID:5652827"
     mRNA            complement(<300945..>302717)
                     /locus_tag="LMJF_26_0990"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684051.1"
                     /db_xref="GeneID:5652827"
     CDS             complement(300945..302717)
                     /locus_tag="LMJF_26_0990"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684103.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.0990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.0990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652827"
                     /db_xref="InterPro:IPR013122"
                     /db_xref="UniProtKB/TrEMBL:Q4Q995"
                     /translation="MVLLHSLVNVIILALLLLFAFQYQTIRNKEATDARYTLASYLFA
                     SNDHTHSYLYRRIETIDEFVGALESIVRAYYAVPTRSRGLFMHYTNSSSRDFDAIAPP
                     TLFLQYHLGYHGAPSYAQLGTKTYALTLESPTGPFVNTTALLNNASESCTPQADPVAG
                     GAFIPCRVSAIGDLLDRVVLLRLAFSLFARSRRWAGDRAATTPSTWDVVVDYGFEGHK
                     AAVTMTVRLSSVSRRQLEQEPLLLCWAVGLLALVDMCARLRVQVKEMTVVNSRHHHYG
                     TLPGEEEGLGKVQMLSPTLGTVKAGENGWRWMGYLSNVAVLSFATVALVAQHKRCTNA
                     SLEEAVTLLLAFAAMLSSFRVVVLLKLFPAWYVLIDGLATSLQQLSVFVVGVLPVLIG
                     YAVCGTAVFGGMSGIYFQSIPSATVTLLCSMFGDNLLSTFLHMDQSPHWLQMLFVRVF
                     ILTFLALFVCNILSIAHSIIQDSYSQALKSYASTTTAAAEAAAVAQQQRPSDSNGWIG
                     AYEEMSDDEGGAEHDRRNRPDERTPDSAASTAATLASYSRPEHSPGNSSNARRQAVPP
                     FSPREVLRAADVKRMLSRLERVSL"
     gene            complement(<303498..>304511)
                     /locus_tag="LMJF_26_1000"
                     /db_xref="GeneID:5652828"
     mRNA            complement(<303498..>304511)
                     /locus_tag="LMJF_26_1000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684052.1"
                     /db_xref="GeneID:5652828"
     CDS             complement(303498..304511)
                     /locus_tag="LMJF_26_1000"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684104.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652828"
                     /db_xref="InterPro:IPR009011"
                     /db_xref="UniProtKB/TrEMBL:Q4Q994"
                     /translation="MHSAALRRREEAAKSLAELEPEYAQIVADLPALEARKAAAEKEQ
                     EALWAELGMKQDESEAGLYESEFSDEATSCIRWCETGGCIGTGPRESHRDKSCSNVID
                     RDSSGYCECKTNDKKDEPEDDEEDVEPEAEGEGTEVRRGTVTYRFSSGHPRFTCMYVC
                     DHSGEAGVDQQPEKLESFTILGELREASKSLERKKNRLEEVKGAMEAAKKLLSSPTIT
                     TEDLLRTLEKEEFTIDFQEYTYAIVMFDTVYQRDMGMTTGGNLLGLWKSFAENTYSVW
                     AKDAHDLTQMIYDNGLKCWNGVVRNVEVHLVCGPENKLMTVEEPSMCNYRMVFETPAM
                     CDD"
     gene            complement(<306346..>307578)
                     /locus_tag="LMJF_26_1010"
                     /db_xref="GeneID:5652829"
     mRNA            complement(<306346..>307578)
                     /locus_tag="LMJF_26_1010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684053.1"
                     /db_xref="GeneID:5652829"
     CDS             complement(306346..307578)
                     /locus_tag="LMJF_26_1010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684105.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652829"
                     /db_xref="GOA:Q4Q993"
                     /db_xref="UniProtKB/TrEMBL:Q4Q993"
                     /translation="MSHQKRPQLTLAMPETLQVLDMGLDFRSYLTRVDESGVPILGNV
                     ISYGAAKVADIFEPTVGLLVTVLHLFSQSGSGSSASMWLKTYDTVQKVYLEQQENHID
                     TDGAKYAQAARDLIASQLNLVASPDNRIITERLLAFLDYQSGIRGPQAPSQRKIPRDP
                     KGAFCNLHLADHKCYQEFSCNQLHLHEAGPVRHRINFLQKLAEIMMAEERPRAEVVKR
                     VKDSIFFARYGNKVTVRCHNNWIPFFKTLYTDGRLEQAFRTNAYSCQNLNCVDEHCKG
                     IHPQDRRVPPATKPIDLHNAQQVALELDEEAEHVVSAVEKAKSAPEAPPALSLASPLS
                     VLSPTAELWRNTVRDYVRQSGIPQVEADESLLRTLQDTKVTGTPLSTSERMTPLLAEL
                     DNYAFNSSQSSFNSETRT"
     gene            complement(<307998..>308195)
                     /locus_tag="LMJF_26_1015"
                     /db_xref="GeneID:12981818"
     mRNA            complement(<307998..>308195)
                     /locus_tag="LMJF_26_1015"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721757.1"
                     /db_xref="GeneID:12981818"
     CDS             complement(307998..308195)
                     /locus_tag="LMJF_26_1015"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721805.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1015"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1015"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981818"
                     /db_xref="UniProtKB/TrEMBL:E9ACT3"
                     /translation="MSSTFTALDELEREINTYLDGTQTTGGGDIGPVLFHSARVQMEI
                     QDLSQRVQQKSIALEDRARNS"
     gene            <309670..>321804
                     /locus_tag="LMJF_26_1020"
                     /db_xref="GeneID:5652830"
     mRNA            <309670..>321804
                     /locus_tag="LMJF_26_1020"
                     /product="putative dynein heavy chain"
                     /transcript_id="XM_001684054.1"
                     /db_xref="GeneID:5652830"
     CDS             309670..321804
                     /locus_tag="LMJF_26_1020"
                     /codon_start=1
                     /product="putative dynein heavy chain"
                     /protein_id="XP_001684106.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652830"
                     /db_xref="GOA:Q4Q992"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004273"
                     /db_xref="InterPro:IPR013602"
                     /db_xref="InterPro:IPR024317"
                     /db_xref="InterPro:IPR024743"
                     /db_xref="InterPro:IPR026980"
                     /db_xref="InterPro:IPR026983"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q992"
                     /translation="MCTTADPTAAATVPHDKDVELLRMIQKASRRPARAREKRVAPKD
                     EPILRNIHTSEEAVAFFTANGDSTSVKHVFLNYAPKGLDFCPYNLVATKKGSEEPEHY
                     ILSATGIVHVRPSMPSEVMTLADWMKEASLFNILRKIPFFKNFLLYKAFLRLQMKLKQ
                     RKYAATRRLLVKDLLVARPTFAYPVLDLVKYSHAISDAKLIEYDPQGKHDYVVDDYSL
                     GQSIQRQKASVFTNGVMEHMEEKVTKLVEVLQHRADVPDINTREALVQYLLTVAASEV
                     SDTRVKRKEKSMLDAREDLERRMRELKRSLVEYSKLHVFIRLIDFLTSERLFQRVLSV
                     FQTFLNLVRGQAQSEVRKVGFQVLLRPEESTIVFDPKESALRALFAELLSGCTDTATV
                     GPRLCEQKHFKALFPSPPTVWSIGDELRTNARVMYIHTALLSILHSDYEKADSRLATY
                     LATVPHIQFLQKSWEEISEECKQEASEATLSAVSLAKLYRRLQEAQDSLRVLIATYVG
                     CLLWINAARLKTEIEPRMTILRDAISACLRNTARDMIRELNAYFKSKTQAMNERPQVL
                     REFADYTAAFNEIAANASETDAKVSQAEALCDLMDRQQVDFSNDDDNQLRERTLGGSS
                     ATKSLHSLFDEVRIRAEQFIEEEMPAHVETLQSEVANVEEQCSGLNELLLGEEFSLLT
                     DHTEPLLQYLADINAKLGEVEMREGQLSRFAALFNLPPFDWTFVSDVKTLYQAREETW
                     SMLDSFNKKTEYWFETPVKELDTIEMEEQVNLMIRRAGLVNRTMLERNYEDQVAPHLL
                     EELQSIRANMPVIHDCGNKHMTAEHWNTLLKQVTGTAYSYHDDLNLNSLEEWDIFSFK
                     EALAEQSGLATGEWKISNDLDLIRQRWDTLNFMTKPYKDRDGVFILDDLEEVIQQLDD
                     HQIELQTTMASRFVASVRHKVEKWMRDLRVVSNVIEEWITLQKNWMYLEFIFSSDDIK
                     EQLPEESEMFDSVDRLFRSLTSKAHSQKNVFQICTEDGVLEDLQRNNASIDVIQKKLE
                     DYLETKRIAFPRFYFLSNDELLSILSDVRNPKAVQPHLSKCFDSIASLLFSDEECSEI
                     VGMVSGEGEQVPFETPVYPIGNVEQWLSDIERVMKTSLLSHMHRTIETAPRRKREEWI
                     FQHPAQCIQAVDMILWTGQVEAAIDSASLQPFYNDYHGQILCMVELTRQSLSKLQRML
                     VGTLIVLNVHNRDIVHNLSHESVASVDDFAWYQQLRYYWEPDPRQAQSGGNNVAIHHC
                     NAHLWYGYEYLGNQPRLVITPLTDRAFLTCTNALAMNLGAAPQGPAGTGKTESVKDLG
                     KALARQVVVFNCSDGIHYKTMSRMFAGLAQAGAWACFDEFNRIELEVLSVIAQQMLDI
                     VLALDQRLERMDFDGHPIRLSPNFGVFVTMNPGYAGRTELPDNLKALFRPICMMIPDY
                     ALIAEIMFYSEGFANARTLAQKMVQLYKLSSEQLSKQDHYDFGMRAVKSILVMAGSLK
                     RQSPNESEDMLLIRAMRDANVPKFLRDDTTLFMALLKDLFPTVVVEENSNTLLLDYIH
                     RQLTADGRQVVEGLVTKAMQLYDTLAVRHGVMLVGQTFSGKSTVLHTVKQALTHIKQD
                     GHDAEGNVPLFNPVHIHLLNPKSVSMGELYGQVNEITREWTDGILSNIARGITRAALT
                     KLDREWVVFDGPVDAVWIENMNTVLDDNKLLCLFNGERIKLPATATFIFEVQDLRVAS
                     PATVSRCGMVYMEPYYMDGNRGWVPIARSLIEAKAKKDTRLHVDRLLELLDRLLPDTL
                     DFVRTNCREWIPSADAQLAVNCVELLQGFLATSEDAAVWPREAITPAETLEADDEDGS
                     WVPHGGTDTYAAAKRSSSVTAAMSIPSTPAEFARPAITNTTAATLDERRLFDMYFLMA
                     FVWAIGGNLRDDARDVFSAFLRDKVEAVLPGLLRLSSSSAAAESEGTHQRVSLYDYVV
                     HRPSMQFITWNHLVPTFLYNRRSSYFDLVVPTAEGVALSTLLSVLTASSQHVLVNGVT
                     GTGKSLGVTSFLASALNTDDPASVWESFSMVFSAQTRGKDIEDRLENKLHKIRSTALG
                     PTPGKRAILFVDDINMPTPEIYGASPPLELLRQLISQGGFYDTHKNPAFFKELHDVLV
                     LAACGVPGGGRSEMTQRLTSRFHLICQPALSESSTRRIFGSLLHGFLHQWESAEIRAL
                     STKLVAATLACYERITQEKLPMPTRSHYTFNLRDLGKVIQGIMQTSPRVTSSPEAFHR
                     LFLHEVSRTFHDRLIDAADRAWWWSTLSEVCSSVLQHPWNPVYEELIFGDFMRRDRAH
                     YEEITETTDAIGRGLTEYQNGFNMEYNKEVELVFFKDAVQHVARLCRVLRQPRGHAVV
                     VGMGGTGRQSLCKLAAFICSLPIYEVTITRTFSMNEFHDVLKKVLLDSARHDKPVLFF
                     LSDTQLVHEEMLGDINNLLNTGEVPNLMESEEVDQIVEAVRPHAVAAGKRETRSTIFS
                     HFVSMCRDQVHIVMAMSPVGEQFRRRLRMFPSLVNCCTIDWFDQWPRDALASVADRVL
                     ANLSMERRDKSRLIELCVAIHVDVQEASELFYSELRRQTYTTPTSYLGLLTSYRQLLE
                     ELDKSVAEQVERYQGGLDTLHSTRTMVDAMKVKLIEMHPRLVEAAKSTEEIMGRVEKE
                     QESAELVRKQCAEEEEGASEIQAEADSIRGECQAELDKAMPILKAAEDALADLRTDDI
                     REVRSFLKPAVRVVLVLEAVLVLLGEKDLSWDRAKLVMSRMDFIKDLQNYKRDDLSEK
                     TIKAIQKYINNPDFQPEEVAKSSKACKSLAMWVMAMNNYYEVVKVVAPKRARLAEAEG
                     KVAVATQALEAARSRLRSIEDKLATLQADMEENVLKKHRLEEDIDLTTVRLERAEQLM
                     NGLASEQSRWVQAVAKLVAEKAGHPGTVALAAGAVAYLGPFTAPYRDRLLRAWHAKCV
                     ELGLPVGGSGFQLSSIMDPVRIRTWAQQGLPTDPFSVENGVIVSKSRRWCLCIDPQGQ
                     AVSWIRAMEKENNLRVIKLTDANYMRTLENAIRVGLPVLIESVGESLDAALDPVLLQQ
                     TYRSQGRLLIKLGDSEVDYDPKFRLYMTTKLANPFFLPELQIKATIINFTVTQTGLEN
                     QLLADVVRVEMAELEQRADQTVLDIAHGKDELKALEDKILKLLASSTGNILDNEQLVN
                     TLQEAKTMSESVSDALRVAEETQRDIEAARDRYRPVARRGATVYAVITELAGLNHMYQ
                     NSLDFFKQLFVLTLRQTEKQDSVNRRVEILLPAVTLRSYNAICRGLFKADKLIFAALL
                     YVHVARQEGTITDEEWSFLLKGSEGKRFVDEEMDPPPVWLTLPAWNELTALAETLRTF
                     ASLKDSVIDNETEWSEWYAGEKAYESYPASLGSYSPWQRLLILKVFREDLLNYGLSRL
                     IECELGKAFTESPAFDLDGCYQDSTPTAPVIFVLTPGTDPTQLFTEFAERKGFGARKM
                     MLSLGQDQGRKAEEMIRVASTETGAWVYLQNCHVYTSWMPSLEHILEELTHREVQRDF
                     RLWLTTMPVTSFPVLLLQSGVKVVKEPPQGLKANMRDTFAVAVTEDLWNSCPGNPTTW
                     RRMLLSLAFFHAVIQERRRFGPLGWNIPYEWNQPDLSASLQSLQTYLKDEDEAVPWGA
                     LRYMVGVINYGGRVTDFLDSRCLSTILVKFFNDDVVAPNTQFNVSPDGIYHIPEDVSS
                     LASICAYLNDLPTFESPQLFGLHANADITFNRNTVRRQLAAILSVQPRTKAAAGRSPE
                     DKVLEMVNEFQRRLPAAIDKTHAHPDTYRLTEAGTMISLGTVASQEILFFNGVLEKLE
                     RTLHLLRRAIKGEVVMSAELEAMFDAMLLGQVPKLWQDGGYLSRKPLASWYEDTLKRI
                     EFFRDWNDNGLPTSFWISGFFFPQGFLTGVLQTYSRMHQAPIDEVKFCTHVTCYELPE
                     DIEDSVENGVYIHGVFVEGAGFDLDSSTLVESKPGELYAPMPVIHLEPVRLSETTATA
                     ESYACPLYKTSARVGTLSTTGLSTNYVVTLDLTSAAGVGPRHWIERGVALLCMLDD"
     gene            <323266..>325605
                     /locus_tag="LMJF_26_1030"
                     /db_xref="GeneID:5652831"
     mRNA            <323266..>325605
                     /locus_tag="LMJF_26_1030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684055.1"
                     /db_xref="GeneID:5652831"
     CDS             323266..325605
                     /locus_tag="LMJF_26_1030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684107.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652831"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:Q4Q991"
                     /translation="MLRGCAAACGQCRESASAVYGQALWLLLRPWTRSPSLPSSTHAR
                     LGLRRALGTVTSSLSSSSSCATVHHPTRWVSRKSIEEQLPSNIKVDPNASATAGRENE
                     GLGRDAFSSGINGIYGNRAESAMRGMLGPQGQADARESRAVPILGRASVQGTKYTLDR
                     STVFEHWRFHCSEPVGWHLSKLGSTTCKMVNDVNEAVESLQLQIIKGCNVFEIDGAAS
                     EVHQSIARGIYEALQAFELDRSGFVMVARCGLIKQPRFQDEITRVEASNTAAVRNRII
                     PIFERYKASSLPSTSLKSGFRISELDDSQLARLNLRRVDRTTAAGLSPDWLDAFFTNV
                     AYNTRLECIDVLLLEGMHTLFDGRPDEHVDDDILQLFVYLERQVKQGVLQYYGVCSPH
                     LAPPVPRNYPEMPPDALVPDKYRTPPKEPATINLYRLMALAERAGGADHHFRFVQYPF
                     NLTQHQAISSPLPYDANHTLATLCKALGLTALGYSPLEAPNLMQLPERYHNFPMEADL
                     KALRMNFFTVCERSVLKEMEIKDTIDKGPDTLPPLEHLFVASVYLAAQRQFTNLFFFT
                     DWANYYMTPRFRRAMTRFKEASSADLKEWAKQYEQLISDLLRMRQRMFQHKHGKQAGL
                     VNMAIDYVSPTLARCPMLNQKAINFATYGCNVLLCGFHVSRYFHEATELNPAKDGNLP
                     IPEEELLALCSAETVSYANVSPPHPYMLEPLMGEGKISKQPSKGAAYLVRIDPQNPKF
                     PDIPEELQTGDSDGEAPVSADGATAALHKDEAPEKAVKE"
     gene            <327161..>328810
                     /locus_tag="LMJF_26_1040"
                     /db_xref="GeneID:5652832"
     mRNA            <327161..>328810
                     /locus_tag="LMJF_26_1040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684056.1"
                     /db_xref="GeneID:5652832"
     CDS             327161..328810
                     /locus_tag="LMJF_26_1040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684108.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652832"
                     /db_xref="InterPro:IPR007484"
                     /db_xref="UniProtKB/TrEMBL:Q4Q990"
                     /translation="MLRSIVVAVLLLSSVCLEHMVQAGPVLEVGVDRAITFNRQLGDG
                     DELLFGSRAVLLRGEIVRYMAGASASYHGYTVYVQCSEHLTNFALQQLAAPELSKAAK
                     GLVVELCDTDTTNEDVLSFFFSNTAANIPVYFLPNGTASKELLRLLSVAAQRRATERV
                     VLSVAKTRRLSELVENSTLPSATIESHYVHKPKQARSKAASAAAAPQVLVTAHFDSLG
                     VSPASRTSGGASGAVVAMELWRRLTSTPYARQESVAPYGVTVLFGSTSRFNYAGTTSW
                     ISQHTDRELDQFRAVLCLDELLPPRETSKDAPDLYLHVQDVLMKRQHGQQVVEQVEAA
                     AKLLGISLKVVSAKTNYQHYDLEFEHEAFASRQVIAMTLSTHRVHHNDQLFRDLRRPP
                     ATAADAAVLAKRADLVEAIVRIIAEAAPSVEGATTVWPGAASYIQGLLHYASDSQRSP
                     VAQNGAGLRQYAATVEHHMRAQAAAAQRATFTSASSVATYQELRTPGITLFGPYEETM
                     QVFVAKSYLFECAVAVAALAALLAFLYVEVGLTTALRLFSD"
     gene            <331235..>331723
                     /locus_tag="LMJF_26_1050"
                     /db_xref="GeneID:5652833"
     mRNA            <331235..>331723
                     /locus_tag="LMJF_26_1050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684057.1"
                     /db_xref="GeneID:5652833"
     CDS             331235..331723
                     /locus_tag="LMJF_26_1050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684109.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652833"
                     /db_xref="GOA:Q4Q989"
                     /db_xref="InterPro:IPR001041"
                     /db_xref="InterPro:IPR001055"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR018298"
                     /db_xref="UniProtKB/TrEMBL:Q4Q989"
                     /translation="MGNGRMTRRLTGCTSLLCLASVTVQGGSLLQSRRFHGHGGDRNK
                     PVEVEFTLPDGEKKVVMGYEGQTLLDVCAEQGLPMEGACGGSCACSTCHVYLEEKVMD
                     LFQEPTDDENDMIDQAFYPEPTSRLGCQLTLKRGVHDGLKVKMPRATRNMYVDGAKVV
                     PH"
     gene            <333283..>334275
                     /locus_tag="LMJF_26_1060"
                     /db_xref="GeneID:5652834"
     mRNA            <333283..>334275
                     /locus_tag="LMJF_26_1060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684058.1"
                     /db_xref="GeneID:5652834"
     CDS             333283..334275
                     /locus_tag="LMJF_26_1060"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684110.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652834"
                     /db_xref="GOA:Q4Q988"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4Q988"
                     /translation="MMASFTPLDNFKSRSRGVMPTGIVIDKSCRVYVTQIPLERIERD
                     GASAMKSEFEVYGPLESYKMFTDRSGRFIGSALCTYRNPADASMAVYCMDGVEVEGST
                     LHVEPAKEHGVVLLASGSSSGGNGQHRDHSRGFLRDTQRQWGRGGRGGAGLLGAGRGS
                     GYSTTGREDASNTSELDLCAEELGLAATDGVSPSAANGKWSHDKYEMMAEGKDMDEVL
                     GIRRPHHHRGGARGRGGRVGQRYGERADAAFERYIHERDANGKDAPPPPPPPPSSAAA
                     ASSLSIQADLQPTPATEPAAEGSVTATMVEMAFGADESDAPVIGAELGALPEDA"
     gene            <335084..>336625
                     /locus_tag="LMJF_26_1070"
                     /db_xref="GeneID:5652835"
     mRNA            <335084..>336625
                     /locus_tag="LMJF_26_1070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684059.1"
                     /db_xref="GeneID:5652835"
     CDS             335084..336625
                     /locus_tag="LMJF_26_1070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684111.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652835"
                     /db_xref="UniProtKB/TrEMBL:Q4Q987"
                     /translation="MSPAVSPSSKKHASPPKPSGKQGVFRSHPRGGSQLSSFSSPPSP
                     SPAMTVGDMHGAVAPPRTSCTTEEKERSLLRYFSRGRCLYDTVPLQSASFALQRASCT
                     QAQRVPLVTLFPAPSPSESAASLSTSAAACPTAESPGLIGVQSSASRPVGKSVTTAEG
                     PAPVAPPTASSPLSCNLSSDLFSSYELQEGQHSDRLQFRLLSARFSSASDSNKFFGAA
                     EMPLRDVCADMAEIWDTMCTTWEDAMRAWSGPPCSGAAGFSRRHSACFLVCYVQTQQK
                     VAVGMSVQRIAAQVCELARANYAPQLFRVVPIFIGLRAQVTLCMDATACSSLAADVAP
                     MVDARRTETVTYATGGLYTLAETVQCITRLGPHALDPRGSSDASPHVGSSRAAPELLC
                     TLEPQVFLLSDSWLHVRSVADLYGDDSLSNSASDSRSASAAAPPASEQGQNRHARRAT
                     SFVPESTRRNVHVVPAVVADRLSRIEERAIARYIWCNMQRRVSDRRTAETLQPLHPSS
                     FAKPL"
     gene            <337818..>343559
                     /locus_tag="LMJF_26_1080"
                     /db_xref="GeneID:5652836"
     mRNA            <337818..>343559
                     /locus_tag="LMJF_26_1080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684060.1"
                     /db_xref="GeneID:5652836"
     CDS             337818..343559
                     /locus_tag="LMJF_26_1080"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684112.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652836"
                     /db_xref="UniProtKB/TrEMBL:Q4Q986"
                     /translation="MPAAAASLLPCISSASSLAPSTSSRLQRPLGGPRAVPPNNGSSA
                     AGAALRGGTTVHSPKDDDNADETGNHYDGEYDRLVFSPIHPSHASLAASFGTSNEDRG
                     DGADSTVAPDSLVLEDSEHHYSESFSPGSPRGPPSRGFITASQATAALERLPVLSISP
                     RRQAASSAVTTPISAQAAAVSTFSSCRPCSKTATLLTADAVTLQPDAWWSTLDGTLSA
                     TNTLLDNESQRIHHVGKTPPPASFHPLLAPSLNDTLGRADRAAIVLSMRLSHQASSST
                     GEAIAAGVDRAKDGSAGRSTKGEEATAAAVAALAMRLSRATAGGSLARGLSGAASTRL
                     SDASRGSAGQNTLQGLRDALRLTQPSAEELDISAPYIASHWLGASEEGHGPLSSSDVR
                     SKPAPKGTTRASRAHRQTTEEVAHPHGAQEGSAGVIKRGGGTQLGRGASARTCADDTD
                     RAPAPAAALLSSARALLQSAPLHEGAAEGRVGAVMQGLHPAASVTATRAHNTRTSSVG
                     FTTDSNAGAREGAGARTGNQDGCARAASHALSPPSHPHAVAGLAFTAELPRSFPWQQD
                     CLTLEEMKRRYGAQSAVHTRRRGQRYHSHRRSEGPSATDHSPRSSYAAPLALLASPVA
                     SSVPTSDFSAASLTSSIFMRELGEGEAARHMLAKHRWRLAAPREAVSSASGDAAQRSP
                     LRSRRGTGATQVHLPHSATSKEAAAKAYREQQLRLYSSHLATPSTLLTNESFAAEQGL
                     LDVDSLLRDTQRHTAGASMSPVRCAEASGAGAASASVSGVAATTKRVPASKPVAGTAP
                     RLSALDRALQARAALLRRHVQGRPAWKRQLHQVRQWCDRTRVMVRFDNGVCVEQMAAG
                     PSHRTIARQHQRQSQQRAMTMGSRTGSRDAQAGSETSGVDLGDDAGWQHFVYADDPAT
                     AHDAVMKKVAEEEHEVQRQNVLQQCRERQHLSFLVESFMGGPRGGPVSSPEQSVGPGK
                     AAAQATCRGSFGHRADSRRAAQALSPRTADAGRERLRIMSPLHGLGTKPELLQEHQHS
                     SQLAMSATDDLASKEASATLGHVSPSSLQQPLVSIHANLCARLETWGTDVADNEEALP
                     GRGSTAEDTAALPPAAAAGAVCDDYALPLAWQGAWRGSVPPRGRSMLLSDHSEESVRR
                     RSVAEVKGDPTVSVQGTAERHNFASPLVHLQRTSLGQTVSATFTRAERDLLSFVLTCA
                     SGGGDVEHLSVLLSLCHRHGRKSTAVEWHLSSTASAAGLAATQLPPALVALRTMLDQW
                     TQAPVCDGAAVDTAVAQESASCGAVAARECHVSVKELPFSAPCDVTEVAITQEAAGVR
                     RDADADAGSPRVDHMSGKAKGPAAAPTSESTPPPSWNALVTALLSGYSALDLSFLRQL
                     HLLLWEYKAKEHGGLRITVADAPEGVVTSTPPPPPISTAHRSQGAPPAVLPLALHLSV
                     VQEARMAASTDLRSSDSSPRTLSTVVVDAADLLNAIAATPLLRWLCDASRQSPTSSWA
                     ELVARLPEACAQDWQNALARCIEAASSGAHPHENVSARVSFVSGESLPSRASLRAGLT
                     AATASSPYAGKLESFLCDTASALESAAWRQHRLHSVLHRASLHAEQDRRAANSAAATG
                     ATTVASLAVDNTWDAVPAAFPCVGGTPYLPGDEARARYPLNMRNLYLMSALAAEDVDA
                     RIVPQLREARVQYADALRAAADAATLASAPCNPSMSNVSLMAFSRPTASLPLALQQRV
                     HLDKLFQIEQRFFSFLWTLWNSEQSVFAFNQHVAPFNAFTAAEQRCWGPLYRSSLKVA
                     YFVCEELVEKGMENVSAELLPFVSIVAAFAGCRGGHRELLSKLKTIMLELTERAKKVQ
                     VPLESLSWQGKRSQVLEEAIAASKIASRRAGAVVSCLTTEADVVSLPLAELATPALRL
                     IHVPPLSPPPHGM"
     gene            <344489..>345775
                     /locus_tag="LMJF_26_1090"
                     /db_xref="GeneID:5652837"
     mRNA            <344489..>345775
                     /locus_tag="LMJF_26_1090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684061.1"
                     /db_xref="GeneID:5652837"
     CDS             344489..345775
                     /locus_tag="LMJF_26_1090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684113.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652837"
                     /db_xref="UniProtKB/TrEMBL:Q4Q985"
                     /translation="MAERANARADNVSRLRELLQSCPAHELRTLFPKPPPHPHRDMWP
                     LATPVDPPSRYPSASARIKKSAASDTYRFLSSAVMESVQPGATRRAAVDTQDATDECS
                     AKGPQGKGHYGSPCWYGAPPGAWMDATYFTAHQSSRWNSLFHDLYYIRNEPTAPLLRC
                     PACVGQRLRDGVATLPRAESSNLSAPCAAAEVPPASSSSPLWMDPAELHRHLSFIHAD
                     ELFTPHELKLYNAQVLHELQHSCGLAPAPTLADGEIGAGVAPGVHKTQPARVILVADV
                     ANVELGSPGELLEMLLSPKLLRIFSDFPVAFCATHELFVPVISKTLHTLYQLARLHPA
                     STLHVFFANTSLESGDLLTSSYLNDLLLANPSCAVPPVVLLTADLQQQQALKEVHGAP
                     GHGIGNGGHVRWVKPLTAAQLVLDLYAALESSQSLM"
     gene            <346544..>346924
                     /locus_tag="LMJF_26_1100"
                     /db_xref="GeneID:5652838"
     mRNA            <346544..>346924
                     /locus_tag="LMJF_26_1100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684062.1"
                     /db_xref="GeneID:5652838"
     CDS             346544..346924
                     /locus_tag="LMJF_26_1100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684114.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652838"
                     /db_xref="UniProtKB/TrEMBL:Q4Q984"
                     /translation="MLRRTHASLFRRTPVRLSGGELYHPPKLEDIPPSSATKGFFGAY
                     NGGLVMLRFIDLKWMMNRAVELGREYYISAPTLYLFLWMFCWKGFVIMRYGDGNPPRH
                     VDWNTEEAGYLPQGFEQTKVTKAI"
     gene            <349548..>362105
                     /locus_tag="LMJF_26_1110"
                     /db_xref="GeneID:5652839"
     mRNA            <349548..>362105
                     /locus_tag="LMJF_26_1110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684063.1"
                     /db_xref="GeneID:5652839"
     CDS             349548..362105
                     /locus_tag="LMJF_26_1110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684115.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652839"
                     /db_xref="GOA:Q4Q983"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR008858"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q983"
                     /translation="MEYFYRSNAAEITPLKAALVNLVSSCLMREPPFEATRPGKLPVI
                     TAPATRAPTADEAAVDVAPAPENDGASTVAQMRELVHLISRQDGEFVLKLALYARHEL
                     HLRRSPSFLVALCAREPNCISLLQPYMEKIIVLPSDWLAVANFAYFHDCDAAHDYAGT
                     LTYSVKTEREAHATASVAPSAAKRSPSSTGTRSPEPSAVEARSGSSVGSQGADPLASR
                     IGAKARGDRHQGAAARDPTRSYIPAALRSALVSTFAKFSVFSMAKYDNEAAEHRTKRR
                     QIRRDRAAAEAAVVASSMTDPAESSATCTRPAALPCRACPQTFTFKQLIRMLHITEPA
                     YIVCCLLGKRYPTNADDFRRMRLHLTDPTWKNPAPLTAGVTSSAKGVRAAKDTYGRAI
                     LGEGGREGADDSHEDSAALPFCVFDARRAGQRMHLPVPVTWETQLSKKGNTGRVWDAL
                     ISSDAVPYMALLRNLRNILTRLCSASTHKRVLDKLVDEQQVAASQQLPYRFYSAYLAV
                     RQMGTLLVHLDALRAVTRKARFRKEVASERGRSGRGGRGGGRAAVASKFAAGAVRQTM
                     REAAKRFERPLVPRAYLRRYVVQYCSALDSAINTSARLNVIPMKGTSIVIICVTSALF
                     EPMSAVGRTATTPASSQRKVDVTALLVAMLMRSCEQCVVLIYCYDEYVVFRENDPDVE
                     RTALQGMYDEEVGSRSSWDTESSSSSSSRGNDFDNNGAVEGDFEAMSNTLRKASAKNS
                     QKGAPGLMGLVSALTARCSSLLERKREEVGPDGVATSFAMFADAADAQFPYAFLDEVI
                     ERNMRIESLLVFDEGVHRTYANMNRNAPAFGDLPTYLSRLRRTCSPDLVYVGVNLKAS
                     NPPAAEGVAQAPGATVFPVTASAAGAPAHRKRGQVSEPSAKSGAAVALQQAEVKLRFG
                     HRNDVLLTGFSDSILRLVAERTGGGPLAVIERAAETYHVSRLSARASQAAWEERTKAL
                     KVLAALREGHQSHIGGGGGSLEALHAPGAFTFDDCLKPLTQSSTATTFPMQSSSHPST
                     ARSLVAEAMAAPAVALPFFDGDGKAVSATGRSWDCSSRSSDRRLQWLTSRIAGQRREA
                     SDAGTPSKGRTALPSIRRLLAKPSLSESAVATPSASGAKSSAGEAVDPARHWDSGETR
                     EIEPAWLAAEGKNVSSVFHPQPFISILKLFSMSSSKHGDSTTASAASDAASVDASATA
                     CVAAMTTLAKTASTKSVARHRLQGPASHPLLPTASAVARRLITSYRVCRFFISSTFLD
                     MNNERNAIALDIFPRLRRWAAEAGLKATLLEVDLRWGIPALATSRNLSTSVCLNEVSR
                     CSPFFIGIIGARYGTSPPTPLQLVVDEDVDAEDYAWMRELSDPHVSVTELEMRHAMYN
                     TKRRVGCDGAPWSALFFARDSPHLLSSFGPADSACRAVYEADSDTSTEAIERLKKRIT
                     ESGCKLVSYQAAYISPAKTLLPGNSGRSSGGAPHLAGGSIRSAAMCSGARAMMEDDLG
                     RWAARSRRGFGDGAGQAASSISGKTSEADSLGALVTARITESEERKRLTSMDVAIDMT
                     DFSSKVFHELQEVICRVCGVRPGLDDSAAEKQRQQHADACVADVHAPETDAKARRCAR
                     SARSAVSATSGATAAEAPDMYEMLVVAQSEFARKLSDLYAAPRGLLEQLSSFALNGTL
                     GVTDESDVPSDAGAVRQRGVAPHGTKRQESVTLIPSSESAYDTCPVRGFSLLPPQQRA
                     QHVKDSASSGGGTPCQPLVARTGALGGGTSSILLLEGCDGDGKSSALAALTALVLEPM
                     QKASASEATPRFLFYSTQAEDDSVHGLLLFLAKSLCIFFQLYGEVSVQDTDAVDELLL
                     VLDHAYAAIHRHFETSTGDAGTATTARGGRGINGGGSVAGRAAAGAGHAALVVVLDGL
                     DKSSEAAELVSLLGTILHPLATQHIRFVVSACPRSPLARALRTRTPPAHVLTVPILSE
                     AERAELVRLHLANYGKVLEESFTADELKNLLRKSGAGRPSYLISAITHLRLFSTFDTL
                     REDIRLLPASRAALHEQLFQHLQARFDPATCRVVLSILLLRQPVGGVLEFNLYRLVSD
                     VAAASRLVTLLRGICLDTHHGRLFIKSSTFVDAVARRFFRFASDYQCVQERVLLAELC
                     YQPIDVSLDEQEVKVGLRQVAESIRRSAANPLTRRTFVPERYAPRELLGVLQGSVQAC
                     RLDVTAALACYLPFLECLLVSRRMLSQLIGLLSSVVSATTSASSSAPGAPTATGAAEA
                     EDDADAEDSGSIRPLASYRALALPWRHYRSDIQHLGYVLEILQKNHHVLLRQPALLRQ
                     CVWNTVGPAMCISAYDAASTARLRHALHRMTTTSKSTASCEVQVDPQGERRRSEDAAL
                     HSPAARSPDMPTFSVLSTMWVHWLNARQHGGEGRVMLTTVSPQSIRCMAMSPDGTEVA
                     VGGDDGILRRMSADEDEQQQLQQSQLAPKGTESAGSAGVVGRRRVASTLRHESAVTSV
                     LYVNPRTAGGPTAGTNGTGAPATLAAPTGVAQLLVSGCARGLLYVWSLEDNSLLQRGT
                     GHLRAISGLVCHPLEPLVLCSCSHDSLIMLWGVGAAEATSRLCSEVQAALALRMPKYP
                     ADSAERLQHERLQQRTSEEKGNGELCVGGGGAGSTVVWRGIPGWSTGIRSRQTPFQAS
                     LMPFHTERQHHTPVAAIAFHGSGDIFASGSWDGVLVLHDTRELCAPSSAITPEMNVPC
                     EPPNQTRLTSRRSRRAKVVWRTRRGPERRQVTFQSMEFELGSSVRALSFANSLAVTCV
                     VGCHNGTVVVVDHASAAVVARWTSLHSAPVTRLTTSLDGRCVASADEHGVVRLTHTGI
                     TGSVFATFNGHHGAVTGLCFRPPRAGHGEDVAGGADALQAPPVWLLTAGEDRTLQAWR
                     VDSSGSGSFKTQTATSRRRLIAAHCTAVTAVASSRDGQLVVTGSADGTAIVFRVPEEI
                     DDDDDIVYRGACGAATGMDCAGTTAWDRPKAVGKKASPDSSTAAGNAQTTLPLKPAFT
                     LRHDDCRITCIRLALRDTRIVVGVVFGLVYVWSSSPGLNQVEGRLLLRVRVPEHGLYP
                     VVSLSMVERCSATAMNGNRGKAEARKGGIAQQTRGAETTLPLANPLQPARTHTRSSAV
                     TAAIAVSSPTEKEDESSTLVTAVCANGDVAIFKLLSDAASLVMAADQARRRQRQQRHQ
                     IRATYCATGLVNGVFPRSNSTSYASSADTLKRSAEDVGVAVSTPASKSLTWVERVENG
                     GKGGGVAPRAGSTATASNSTPCVREAGPAAAQVGRWRPMPPTTDCAARRRGGASVAVS
                     ATPAPQAATFVEAPRRRQQALDRRARKLQRLLSRCRETEVELCSSFRLHLHRYRLHWE
                     NVADAEEITSVVWLNAQHPQLSLSADAADASAAVLADALDVEHARLALVVAQRQLFLL
                     CSNGHESALSGCLTVRVPSRLPGSSSVLKSVSGTMPKEGMAVGAPVWGASGDGTNVEG
                     DVVPPEAVEAAATEEFEVDLGCLLRDDEYFTSSSSAVAVAPPAPSAVTAVALRWFAVA
                     ISTSQGEVLLLRVQVPHDHEKHSDTLGTPTTPFTGSGARPPTAASHHLSTNILPRTSI
                     TLCRRLSFTGSIVNQAAAAERDETEAGTSGAALHRNTAVPRATCVELCTLPPELGTSL
                     DASAPSLPLDAAATVMERVALFAGCTDGSARVWLAAAPPVVPHARRASPAGIEMDETP
                     AQSRIDGASDAFIGCFYCTSSVTVVSGLLNYSVPRASGGGVSALVPSSRWIVGDTLGN
                     VYQLRLERDPPGGVAALLSNSCDMLTAAGGGARSGNAEVRMTRAAAENIHAEPWARSL
                     QRLTTMMSSAPPASAAGAMQTPGANDSADEGCLAGGRTTASEAVGTLAWPGWSSHSSE
                     NWLAPVDVSSALPTLLRRAASATGVRADATSEWRNTNGKPRTAMLSPSVGAADRTPGA
                     GDATLQLSTAAPFCSTLVSFPPVQWSCLPDLPSVQRAGAAVVSSATGGAAEDVTARGS
                     DGPAHLTWLGGIGLSSPPTALPSFATGPRASQSVLERQGADNDGGEFAAAQSFQVPLT
                     SLLARYRSQGAGTDSGTPVSWRGETAAAVRLPRRGKANPSVHVEVPALPLPKQLLTQG
                     DRQHHLINADDEDEEDYFAVLYTAEPLVPQSPCAGGSEARRAWLLHQQEVLKEAMRVQ
                     RYNKLARRALEAYQRRTATAMGL"
     gene            <363043..>364443
                     /locus_tag="LMJF_26_1120"
                     /db_xref="GeneID:5652840"
     mRNA            <363043..>364443
                     /locus_tag="LMJF_26_1120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684064.1"
                     /db_xref="GeneID:5652840"
     CDS             363043..364443
                     /locus_tag="LMJF_26_1120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684116.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652840"
                     /db_xref="InterPro:IPR019347"
                     /db_xref="UniProtKB/TrEMBL:Q4Q982"
                     /translation="MAVPEGRSIYEVLGTVLYRTVPVNIDDANVQRKQQQQRDDFNVP
                     LDYDTALALREIDEATIAARYLATKARGAASATAGGAASRDGPMVADRVSSATTTRAS
                     AAATSAVPVPPQRSNTPAFTAARHGGSGSGGGQLSAAKMSPCTLRVGSPCENTLTAKF
                     RSNVEAAGGQWNASEAVDIATQNAYLVKARMNAAAATKSTGSGTGEVPAAARSSRDGV
                     SAMTVAQAMEILFPVEEVGHGGGSREDSAKDGEEKASDGALTPPLSASTSPVLSTATA
                     AAARTAASTPVVWRRADVAHLSRLDVVLLYKHLERRCARESARPRGVVCPNRECIYND
                     GLRELIRQVTLLCPERGLLLDELARSMRQAIETYDVLLDSANQYAVRKSTERDLHQYL
                     FAEKTDLETEVRRREHRVSEWRAKYAGLQKRFQEQQEADRKLHAEEIAYAKRANQQLV
                     SEIKRLASEAGKAKGA"
     gene            <366317..>371512
                     /locus_tag="LMJF_26_1130"
                     /db_xref="GeneID:5652841"
     mRNA            <366317..>371512
                     /locus_tag="LMJF_26_1130"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684065.1"
                     /db_xref="GeneID:5652841"
     CDS             366317..371512
                     /locus_tag="LMJF_26_1130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684117.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652841"
                     /db_xref="UniProtKB/TrEMBL:Q4Q981"
                     /translation="MRSPTVQAQWSAAVRHGERDRVLSPKREQGGPSTAHDVNDTDQN
                     QVTSAATAVTSATQPSQLSLKETGMHRSTSALQCLQSIQRADGLGGTHTRRATPSAAV
                     AAAATTAIQPLLSPASSAHHPAASVSSKAQQGRSPSLSRPSSAAANFRGTTNGSSVPH
                     PALRSRSVSAVQQQHLRTLPSHVRSARSSSSHSRPASAAPQEDFPQMMASRSAAARSQ
                     ESATSVPSGNGCRIFGRSPVTAPPVATTAHIRAFSNKTLYVRPRSASLTCTSLPAPQS
                     AKRNRNLIQVLAVCHNGSPTARACRAGIANNSAVRGPESLSQSGQRHFLRAPRPHQVP
                     TMGTREQVTVDDTSVKGVQRSCSCSASMVQRQQPRQTSAGSSPQADQTQPQGTRADAA
                     GSGTPGCQLDESGVADNDGGSHRCVGEHQAFEELAMAVPFTPQAAAGVAGIEIGPAAG
                     EWNLPRIQQRILAARLQAEVHQHFTSAVEILLAVQMSLDVDYQEASQGGGGREPASVF
                     LLTPAQRAYYADLVGRELQYVTALWTAKLQSTESPTLAVTTPAVDQLRGAARNIAGSH
                     AVPSEPTAATEAAGEEGTDVRVRKHSRAMARLMSSTEHRLASATHATDSTASSTSCPN
                     SAEPAHSAVAVSVTSTGHPLPKTASRKRTLVELHQIPEMQTCAHRSRQPHVSATDDLN
                     SDESEASQLSSVLVYTSSSKVGAPSPHTPAFSERGISATGVRASDSFIHAVPESSALD
                     GTTVPAQPRGQRRPCDQRRGRKPIRRNPYLMDAVSTNSSAANELSSVWDDEVLGSQLH
                     GPFEDAVMQRVQCRSMQRKRSSINEPQATTETRPSSHSSPLGLTAEDSDGHRTGHRGS
                     LVADTSPERSSDSSGRRVSILKACPHVCQLSPLQLTASAAKCRAACDAVTSAPTSEHE
                     ATAAALHKVEDAASPVSARAGSSHPLSSAAPSVASNCSSPRTSKKHRPVHSAETDVDA
                     AAPPSCRPTELGRTVQSPLRSSSPMARDARVGDSAPAPSTCSAVATSGEATAKAQPVG
                     AGDADVAPASRVSSSRPLPYAKDDEQYSELNVSDARNAVMRRQMTQQSALLADRQRRG
                     SASFSVIEAPGDVQLSSGMHTSSTHPLPRHRSSGGDGSIASSGVISATTNIISNTSGA
                     ADLPASTTERASITATASRAGAQHGHHHTQHLQNSTLDRDRGQQESRQFLSPPSSTRL
                     LAARDEDGSRCPCLSPAQQPYAYEHKTVVCSDGQPCKRLILCKAERLSRSTRLHHTET
                     GSVVPGNSSQQGVSEPDTPRSLSRPSNRTSTRSQHTACTPLIVGADESSSRGSQTELQ
                     HQERTDTESTVNAHTPRTSLMATSAPLAAERLEKHLPLAMLATHSVETSPLQREAGMA
                     DGESAAPVRVVVESVSMRKTSSADLDGQEVVFNVSPEDESASQDNFSGAFIREAVAGG
                     GQDAGVSSIVATRGPGLQTPEGSWVSDERRQFIFSGDVAQLWLDEEGSLAGSYCNTYR
                     VELQRAEATALKWRGPPVCNLRALAAVGDGNVAGERHSAHGGRSVSSSAAAELSAAVS
                     TEALHEARPAGGMPGGVTSTCTGPTGIHFAGPRELLKTRRQERQHKQPPQPKMLRQSS
                     CHLLASHGAVVAEAATERCDRSCRADITDAQPFRRGSVKAETVRGDGARVRSTIMHCS
                     LPPDPVTQLPHRKVYGDDNFIMFRRAAAAAVAASHPVVVGATQPKRPETVGATPTRPG
                     YASAQ"
     gene            <373870..>375489
                     /locus_tag="LMJF_26_1140"
                     /db_xref="GeneID:5652842"
     mRNA            <373870..>375489
                     /locus_tag="LMJF_26_1140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684066.1"
                     /db_xref="GeneID:5652842"
     CDS             373870..375489
                     /locus_tag="LMJF_26_1140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684118.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652842"
                     /db_xref="UniProtKB/TrEMBL:Q4Q980"
                     /translation="MLCTSMRPAHVCVAHIRLTSASTPYASVLLHKMPTTSLVSSSTT
                     TATAAAVTSLQSYAMPRRWQSSATPYPGLPSAAPDSTMVEQPQQPQPGSIVVTYSPGS
                     GAAGNGLTLPTTALTGHCDVISETLSKADELLQQKKAQEALGTGAEILTAESIDEMVE
                     ELKEITTSEVEVLVGQMRSPAVVQQAGMHELRRTLYYATSLKARDWIEPAQYTPLMRV
                     LTVELLRRDSEGVLAPDDVLYVTTHMITANFYNRHLWNRMEKSLLLRNYDAIDMATIK
                     ALSTKLFKTRRGCAKETLDVRRKILGAMTRRVAVLANDFDLPSLLGILQCYTIHDMTP
                     PPIQSLAVRATNHVGEFTPQECATLSQVLRKFGLLRLEVCERLIERICTADELNQHMV
                     HSALISIRTCYNRVSDSGRNALQAEPTRQKLRAMGEQVSCRLQEAVFPTMNVILNILD
                     IVVNLRIYVPKKSLQSLFTRALDMVRVVVEQEDDLIDPTTGKRVRPITMEQGRQLNAL
                     LLHYGSDLCPDLQTLLKQCFKDGLLPDEASI"
     gene            <376599..>378908
                     /locus_tag="LMJF_26_1150"
                     /db_xref="GeneID:5652843"
     mRNA            <376599..>378908
                     /locus_tag="LMJF_26_1150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684067.1"
                     /db_xref="GeneID:5652843"
     CDS             376599..378908
                     /locus_tag="LMJF_26_1150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684119.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652843"
                     /db_xref="UniProtKB/TrEMBL:Q4Q979"
                     /translation="MPRRRSGRCPFSLSTFASCSQHCLRSSPAAMRHVHARICHYSSC
                     NLVGRRISYMSSGIAEVPTSGTPWERLVRLVTGLPSAEQRSFALTATGAPALVNVAAV
                     RTALPAIRELWLSAYHPAFGCGEERDRDGAIASAVTASDLDAQRQQHQLLPEEAEELP
                     LFVQALGHLAAALHESIGEATEAAAAAVAADDADADAHLLKMHEWLVELQALLLFIGQ
                     YHLRFLIPATFLPKLSSLAVSPVPETRAVDGSGGASCSSELDRPVAAKRRETQVRDDS
                     SVGQLADEAIANHTSAPPAVVKGIVPGAASLRRLFRHAREHVQDMAPPLPAEELFRVV
                     VLVEAARTILDVTHPPPLASGVRAEVYGVLLSVVSSSEQLSSTTLASLATCLARCVDS
                     YAMRQQLSAAARAPQESGAVLGDCDDGGGMQVRGERFADAGCAALSAFLRRVSHNIAA
                     CSAGTSLTISPSPIERHEAAQLNRLRGGLDTRLRPTSVLHHVRVLANVMQRRVAQTLY
                     DTESEHGAHQIQQEAGKCGADGADVPVSSTGAARVAKEARIEAGMLGILTLEKLKARA
                     GTTSSETRPLTATQPRRKRRTVAEIRAAAERDRVDAGNFSAQGNPDAPSSHAPNGSAA
                     PPSSTPCSATSDTTRVSFTDLAEVCSAMAAIGFRGDDTAAEEPMWRHAVEFACAEIVA
                     TADARDAAAAVARADNGDAAGVAADREAVVRQTLLDARDLCFALDRVDYTHGYDRVMT
                     TLVRCGFLREPIPAPSAARRSMKDIPSSV"
     gene            <379601..>382534
                     /locus_tag="LMJF_26_1160"
                     /db_xref="GeneID:5652844"
     mRNA            <379601..>382534
                     /locus_tag="LMJF_26_1160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684068.1"
                     /db_xref="GeneID:5652844"
     CDS             379601..382534
                     /locus_tag="LMJF_26_1160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684120.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652844"
                     /db_xref="GOA:Q4Q978"
                     /db_xref="InterPro:IPR006145"
                     /db_xref="InterPro:IPR006224"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:Q4Q978"
                     /translation="MPTSRRPRTIVELQRLEEEAWASPAQRALYATRHIPGFPWYTVQ
                     EVSSPEKPATASATALFTTGVRRHVIPYDFSFTVFVKGRWVGRRLLEVYAEELPHHTP
                     AYYEACLRQGRLYCVQRGALGQHNTQRRLLKRSAATPAPAGTAGSFSDSAPGLASSTY
                     TAPTTTTTTSASDLPQRRHADRRAASPAPLPSRGEDVVLQHGDVVYHTVHRHEVPVTV
                     GMCGADAVLITAVCIAHYGLICVNKPTGLPTHATGRYYYNSLTSLLEYVLAPKRLAAW
                     LLVEDPLLQSLVSTEHLSPSEKAELYAYYAPPPAPVRRARSVRQPCEHLLDGEGGTEH
                     TSGSSQCYCAATTEASAAGDADLDNVDPNKVPRPCHRLDKVTSGVLLLAVRQDAARRI
                     GSVLMRKANEVEEAVTAELLRRRAEPHASRDRGLETAVTPVAERAASLDGSDGDAGVP
                     AVHAPSSTPASPPASLQRVLASRYELQKYYLARVRVESTRVLPGSGTTFEAEAQRQHT
                     PQPSPLTSPSLPLALPPPLRVWRVAGDEPCLRTHNAYVSRMLSSANGVCDVASLRARQ
                     PTKCSSALPGVFPDGVLTTVPVPASGALASSPAAAATLCQLLFALPTITNAARQDGVQ
                     HAETSAAGVSEEAVVLCTPYTGRLHQIRMHLSSLGCPIVGDVVYAPTSGSADVPGTPS
                     TPVQPPLPRGGLGATESTTYNPETLSTKGTAARDLDGSADCPARLSRGGRDFVFFDAE
                     QLPAAYHRYCQTMKAAAGEVNAASHARQASPSRRAEERAATVDVDGRLPAKKGVKRSR
                     TVCSTGGGREAETAEDMASVEEEEEAPLASTSSVAAVVGARTVGEGHSNAAAARWQDE
                     PLCYECAGRLPILAAGECATGTSAICLHAWVYQVREALLLATDDGAPSTASSPASTPW
                     AAGMLATANLSPPAPCPSSSPEGGESGAGVNNGTAQRLPSHRCLVVEGDVVRFEAPPP
                     AWLRR"
     gene            <383297..>384862
                     /locus_tag="LMJF_26_1170"
                     /db_xref="GeneID:5652845"
     mRNA            <383297..>384862
                     /locus_tag="LMJF_26_1170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684069.1"
                     /db_xref="GeneID:5652845"
     CDS             383297..384862
                     /locus_tag="LMJF_26_1170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684121.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652845"
                     /db_xref="GOA:Q4Q977"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q4Q977"
                     /translation="MLLHEALVHTECPICLQPLDYRLRPPPSRPASPPSFGTSTVAAT
                     GSETTSSTTASGHSPRSPLQLSGSNASGRAGEFCITFAPGVYGSDATDPWRPSLAVLS
                     PASPHEAPSPSGQHIVAHSELCSPFSGRGADLSGSGHTANSSSDEGAAGVVVLPCGHL
                     LHYLCAMQLCEYAIHPSCPVCRLKLASGADLILFRPQLRVSLIAAAQASSGVSFDGVY
                     IEGEHNSAISVRKRSRLEEAEREDDHMQCTDGHLADGEDTSSVQACSPQSGSQRGCVP
                     GPAVAHTSTSQSGGELSAPLLILGDDLEPTDTCAAPKTQGSPATSRQSSGGDADANQG
                     EDDIMIIGARQLPPSQAYAELLLRTTATWAARAETLKARVEHLERSQQLLQSDCTELE
                     RTLTVARRRREVLLNLPSSKDEQDALPSAQRLRELRRLCLETRTAMSSTTTQLAEAVR
                     GHAEVRRQTEKYMRKLSRLESGTGIGRAGGDTTTAAAAKAGLPPPLSRRQPPQGGAAP
                     AGEAAAAALDGPH"
     gene            <385693..>387744
                     /locus_tag="LMJF_26_1180"
                     /db_xref="GeneID:5652846"
     mRNA            <385693..>387744
                     /locus_tag="LMJF_26_1180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684070.1"
                     /db_xref="GeneID:5652846"
     CDS             385693..387744
                     /locus_tag="LMJF_26_1180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684122.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652846"
                     /db_xref="InterPro:IPR006626"
                     /db_xref="UniProtKB/TrEMBL:Q4Q976"
                     /translation="MSAKYPPESDPPHNSSDEEDEEEEEEDEDDEEEIEEWTEVTPLS
                     ELAELEDGPSSHFVGGFSVCNHLGDAIGRVQFKEDIVLVFPGVYAAASSSSPSSSSPL
                     ELNEAHLGGLCVYSVSYAREHASHGGSKRAAEPRYMSPSKRRVGPWFTYLTAAAAAVF
                     LAQDSSSGGTESAKSSKAYNPLGAAASKAVEAIDSRKAASTATMHTTSGSSVFAPAIT
                     ATTANPQLYPVFDFPISIAYTSESADATASSTCGLPHYVQQEQDSDEDEEDEEASETG
                     GGDDGGAEQEQEELGAGALREEVVITLAGLCARAGVTIGSLTRTHITHCVIGSPQQHP
                     TSSEASTVAPRIAITAAPLTEALVDHCLVYGGSAYGLYAYPRCALAMRSCIVEGPNTE
                     AAAYNAASAPATNAASAGGSRGCSALAQLQRCQARTQLLRRYMDRFEENQVHDTNASG
                     RGGESRDIEEGVLPRFCVPGASAAGAAAISMPCEVAIMCDDADVQLTDCLVTHTRHGV
                     LLHGGCTGTVVKGLSVRSVAEVGLYVYGMAGAADVQYSSVLACGLACLLVVGPSAAQV
                     AAAEAELPARPSEADEEEDMEQSEDGHDRRRPIFAQHPNIRSNCFIGAVRVQGEVRSG
                     AMVDNLVFLPRDEQGVAAAAAAGAQMVLTVPADTERSFAYVGMEGERIPARAADEAAA
                     A"
     gene            <389416..>394731
                     /locus_tag="LMJF_26_1190"
                     /db_xref="GeneID:5652847"
     mRNA            <389416..>394731
                     /locus_tag="LMJF_26_1190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684071.1"
                     /db_xref="GeneID:5652847"
     CDS             389416..394731
                     /locus_tag="LMJF_26_1190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684123.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652847"
                     /db_xref="UniProtKB/TrEMBL:Q4Q975"
                     /translation="MSSWPTPAGVGTFYVNDFKAQIASILGSHAAATGTSPSGSPATE
                     GCGVAGRPQARREGGGGLSQSNSPFRHGSGIGGFDSVTPPPEVVPYSVSASRGTPLVT
                     PTRGSGANRSGERAKSARRSSRAAPLLDTSAVFVTPTPQKQRHHHLSPAMSARDNKRK
                     STRARRVTTSASRRRSPKRDGAQRVGSPSAGHTNVTLATGVGGGYAIHVNRHPLYSGR
                     GAPQRRCASPPPAAGKAAGVQGGLAISVEANTVRRLQRGGAEKPAASVAVTQTAPVKA
                     ATASGVCATVSAGQTRPSAQRGSIIEQLAAATQTNGGDGSTLGQAAHEPHANASVARS
                     SSPRKCPRPHSESKLRLSRLTGGSDTKPLGPLRLQDRMRMHLQQASFNVSVSAAGEAD
                     RRLPNDTLVLAGPEQAPDGEENPMYAQLKAFQLPQAHTAAPPAPAPPSLPGSAPTGGT
                     SAAAPSAAPPPPAAPGAVTAAAVTGLASAPAPAPAAGVPAPVVPPPPPGADVLAAAAF
                     VGAPAASPAPPPPPPPPAVAAGAGAASAPAAGSSAAGTGASAAAAASGTRLSAQPVSA
                     RVPTKEMTEAEEERLLRDLAAASHHNHRCARPPPSAGSAVPATDAGLTAAIETALQLR
                     REANSGALHGWRRPPANVLLPDPTLSAPTWVVLKSAPAQEAQQAAAAATFARPSGGAS
                     VDRSASRADDMPAAAHEVAENAADGDETARVLDCIDYHAPFQCVLRPEYVEHDLVPAA
                     LSVGVVAHTGMDDPMKSWHTNRTTPGAAAAAVEQRDNVNGDALAAVAAASSDTAVKTL
                     AAQAVILRDPLSLLACEHLAEDTIDIAARRRAYLSSMDALHGITRGGALVSTLQEASP
                     LGAVFCELSYPAKVLLSAILYMRSLGALPSLLRVGPLTEYSPVVDKENCIELVFYNPP
                     DDEQGVRAAQEEQHKSGQLKPSRHPFERERAVGATVLHSQVPARRVSLIEAVTPTNAP
                     GRARSQPHAEGQPRSSPGALFRSRSGRQYGNTRSFTGDSLAGKGEAHASHAHSYTDPS
                     PSPLQKRRPTALEDRLMSTLSATARRRAGSATSRSVSSAAVTSHTVSPHRFFSRAIST
                     NLAGPQLHDTEASLTAADTLDGVRRLPGADGGEPCPSESGGSWLLRNASQDGPARHVF
                     ARQVGDPGTNADESLSGSDNVHRSYADLASGRQRRQKLSQLPAKLQGCGSGYTSTFAT
                     PVPRVRITPPSGTSASGASGAPAQTSATTATGSSALRRSSVTVALEDLQRAAERGGVS
                     AAARAATAPALPSHSLPDRADPLSAVTQPAKAMPPRLPTHFEAGQSATACGTRGAATP
                     ASGSTPASAHGPGVARFPTGEQELCVVLRAVVAQKSHVYSFGKAETVHVLPPLPRRST
                     DDDDDKALLRKQTTQKAEMERLATDSSSPLHKFLCGGDKLRGEAKIEGDQWRAVLLDR
                     ARRAAAAARQHVPVAVNEKGMQTSADYGDLVVAFVLSGNASELCGSVPDMMELEALRY
                     RIFSLLGYSASDPAGMQAVKEAAGIGGASAAAQPPAEAVTRSCTTAPSPLEPNLARLQ
                     QHLASFEAFHTPASPHPKARETSSFGASSASPCASLVRGQRRPSFFEDVLQRADPLAD
                     LDNGDGKRERYPTEFDVQQRQTTLRQRQTQDVQALMLQRYPIYRASSVAESTLQAFFA
                     EAKEAVVAARQQARRRDDAKSSSGRPSTSGRRFSSPDQSLDPLTRHTRGDATTTALQD
                     SERDLLRFRPMSLNSFHRELTDAVQYALDLQIRQGKKDVLHALHM"
     gene            <395566..>397506
                     /locus_tag="LMJF_26_1200"
                     /db_xref="GeneID:5652848"
     mRNA            <395566..>397506
                     /locus_tag="LMJF_26_1200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684072.1"
                     /db_xref="GeneID:5652848"
     CDS             395566..397506
                     /locus_tag="LMJF_26_1200"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684124.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652848"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:Q4Q974"
                     /translation="MSRFTIRRFVLQNIIAVAARCPSATVASAAVAVMTGGTGPASAS
                     AASSSSTGSWVRRMLVKSRAGSTSAFSSHFALVTEAEMERIRRCRREDAEESRVVLAT
                     CPSRSVLRGIGGGALNVVLGFVISPLVLLAVSLERVRLGSGVSALWTAPCYGLLWGGV
                     FLVCAQYAAVQQVALSSYYSCVATPLYYCVNRRPMADVAASASTSAPRARAWTWNGLR
                     CCFEAPQGTPNAHHPLLQLYEDPSVLRERAMKRVTRRDKDRIKRKAKYSGKAKTGGTD
                     GVADDDYYGLLGVPTDATPRQIKEAYNTKVLHIHPDRNPSPDAARQFDRVTKAYRVLS
                     SPQKRKKFDLGGTEGVEDTGARKRDAVRALFGGEEVHRIAGDVFMSSFSQRVIDGLDY
                     TGEELAVLRQRMYEQCRDELLCNYLVHYDAAAAASKKVADEKKRSGSCRGPWKGDALT
                     IRLRNILSTGLAKEVLHTIGHEYKRVIAYFDMERRRPSGSGEAGEANGGALPSPVRDA
                     VAPHSKSVSLPFLVVARAKLYFKTVGPHRWQVRRQKFTYLAAVRGRTFKDSEAMVDLA
                     WYTSVQELEATANTVALALLYDPQLPAAEAARRRDALEALADTFILYGQPYKGANKST
                     MNQLMNSMREYQQQRQREKDTQ"
     gene            <398362..>399606
                     /locus_tag="LMJF_26_1210"
                     /db_xref="GeneID:5652849"
     mRNA            <398362..>399606
                     /locus_tag="LMJF_26_1210"
                     /product="putative aldo/keto reductase"
                     /transcript_id="XM_001684073.1"
                     /db_xref="GeneID:5652849"
     CDS             398362..399606
                     /locus_tag="LMJF_26_1210"
                     /codon_start=1
                     /product="putative aldo/keto reductase"
                     /protein_id="XP_001684125.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652849"
                     /db_xref="GOA:Q4Q973"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR018170"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:Q4Q973"
                     /translation="MQMTTTAAAASFLPSLPFGVPPIGIGTYELRGDACVSAVRAALQ
                     MGYRLIDTAAAYRNEELVGEGISSSGVPRADLFIVVKIAMKSMSSDEAVRQGILDSIR
                     KLRIDYADCVLMHWPGCGGLKPQDASGHRAARARCWRIMHELQALGKVRYCGVSNFLP
                     RHFKELNCFHDDDGGCSEDEAVAVAAQPHASIIGERNADVEAHRHCGDMSSASSPSSS
                     EAWPASASSHPLLPPILNQIELHPLCIQREVDTYCRGRHGMLLQQYSPLGKGDARLLK
                     HPRLLEVHARYFSNQSAGNHVSEPPQAASPEAVKSYSLEDMILMWGLAQGYCTLVRSH
                     RPDHLHANLDAARDYFASVEAVAKGAGNGGGGGEASRALAGTARALLTAEQLDVIRHL
                     RAHIGVEDNQDMHLCWCSSQIA"
     gene            <400276..>402288
                     /locus_tag="LMJF_26_1220"
                     /db_xref="GeneID:5652850"
     mRNA            <400276..>402288
                     /locus_tag="LMJF_26_1220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684074.1"
                     /db_xref="GeneID:5652850"
     CDS             400276..402288
                     /locus_tag="LMJF_26_1220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684126.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652850"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="UniProtKB/TrEMBL:Q4Q972"
                     /translation="MSSTDIRSTNDITSTAVSDTNDSLATSSGGANNTANTLTTDVII
                     RECIKQGFYRNPICNEKLYLHNRGYDSIAPTAFEPYTDVKVLWLEGNGLSVLPCGGGY
                     TQVRPPARVDPFAAELEAAEAEQAAVPARFSVQHVDPSTEAMHHHQDALSPNVVAQKE
                     SSLPLAADVPPKDRDAFSSLYPTVRQLYLHNNLFRSMPDLSRFERLDAVNLSGNFFQT
                     VEPHCAHYDSAVCQHHASEVADGTSPTSAMTSGASPLLSKSLQREQEQRRQQVSPDPY
                     SAGGTAPSEDLTVVASPEDAKRQRTMQLERYRHTADVFSVFCGHSPLPESEEAEEARD
                     EDRQRRVSSLPLKQPPPPAPEHRNPCSSLRNLNLAGNRLQGFEDCLGLLCYRSLAVLD
                     LSHNHIADGEALLLILERLPRLQSLKLSGNPLVRSLPRYRKRVLSRCKRLLHLDDRPV
                     FAEERRVVTAWAIGGDDGEEKERHAIQEERAAAEKKRLEDFRRLISRHQRTGAVEAPH
                     EDYINAITTVAALSTAADTADSHGRNRAGRSSTGTVQRHSRPPTSDPDSSSTSSESED
                     DADDDNQAGSGTGEQSAAAMGALVANVSNTAAQADVSAAAAVGMIASQHENKPPREVR
                     GASSSQLQQQQQQRVLSSNQRVEAAASTAAGADDDENNDIFVPNAV"
     gene            <403961..>413290
                     /locus_tag="LMJF_26_1230"
                     /db_xref="GeneID:5652851"
     mRNA            <403961..>413290
                     /locus_tag="LMJF_26_1230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684075.1"
                     /db_xref="GeneID:5652851"
     CDS             403961..413290
                     /locus_tag="LMJF_26_1230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684127.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652851"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="UniProtKB/TrEMBL:Q4Q971"
                     /translation="MADRTQPLPSHTKALTAVKPNLETRKSHQPDLSGPRRGNRDAED
                     HHGENRGTEEDAKTTRELQERLHSCGEARAGGKPLSSFSSAAASAGPTCLVSFTGFRD
                     EDEWQETGDESNDAYDNPLAHVAGGDATPCADSLSLCKQLVSVLPGVRVEAKLTSSTN
                     VLVARRGFTKKRLLAARQGIPVVLPKWVAMGCPALPTSGGACGASGAASAALHDLYAV
                     PWLYGYTFSTTGLTTSEKAAIDSVCTAHGAVVEPSLTCKCDVLLTSAECVQALQRLLR
                     ADREGDAEQRRFRQHLRHAALQRTDAGLMENSGAEMAPPGRRGGAPKATWLTDKVRFA
                     LELDVPVVDCVKLFTMLRLDRLPPPTWTRGIAAVMYTSSSKARRPCDSDAEDGQRQYA
                     DALDGSDFDAILDVCRVGSPAGGSSEWTRILSVFADRGDASTTGCALQSDVGVADDGK
                     EGRMPPTPLNSIALRGDSKQSSSSCTDSASTVSDPDAWEELLSCALASSLDEQQTRRA
                     DAYPGVSSSADAINAADHLTGTTPTTTKATTAMTTTSPPLQAGLERLTVNTADVEDLA
                     NAGAEEPSTQQVVLPDYYSATTGSGLPPRSSSQGCHAGQEVLTATADASWGIAAVDPS
                     PRWTTNALLHREPAPPRQSSRTDEPVACAQRDGADAGVLGRRTASYWAMHRSAERFQP
                     QLPARDTAPQHTAVMHPDDRVAPLSQAFADSGELLAATHDLVESCVAADELGLASAQQ
                     LDACDTRVCGATTARQALPLLAMHPPYLTICVLGCTELELRKTVRWCEQCRLLRSPVP
                     TSATDIVLLGSRLLTKKRYTMRPAVDSGDDERGTKGGKKQRPQRPARHRSAFSTWSFG
                     ENRHCGHHAGHGVAVTIRYWEMDAAVAQTLADVCGIPRSRMAPLQWLEDAASAAQKAC
                     ETAKLAAESEAAQRSSAHAWTVDSKGCYTDTCCTAATTPPETLVGLLEERLAVAAESE
                     ASAALARQPLFHPLPPLSPDQLPDIADLKYYIRVRQAPATLWASNATPTAAQGLDDIA
                     AGAASAGLESRKQVKGSEMHYSARPALGHPAKQPASSSAPVEEDDSLTAATSLSVVSV
                     SAPTTSSVQQPLHAEKTTLGVEDAEHSYKEALETAGRRFTQLIALLRVTGDGDEAQGS
                     AGAAEVYREGRDKVLAACHFCCVEGEYARVDWAVVRGLIRYGGGRVEKRVAHDWQTLW
                     QQPQQPSVEVAAASAGAQQDQEAHRRLARALRRGVAYAKLRQKLRRVMGDVWTAHQAS
                     RQARSETPSQCHGAVCASADAEQANAAEVARLTAKLQLMSHLCQQAPVLCLLPHSFQR
                     AAGDESGMASAVDATVRHKKGLPGRAAVGPASPYKRLHALRYLPAVTMDYVLACIAVG
                     YCLNPHSCFLFDMSIPSAPDMRLFHHQHVQRGGSGAPSQKATAQHTETRLRLDIAGSI
                     TPEGNGDEAGQRPHAGAVAAGSGCVGQARAPPYRPTLSSWVLERRYSKTDSVGVCISV
                     LWKLPTPPAAEGERCWSRVDVASPPATTATIEPCLTPDASLVPLLRVLLLGLRNAVEA
                     LGGHVADTFSPSAVTHVVSVDVGGILSGTLGDAFTSDVVGKRDAVVSSSDGSRPFPYW
                     PTQSIESVASCAARDEVSLVGLEWLAACVEWGAFVDETGYAPPADLLALVQVEKQKAL
                     LASAQAARTAVHRRAAQAQRPPPPWQSPSHCRLSEHRDHVAAPSPANPAPSGALTAHA
                     TRRVPHLERHRKRMRIPPRGASESGAPHIPPHPRLLDYGPPLDRGGAEMEEPNECRTP
                     VLQRVSGASTTWCDSGGEPCTPPVRDAPSPRNVAQHRQQSPPPQPLSSPVLPPPCPQT
                     PSGPHSASQSMTLRAGSAGTPSAGDHGHPRQRLRRYSSSTSQHNTRSLLEQQDAEAYV
                     EHLGNLFNFFSPGSTPLPSSAHRCRDRSIATHADPDASTPQQLRSPLLSHTPSQSHPP
                     KVTFTPCEPHPHCERMRERGTSGASSSSQCTQVLTPSKTGTTLQMTAAETTGSAVGAS
                     NVFSTPRRRTLRGAAAATAAYTSSATKNSALSSLDKQRRCTEEVAIGTNSSVADLQRW
                     RPLAEAVTGLCDVESGAPDASAPPPQLSTLPNLLGGSTELSRGGTVEAKADGVSSATA
                     ISCEEADAKQRQPQGGGCTGSAHDAQTLDELAEGMKPRSIGMTAGTAQQHQVHKRSRS
                     VGGQQDASHTRVQVALGGPHHSGPEAFSWVHDVIPDSQPQRQDIAVVACADKELMSGD
                     VLVPTTFIAATAEAYGSTSAATAETAAGSGHGNDAATPLLAGDREEAEHEDDAKGVSP
                     APDAIDTAPGLPIPRPPTATGSTSSLERKAVRPRLGSCSAPRRPSSPPYPSPPSTTMV
                     ADVYGGANIVANAAEEEQRCTAQCAHTGSNAQGLSPWSRHRPLSLSRRPSPSPAPAPS
                     PSRTEPTTLGAGTAAATVPSTTVATSCTWECLRIYVLHDLPHREARVRRCEEALEALA
                     RRRDGVEPTPHIGGGLRTAEPHVKRGDNCGSVDVASDPSLPLTAPQPAPPLRFVARCE
                     DADVLVTHQINLRESVLVAVAAGCWVVQPGFLECVVAVLDGACCWSDKNSTTSFMRNP
                     WPTLQLQPQRHLALATAVAAPITAAMKASALCVARLRKALPTYEWTAEVLPRVRASGY
                     PPESDSMLPLQRALVQQCRRQRQMREQAAGGSVASEDAGHPFAGSRSRQRLFEGNSFV
                     LLSSFPAVNMFSARGTRTTEVSVTDAESCGTSSRVRAIERILETGGGCLCCSVQVGSV
                     AADEEKTDGSTDIVAASTHVPPAAQQPLRCCVCVPSLHGQGHEPLRRGLAHTSVPVVM
                     DAALYHDILWLACYQVHRGLSETLYVLLDGSLLGTSAGDDHAGTVVCVSPAPHTAVTA
                     DAAAAAGRAGEESDNAHLSATSPVSEHDRISKKRRTGDVEAHDSTRPTAEPVSEAATV
                     AAGALAVPTTCTVAAWISSWLLASPNDGSLSKAGNEPPPCRRGYAPAAAQAMRGHLCA
                     CCAAVCAVDDDVRVSSSARVSYNVADVPFAVPSVQEVHQACIDVGGGAKAGSPMSASR
                     VAVRRIEFRSTGWAGACVAAGGAAVMAAATDGWMRECEAHTLWGTLFLE"
     gene            <414139..>416064
                     /gene="HSP70.4"
                     /locus_tag="LMJF_26_1240"
                     /db_xref="GeneID:5652852"
     mRNA            <414139..>416064
                     /gene="HSP70.4"
                     /locus_tag="LMJF_26_1240"
                     /product="heat shock protein 70-related protein"
                     /transcript_id="XM_001684076.1"
                     /db_xref="GeneID:5652852"
     CDS             414139..416064
                     /gene="HSP70.4"
                     /locus_tag="LMJF_26_1240"
                     /codon_start=1
                     /product="heat shock protein 70-related protein"
                     /protein_id="XP_001684128.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652852"
                     /db_xref="GOA:Q4Q970"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:Q4Q970"
                     /translation="MSSTNAIGIDLGTTYSCVGVFKNEQVDIIANDQGNRTTPSYVAF
                     TETERLIGDAAKNQVAMNPSNTVFDAKRMIGRKFDDPDLQSDMKHWPFKVIVKDGKPV
                     ISVEYQNQTKTFFPEEISAMVLQKMKETAEAYLGTTVKDAVITVPAYFNDSQRQATKD
                     AGSIAGLNVLRIINEPTAAAIAYGMDRKGDKGEKNVLIFDLGGGTFDVTLLTIESGVF
                     EVKATAGDTHLGGEDFDNRLVDYFATELKMRCGKDCRGNARATRRLRTACERVKRTLS
                     SSTTANIEIDALYEGNDFFSKITRARFEEMCRDQFEKCLEPVKKVLADADMKPQDVDD
                     VVLVGGSTRIPKIQQIVSQFFGGKELNRSINPDEAVAYGAAVQAHILAGGHSSKTDGL
                     LLLDVTPLSLGVETSGGVMSVLIPRNSTMPVQKTQTYSNNADNQRNVVIKVYEGERPL
                     VSQCQCLGTFTLTDIPPMPRGKARINVTFDVNTDGILIVSAVEESGGRKEAITIQNDT
                     GRLSKEQIESMVREAEKFAEEDRMNSERVEARNTLENYTFSMRATLDDPDVQNGITQG
                     DRQQIQDAVNAASSWLEKNREATKEEYMEQTKLIEGIAHPILSEFYKKRVMEAPPSAG
                     PKDGAPSDEVPHAEDVD"
     gene            <418561..>420648
                     /locus_tag="LMJF_26_1250"
                     /db_xref="GeneID:5652853"
     mRNA            <418561..>420648
                     /locus_tag="LMJF_26_1250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684077.1"
                     /db_xref="GeneID:5652853"
     CDS             418561..420648
                     /locus_tag="LMJF_26_1250"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684129.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652853"
                     /db_xref="InterPro:IPR011044"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:Q4Q969"
                     /translation="MQVSLHNTVKTYNLTAGKSLPEWLSERRKNKRASAGQENRVELL
                     HDLEFPHCARCIFRCANGTHLFAAGDYPYRLKCFDVNDLSMKFSFNADMNILSGVCLS
                     PDYRKFALRGEGRQITIHHTSAIIDRVRVPHLQRSLAYNQFQADLLSAGVSPEVHRIN
                     LETGSFVESYQTSSADGVNHVEVFGRHGPVSGVVLTAGCDGAIEAWDSRVGAAVARVQ
                     VAGSGSSSGIDEPCEVRHIATEESGGLLFTCGLESGEVLLYDVRLQKPLLVKDHMNSL
                     PIVKTYFFHGKSTATGEASFVLSADTRSLKVWNKHDGSNFTTIDAPADITDFTLFKSQ
                     HNMVAPYESDDSGVVALCCDVPRVQVHFIPQLGAAPRWASFLEVMTEELEEKETTTVY
                     DDFTFISKDEMNALGIAAEDLAGGKVRPVMHGAFIENGLYRELRAVVDPTAFNNYVAS
                     KAKERQSKRWADRISRFHRSKENDEDADDAQAGGDAAAAATCNSALATAKADPRFTRA
                     FDRTACGAASSFALDRRNPEYAKLLQTIDERRAKASARRERYEAEMFSVVPDVGGEDD
                     AESCEDGGDRAAQRQIGRSSATAAAAAEMDKDEDARHHLHGVQSSGRTKRRAPPQQKA
                     AVSAKMSERDSAKSVKGAVGSAAKQVTMFEVSGQNTDVFLRNDKQVHAIRKKSRAEKL
                     TLGERLKLAASVR"
     gene            <427535..>431422
                     /locus_tag="LMJF_26_1260"
                     /db_xref="GeneID:5652854"
     mRNA            <427535..>431422
                     /locus_tag="LMJF_26_1260"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684078.1"
                     /db_xref="GeneID:5652854"
     CDS             427535..431422
                     /locus_tag="LMJF_26_1260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684130.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652854"
                     /db_xref="UniProtKB/TrEMBL:Q4Q968"
                     /translation="MSDSLLNHCCLFEHYDDQQQSQQAVAAGGGGTLNCLVETHKGKR
                     IASAETALTTARGSDANSVGSASGSVIDNDDAYRRESYKVEVDSVWRITWYLCRVCRS
                     CYDHLVDSILDAHETPHAAATLHSSSKLPLWYYARLCSSSELLGTDGRTGVHLQRRGC
                     EAPRHATSKPSAASLCPTAAVSSRPLPPWSSIWARVRASVSLPASRALSTMTSPAMKA
                     AATPSSVSPSLLQTRDHYQARGAASRRSRGRTSTNAAGVQASSGLGGSGYTSPVNLES
                     ARGDDSILSLSARPAIKSPKIASAQPQSPQPSSSSRRAQRTVTPPRRLLISIDSSPGP
                     LREAVALARRWRRIAVILIDERDLADADDGTEAPQQQEAPFGALSAHLYADVDAETAL
                     RSSSVTDQSSGTQSAVQAPPIAAATGITSPVPQRTESEKYDVHQQNQATDSNPAPAAM
                     TKTSARRPKLSIRVDDVTFGDADGTAAAWASGNSTDAAALRGLAPAAWLLPQLPLQAA
                     APVSPFIAARASSPALSPFLLHENAFLVTTVPPSAGAAAVASSSATSKPISCLPDGPQ
                     AATSSAVNGENVPATPYTEGKLPALPVALDSGVCVLRALFHQAGAVVRLSSMPATTAY
                     TTPTPTSAAAAAAAASGGSGLSLGARTTGASGIFADPASCASAQTVVTPLWGTGPESY
                     AAQRQTVVREMAFRYQLGLGAASPDVMTSPPTAAFISGAYTVSGDQNEGAHWCGAAGQ
                     RGVPVGLGSGSGGYVNATCRRVCGCPAATSFERMMAPVTTYFQLRPQVTATAAAPAAT
                     AATATAVNILPVSTQVEIVGIPIDTSAFTGATALTAATAAAPSAVSMVSSGLPSPHVR
                     GGGIGAGTATIPGLAACDTVGGASRPFTMAEFLPQLAKLSTSLDGYVIVILRRQSSGC
                     AGGGDRTSPGGSATATRPGPNCDAVGDASVSQMGSSNSSGGQQPRELDDSAQQGADAD
                     QLTSSACVPLSLLEETKCSVPRPLQLRDPNQRQRRCHRVTELFGGQHIRLFYQQLQSC
                     GVLQPAVSVVEVSDEAEPGAPKLSPVYLASSKSPLEEAGLSYDELGTPSMPHLKAPAG
                     TGGEDGVAEGWLGAAKSSPQSSALSASRMSIASSVDSSLMQQPSSVSTSATAQSSQAT
                     ERAPHAPSVRGDCFERLQLPASVGIALSQTAKVINASAFPVAAPTALEQAMNSLRCVS
                     RHLGISMCSMTYASKTAPRTMSSASTSYSSQSSTVPTATMAAEAPVPAVPFSPAKANN
                     NASGIGESALLTRALESLVATLVYWDICATLSQ"
     gene            <432507..>435065
                     /locus_tag="LMJF_26_1270"
                     /db_xref="GeneID:5652855"
     mRNA            <432507..>435065
                     /locus_tag="LMJF_26_1270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684079.1"
                     /db_xref="GeneID:5652855"
     CDS             432507..435065
                     /locus_tag="LMJF_26_1270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684131.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652855"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:Q4Q967"
                     /translation="MSGAHGSGSSSSSNARDDNHSHTKEDEEDQVLEDEEFAALRDTD
                     GDEHMPVAHRLAHKADALDAELRRIRYCLCDRAQWLVDTAPATLTGRPTRMDKVVELL
                     KAAGSQQQSDGTAAKSSRKGTSAATAEAALRASPYAAWCGTSDPVLRFLSLRVLRTRA
                     GQAGRCASRGEAPSHGTGLATLNADLDYLRRGRALHQLNYYSRLNLTPKRHIWISLYQ
                     ILWNGVVSAQDALGCVVFGTLRGIKDHGTVQGACRGAAIGLVKAVEFLCYGWVVSPLL
                     HLSRGLCNTLYGPVNSITGKYMFDALSGRWMRCTVADARLFRHELQLEKRVLRTIGRA
                     EFRRKRMKTQHKWADRMASMGFSVDMMKDKFMPKGTCGSQGASADKEGLGGSNQMRNP
                     YEVLQVRRTANTQEIKKQYKKLAMVFHPDVVQNHRSGGGPLSPEEKAEAQHKFEEISS
                     AYQVLSNPEKRKAYDLGGAQAVRLHESKFGKFMSRTPSEIVQSVFGGEGFRHVLVGEL
                     LRSHWALRNEAQVSVSIHELEELQCIRVRQVAVELAAIADVHAQRPTTPYYRGASPSA
                     GAGSAEGSRRRAAFSHPASSSSLPDYLKSGKARSSSAAAAGCRRSTNGAGASAGIRID
                     REAHDSIMEELGGGGRAPGCGGKAAPHEAASAASLAGSASSSSPFVLHPGSNEYNCFS
                     RDFEERCDRFVRYMAEACFGKPLLYEVGEAYVVGAQRFLGIRPFYAPKMLVTRKIFAG
                     MDRIYEAFSDKTRLTAEGVSRKLMAEYFNMEYDAVVADIHGVLRYVVQMVLQDVVESD
                     EVRRKRCYAVWYLGEKMMTVGERWTTRIASDDDLVAYIQQAATSVATTSKPPAF"
     gene            <437094..>440366
                     /locus_tag="LMJF_26_1280"
                     /db_xref="GeneID:5652856"
     mRNA            <437094..>440366
                     /locus_tag="LMJF_26_1280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684080.1"
                     /db_xref="GeneID:5652856"
     CDS             437094..440366
                     /locus_tag="LMJF_26_1280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684132.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652856"
                     /db_xref="UniProtKB/TrEMBL:Q4Q966"
                     /translation="MSTVSPWMAQEKKRSVTPVHGVAANAADDVRSLPAQNQLLLDPQ
                     YNVDLLTFSHIRERMRQQQQQQTAAKAACSSPSQSTATEAPSRAPPKVTPDGTADRLH
                     APGHAAASGATAPLLPDEVLSEEDSDSSEYDRGLPMDLENDLGSFLTTAGRAFAQMKR
                     NRQSLSSRKDKSAADIESLHPQQGEAATIHTAPSPAAVAAASGTAMEAGHATGGDGAP
                     AEAPVMMSETHPSQCMRLTQEPTAVLERSKDEDIDVDPSISDAGVAGRVVVQRKDSFA
                     SSSAASSSSVAAGRRASDAAGESEDDYVGFEGGGVAVMAFLYEQTWMALVGGGPTPMG
                     TPQCVQFIRDGELQHHLLMPDPVVRLFLDARLLFVVTTAELRMYTNPIEREWTCLRQS
                     LPLSAAVASRYAFVAATADGANAPVRVWEKLPDFGTSPSSASAATAADAAEGGLRVTS
                     FASLASRPGGQIGDRGTRTAAVSLPVIPVVVDYARSLVLLPAGEEGKGFALHRYVSGS
                     EVRYTDPVRNAGMSSSASAPDTERAAEAQAHLLTGSTAVTTGRTTSFLHHIATQGTAH
                     RNPLYNLALYVGWPSSIARLLSRDTQAGAGDQVGGLSSGGLVTLVAASSEYATRITLW
                     MLQGSQHEMASPYKDYPSSPSADSAGAAAFVLLREFRVGVRLAAPQVVMASLPGVSRY
                     IARGHAALAGTSGRACSGGAEAASSTGAILLANASLAGDTARSHGTATPASASGLFIA
                     ASSPPSSASHTGTMTSWATEAAAAVASSATGLAAVHHLQFVGNGAYLLCVHGADIISI
                     FSTSARETEQEAKNVCRDRVAAEQNRYSRLSIVKGYLPQALSSRLEAYTRQAWSSCSG
                     RLPSADPTFMPRWICAQRRDMPGAATTSTATVSTAAPTSVSASHGASSLGAVTATIEG
                     NSSRGRQRFFQRLTSLVGSRPPAAASATLPSESAKTAGLPGTDEDEPSASVPSRGTNP
                     ASRSLFSRATASRRLKSSGAPLTFPTSPFGGQRPLAGGGVWGTPLTELPQCIQVWPSA
                     PHAGTGASHPYTGAASTASSPRRPPIVLNCATCEGAFASIVLFAEEGELLTSQVVPYA
                     TL"
     gene            <441008..>442774
                     /locus_tag="LMJF_26_1290"
                     /db_xref="GeneID:5652857"
     mRNA            <441008..>442774
                     /locus_tag="LMJF_26_1290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684081.1"
                     /db_xref="GeneID:5652857"
     CDS             441008..442774
                     /locus_tag="LMJF_26_1290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684133.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652857"
                     /db_xref="InterPro:IPR003347"
                     /db_xref="UniProtKB/TrEMBL:Q4Q965"
                     /translation="MRTSTVSSATSCGRPVTLLEAFASSAAALRQFGIPRVRVVGLSE
                     GCTQEDYERQRARPDGKDLETLLQESSLRGPHGRIDTARRRTHNEQSSLHEAAAHHDV
                     PVVTEQEFMHKFVFHSRPCVILDALEAWPALHKWRDDRYVFDLDHTLPLEAKKSDSEE
                     EQDEDEDAKEDDEDTGTNEPVCKHAGATKSMGEAVMRPKTVTVALTPNGRADSVTRVT
                     YATAAVPAEEAARVYAGDEACKQAVLLSPPTHVADTDGGGAIREEKIFMCAAELRVTL
                     PQLYGLLLCSPMRSPPHPIGIDMRTYADKQRTPAIAYAQLQNNCLNTEYTHLHVDLLP
                     NVERFGCRVFSKEAVEAANVWFGIPASVSSMHQDWVENLYSVVRGVKEFVLIPPWEGP
                     FVPKPEIPAAAFAIDEAASLIDPEDDRAESWSLQFKQYPVKDGTVVPWMDFDLAGADV
                     EVDAEGAARAELEGRLLEKLRVSTSPSPSLSSAEAKRESNGEDVAAAREEAGRKPLHP
                     LVIYVHPGETLYLPAMWLHRVAQYPDSTDLHARKRHSESANAAASASPPPLPLTAAVN
                     YWYDMSFSNPSVVLLREFGLLL"
     gene            <443547..>447119
                     /locus_tag="LMJF_26_1300"
                     /db_xref="GeneID:5652858"
     mRNA            <443547..>447119
                     /locus_tag="LMJF_26_1300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684082.1"
                     /db_xref="GeneID:5652858"
     CDS             443547..447119
                     /locus_tag="LMJF_26_1300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684134.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652858"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q4Q964"
                     /translation="MTEKSLLLKCDFAGHYFMVGTDFPAARIFDTTTSSLAAVVELPL
                     RRRTVSLAALTLTSVAIRQAEENEAPASSGKGSSLADHRSEALLDNKVATYYAAVGLS
                     DGTVILHDVRRDVQLAHVQVSETQQPIISLQMCGEYAFCLAANHILYVVHVQNATSGP
                     CLRLCVQPDASSIAVTTLTAMDTAAMTAARTASSATGSHRVFRVLVSGPTNALYEMRA
                     LASKSSCSGAMAGSATANTAVARQVHATKLLTFPSQGTSAEFAWVSSVAPSAQPAGGG
                     GVSGTPVSLPAITASAQDGVVRVWDVRYTPPPSSAAASLLTTGLDSVAASSSAVVARC
                     RRTLLCGQRILNVSVLPDTANGSRKGNYVMVTTLTGSVLLWSLGDALLPPVVEPVPLK
                     PDVVLVSAVAAGRLLFGALRPASGAPSHAAASDSPLRSLEMTLLRGRFALPLFETKNV
                     GDAVEEASSAAAAAPPELAATTDATVGARTKARAAKANAVDARRTALATLALGVAGTN
                     ASVATVVELPLNATHASLLADQRDAEYLLQHTTDAATSAFVVMDTVWAAHQQQVAAKA
                     SQYMTDAFKAPQLYHAKSIQDLPVKQHTLEQRLQQVAREEAAAALRRRQLATGSAAAA
                     EGASGTDDALEQRQGGDTKAGRSVISHHALGLATVPLYQALHANDTSAVMDLLSMSAR
                     SAEGMRATVLSLQLPYCLQLLHVISERLGLCSKAVEKVTAASQFGAGDGAESTTAYTT
                     AEQDGHAAGTVSGSATADAAAQSADAYGGKGSGAALRGGVAAFSIRSSLLEWIDAIVH
                     YRGSELLAVQRDWDAREAAGRASEATPPMVASPPKDFLAPILHHYESLCSQYDKLAVL
                     YGRLSIFKSVRPSQKNEFLNIPRKSLSSNVEMGRPVPAVNGGLTTSSDSSKRRLHLTG
                     RSSVVDDDILFPVMFKESRSRSGHRVVRVRSKLEIEKKRRQRESKGVALQKRARALAR
                     EQLRSTKAAHSILDDNSGMKRGGLGVMDQIMMAEMAGKDGEMDLDALEAMDLADDASD
                     ANMPSDVSFDSEADEEGEDCSGEEAESATAARGKSKKTRREAVVADEMLADAGDEESD
                     DDQDKDDDAALDSSEAEFSSGSDDDVGSDSLDGGDEESDAEDDDDDDEAQESSDDDKT
                     QASDALDDEDEDDEMGEDMQELLNRHEDDADRSERRKAKKVRTD"
     gene            <448827..>449855
                     /locus_tag="LMJF_26_1310"
                     /db_xref="GeneID:5652859"
     mRNA            <448827..>449855
                     /locus_tag="LMJF_26_1310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684083.1"
                     /db_xref="GeneID:5652859"
     CDS             448827..449855
                     /locus_tag="LMJF_26_1310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684135.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652859"
                     /db_xref="UniProtKB/TrEMBL:Q4Q963"
                     /translation="MYTRTTPLLRGLFSRKQDMQSMVEGHFWSLTRYRILPRFLGLDF
                     AGNVIFFPSHRKQGFGGWTAVTLGAPGSANSAFLSSDMSGVNVLEDGYPLHYKASRKL
                     QAFVAQERRRWQKKQAEAMAAAAKAKADSDAAAEATTMAAQTAKSGQAVNVEIPQEHV
                     ATYDNDQQFRDMLAIKCSQPRFYTSQLRVSRLATIMYKCLYFYLWAVFVSLIVQGYLM
                     FRAWVNPPAREGLKNIEEHVLHIPRLLFSGCVYGLVWLVRTAQPVIDPVVNFLTENFP
                     QVNWGAASAENLASRAQHLADDAHPKAKERRQKEMQLKLQTEAERRAWWTRVLMVLLV
                     VFSVLCVL"
     gene            <451412..>452248
                     /locus_tag="LMJF_26_1320"
                     /db_xref="GeneID:5652860"
     mRNA            <451412..>452248
                     /locus_tag="LMJF_26_1320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684084.1"
                     /db_xref="GeneID:5652860"
     CDS             451412..452248
                     /locus_tag="LMJF_26_1320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684136.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652860"
                     /db_xref="UniProtKB/TrEMBL:Q4Q962"
                     /translation="MKCSAALYRVASAVAAAVPKHHSNTTCTKEDEASATRKITNITP
                     KLADASNQSVRYCSGRCGNFLDVAPVPPPAPVFRAAAANGSTFIDPSSSAVATSFNNN
                     CHIKSFRQRVCTTTDVSMRPLLLLLDDSRALNAVAANASIVSSAAATMKSGRSKYGDV
                     LEQLSCRWAAKFYGKVTYGPRNYPYPSSRWLARRFQMKKHRILKRFRFRRYKLAAVAN
                     LPFAKMIRVGMLPELKSSKTKKGDTVDMGLSSQLVKAARSSAGATKTKGKRTRPKSKY
                     QV"
     gene            <453251..>454486
                     /locus_tag="LMJF_26_1330"
                     /db_xref="GeneID:5652861"
     mRNA            <453251..>454486
                     /locus_tag="LMJF_26_1330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684085.1"
                     /db_xref="GeneID:5652861"
     CDS             453251..454486
                     /locus_tag="LMJF_26_1330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684137.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652861"
                     /db_xref="UniProtKB/TrEMBL:Q4Q961"
                     /translation="MIVRTAARLSARWPAALLAASRGLPSSGAWMPRWSAFFNELQLQ
                     EESHRGGTDKASNTRFDAVPAPLLRSIAQHWVDEALLEVASARLAEVYPPAHANGLKG
                     VCEAAVTPSEGLESLLATWSAHMLLSVLHAPRQASIAAPLHKVQSCAYAAPDTVSAVL
                     ADCLGKDIAPVLRYLTAFATPPVSKPTSHQSHHLAASTRVLRHALVLLLYSFVTTWRG
                     APPRETPPPPGAIALTREERALALELCRCVAALNESDTGSESIATGERRGDTSAQAHS
                     RDARAEATGSHVTSLEAVTGAQFALVRDALADMLAPDHHSDGSAASTPVRARDSVAGN
                     GPLWRACEAWIAGAVGTAVGASVAPPSSPFAGITGVRMKEEEAVDLLERVNDQLNQIA
                     RGGAVNAASRQCGNSAAMP"
     gene            <456170..>458062
                     /locus_tag="LMJF_26_1340"
                     /db_xref="GeneID:5652862"
     mRNA            <456170..>458062
                     /locus_tag="LMJF_26_1340"
                     /product="putative DNA ligase k alpha"
                     /transcript_id="XM_001684086.1"
                     /db_xref="GeneID:5652862"
     CDS             456170..458062
                     /locus_tag="LMJF_26_1340"
                     /EC_number="6.5.1.1"
                     /codon_start=1
                     /product="putative DNA ligase k alpha"
                     /protein_id="XP_001684138.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652862"
                     /db_xref="GOA:Q4Q960"
                     /db_xref="InterPro:IPR012310"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR025487"
                     /db_xref="InterPro:IPR029319"
                     /db_xref="UniProtKB/TrEMBL:Q4Q960"
                     /translation="MKATVLRRLGGSGLVGHPTLLRLRAVKRAATAKVKGTARSGRAK
                     EVAVPAAGSGHGSHKLSLADFHPAIARTWIAAASNKMLQPQHVAPDSRKLAWWICPSC
                     HHQHNKRIDLHLAAGGACPKCEAKPPLAGGASAKKSASSSRGASNPASPLRKKQASAA
                     SAHAPVPAAAALRHRCRPNSTLDTIGAPNANLLSKSVADNQYLRVQETRNLLPMLAKS
                     YEKERWKIAPDEVLQVSPKLDGIRCVAAYRIDTKQVLFFSRSGTLFECCDDTIEPALR
                     YLFEKDPTLVLDGELYNDSINLVQLGTVCKAAGKATPPPPTAALSGADPVSAFYNALL
                     VATYGKTKRKGGSAPAAAVPQADAPTVIGFDQLTSAIRTTRQWRTPEVAALQRQLQYH
                     VFDVLYSREFPYGRGSAVPFSVRYGVLERLLASATAHNLANISKYNPLVLRRVPSYPC
                     TIDAVDAVLQAAIRVSYEGVMIRRECQGATTAAGKDGSEKMESATKKIKRSAASSGSK
                     ASAGASTANSDGGYGYGQRSSTLLKYKVMQDAEYVIVGAVEGSGKWKGFLGSFICVTP
                     DKKHRFTVTPASTDADKRRMWQSWKTVYKGKALTVQYQEITADGVPRFPVGKCVRGAA
                     DGRDWL"
     gene            <460343..>461644
                     /locus_tag="LMJF_26_1350"
                     /db_xref="GeneID:5652863"
     mRNA            <460343..>461644
                     /locus_tag="LMJF_26_1350"
                     /product="putative DNA ligase"
                     /transcript_id="XM_001684087.1"
                     /db_xref="GeneID:5652863"
     CDS             460343..461644
                     /locus_tag="LMJF_26_1350"
                     /EC_number="6.5.1.1"
                     /codon_start=1
                     /product="putative DNA ligase"
                     /protein_id="XP_001684139.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652863"
                     /db_xref="GOA:Q4Q959"
                     /db_xref="InterPro:IPR012310"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR016059"
                     /db_xref="InterPro:IPR029319"
                     /db_xref="UniProtKB/TrEMBL:Q4Q959"
                     /translation="MQTPSNVSPVCMKMAVWRCSHCLQEFEMVVGHFIDGGGVCPHCH
                     SPQKKLDNVTLRNAQGELVIKKPQYVKAPRMIHLNYRSVLFANPHWESLNIQPMLAQR
                     WELVADELIKGSNGESGTAPDKHLLLASPKIDGIRCMIGYNEKLREVQFFSRGGIVLE
                     CCHGLVPQLLPLFEKDPTLMLDGELFAPECNFEQLNGLVRRLNKRSDTKTMEAQARLL
                     EYFAFDIMYSAQLSSVSAPFNERYMLLKKLIPVCGAKRISNYVHDDTRKKVIRATHGG
                     VATAAVANGQAAKIYHVPAAQVHPSDMEDVLSEACSQGFEGVMIRLPKFPYEHGKRSF
                     GLLKYKQMHDAEFKIVGFVPGEGKLKSALGAFVCTTKDGKYFHTPPKVSCKRRIELWE
                     HRSEYLGKYLTVQYQELSSQNVPRFPIAKAIRGSEDKRDWL"
     gene            <462654..>464471
                     /locus_tag="LMJF_26_1360"
                     /db_xref="GeneID:5652864"
     mRNA            <462654..>464471
                     /locus_tag="LMJF_26_1360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684088.1"
                     /db_xref="GeneID:5652864"
     CDS             462654..464471
                     /locus_tag="LMJF_26_1360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684140.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652864"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q4Q958"
                     /translation="MWRSLYRRAPIPADATGLRGVADGAAHGWQRRTAAVTGLLTTQS
                     SSRSHLGARLLLSSSSPLRANLRRRIGAPGSAPHPCNVARHLSYVANAANFEAEVLQS
                     QQAICLIYYIPNRNCSAYLKAAEKLVDSINAQATGLDAAASTSRSGGGAAEVSLSELT
                     VEVSGTQVSETAESGAAPSTLSPASAAAPTQRTHKMEWLKLCTINADENRNLASAFSV
                     ERARLPITYFVMQGTIVDKVVGHVAEARLSSILIKFLEHYQKEMNVDLLAQQNKSSGT
                     GGASASPLPSAATADLLSGTSTAFLQEKIMNALVGADMIQLPEEAEKLDGLRRTLQEA
                     KKKAHAELQELHKQLGMDVRRLSDAEMQAYYFKSPQFHALGLLCALEALYLARSHATL
                     GDVARVNVDWARHAVHKDFEAIQGDLALRRVLALVDANLVRGELRTAAVLAAQDTNRL
                     GSVLAAMDTDDVRGAQHRDTVKEMEALIAGQSQYCLDMLRIIDDNIDSRTLDGSAFPS
                     AIVDQLFELLKSNLKLSRTRLSQSSWTAEADAPDAGSAEESMNLFMDGKALDMTAKRV
                     LMAKARVPQVRTLIMSLLQLYPTDPKSQDARSRLASLLY"
     gene            <465553..>468261
                     /locus_tag="LMJF_26_1370"
                     /db_xref="GeneID:5652865"
     mRNA            <465553..>468261
                     /locus_tag="LMJF_26_1370"
                     /product="guanine nucleotide-binding protein-like protein"
                     /transcript_id="XM_001684089.1"
                     /db_xref="GeneID:5652865"
     CDS             465553..468261
                     /locus_tag="LMJF_26_1370"
                     /codon_start=1
                     /product="guanine nucleotide-binding protein-like protein"
                     /protein_id="XP_001684141.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652865"
                     /db_xref="GOA:Q4Q957"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q957"
                     /translation="MPPFSGKKKKEQLQAKRQRKRDEEERSKLRDREREKLREELMER
                     AEDASEAVLDALLRERANQQHPARGRRARRREEENTVTHRKAVGGDDEDDKSGSGASS
                     DGSNREGGGKLRRSAPPTMMYSADRQHGVRSIFVKESAAVIAARKQLSYQPIPCRTTM
                     PPTGIPFGEWFTFPSSASSAAAVVSAGANSKRGGAWDGGDGAPMCAEEKLALIAAEQQ
                     RRMERPLVASAGDALGDVSSSTFFPFAVELPSRGWHVGAEGSAVVADASIVMAGAGDA
                     STQLPSDRPRAADLQAAGSGSATPASEAGQEEVACAGQRSSSQNEASGADSNDVDASA
                     VGTGAAAAKGHNQDDAQDIRSIEKQRFALYTDCVDAYPFPAALVGLEVSSYERNVEVW
                     QQLWRTVELSDILVVVADARYPIIHAHLGLLTYITKKQRKPCVFVLNKEDLVPASTLR
                     CWQRFLYHYLDDLGFSVEPPDAAEQPVEKDTERCNSDGFARGGSTSARIVLRTFTANP
                     RPETAGQPDGDVDVTRRQKNRKKANEHMYEKLRTGRLNVAKHLGGDQCGEESEEDDEL
                     RYGATEMFVGMQAAQHALQQDRRAYKELEVVAGKITELLATCRRLGAAARATAQEVNT
                     AAVEWSNAAPSSSPTYATSSLPCAALRAARKHTKAQKRRAARRGSGGGGGGGGGGGMG
                     GALAGDDSGSANSDDAVEDRAPDSPSYLHIGFVGHPNVGKSSLLNCIRGTKVVSVSAT
                     PGHTKHMQTIPVPSEHLTLVDCPGLALPVFGVPRPLQAVLGTHQIAQTRDPQTSISFL
                     AAYLPIEKAYGLQRPEHALPEVGWSSYELCEAYAKKRGLFVKHGKGSLDVHRAAIALL
                     QEAYEGRIALFYAPPELNLLQSAWYRERIRPHLLLSVFKPALLAST"
     gene            <469151..>469735
                     /locus_tag="LMJF_26_1380"
                     /db_xref="GeneID:5652866"
     mRNA            <469151..>469735
                     /locus_tag="LMJF_26_1380"
                     /product="prefoldin-like protein"
                     /transcript_id="XM_001684090.1"
                     /db_xref="GeneID:5652866"
     CDS             469151..469735
                     /locus_tag="LMJF_26_1380"
                     /codon_start=1
                     /product="prefoldin-like protein"
                     /protein_id="XP_001684142.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652866"
                     /db_xref="GOA:Q4Q956"
                     /db_xref="InterPro:IPR004127"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="InterPro:IPR016655"
                     /db_xref="UniProtKB/TrEMBL:Q4Q956"
                     /translation="MNAILEKYTFKDDYVSPRGIPKVAFVENVAELVKSSGDSAETLL
                     KRFSEQYSKYKLAEHRLIRTTANLEAKIPDIKKTLQTLEYLKKSLVAENGGRGFTTNY
                     GLTESVFCQAKVLPQKTVHLWLGANVMVEYTFEEATQLLERNLKSATENLAATQEDLA
                     WLQEQQTILEVNTSRLYNYDVVERRNKSEEEAKK"
     gene            <470873..>474241
                     /locus_tag="LMJF_26_1390"
                     /db_xref="GeneID:5652867"
     mRNA            <470873..>474241
                     /locus_tag="LMJF_26_1390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684091.1"
                     /db_xref="GeneID:5652867"
     CDS             470873..474241
                     /locus_tag="LMJF_26_1390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684143.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652867"
                     /db_xref="UniProtKB/TrEMBL:Q4Q955"
                     /translation="MKRLPPSLYVSCYYRSYSCRTAAGGSGDMLRCRISPVPSARTSG
                     VVCGIGSNPPPGASRERLISFSPSPLIAQWQQRRHMHDAAIAPALQSHNAATVAAITD
                     DQISGSLLTASPEPSSVCTPSSSTANTSGSTDHTPESLLLTQLQMLAKQDHGTPTSDR
                     GKGVVDSGATGADVPVLSKSAGPLAALASDADMCASGSPDDSTLASSHNDVPAWRRGL
                     ELVQTASCVTAAVTEWLLFLCLRSHQSATDAAESLTAAPLEVCEGVYSAWRELHRGQK
                     TESDVAAAAAADVANAVAVSTSAHQLQPSSPLMSDSPSSARAHLPRHRSPFSPKGIHH
                     HYATYLLRELHHAETAAVSHTATRKGSSGTHGDGNDCKALMPTKDSDAAHAAPTHRMR
                     YLLHRVLEVLLVHLPQDLAAAAAGSAAKTAEPTCGVKRRRSQQRQPSLRPTTALLVLE
                     AARHAASFHRQSSTLSSVGPSGNFSLLSFLRETAHGTGSPPDAPAASPSPTHSALAAV
                     AREAFETIMRSSATAPTDTSAAASQQQHRLQNDALVLYVAFLATICMPPMPERCLEVE
                     LQVIDSFVLAGSPTARQVGGPSPHQQQQAVSSRPPRSLVSADRASRDESGSASSASAL
                     ATAAGVRWLMATYLSPSASSASSASSAPVSGPRAEASRRQWDLTRDAVVAALCRPNSL
                     LMSGSCEPSSVAPVHNQGVCGVPSSAPPAPLPWCAWMLRALLLDDAHQQQKSGSGTAS
                     LGGGLRSDTDEMSTLALSIQLVMELRRHSQATLTCHGSPRWEEHRQHRLDTLLRRPLQ
                     LVWATLLDAAVRGQLIPANSCSVAADNGVATQHSARAGSCPHGSTPAVLQRLCYPHYD
                     KTQWRRGTVNLYMQLLDQWGESTQVRQVFAAVARREREWQLEVREAVLAERRGLVSAG
                     EKVGGGDEDDSRSIGDSEAEGLSTAEGQAAASTARADSHKPMVVRVFRRYRPALNLES
                     CLITLRHCGFPRRVFAELWDGPASAKDASEGTDGTPAAAAQAKLAGEVLQYMIGLLHV
                     AERRPHRAAPSGGGADANREQESRGDGTKTPHALSTDGGPGANLGDSTMEADGLPVSH
                     WVAWIRKSCVPTLAHLYQSAGLEDEWAQLGYGHE"
     gene            <476494..>478239
                     /locus_tag="LMJF_26_1400"
                     /db_xref="GeneID:5652868"
     mRNA            <476494..>478239
                     /locus_tag="LMJF_26_1400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684092.1"
                     /db_xref="GeneID:5652868"
     CDS             476494..478239
                     /locus_tag="LMJF_26_1400"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684144.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652868"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR004170"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q4Q954"
                     /translation="MGAGGVSPQSRGVASSFTTGGSSRAAATTTKANPRPQGGAPRAA
                     GTSGAAAAAGTKPGAAISYKKGDTLRVIARLLKPGETLSQEVGRVVDGTLITVHSIPP
                     PPPETRKEGTVFGWFVEDLERPGTWEPYAKESADRLEDAFLNMRGTCTVVMKKRSYTV
                     NLHTMQQLPAASAAAASTYPALQQQRTREVKRVPVVTYTDPNTGEVKVLEALLKMADP
                     FMDEEEDNHNGQPQQIAEGAGDVIGADADGAAVAAETEAGDLPHLIRTVMPHRSPIYT
                     MECTPDVQQLCPEARAVVEPAGGALVLSSGRDLQLLEWSIETSTVITRYEVPGTTSKN
                     SVLTANYSRTAKWMVAGLDDCTARLYAIGNPSEVYRLEGHTHKVYGAGVLVGDVQAAT
                     ASMDCHVKVWDIATGVCVRNTVPHKSHIFALRPHPTDPNVALTAGEDCKVCLHDFRMG
                     NSVAAVFTGPDRTIWDVDWNPANTTFAACGMDCTTRIFDPRVSTAAVKILRSHSRPVH
                     SIKYTPQGRGVLSCSKDSFVSLADTTNWSVQWQAKAHITTVFRVRYHVGKSVIVTAGS
                     DSSVNVWSWVALAQL"
     gene            <480001..>481611
                     /locus_tag="LMJF_26_1410"
                     /db_xref="GeneID:5652869"
     mRNA            <480001..>481611
                     /locus_tag="LMJF_26_1410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684093.1"
                     /db_xref="GeneID:5652869"
     CDS             480001..481611
                     /locus_tag="LMJF_26_1410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684145.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652869"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:Q4Q953"
                     /translation="MLNHHVVLFAAPIHGVELAGLLFIDYLHSSLFQMDIAEALSDVN
                     GWFSFFRSGFNPSTLLSFYSRLISERLSFRLLECGVSVLCMYSESKLCQDALVFQYVY
                     PIVRDYRYGRLWCTRLLRFVGGLLYPSFLRQFRGGFSASSSSSGTSRATANGLTRGGS
                     ASSATPRPLSQSDLVDADVAFYRNPPRPSRVNPFDGMPEPCQEALRYYLYGYQSRPFY
                     TTFVSGFIADVTLFVTEQIIWGSYLYQERIKRTSRWRILKPYAADLVVVSVQATLVYA
                     ARVLGVLLGQKLSREPTGGGIFWGERVTLLLLSPGIQHVSLIAGRAVRDALERRHPRT
                     VEDELEDKRVEEEAEEAARAQAAAAHAAFAFTSVPLGNAARGAANGPGDAGVGGGARH
                     AGHSGICEREDTNYYEVLGVTMQSKVADIKKAYRAKALLNHPDRVGKDPVAQEQARQQ
                     MSAINEAYDTLLDSEKRAQYDAMRCFSEGPEFFKKLESMTTAQLAAVSTVVVLGLGTL
                     TAASAYGQYLTIFQRMTSLGRGPLMLFS"
     gene            <484446..>491708
                     /locus_tag="LMJF_26_1420"
                     /db_xref="GeneID:5652870"
     mRNA            <484446..>491708
                     /locus_tag="LMJF_26_1420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684094.1"
                     /db_xref="GeneID:5652870"
     CDS             484446..491708
                     /locus_tag="LMJF_26_1420"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684146.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652870"
                     /db_xref="GOA:Q4Q952"
                     /db_xref="InterPro:IPR000306"
                     /db_xref="InterPro:IPR003409"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017455"
                     /db_xref="UniProtKB/TrEMBL:Q4Q952"
                     /translation="MAHAAGGRNAAGAAPQYYDPNAPLTRPVTTIQVETFLPREGMTP
                     SLVLADGSHYFGPVVEDSRCRIPHGCGIILFQYDGAAKPNLTVAEAAAAASDSSRGGG
                     LTSFFFGRGVPQDSGASQAAATLTALCKRYRQGDRYGGDWVNGTFHGNGVLVTSSFTY
                     HGTWIEGEMQGKGTISYTRKYVDYRPRNTNGSGSGVGEGVSNLLLKGLSYVSPFELVG
                     TAAAPKEYIGDFDAKHYRHGMGLMRYYNGDVYEGEWRDNCRHGRGKLRKVDGEVYDGD
                     WAFDQRHGNGKIMYPNGSLFKGSMEYDQRNGEGIMRFANGDEFFGTFKKDRIDGHGTM
                     RYRNGDVYEGSWRDQLRHGQGKYTLKRTGATMHGEFQSGLIHGEGTVIVPGVSTFVGT
                     FVRGERTVGTMHWHQQSSQQSQAVLANEDITAAAAATAAATLESPESSLVDATLSPGP
                     AAPPLPGISSASATATIGAAIVAGKASTTNYLCYQGQWHGEHMHGRGLLWYTNGDFYA
                     GNFHKSRRHGAGNMRYAAEQAEFSGQYVHGIRHGLGMLQRANKTIQAGRWQQNIFVEG
                     YEGEWDGSVFHGIGRLTMPVDIFLAMRSSSSALKPSELSAMWSDRSNTPLTNASFIAG
                     HEEGRCAAGDGAPQGATTDTSLNGITASRTGVSPLFIDFFGLFRNGLRDGLGVLKLPA
                     LNGLVGGSLNLAEERKSGGGGGQGDSGGGGTTAHGAGGVKAEKGRRGSGGGGDGNAAA
                     GASRTRYSTVSLASMPSMLIKGRWVRDVLHCDKGVWAFPNGVVYIGRFRNGARDATRA
                     CVWWPDGSVLESGWCGDAPSGAGIWYQRNRITPVYQTISPSLLRRSRSLRLPEKDSPS
                     RSIGHATDGGQGASDAADADGNGTSSALARDAFGMSYLLRLIGSGLVGHGSSNAGDGI
                     GGDTHDESDNDQPRRVLVDFGNHFTFSCSWCPYTMNLSTYAAVVLPQIGSQTSPLPGG
                     TPWPQLYHSPSMSAAVGAPRPWAAETAKGGRGAPPRTAAASPTTAVGSSGAGLQASVP
                     WPVPTAKKMSSCANSLHLSDAPSSVVIGRASGAGVVYFDSGVVLAGEWLGNFPRLATP
                     YRPWSAFDYFIMWQTTRAASRNCASTLPRLVAPRLQSCYTSVLVAAPEDVSGEPRRVA
                     GGRLTVASSPLAVNRMGDPAEHAPASFTPPSPPPSPDARCTLCGKDYSFFRKRMHCTL
                     CLRSTCSSCLGHMDTEGPAQQEDVKALLRHAYLTAEQTVQLSTAAAARTALTNASGSA
                     ARPITFPSFSAEQVDHAFDKKSISTVPVCADCARAVLWKLRYTQLWIPMSMFSSVVEG
                     DKHHQETRRNSGVKAAHHDARNGENKNGVADGDVDDGAAEAANPLSTVAHSQESFRQV
                     SAVGQSLPLSPERSAVPATAFDDVEHHQHNGRLPTGNDALHSAASAYSSEVSAVDEAA
                     HDLLAATQAGSAATEDKPSTPPAASPSSVNDSAVTGTSPAPALPPASASSQTPNLSGH
                     PETARRSCSKILPPTQYIIYSGYTSHTIPHVYGELWWGRQYYYRGGFCAGERHGFGTQ
                     YMPNGEWYEGGFERDEWHGEGVYYLDDGSVLLGEFRKGKLHAVHYRGEVEESDTCGIR
                     PHGRGIGYSPDGSVYNGEWVHGQRHGTGMLHLADGSSVYSGTFVSDAMEGMGKLVTTS
                     GAYYGDFSQNKQNGKGLLFTADCVVEGSWVQGTSSGFTRIYERVTGEVYETTYSDGNE
                     RDDCFTAPVMIDDDAAAECGQCGTAFSFFLRRHHCRLCGDVFCDACTQHRASLPSTVT
                     GDGVPSAKSDPASSSASGVNGQQLRVCDACFFRLSQRRMIALRRYADGSVYAGCWSQG
                     RWVSRGLYCRPDGVFVVMDTYGHALLPLAGIAKEPLKGGASADMKEPEKPSAAQPACG
                     LGVVRRPSRATGLPVSSSILQDAAPAKELLDGVSESSSRKDLDAFLLWWATTRSRCGL
                     HVPLDVLLVMQYQRMPTQMLRGKEATVKAGSDAAAYLAAPARCALETPHTPSLRPIRL
                     FITLADSRREMQAMVEGEVERTSVSAAPAETAAAPAPESRLSIEEKRTMDSDVEAAAL
                     RASRFMPVAIPRAPVVPITAATIPVTSVAELPEVTTAAHPSSLHPAHQATGADPLHAF
                     GFSAWATRPPPSIEPEDISDESLVEMMQAERLSWSAAAPAAKASAASTVPPLMPPTPA
                     PPAPGLNTTVPWDVWTTRDVPRYAPPPLATVAAEATPAAQPPEENASGGGEADAAPLP
                     TLRSEADMYFACPFWGPTVPDAQVLLEQGKVTQATELMCRLQQQHDQAVNPQQQKQGG
                     DSGSSDGDGNGNTEGSGGRGATASGGGKTRRGSAADDPLSMLQSMQGGVPNASVSSWE
                     AGHLFSPEQRAQCGDGWAPAPLRGPYVFDISAHEKHRSADGQRWYAKVTQREVLKF"
     gene            <494683..>498063
                     /locus_tag="LMJF_26_1430"
                     /db_xref="GeneID:5652871"
     mRNA            <494683..>498063
                     /locus_tag="LMJF_26_1430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684095.1"
                     /db_xref="GeneID:5652871"
     CDS             494683..498063
                     /locus_tag="LMJF_26_1430"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684147.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652871"
                     /db_xref="GOA:Q4Q951"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="UniProtKB/TrEMBL:Q4Q951"
                     /translation="MEERATQRATSARSDRYDGLLPLNPSPSIPFLVITTSTPTVVLP
                     SPPPIVASALGTPLVEMYPQSLAGSSTHTSSSGDRSLIASRSPSMQLSRTAASFAASS
                     LPGNWVMHDPPTADKAPVIASLPAAAATVFASLLHHSSPETTPDSSPMLHARPSALTK
                     MSAVALRDAVELEKADAPFLADLCGPGRQWTPRYVSTTSITAPTPTPEAGNVGAPSKD
                     SDSSLPAALRRLLRRTSASKSVQSRDDGSDAALTADDEHNPTALPRAGAQSKLHSGRS
                     HNSGGAGSPHGPSPVTSSTPAPQSQPRQPRCVATQEDCVSASSQRQEFHISPRARSQV
                     YLSFRSGAATVPSQSSLCSPVSPTPKRRVHLGSAGNAFAGKATPVVAVDHFPSAVERQ
                     SGRHNSNASSSASSDRCNDVDDKELLVDGSAESRRLALSGTATASRAAPREAATSSNS
                     ASDTATPSALSGTADAAAPRDAAVRADASASCAGAQTIDVAGAARHSPQTDARVGEDV
                     AVKTSTTETTAKTAERFPRSNGPRPHLVKVAPSHLCSFPKAGITSTPQPSTFAHTPLA
                     TSSATSSTYKSRRQRVRASSQPVGSSCLLFARSGATGVSTSMAVMQRSRTNEDVHGNT
                     HGSHGGDQHKGWHRRAAHLPPPPPPPSRILSPMLSTAAHIGGLFLTLARSAHVHHHGL
                     GCGASAHLSVSPHSSGCASPAQDDAQGLRVHYTPSSVSSPPARTEPAVDDDDRGFSGG
                     RSAAVSKFGSFSFSTTVTNTPRLSVDDSASRMSSPSTVSSTNRNSFVDIAHKSLQEHP
                     PHNYRHSNRSASALVHNVPACARESPTSEVVVMPITLVPPTSLRLSGASEASLNGSVA
                     SSGQRCSSNPGYDSSCGCMQMHNGDDEQGLTVPASVTPPRGAASAFATSSVASLAATV
                     TSIVGHPISALFSSGKLKAPMSRKSSNSAFQLSPPGASTGHSTPCLQDGFVMRPDAET
                     LQGLLQGKVPRMPGCSIRDWAAHLSAKEEELRRREQKRHHTPHHRASGGATRFGGGAP
                     PPKPASTAASRTALLPRMTPQEVATHNTPDDLWIVIRNVVYDCTAFQRYHPGGEKLLL
                     ACGGRDATAVYDRFHAWVSCESFMAPYAVGVVSPSETR"
     gene            <506724..>509072
                     /locus_tag="LMJF_26_1440"
                     /db_xref="GeneID:5652872"
     mRNA            <506724..>509072
                     /locus_tag="LMJF_26_1440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684096.1"
                     /db_xref="GeneID:5652872"
     CDS             506724..509072
                     /locus_tag="LMJF_26_1440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684148.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652872"
                     /db_xref="UniProtKB/TrEMBL:Q4Q950"
                     /translation="MGSACSHGEDARHHRENRKNRINPTETYDKWQQKMLLDIGADPL
                     AVIRDFPRMTVFVHTTACCNCMPDCYSPISDSEAAASSRKLQQQEQPRRNSPLNPLAP
                     RNRSQPHSCLDADAAGAADMDGESKQQQCRRRRMEKASGPALRVDASTGASANADAGD
                     SWVSPTASPLLAPRPPPNVMARGCAGAQRSGLQEPSCDDDAFTARMQRVRDAVLLLSE
                     LCNERATFGDSFESAWDRLVVHGNFGGRANNLYSNAAGESAPGATQDGRQLPSSKKFR
                     NQPITLDVHQVLLNACLDSGMLMLLDDVNSAAALASPPHGAAQPRIIGSAPAPLSLQP
                     GAPPGLVNCASPPDTSSASGLQLHRANTATALTADGATGSKCATVNSDSQQQRNRESA
                     AASTSSAPASMMRTARISPQTTAALGATSSRYVVRSATFHLMQFATQGVMFFPVQRLK
                     HVLWMPWSSHMQDRAWTIHFHVKDATPEDLITRRQRHLKALCDTSTSGLLPNADSAAV
                     LAAAGADGHRDSLSTALPTTTVTTDADRWKLPAISGADASAAGWHNTCGAGVSDGVHK
                     GKIIVIHHFQTGRHHVEDSERKITPVYELDWACSIRVDQDTLLKAFSPYQGYAVAAKD
                     AAAPSPSVPPLPSCNPSMLQEMTSEAASLVSHPRQHLCDDDDHETVTVDASPSVTTSD
                     NVSEAAFPRRPVVVPAATHHPELIALDVGVLTAQQPQLLRCEVLRASVEVVAARMAKP
                     PLTFCMVSSTWRKRKEELDYVLKQQYNVQLIEVNELPKKLPY"
     gene            <514342..>518319
                     /locus_tag="LMJF_26_1450"
                     /db_xref="GeneID:5652873"
     mRNA            <514342..>518319
                     /locus_tag="LMJF_26_1450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684097.1"
                     /db_xref="GeneID:5652873"
     CDS             514342..518319
                     /locus_tag="LMJF_26_1450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684149.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652873"
                     /db_xref="UniProtKB/TrEMBL:Q4Q949"
                     /translation="MLGHVGNIGSGGHSHGKGGCDMQGAPVLPAAATQVRCMSPIERE
                     IEQALATQRNQQTADMAERERMLLEQQVNLVLPALQASLQQSQQALEDQLLQVKLQLL
                     ANQQQQQSGSNMDMEYLRNEMTAMRSAISSMSMNCTSNSDPGLPTRKPHKPQHRKATS
                     ARTRNVRRRRQHRSHIDEDDSWVSLDDILCSDQYDDDRHAAGDRDSSGRSPSPRNARL
                     LSPTPSQKIHSALKSMQAEIRSLRAMSATRMEPAFPTASMLKPGLHLLKLAALEGIGL
                     AVPLDEVDVSIKVYYMSYAHNEYLLEPYLERSYPRRPLPLVRHDASTVLFTVPPLEFM
                     VHSPKEMVVFVLQVFYRGRLLCWSTIFAKSTGSFSEGVRNSCYDLAKALQTPGGMIPE
                     ASVSGYIETNSLDVLQHAESILNGSAVSFSASPSSPFPQRQYVQLPGLPPLPPPPLGQ
                     PLLPGMPGCEGPFLPPTSDGHMMLLQPTKGPIAHFILPPPMGVSILEWNQEVVKHLKK
                     IQKHLPNKVTAPAVEKGGANGKHGSNWKSASPLSQRQVMLDSSSSSSSSSDSSMQSFS
                     SLSSMCISQPTSNGGPLRDPPLPIHGQLEIIGEDMSKHPPVTRQRQRQQQRRSHRSVV
                     HFTKAVSEAVSAAEVPAAKLPTMSIQKPQEPAKVSAVAALVKEPLSTDVPPSQTHTPP
                     PSTDASIAESAAKEATAAKLPDNPKSQMASTFSPRVPSADDPSAALQAATPPPVPCKV
                     PRKDMSLVERSRLRASTDPQGNLAVPPNYKLNPDNPPVVNLGKLYATADPPLNPCVLL
                     GLSKPTDRPPATLKTPGHGENGNTVDIFVDGVSGVPIDAVCSRVLVYITDELDLGTGA
                     LLNPLHHPRVFMRKPDLVAYQNLTSSSIEPAFEAKMSSNVGDQTHAVVIAEYINDLQE
                     SPIVLGHCCLPINKRFFAGNFVARLKVGDPRRSQERAVDEMRSPARIADEQQRATEKY
                     DQSQLEASFNSQALRNLMPLPPSKLSECAPLGYLIWRLENPDMRSPFFEMPQQVPLSQ
                     QEVQLFEDRKNHAGVTPNSKGLTSEKAASNAFIGSGTTQTDSISCISPFSEQRGAFVK
                     VEGIRGVGDDAAMYVVVVYMAKAPKGRRVYYTMMPDWASDVGAPMFKDPPFAFQGIQY
                     DKTSTTTYMLLKLSRLEIAADPPLVECIGWTMNKLFIDSAPALRQGRYVLPWLNGPLP
                     PSVVQELLTQHISTVFLSHIKAKTIAYLEPKATLTISQGDPACCVALVDNTPGRAQPR
                     RLLVLTASKKTFPSSTCEGMVGCTLRRAHEECFGGGDARALLQRMNMAVQEYLTAKMK
                     ELEEL"
     gene            <523432..>524439
                     /locus_tag="LMJF_26_1460"
                     /db_xref="GeneID:5652874"
     mRNA            <523432..>524439
                     /locus_tag="LMJF_26_1460"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684098.1"
                     /db_xref="GeneID:5652874"
     CDS             523432..524439
                     /locus_tag="LMJF_26_1460"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684150.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652874"
                     /db_xref="UniProtKB/TrEMBL:Q4Q948"
                     /translation="MTATTTDSTSCGSHPRCRVHTVAMSQAFFYVAIGVLMCLTVSCS
                     ASGYNASMYVNSDTAVTALFTGPKLVMVVATLPRDFNPNAFINGLYNLFSKADASIMN
                     VSSVSLVNWCAEDSIALNTTLSCPPSVQFDKDHGYVLALVQLSGWSYTSLTSPTAVDL
                     SSLGVTDSILVSQFGGTYNPDSTSDMNNSSYIINFNSNGMVTYAIFGFLMVIVILALI
                     GVSVCVCLCDSRQLNHNKSIVDRVIRTVHLNYMAALYGRSHHHRQQQQALENLNEHIN
                     LYADLPNNGCSGAPHNSQSWTHSPQANKGSLKAKRTGWESLYREDGDTREMQEMRGMR
                     P"
     gene            <526230..>528407
                     /locus_tag="LMJF_26_1470"
                     /db_xref="GeneID:5652875"
     mRNA            <526230..>528407
                     /locus_tag="LMJF_26_1470"
                     /product="farnesyltransferase beta subunit"
                     /transcript_id="XM_001684099.1"
                     /db_xref="GeneID:5652875"
     CDS             526230..528407
                     /locus_tag="LMJF_26_1470"
                     /EC_number="2.5.1.58"
                     /codon_start=1
                     /product="farnesyltransferase beta subunit"
                     /protein_id="XP_001684151.1"
                     /db_xref="GeneID:5652875"
                     /db_xref="GOA:Q8WR00"
                     /db_xref="InterPro:IPR001330"
                     /db_xref="InterPro:IPR008930"
                     /db_xref="InterPro:IPR026872"
                     /db_xref="UniProtKB/TrEMBL:Q8WR00"
                     /translation="MMNLAPDTITIGAQRNTELLLLEYLRSTNPHIHALWQRHPNKDN
                     DASSSSAASSPSKDTRGASGSDVGDANASSSSAASALRESFDYTEPRLYRAAHVHFLM
                     ENLSVAPQGFSSLYPSRPWIVYWALQAADVLNSMESEVLHRTPPSAIVAFLHSCLSVD
                     HTCQAEVNNRLAAAATSARGAPEGKDPHVTGTPLESSTTSVTLERDSADATSATLMPP
                     VEDAAEVAEGPSRPVMGFAGGATHQEPHIASSYAACCALAMLSWYGDGAPLRQLPRAA
                     IKRWLLTLRNEDGSFRVHGGGESDIRASYCAAVITTLLGLDDPTTFDGEAGRCEFVDD
                     VRDVPVLTLQTARFVAACQTHEGGFTCSPTASEAHGAYTQCGLAALLLMKQPHMVHQA
                     SLRRWLAARQLNYEGGFNGRTNKLVDSCYSHWIGASHVLLRTVEAYTKCFTEVPTTHS
                     RNGDGTGGCEDGYREDVDCTPSARCLRAREVVLLDHAQLLDAKMIHASADDAWDRAES
                     AHLTRLGVVDQFLGADDAVLRSAEEKRTAVTALYERLLESRLAAVRSCDGNGDAAAGD
                     VQGSLEAWRARQAFLYADVGDFYFNQRKLQDYVLRCCQDSEIGGLMDKPQTAHDGYHT
                     CYSLSGLSAAQNLQYRTHVTAADAAYPSTYLERAFARSYLPGRESGSTSGNEEGSCGV
                     VLGLPNTSAAAESMLLRTTSPIFNIHQSRVLSALRAWSVKAFV"
     gene            <529390..>532434
                     /locus_tag="LMJF_26_1480"
                     /db_xref="GeneID:5652876"
     mRNA            <529390..>532434
                     /locus_tag="LMJF_26_1480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684100.1"
                     /db_xref="GeneID:5652876"
     CDS             529390..532434
                     /locus_tag="LMJF_26_1480"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684152.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652876"
                     /db_xref="GOA:Q4Q946"
                     /db_xref="InterPro:IPR019335"
                     /db_xref="UniProtKB/TrEMBL:Q4Q946"
                     /translation="METAPLPSLAATPASAAVPSKPQLLMPSVATVADASSTALSSDC
                     IARVNTVIADDIRQLGRDDLDVKRWLNTALSRLVEAAKEVSPAGTTAAAAASPVPSYA
                     STTPLASATTTSTRKPLHLEEQLVQLLHARVQTHSQELSAGIEDLISATLVRLPRTTM
                     ELTRMATEAAELTEQLQRIEGVVRPAVVAGSEAYVTELQLRTASESKLQKCKRYLEKA
                     ARVKESVRNLQYLVEHCESTNNKTGSGNGSDPLNGGERGTDSSADPITAGNSVNGSAS
                     SGKVATRHRDLDEVAGIIRQAREDLKEITAVDDTFGEQYKAQLEQFEQYIEHALEEEC
                     VACLLAHQLERATRLMTTLYSIGRADAVLKRYGEQAATQLATMQQEKLRACVNRGGAG
                     VHRSNVAAAAVAELLRREIIPDNNAFVSRELTFLSSLVRRTLEEDQATSPFKSGGAGA
                     SGATQEASTTTRSKPPGASNPSAATASSASAASIPGGGTSGGSHIAVEDDPRAVQALE
                     VISIILHKLYESVQSTLQPLLTERPDTTNADFVACLSAIQLIKISATSVTTAAPQGTA
                     GEQSSSSTGFATPQVAAKDPLEKLAREVTHRALGLFASLFHEERVLDRYAARVCAPVA
                     AFCEQPLSRVLSAVASTATDGELDEDSLTSVLMHAIQEVLVYAPEKITTRCTTAWHAS
                     LSKMLAQLQPTPSTSQHTLLQYLYIYKRRMRPLVMRAQQSVEDWLSTGTVHERYPASA
                     AVLCADLQTRVWAPLKDEVEEAQESIQKSILNSITRPILATVAAYTSLPYWGDAVALA
                     DGSSSSTPVAAAASKPLGTYTQGQAAPSSAVRNMGEMLMELPLTLETLGSSAVAECRR
                     NAQGAGSAGNGASDTDAEDGVRALIEEQAEEWLGTVVSDVVSTFVKEKVLQLQIGPFG
                     SVPPSQQQQREHQTQRATTGASEVAQRRYAAALEQLTTDLDYVRNILSAVNEESLETV
                     EQVLQAVQALPPASTCAAFVVGDAIRMATLRGSAADDAIEQH"
     gene            <534109..>536076
                     /locus_tag="LMJF_26_1490"
                     /db_xref="GeneID:5652877"
     mRNA            <534109..>536076
                     /locus_tag="LMJF_26_1490"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684101.1"
                     /db_xref="GeneID:5652877"
     CDS             534109..536076
                     /locus_tag="LMJF_26_1490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684153.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652877"
                     /db_xref="UniProtKB/TrEMBL:Q4Q945"
                     /translation="MKLSVASHAALLPCSAPPPQLLLLPKLLTFCASVLFVFGALCLV
                     TASPFAAAATGASQKSKARKQATELLTHVTFASCNRQSHDQSFWMASIASTIAAQCER
                     AGGNNSKPHTDLLLWLGNAVYADVDEAGVALSLARPSHGVEQEYKLLTENPYYREFVE
                     VVVGRDGRVSGIWDDRDLGRRGADGSYAPSEAIRRLYLTYMWKGHPLAVKDATGDGTP
                     GALYSFTGIPAPTGAPLAAHFVHSVCTITLDVRTQRTVPPNLVDALLRRSEKTDLRLR
                     GSAGAASDARLAEIRDVRAQVMEADLLGRRQWAWLERTFATYLAPTARSPGDAAGRAH
                     CAVTLIASPWQILLNDNKPFEGWDLYPASRSRLLLLLKKYKVERFVFLSGHAELGELG
                     VMQRASKEDIRVEGPTVTLTDSFPRESPTLTASELLPPRRSSLVEVTSSGLTHTVREA
                     PLVGWLAHWFTTSPMEEDATSNGLLQGHLFLTRNTTMERQFGTVQVIGDRVAAAWHAD
                     AVAASREEVLARTRVLITLHSVQRAGAPLVTLERTLESLPSYAVELLEEEEKEDDAVK
                     AIDLYDAAHLPQFNVYNDPRYYPWLKRRMAAWQCAEAPCVSGQHFMLLRVIANLALAF
                     AVVLVFLAAVFYYQLKHRDMHEENGVKLKQD"
     gene            <541298..>541708
                     /locus_tag="LMJF_26_1500"
                     /db_xref="GeneID:5652878"
     mRNA            <541298..>541708
                     /locus_tag="LMJF_26_1500"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684102.2"
                     /db_xref="GeneID:5652878"
     CDS             541298..541708
                     /locus_tag="LMJF_26_1500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684154.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652878"
                     /db_xref="UniProtKB/TrEMBL:Q4Q944"
                     /translation="MGSKPSKRTDKKSVVAPASRNPNRTSDRTALRSFDVGSDDVIGG
                     PRASNSVNERQSPERRGFNNPIPARSGGSTDRALKRQTRMLGAEDPDGAHEDLDERPF
                     HQEKVNRVPTKALLKPPKNPESMIADPYEDQELY"
     gene            <548523..>553070
                     /locus_tag="LMJF_26_1510"
                     /db_xref="GeneID:5652879"
     mRNA            <548523..>553070
                     /locus_tag="LMJF_26_1510"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684103.1"
                     /db_xref="GeneID:5652879"
     CDS             548523..553070
                     /locus_tag="LMJF_26_1510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684155.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652879"
                     /db_xref="UniProtKB/TrEMBL:Q4Q943"
                     /translation="MPCVCEASEVPRTPLLSALLQSGSMPETDNVSQNGGCATHAFMA
                     VTNAAPRPSVGHSNGREDGVVPIRQGDDRSKVDMAFVNASLQPLARAKSGAARHLSCN
                     DGNDSTGGGPKRRGGNAAEALHSSTTAGADDKDALQSAMTSASSQCVHFVPNNVATAT
                     ATDVLESPAAPPLSPEGAHNPCDDTDDPLHSRRHRHCYTDTESPGLGGSDGPQTWSAA
                     SSVSSAPHSTAETQWCNTSEGSELDLHEIPLPVTDTTTGHLTAVLSVCGGEASPVTID
                     ARTAEPAQKNNTGANGWSPISVSAVMSPNRQSIAGLQQSSKGSGWRRKRSCDTSAVQS
                     ERHSCCCCSDHGDTSPASLEKSVPRSTGKPIDDGPASPVASLSQKRIESLDDNTRTPT
                     STQATMAITPTTMESGIALDPSSSHSSLQSVDSHHALQRSASISRMCVPRQEMAPSLH
                     LSMPIRAGGAVVASTIVGVSVRSPLEATTSLMLPMFTVDSTASLITFPRSDTAFPLRT
                     TLNTLTKSVGDESQQPSPRLHDQGDAGDADQPPLTPTAPAVTPAAQHLSSSIAAARRE
                     NLDGSSVTSSRQQEQQAPFGQSKHEEANATESGSSNSLSPPPQQNLRNFTVTSAISFC
                     VDNAATACDPRSKTAEHSSLHSSAISMRQSSTMSEDQILQTLAHGMALGGVMTGPWKA
                     AQDNSTPTPPKPCASDPGSWRLTGRPFAPQHPPSPPSRTVASGEMGTDRGTQQGSTNC
                     ATCPCGSSLMAPHMHRAAMSLYLGSGTQAPRSHGKSPAAGLVAPPTHFSELQRQRGRL
                     SRMSSTRPVEAQGARPAQVRSLVSVSAASGADEAAETGSRSLTHSSLAVVLSSPSKRH
                     RGLPNLGYFCATADDSLRDASGSSATTLPALLCSALHAERSLATPFGVEGVIFSAGST
                     PNVVGCVEAGVAAWLPAVSSDTAARPLSGDQAVMLQRSDSSTAHYHVPSSGVCSNADS
                     GVAVGAPMEALRAERFTFLQSVQDVGGLAAQAETGALLGDAGAVQSLLSEEKAEPAAL
                     ATPTVSPPTLMPSSVFVPLPTVGFVSGWMPRIPAGGVSTLFPFNTTSTAASSPARKSA
                     VSSGNSSESPDGASERISALRMAAEPMCVANDSVATASVTFMAETSSARRSSPPAPAM
                     LPRPLLVPNPSYRIPGSEVAAAVATPPLPEMVSLKDNVSARPRDGTRSVFQPVLPLAQ
                     EEYAATSLSYEPGTPKAMSPVPASRVKDESVAATDLQHLWWAPAVAWAAAPFRATGPD
                     ARPTPVHCNSGESGMHSAAQSLSCSSLRGLLPQEQQAPRQLQMCASAAIRPSLYSVHN
                     NGDQGVYQIADCMRNARAGPVGGALRGTSSPFVERTAGMGAGGGEGHGQRCRANGGML
                     FHKRGTLTGSSGRCHKKGGKGGGGTGSPLRISIPRYCDVETLLDDAEQAMSRAAVPII
                     SLLGCGGPSLHEDAYSFDMLGNGLASSVMSLATPAPTSSNAGMDMGLVSPLVLASASD
                     KPAASPTGRTSSLSLSAPNER"
     gene            <555243..>556448
                     /locus_tag="LMJF_26_1520"
                     /db_xref="GeneID:5652880"
     mRNA            <555243..>556448
                     /locus_tag="LMJF_26_1520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684104.1"
                     /db_xref="GeneID:5652880"
     CDS             555243..556448
                     /locus_tag="LMJF_26_1520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684156.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652880"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q4Q942"
                     /translation="MAAVPLHAVPTPSKVLLPGFVRKAAPVFFVVMHGFLAHSGAMNS
                     FVVILRNAIDAHNRAVLESNDQTSVALPFHITTLDARNHGLSPHTSTHSLENLVEDLS
                     HYLDHDFPRTVSRVSEAWMRDGSDHSHGDVACPRVVAIGHSMGSLTWTQYLMDRYLPS
                     LASSEKVRGSELSPTTASSPSSNVSSSVRSSLDVKGLVSLDLPPIVRSNMTANLTGEL
                     IDIIEHMKAVNLSAISDLRSGQEEFYRCGMHDIRVRGLCTTNLALQRDPNDLTRRVAS
                     WKCNVPVLEHSIRSGELFLPDSYYKPAAGGKGSGGTHDAQEQKQRQHRLALEYPSVGT
                     VPVLSVLGAASPVGGDPQYQQLWERYAIDLRQHSIPHATHTVYFDKPHETVELVTNFL
                     KEIQVDQPL"
     gene            <557225..>557881
                     /locus_tag="LMJF_26_1530"
                     /db_xref="GeneID:5652881"
     mRNA            <557225..>557881
                     /locus_tag="LMJF_26_1530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684105.1"
                     /db_xref="GeneID:5652881"
     CDS             557225..557881
                     /locus_tag="LMJF_26_1530"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684157.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652881"
                     /db_xref="GOA:Q4Q941"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4Q941"
                     /translation="MDTAATNLSAHAKPWAPNGPGSQQPQMQHPRSHSNQYSQDSGVS
                     SGQGAGMQRGMRARGCANNGSANSMMVPGQHHHEYGTLNGMLHSIQQQQPKLSSTAAK
                     LFVGQLPFECTEERLRNLFSAYGNVEHIHILRDNSNRSRGAAFITLSTVQEADTAIFT
                     LHNRYRMLTNRAIQVSYAKNSPNISPFGTHSAVEVHQSNPTNPLPDVAGLATQVARLF
                     "
     gene            <559509..>560702
                     /locus_tag="LMJF_26_1540"
                     /db_xref="GeneID:5652882"
     mRNA            <559509..>560702
                     /locus_tag="LMJF_26_1540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684106.1"
                     /db_xref="GeneID:5652882"
     CDS             559509..560702
                     /locus_tag="LMJF_26_1540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684158.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652882"
                     /db_xref="GOA:Q4Q940"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q4Q940"
                     /translation="MRFLAKAATTSAVTLGVGAVALLYCQRARNPGAAAGTSEVTKQL
                     SAKEFNGLQNATLLKEALAPSHLPWTFHAQKDRYTNLRELTTHASQETATAQPPGGRA
                     YTASSSDMKLTFYRLLGCPYCAKVEAVLQYHDVPYEEVHVDPLSGKGLPDRRYQLAPQ
                     LYLAPLAKRNSGGAEAAATDSNGVYVVDSAEIVSRLSGPLKYAADIANPRISATRDWI
                     TNHFHGASFAITNNSFCDAYATYAYVTPSNYQNFLYHVVGSAALSVLSRYKIQPRLIA
                     KMECADGPAAATPTGAPASTDSNGLWMLSEASRKALAATVRFGAVEEWLRAELQTFLQ
                     RRPADKVFHGGSSPDLADVEMYGVTRVVDQHPRLGAVVREGAFGEWQTAMREKLKANT
                     GSVYA"
     gene            <562222..>564402
                     /locus_tag="LMJF_26_1550"
                     /db_xref="GeneID:5652883"
     mRNA            <562222..>564402
                     /locus_tag="LMJF_26_1550"
                     /product="trifunctional enzyme alpha subunit,
                     mitochondrial precursor-like protein"
                     /transcript_id="XM_001684107.1"
                     /db_xref="GeneID:5652883"
     CDS             562222..564402
                     /locus_tag="LMJF_26_1550"
                     /EC_number="1.1.1.35"
                     /EC_number="4.2.1.17"
                     /codon_start=1
                     /product="trifunctional enzyme alpha subunit,
                     mitochondrial precursor-like protein"
                     /protein_id="XP_001684159.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652883"
                     /db_xref="GOA:Q4Q939"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="InterPro:IPR006108"
                     /db_xref="InterPro:IPR006176"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:Q4Q939"
                     /translation="MNRAESSANALGEEFVKNMNTALDIVESLVAKGEAQFAILASAK
                     STFCVGADIDQMYTVTDPAVAVQVPTVGHKLFNRIEQEKFPIVAAINGLALGGGFEMS
                     LACHQRLMASTAKVGFPECLLGLLPGGGGTVRTQRLCGLTKTVQWIMTSKQIKPQEAK
                     SAGACDVIIPADDRWNGEHRFYEGVRKWAGQYLSNKPARLSKRKNISLMDQVLENTTF
                     GRRKVADETIKMLNKKTRGKYIAQYKALECIMYSATHSNQQGFDKECRGFAELLCSPE
                     AKNQMSLYFLQEGMKKSADKTGVPKDKVMPVNRVGVIGAGVMGSGIVHYFAKNNIPVA
                     VKDLTEESVKQGITNVRAEFERAVRRKRMVTAELDGKMALVTGGTTNEVFRDADVIVE
                     AAVEVMDIKKKVIQQLEKDGILHSKSLFATNTSSLSLTEMQTVAKCPHNIVGMHFFNP
                     VSKMPLVEVIKGKSTSTEAAAAIFNLALKTGKIPIIVNDGPGFLVNRILGVYMAEAGR
                     LAVDERCHPACVDEAILAFGMPMGPFRLLDEVGLDVACHVGPVLANGLKSDRFSVSAT
                     ISQMVADGYLGRKNRKGFYTYAAEGKEAGLNSAVLQKYLGEELSASISETEIVDRCVL
                     LMVNEATRILDEGIAMSPEDVDTGMVWGTGFPPFRGGLLQYADHRGIANVVAALEQLQ
                     RKTKRDYFAPTETLKKMAIEGKRFFPTRPYVPYQERHGYPKVTY"
     gene            <567613..>572493
                     /locus_tag="LMJF_26_1560"
                     /db_xref="GeneID:5652884"
     mRNA            <567613..>572493
                     /locus_tag="LMJF_26_1560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684108.1"
                     /db_xref="GeneID:5652884"
     CDS             567613..572493
                     /locus_tag="LMJF_26_1560"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684160.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652884"
                     /db_xref="GOA:Q4Q938"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q938"
                     /translation="MSRKRAAPSMRLEGPAAAPLLEEALLVHTRSALARNFMLITERT
                     IELAAQPHAHCIVGDLDTLPGTAAVGGTAEPAGDDVSSAKSLMLDARGASNIAMRAVL
                     PCVQYFIVSECARVARVVREEGGNGYGDDPATRAAELLGFLLSMLDKYDTFSNLFAVA
                     CPSCRVAGVSYSSFSFLPQFLALSQRASADEIHLMDQKSLIERLGLLDGCRATTGQPL
                     DVMECCPFGEAHLSLYLLIRTSSGERHNWRLSRLWWQHVPFQLLSFPAIAKAAKAFET
                     SMGQYTADRTRDLIRHQHMAANSGGKWAPPTCKQAKSPKFTAAQRALIKPKAGCLTWA
                     EELLRAILPETATHPWHRNSADLQSRIRSCYAYTCADVNHGGYFSATLEPPLSLLFST
                     FSTGSFASTASFVQARLLFAHMKVCQHVAEALLRGGCCSCHSRHDAAAGEVLFVEAHG
                     PFMTALRHCRDESYLLTGNDTVTVGRTASAAVAVDAAEETTTAPGAVAAGGCQEAATF
                     YAAGSFSRFQTTLELTGSMNAAQIVSYVTQVTAESTETLPAAQMPRQYIRAELKRHQL
                     ENVQRMWNKECEGYRDHVSVPLYHVDTAAMPAARQVGVMYYCAATNETIVVRGSGGPV
                     VAGREAEAEAWNAAGGRIRGGLLCDNVGLGKTLSILTLCAYDRAVREAGNSGGEEAEA
                     LVGEIALATRKVWQVSAKTETMRNCMLRSTREVLHWAFGNFRAGIVPHPTAPTRLPHT
                     TLVVVPLSIATQWIEEIRKFYPTASYILFYGAKRAQYTAADMQRADFVITTYETLSTH
                     LRQEACGLQFWLARVADEADDAVCAKAASHGWSNLMPSELFAAVQQYASEVVWPAAGG
                     MREAGGIGRGLEMTHICDCTVVPLPQGGQRTCGSHRSDGRGHAPLGSGEKLQVSSPAS
                     DTTTSSNTWTLELDGVDGVSVFRCPTLSITVTFDNSVVDATARSVDRHTRLPGTGAVS
                     DAFLDHTWELLRVYSATTTSLPVWQDAVTQCRLFDDQGSPSDTSVFLALLYHAAEEYT
                     LPDSARRELVRRVLLPPLWRVLAGYWVHMKAHYADVAVAETTGRSALRVTDLLFRRVV
                     LDESQKCSATSLFHLLSGERRWAVTGTPLNNNKTESLGFALRFLGMHSAARLLSRPPF
                     RHASLTHAYLNTHNVLSASDAAGHSLADSVNRGLRSLWVRHHSDTLPVSVANGVAFCL
                     CAQCVQRDLYSASEASFTNIPSEYRLWTPPRDLQVGLPCLPNSLFEVLTLTMVRHERD
                     EQVSRELQLAPARYHVHSAALTADEMRLYDRVALVIMNVAARLHRQGILSSRMGYVMQ
                     WVQDLCRLCLHPSRVGNDKLLRGDIEAHMLRGVRLMSDNGVCGAGITEVLAASFVAAT
                     PQEALEWVKLVAAARKPGLLRDSSVPEETATTLAELAQVPPLLPPCGVCMDTMAEPTL
                     LKCFHMFCKECVLGVIDASREVAGNASAKCPYCRDRKSMLEEKRVVTVDTAVPVKAAA
                     ETRHDDDCCRTATAHSGDEEVDVVLASIGNGSRVRAFLEVVEEIWRTQPDDGVLVFSK
                     YPTFLKLAHDAVVAQGYAPHMVCGASSLAQRQRAMRAMQPPSGASVLAAPYSVCHVAQ
                     RKRRPQLDLRQPSRFP"
     gene            <577306..>579363
                     /locus_tag="LMJF_26_1570"
                     /db_xref="GeneID:5652885"
     mRNA            <577306..>579363
                     /locus_tag="LMJF_26_1570"
                     /product="putative thimet oligopeptidase"
                     /transcript_id="XM_001684109.1"
                     /db_xref="GeneID:5652885"
     CDS             577306..579363
                     /locus_tag="LMJF_26_1570"
                     /EC_number="3.4.24.15"
                     /codon_start=1
                     /product="putative thimet oligopeptidase"
                     /protein_id="XP_001684161.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652885"
                     /db_xref="GOA:Q4Q937"
                     /db_xref="InterPro:IPR001567"
                     /db_xref="InterPro:IPR024077"
                     /db_xref="InterPro:IPR024079"
                     /db_xref="InterPro:IPR024080"
                     /db_xref="UniProtKB/TrEMBL:Q4Q937"
                     /translation="MAATSIFANISTVEKCAALFPKTVAACEDLVKAAKHRAEQSLGK
                     IYGISAADRTFENTAKSIDMASIELEVSASLLSVIASVSPSKEVRDEATKRVVELETF
                     SIDNFESNRQLYSALKEVCAAPAYEAVYASGKAPREYTYWMEEQLADYRRRGMELPEE
                     EFQKVVKLQKELASLCTVFQQNISEDKTEVHFTVDELKGVPESVLSALQRTEAGECTL
                     KMDYPTYFAVMKNCEVASTRQAMAQAFTNRAYPVNDKVLKDIIEKRHQLAVILGYPSF
                     AHLYISDKMAKTPEMAQTFVESLIPKLQKKWTAEVELLKKHLHPSCSLSPAGDIEAYD
                     IPFMINQIKKTLLNVSETAIQEYFPMDATVKALFDIYQSFFDVTFLQVDNGSELWHSD
                     AKTLEVNDNKSGCVLGYIILDLFPREGKYSHACCHSVVPPVLLKEGGNDFSPALAVVI
                     SNFPAATADRPALFLHDDVETFFHEFGHAIHSLMGRTRMATFAGTRVKRDFVELPSQM
                     LEEWLWEPEILQKITSHYKTKEQLPRTLIDAKVASKNAFSGRDTLRQLQFATYSLQIF
                     GLPFSTQPRDNLDTTQLFYDLEPRVMPGVNYEHNTHFESAFGHLTGYGAGYYGYMWSK
                     VFALDLFEYIRSHNGLLDPKMGRRYVDCIIGVGGSQDPNDMLVKFLGREPNNEAFLRN
                     IGV"
     gene            <580190..>581950
                     /locus_tag="LMJF_26_1580"
                     /db_xref="GeneID:5652886"
     mRNA            <580190..>581950
                     /locus_tag="LMJF_26_1580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684110.1"
                     /db_xref="GeneID:5652886"
     CDS             580190..581950
                     /locus_tag="LMJF_26_1580"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684162.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652886"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:Q4Q936"
                     /translation="MEFSSSSSSDAGLEEELHRNFHREQREQRGIVRASSSTTRCETV
                     RFTMPDGRSIEVRKGAIYIPLRDMYVHVLQARCCPEKWFGDGRVPLRRRRPLPADVVV
                     LQQVTEAAAAAGSGATAARPPASVRLSEATDNDFFVFKEVLPQKAEENADEVAAPLVQ
                     ITSVTAQKRQNSWHDPLIDTRFQRMAFLPRWRFSMAHPRSLREARYDTWDAVELPPPL
                     HVDDACCYDDSLGILWSLRRRDGRLWYLRYDSSATTTTRGAALMSVCVTTVDVATAQR
                     CVGMYCQHEGSSSHDAAVGDDEATSRCVCCLLVITTSHALYIRLLYTWRNRFTVEHAL
                     STLKLESVLPTPFQLSSVTCCCPGNAEKSPDVPPSSANDTSFCVGAGRSVFAFIWRNG
                     QWHRVRLASFAATDITALALHGALGHPSLPVAVVAGMRNGTIQVVTAEGGMRNKAIFN
                     TTPRHYGSDITSMYAVQGLAYGIVSVARDGGAKLWDLRRLGSDKDPVCTLLTSRLGGG
                     QSGVCSTAMAGHLLAVSSVSTGLVCVDAQTGARLFHTTQKLSPATRIAFGSLSNVDGN
                     DGFELYTFSPYYTQRFHLHL"
     gene            <582670..>584460
                     /locus_tag="LMJF_26_1590"
                     /db_xref="GeneID:5652887"
     mRNA            <582670..>584460
                     /locus_tag="LMJF_26_1590"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684111.1"
                     /db_xref="GeneID:5652887"
     CDS             582670..584460
                     /locus_tag="LMJF_26_1590"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684163.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652887"
                     /db_xref="GOA:Q4Q935"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4Q935"
                     /translation="MGVCLVHRSIVVADAVSATSKSSTHTALSTPALKQTPRASFEDP
                     LSSFNCDAPFSGYDCHAWSDLQQQNKQSVQDGVDGVSCAQKSSSIATLQRVSLERLSM
                     SAEVSLLDDLLLMKKDDEVASGAGAAGNGFCLGSRRRQLSRIMSDVYSKLNTVTPRHE
                     GEATEDYLKRIFSVVDSESRGKVSSIQLANMLFNDASRASTAMMMAAADHEKDGYLSE
                     SEFVSLLHAESGVDLLRADCDESKLTKLSSSSESDDAVLGSLASLTTQEKSPKDAHLL
                     KTLSKIRMRGVEVTNLCSQSSRTKCIAISPDGNLYAVAHRHDNVAHVYMISNGAEVRR
                     LVGHQGSLLGILFSPDRKHVVTAARDNFMVFWDHTIGLECRFSEHPGIVTAVAVSFDG
                     KFVFSGCQDNLVRKFTASKVKIRAVLPDIPCETHGVIVALATQSTKNDLIAFSRSCDK
                     CAYIANAYDLQLFGQLSGHDSLVWKASFNADDSLLFTCCERKIIVWDGTYFSSIRIFI
                     SSAVSTPGSSADDVLWTTAVFASREHCGLLFCFKSLGQMQVLNCDAAYTKESIIDIQM
                     RSRVYTASIFVGDTMVCGDDYGNVYRVRIT"
     gene            <587168..>589291
                     /locus_tag="LMJF_26_1600"
                     /db_xref="GeneID:5652888"
     mRNA            <587168..>589291
                     /locus_tag="LMJF_26_1600"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684112.1"
                     /db_xref="GeneID:5652888"
     CDS             587168..589291
                     /locus_tag="LMJF_26_1600"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684164.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652888"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q4Q934"
                     /translation="MVFLMSASHTFADPLFFLSLAFINFTNGTIRSEEAGSPAMNALV
                     ESIVQSNARAELTAGQLQALIGLFTSTSEVLSPSHALFRKLSATLAAFPSLEDGSQCI
                     RLCILLCREVAHRKIIFELIEAHNTWVESIATPSISALATSHAGHRSGTAHETTEDRS
                     FLSQLVLVMLVSAESRMKASDLVDFLGADVESTVEVLVTCYGSVFGALPGVLTAASGD
                     YQLHLVARLVELVRELTFWTTYEELHSSLGIGSKAKKTLSQCTGSVSMSALSGPFRYH
                     VGQLISHLVKYDFFGPMSMYLPLVIGKYLASPSSCSSSDGDERNVLMAMSLLRNHLLL
                     LQTLLTLTDQYALVLRKALCRCGLLSKVCGPLLRVLCKPQGCLPGELSLFMQTMAVAS
                     TLTYHSSECHQFWGENSSVLVAVADRSVATLADGCIADPRTSAELVAQLVRLVVNSRS
                     SAAVAPLLKTWESVLDSGGKQYVACSLSNPKSRSRPLDISSPSYNALRCVFRVDTTAP
                     PPPPVATRRGSVDDLLRQRRRGRHNRAQRSLSRGRSRGRARSKRRRRHKSRQARLQQR
                     YHLLVQSTTPTTAVAQEQTQAQFAPLDFVSDASSDESSDNRDDAADAYESTCAPPVDL
                     SRWQRGPPPRTIPIQYICSLSHALIRSAPVLSSTGYLFDEDVIIDYLQYYDVCPISGA
                     SMSRADLVVDTALKEELGKVRANFM"
     gene            <590507..>592192
                     /locus_tag="LMJF_26_1610"
                     /db_xref="GeneID:5652889"
     mRNA            <590507..>592192
                     /locus_tag="LMJF_26_1610"
                     /product="proline oxidase, mitochondrial precursor-like
                     protein"
                     /transcript_id="XM_001684113.1"
                     /db_xref="GeneID:5652889"
     CDS             590507..592192
                     /locus_tag="LMJF_26_1610"
                     /EC_number="1.5.3.-"
                     /codon_start=1
                     /product="proline oxidase, mitochondrial precursor-like
                     protein"
                     /protein_id="XP_001684165.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652889"
                     /db_xref="GOA:Q4Q933"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR002872"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR015659"
                     /db_xref="InterPro:IPR029041"
                     /db_xref="UniProtKB/TrEMBL:Q4Q933"
                     /translation="MRRLLPLRPAAVAFAGSARHSSLTMQDKQPKLPNFNDDTTYRQR
                     SAWYLIKALVVLRLCSVNYLAMNSVPLMKRVEKILGSKLTYSILVKKSFYNYFCAGEN
                     DQELRDTVRKLSRNNIGAVLDYAAEADTEGFAPEPGVASGPDISMSSLVMKPNVQYPM
                     DEGFFNENMKLYMMSIMHASLYSPRNVAGVTAVKVTGMCDPQLLARVSALLMSVHQSW
                     CKHFTNEESLKLEECRVVMGVNRKHQLFITYDQLRAGFEKYNPSNKLSDAQFKEITEA
                     LDPRKTGKVNYFEYKEMLTNALIAVEPTPVQQALIEGLPQMSAKEKVLWKNVNNRLLL
                     IASMAKELNVRMLVDAEQTFYQLAIDAIVATLQKTYNTELPVVYNTYQCYLTYAEDRI
                     DNDLVRARHMNFHWGGKIVRGAYIVQERATAAQYGYTSPIWSTYEETNKCYNAAAKRI
                     FDTFEAQPAKKHEVFFGTHNKKSLEIITASVLERPSIQSRVSFGQLFGMRDNLTVPLA
                     RAGFQVYKYVPYGPVKETIHYLGRRAVENSSILTTGDNETVMMIKELKRRCGF"
     gene            <596991..>598286
                     /locus_tag="LMJF_26_1620"
                     /db_xref="GeneID:5652890"
     mRNA            <596991..>598286
                     /locus_tag="LMJF_26_1620"
                     /product="cdp-diacylglycerol synthetase-like protein"
                     /transcript_id="XM_001684114.1"
                     /db_xref="GeneID:5652890"
     CDS             596991..598286
                     /locus_tag="LMJF_26_1620"
                     /EC_number="2.7.7.41"
                     /codon_start=1
                     /product="cdp-diacylglycerol synthetase-like protein"
                     /protein_id="XP_001684166.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652890"
                     /db_xref="GOA:Q4Q932"
                     /db_xref="InterPro:IPR000374"
                     /db_xref="InterPro:IPR016720"
                     /db_xref="UniProtKB/TrEMBL:Q4Q932"
                     /translation="MPKEKKQRVVLLPLIPTGGDLSPAVDDTMAKGKHSTCGDGATGG
                     RSPATAAASAADGKKLGYKDVINRTIFTILMAYVFLCWISVGIRFGLFLLFVIESTMF
                     YEVTRINQRVRKERQLPSVLFIKWYFFVVCYVFVSLFCNREPLQNTFAWFDKVYDLLP
                     FAFFCCVMLGLVIFVLSLRKGMYRYQFIQFTWTAMMLMLCQVQFAGEMRNMVRGMIWF
                     LLPVSCVVNNDIWAYVFGKCFGRRKLLSLSPKKTVEGFLGAFLFTVIWSFWFCGFLSH
                     FPQMYCPAVGFTNAVNSHCEPNPIFLQEEVAFPQWIQQVSGGMLTTFLVSPAQKHALV
                     LGTFASLLAPFGGFFASGLKRAFKLKDFGDLIPGHGGMTDRMDCQGLMGLFTYCYLRT
                     YVFHETKCPGANDITRCALRMDAEHRQTLVNQLLQSLQA"
     gene            <598958..>599221
                     /gene="S33-1"
                     /locus_tag="LMJF_26_1630"
                     /db_xref="GeneID:5652891"
     mRNA            <598958..>599221
                     /gene="S33-1"
                     /locus_tag="LMJF_26_1630"
                     /product="putative 40S ribosomal protein S33"
                     /transcript_id="XM_001684115.1"
                     /db_xref="GeneID:5652891"
     CDS             598958..599221
                     /gene="S33-1"
                     /locus_tag="LMJF_26_1630"
                     /codon_start=1
                     /product="putative 40S ribosomal protein S33"
                     /protein_id="XP_001684167.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1630"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652891"
                     /db_xref="GOA:Q4Q931"
                     /db_xref="InterPro:IPR000289"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR028626"
                     /db_xref="UniProtKB/TrEMBL:Q4Q931"
                     /translation="MADSKKDNKKTEEVVTQGTDQAQVGLIIKVLGRTGSRGNVTQVR
                     VRLMAEAGSPDYNRTIVRNVKGPCKENDMLSLMETEREARRLR"
     gene            <599894..>600157
                     /gene="S33-2"
                     /locus_tag="LMJF_26_1640"
                     /db_xref="GeneID:5652892"
     mRNA            <599894..>600157
                     /gene="S33-2"
                     /locus_tag="LMJF_26_1640"
                     /product="putative 40S ribosomal protein S33"
                     /transcript_id="XM_001684116.1"
                     /db_xref="GeneID:5652892"
     CDS             599894..600157
                     /gene="S33-2"
                     /locus_tag="LMJF_26_1640"
                     /codon_start=1
                     /product="putative 40S ribosomal protein S33"
                     /protein_id="XP_001684168.1"
                     /db_xref="GeneID:5652892"
                     /db_xref="GOA:Q4Q931"
                     /db_xref="InterPro:IPR000289"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR028626"
                     /db_xref="UniProtKB/TrEMBL:Q4Q931"
                     /translation="MADSKKDNKKTEEVVTQGTDQAQVGLIIKVLGRTGSRGNVTQVR
                     VRLMAEAGSPDYNRTIVRNVKGPCKENDMLSLMETEREARRLR"
     gene            <600995..>601981
                     /locus_tag="LMJF_26_1650"
                     /db_xref="GeneID:5652893"
     mRNA            <600995..>601981
                     /locus_tag="LMJF_26_1650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684117.1"
                     /db_xref="GeneID:5652893"
     CDS             600995..601981
                     /locus_tag="LMJF_26_1650"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684169.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652893"
                     /db_xref="InterPro:IPR007330"
                     /db_xref="UniProtKB/TrEMBL:Q4Q929"
                     /translation="MEMSIETLVEALAVLQQATALDFSANVEGAVEMYIAAVTRLDAV
                     SEVLPADLAETVKRNTEAIRRKIDMLRRSRWTREQTTLFPSFTTQFVPVPIPIEDYRV
                     PRSPFSRVFWLMRLLKRSIHQGAFFTPSLYVSREVWMQDGCGASLRFVGAKIKYTSAL
                     CSAMEPLRSMTTLGDIEKTEMHLRKFVDVERELRSTLDSEIGRVKNAKPQKKSVWGAL
                     AKKAKLWTHQESNYDVCLTWASSALEQGQLFERWHIYFAQAVKGVSPVSPGIQLILDL
                     LQHIGVQLYSGLCVFLLHDMTILVERYQSKCQKSVTRLLPVEPKLESGGAST"
     gene            <602568..>604613
                     /locus_tag="LMJF_26_1660"
                     /db_xref="GeneID:5652894"
     mRNA            <602568..>604613
                     /locus_tag="LMJF_26_1660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684118.1"
                     /db_xref="GeneID:5652894"
     CDS             602568..604613
                     /locus_tag="LMJF_26_1660"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684170.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652894"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="UniProtKB/TrEMBL:Q4Q928"
                     /translation="MCLFTSVSHASPTHTSTPISPLPLPLFLFPFRLLGSIIDPLPRI
                     LSRTVRRPRERPSPTSAAQSGRSGTGGRGAAVDNMQSIQLTNDAGFKFELWKKLLTDA
                     LVKGRQGSDAGVQASVVSALFRVALPTVQAHLPRRVREPCCLSGACTTPGIPFVHRCV
                     HLGRRRIETMESCRDELCFCLAHSTACAGPAVDLVVHGYYSTGNDMRDRYRGLRCLLH
                     HTRARRICFENVDNSNDAREIVGELCHLMQAASSRGRSWSALRLTNCALNPVSFHTLA
                     TSLRTYDCLVNVAIENCHVGTLASVAAYVRSAARLTHLSLRGTTMATHWAAVGEAVAA
                     SVSLVHLNISSCNWQDVPHLSEFVGSLAAFAPRPRFALDLSSNLLTSKCFALLTKASV
                     AFRACVTDVFLGGHKFTDDEEDVSRFLGAYELLDTLSVRRSLLSTGTAQRVLRAVTDK
                     KRLWRLVDVAHVNLATGFFKRICQATFAPGASSLVCSGVDLHGQITKAGFAGCAPVLS
                     RLDLSNCSLTDECVGQLASALERGAPLSLRHLGLSSNVVEKNRTKGGDGSFLFLCKAL
                     RSHSAPYLESLDLSGNKLPLLPVVALMEQASVTMRWVNFSNSSIADCSADRVRVLTTL
                     MRRQRGATAPFVALDVIMASSVDEPWVGLKEVTEWLTTQVSVRLITEATVATASWAT"
     gene            <604814..>605605
                     /locus_tag="LMJF_26_1665"
                     /db_xref="GeneID:5652895"
     mRNA            <604814..>605605
                     /locus_tag="LMJF_26_1665"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684119.1"
                     /db_xref="GeneID:5652895"
     CDS             604814..605605
                     /locus_tag="LMJF_26_1665"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684171.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1665"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1665"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652895"
                     /db_xref="UniProtKB/TrEMBL:Q4Q927"
                     /translation="MSVHVMPRISEAGNPRGATPWLLFLTSASIMQYVTTCSCIAPLS
                     ITTSFTTITCFKCHANAHKHILYMSVSVQREGAVAEIARRECALLTRLATTNRRSRVY
                     RHHLFFRRSRHAVQLARKCYNAANPNLQRRNERRKSAALLSAHRALIKAVEYCTAELA
                     ANRIDTIALCVAFIGILSRLGCCVGQTILLSGGAALLPSSCPDSYVRYLAAAVLAQPS
                     ARSPPPPPSAAPRITPPENQRGKSSSDSYGDIVNRLVKQAARRKR"
     gene            <611425..>612399
                     /locus_tag="LMJF_26_1670"
                     /db_xref="GeneID:5652896"
     mRNA            <611425..>612399
                     /locus_tag="LMJF_26_1670"
                     /product="putative fatty acid desaturase"
                     /transcript_id="XM_001684120.1"
                     /db_xref="GeneID:5652896"
     CDS             611425..612399
                     /locus_tag="LMJF_26_1670"
                     /codon_start=1
                     /product="putative fatty acid desaturase"
                     /protein_id="XP_001684172.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1670"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1680"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652896"
                     /db_xref="GOA:Q4Q925"
                     /db_xref="InterPro:IPR005804"
                     /db_xref="UniProtKB/TrEMBL:Q4Q925"
                     /translation="MLKAHGAEIKKLYGPDPWLRYLMTPFVLLQIYLGYRAKDMGWPT
                     LLLVGYFVGGTITHSCFLAIHEATHGLCFFMPLYNDLYALFVNLVVPVPYAMMFKTYH
                     AEHHRYLGWDGIDSDVPTRFEGRYLSSYAGKFFFLTFQVLFYALRPTVVRTIKFEKLH
                     VMNYVVQLTFNLLVYYFWGWWPLLYFLLCTFLGTSWHPLAGHFISEHFVLAGNGGQET
                     FSYYGPLNWLMWNVGYHVEHHDFPNIPWTRIGKLNTIAPEFYVDLHRTKSWPGALFDF
                     LLDPNVSLCSRVVRERGSAGREKLLPTSTGRMKAAEPHHGPCSWKKDG"
     gene            <613906..>614880
                     /locus_tag="LMJF_26_1680"
                     /db_xref="GeneID:5652897"
     mRNA            <613906..>614880
                     /locus_tag="LMJF_26_1680"
                     /product="putative fatty acid desaturase"
                     /transcript_id="XM_001684121.1"
                     /db_xref="GeneID:5652897"
     CDS             613906..614880
                     /locus_tag="LMJF_26_1680"
                     /codon_start=1
                     /product="putative fatty acid desaturase"
                     /protein_id="XP_001684173.1"
                     /db_xref="GeneID:5652897"
                     /db_xref="GOA:Q4Q925"
                     /db_xref="InterPro:IPR005804"
                     /db_xref="UniProtKB/TrEMBL:Q4Q925"
                     /translation="MLKAHGAEIKKLYGPDPWLRYLMTPFVLLQIYLGYRAKDMGWPT
                     LLLVGYFVGGTITHSCFLAIHEATHGLCFFMPLYNDLYALFVNLVVPVPYAMMFKTYH
                     AEHHRYLGWDGIDSDVPTRFEGRYLSSYAGKFFFLTFQVLFYALRPTVVRTIKFEKLH
                     VMNYVVQLTFNLLVYYFWGWWPLLYFLLCTFLGTSWHPLAGHFISEHFVLAGNGGQET
                     FSYYGPLNWLMWNVGYHVEHHDFPNIPWTRIGKLNTIAPEFYVDLHRTKSWPGALFDF
                     LLDPNVSLCSRVVRERGSAGREKLLPTSTGRMKAAEPHHGPCSWKKDG"
     gene            <616387..>617361
                     /locus_tag="LMJF_26_1690"
                     /db_xref="GeneID:5652898"
     mRNA            <616387..>617361
                     /locus_tag="LMJF_26_1690"
                     /product="putative fatty acid desaturase"
                     /transcript_id="XM_001684122.1"
                     /db_xref="GeneID:5652898"
     CDS             616387..617361
                     /locus_tag="LMJF_26_1690"
                     /codon_start=1
                     /product="putative fatty acid desaturase"
                     /protein_id="XP_001684174.1"
                     /db_xref="GeneID:5652898"
                     /db_xref="GOA:Q4Q925"
                     /db_xref="InterPro:IPR005804"
                     /db_xref="UniProtKB/TrEMBL:Q4Q925"
                     /translation="MLKAHGAEIKKLYGPDPWLRYLMTPFVLLQIYLGYRAKDMGWPT
                     LLLVGYFVGGTITHSCFLAIHEATHGLCFFMPLYNDLYALFVNLVVPVPYAMMFKTYH
                     AEHHRYLGWDGIDSDVPTRFEGRYLSSYAGKFFFLTFQVLFYALRPTVVRTIKFEKLH
                     VMNYVVQLTFNLLVYYFWGWWPLLYFLLCTFLGTSWHPLAGHFISEHFVLAGNGGQET
                     FSYYGPLNWLMWNVGYHVEHHDFPNIPWTRIGKLNTIAPEFYVDLHRTKSWPGALFDF
                     LLDPNVSLCSRVVRERGSAGREKLLPTSTGRMKAAEPHHGPCSWKKDG"
     gene            <618868..>619878
                     /locus_tag="LMJF_26_1700"
                     /db_xref="GeneID:5652899"
     mRNA            <618868..>619878
                     /locus_tag="LMJF_26_1700"
                     /product="putative fatty acid desaturase"
                     /transcript_id="XM_001684123.1"
                     /db_xref="GeneID:5652899"
     CDS             618868..619878
                     /locus_tag="LMJF_26_1700"
                     /codon_start=1
                     /product="putative fatty acid desaturase"
                     /protein_id="XP_001684175.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652899"
                     /db_xref="GOA:Q4Q923"
                     /db_xref="InterPro:IPR005804"
                     /db_xref="UniProtKB/TrEMBL:Q4Q923"
                     /translation="MLKAHGAEIKKLYGPDPWLRYLMTPFVLLQIYLGYRAKDMGWPT
                     LLLVGYFVGGTITHSCFLAIHEATHGLCFFMPLYNDLYALFVNLVVPVPYAMMFKTYH
                     AEHHRYLGWDGIDSDVPTRFEGRYLSSYAGKFFFLTFQVLFYALRPTVVRTIKFEKLH
                     VMNYVVQLTFNLLVYYFWGWWPLLYFLLCTFLGTSWHPLAGHFISEHFVLAGNGGQET
                     FSYYGPLNWLMWNVGYHVEHHDFPNIPWTRIGKLNTIAPEFYVDLHRTKSWPGALFDF
                     LLDPNVSLCSRVVRERGSAGREKLLPTSTGRMKAAEPHHGPCSWKKEGRPNGRMLFFH
                     MH"
     gene            <620513..>621103
                     /locus_tag="LMJF_26_1710"
                     /db_xref="GeneID:5652900"
     mRNA            <620513..>621103
                     /locus_tag="LMJF_26_1710"
                     /product="putative cytochrome c oxidase subunit V"
                     /transcript_id="XM_001684124.1"
                     /db_xref="GeneID:5652900"
     CDS             620513..621103
                     /locus_tag="LMJF_26_1710"
                     /EC_number="1.9.3.1"
                     /codon_start=1
                     /product="putative cytochrome c oxidase subunit V"
                     /protein_id="XP_001684176.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652900"
                     /db_xref="GOA:Q4Q922"
                     /db_xref="UniProtKB/TrEMBL:Q4Q922"
                     /translation="MKRFCIPTLAAVSFARTFFGKGWDNAALDTIYSCMLRKPEVNDR
                     IRTQYASTMDPRDADVLRRLGEVSKENKTFIRVFLPPHLGDPHRLLKCYSLMAYPILD
                     DKGGQLKVEMDGCKLDAFADPDDDYSKVVIPHMELVEYLAKSLLETMKWEATPRGAAS
                     LLESLYRGAEIPDHVFQTPAVIERLESYKDANKVIN"
     gene            <623046..>625166
                     /locus_tag="LMJF_26_1720"
                     /db_xref="GeneID:5652901"
     mRNA            <623046..>625166
                     /locus_tag="LMJF_26_1720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684125.1"
                     /db_xref="GeneID:5652901"
     CDS             623046..625166
                     /locus_tag="LMJF_26_1720"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684177.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652901"
                     /db_xref="UniProtKB/TrEMBL:Q4Q921"
                     /translation="MVKRVEIHARVLRPGESIALSCKSSEFEIVLFRPRHHDRTKAAK
                     ASALKAETIDSSPVGDSSQESISQATGVNIATSKSKIQTSSTGNDARPAEKKSATGSS
                     ILRPSASGLRDVSGAVDVDDQTAAPFAPRAMGGGNEVRALADIAADAPLFFDTAVCIF
                     YDELAKMDYVATGRTTTDSKGLHHKPHLVVLGTEPATGGYCNFNITGPKGESLGDGED
                     EAFDEDSGVLVSRTATSNGPIAMAAADGVEVNLRRLDMCAGFLVSATLYSKDTCLNRE
                     RNVFYMVRRPRSSTPLCLVPLCIYGTPSSSCVSMMVRKVRVHGETTWEIVNVSEPLLR
                     KDVKSLILKLQERGLADPAHFARDYELKAAANRGGDGGSVGTEEDVLSGSGQSSNSEL
                     HASASHKRLSYAFEQEQSLTSMRASLTGERHCPLPRNRSSRTFSTLLTDVPRVVREGR
                     RQYNVGRSHVQTNLFDGDTSEEDEVLDDAMRAVVPRYADASLVRYENGAYNVGSRVGN
                     LATHYVSHRETYGLDAARQRLSGGGRLGGSRDELLPSLGAPRARSSADLVTLLPVLDR
                     CQPDDSEFAARPELPADLLFTSLDRQLAARAQLHSSSINANMKKRQSTVGRAHHSSSL
                     RRSRRRKGSKRPPSARASGRSRSQAKKKGGGKKAKGTRGPKSASGIPGYRSASASPQR
                     SSSSSSAHKLKARKMQSRVSSGKS"
     gene            <626458..>629535
                     /locus_tag="LMJF_26_1730"
                     /db_xref="GeneID:5652902"
     mRNA            <626458..>629535
                     /locus_tag="LMJF_26_1730"
                     /product="putative protein kinase"
                     /transcript_id="XM_001684126.1"
                     /db_xref="GeneID:5652902"
     CDS             626458..629535
                     /locus_tag="LMJF_26_1730"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001684178.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652902"
                     /db_xref="GOA:Q4Q920"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR013767"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q920"
                     /translation="MLAHPILASEDDEEYVIRVIFCLPALLDAYFDAVETICAEPSPP
                     PESKTRADILYLTIQQRLVVLGRVPPSTFRHFDEVSGTETEDKELPKLIDQLRHVFLE
                     NKVDIGPQALLWRKRSLSLARECSDHMNRCRVRFSLSRKVRRKLVAYGSSPCAFSMIS
                     FGLIVIFSCSALVIIPAVQAPLASGLAVGCVACVLLVLSASLVSFNLFTAVRSLHILY
                     SQLFHEYLIAGGSPSDILLNSLQEPSFKQRGKDGPRDSGTKRLEMGRETKTGYYTIPY
                     GDENRIGYIEGKQLNAQVVMIAFDSNYQITWWNNAAEVMTGFLQDGCIGKPLNELVQC
                     FNDEDVCSLIKHTRRGNLLKIKLCSLTAAPTTLSTVVAPILNCDSKPIGNVLICANSL
                     DNLREYRIYMHNYQVSETIGALSFLSERSSLSHEDSTLVNSLRRFVRNGLANHVEALA
                     REMESDWDWTSVEQLLGRALGHRIGLHEVIVDPLFPPTLCVNPDVAKTFGTVVGLANG
                     HCTVTLQMLNLTGNVFSLAVTVLLGPKCRPWDQAQLEQQLEQLLRSTAGSVYLLEERV
                     VLHFPCQVAPILDDGDEGDANPTSDQALQITQARAIINCTVNVVTAITNMVDQHNLSL
                     ILLKTMFVSLASVRERSDLEQRLSARPCDVDVIICDSEWLSSSRDLLMNNDHGAMVIP
                     LIDAQMPVPGDVQHAIRMPLVRRDVQQLILEVGKAVSMKKNAISAREERERILTLRQD
                     SPWTRGKLLGRGSYGAVYEATSDLTGGKMAVKMFYFSQNVESSISTLLNEVSIMCSLN
                     HPNIVHYFHCERKDNNVSLFMELCEASLTDIIVGRRQKPAHLSVVQIIRQVLTAIAYL
                     HSRGIAHRDVKPQNILLKGETVKLTDFGTAIQGNAGKEVRGTFRYMAPEVYKGDPHSL
                     SCDIWSIGCLVCELFACPTPFMQNSSLLGEMTSTVDYLTRVPQNAVLIDFLAKCFQLD
                     PERRWGAGDLLMHSLLSGNATASSLMKLETIFDAKHSNPLDPSSQSVFSLRSA"
     gene            <634132..>636144
                     /locus_tag="LMJF_26_1740"
                     /db_xref="GeneID:5652903"
     mRNA            <634132..>636144
                     /locus_tag="LMJF_26_1740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684127.1"
                     /db_xref="GeneID:5652903"
     CDS             634132..636144
                     /locus_tag="LMJF_26_1740"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684179.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652903"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q4Q919"
                     /translation="MGGALAASRVLRCFLLSKDAEALLQSVLEHHGAAEGPSVNVAAD
                     TLPPEQGNKGEAPSFGPPSCLLRNPDNAVTELRAGEEASVASAVGGDELKDPSQLTRL
                     FSTSQHHQQSDCSRGHAGQSKSTSVPADQVYFTLETVRAHPMISFPEILTQWEQFLAF
                     DGDKDADHVSQHLCCSEMALLNLKLEDGLLASLAAMCGTPPPIDKVPRHVADALRSDF
                     CSGNYRKVPGALHVCRAPLSHRAPKSPACYTLLHFSAELGDVAYVQALLAHYPSGFPL
                     RWLSSPMHAGQGYPTPAMLAVEEPARGVGFQPFSALSPPPSVMPSESEAEVYARANTE
                     LYPCKWVSEHCPDHTGMYLCHLAAARGNVQYLNYLVGLLGAATVLKKQRCAPPVSPLN
                     TWASLRYLPRLTAAQCALAFHQTAALEWIEAAHPFALEEMDRRTLVHALMAAAIHKDD
                     LTGAFSFLRTRSMEPLGILDFVPASVGASRAEMGASKPSQSVWSCELDEAGILRMVFA
                     AAEAGNVGVLRWFDDALGDTDVRWLCDRHGTTVLHHCARGLHAAAMAALLSITVATSC
                     TDSLQKQGSAPRSPPLWTPLDPTWIDVEDSDGRTPAVWCVLSRSKKGRGVEMLEVLRN
                     AGSDWPRRRHNGLSLFEMAAQEHSRHTKLMQYLKLHIKAPLHRQRH"
     gene            <637194..>638771
                     /locus_tag="LMJF_26_1750"
                     /db_xref="GeneID:5652904"
     mRNA            <637194..>638771
                     /locus_tag="LMJF_26_1750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684128.1"
                     /db_xref="GeneID:5652904"
     CDS             637194..638771
                     /locus_tag="LMJF_26_1750"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684180.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652904"
                     /db_xref="UniProtKB/TrEMBL:Q4Q918"
                     /translation="MPLLGCPALMASEKAVESAKGFCGPAMYAASAMHARITLADVPP
                     SADGLRLLASNGNWSEVLALAERLETEVAAKARRYPFKYASVPWSTSPPESTLRGSPE
                     YPQEEPPTAQSPPGTDVTAAAGSASRLSTDAAVRSARLPYVLVQVTANLKMRRIAAAK
                     KVVDALGDIEGEGFRHPVTRESFAPFSLRVVAAFLPLYVGAPMEAQKKLYALLEECLR
                     HERQCGAANSEARIPAAVGGDAVEQSAAPPALQRTWTRRVLRVQRALLHVHIHMNQQS
                     LAHSLAEQVLRTEEIWHDKCHDLSDELHQLRHALHLQQLFCLALHIGDASRAQATHAA
                     IQKIAAANGADSSTEAASSNVVSNANLCKLVVLSCDAFMAVFRGEFRDAVRLFRDVID
                     AAADMKQALRAAADGSGTDVPCSPDSDGFISEDALRRWVLQDICANAQVSHATCQAYC
                     SDADPTKLMSSLCTTLEGYAKAEPQVLCNSDAFVESLVRFYTLSGDRKANLNGLADLL
                     EVFRCDRMSLPNLEALV"
     gene            <639175..>640899
                     /locus_tag="LMJF_26_1760"
                     /db_xref="GeneID:5652905"
     mRNA            <639175..>640899
                     /locus_tag="LMJF_26_1760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684129.1"
                     /db_xref="GeneID:5652905"
     CDS             639175..640899
                     /locus_tag="LMJF_26_1760"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684181.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652905"
                     /db_xref="UniProtKB/TrEMBL:Q4Q917"
                     /translation="MLTTAVMDDCRQGRQDRCNTQDTATVTGCTVQRARHALSPSLRV
                     KACSPRQPCSANIVNSGIKSQTRAAILLLLVSSLLLPPSTNDSIRCLVLHGLHSASMI
                     RLSQPLRRSIDGRRRESNSSQSSKVSMASRRLSCRSHEASALFSTAPAARCANTAPPG
                     PAELPDAEVTSAVSLPSLRSCTAEAYKVSDLRSVHPPQQLTSPFLATAVDFVGTAAAV
                     TDTVESYADGRTKEPSSPRKISTSHYACLHALFNGTNRQPCMSKSAQRLFTSAEVSTL
                     RSEAQQTYARRKRTEEQKELIAAEAEARSLLAEGALDQIAAVRELQEEERVSRMRAVS
                     AAALPVQYLEQRIRRRIDEEYAQQDAQLRQEGRDAWRLRVELETAASVDASMHEVERR
                     AAAHRFRAALTFIIVQEMELRKLVEAESAKFWETFAQEEAEGKADAEHRALVRFLNTP
                     EQLALAAAREKRERRRALRTAKVLKLFKEQQEGFVKGCRHGTGGVSLFVGDAPKKVCG
                     RCRVKWDEGLGYYVSIDRTVKMHPPPPPITAAADADAKTASHAAKRAPAEAAKSGCVL
                     PPLKKMLK"
     gene            <641876..>642139
                     /locus_tag="LMJF_26_1770"
                     /db_xref="GeneID:5652906"
     mRNA            <641876..>642139
                     /locus_tag="LMJF_26_1770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684130.1"
                     /db_xref="GeneID:5652906"
     CDS             641876..642139
                     /locus_tag="LMJF_26_1770"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684182.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652906"
                     /db_xref="InterPro:IPR003117"
                     /db_xref="UniProtKB/TrEMBL:Q4Q916"
                     /translation="MNQCHEIIEADKAYLEEVGMRNILQQFVADAMESRPGNVYEYMM
                     TWATKVQESSISLLKGIGHSSEEEEDPAAKTHPAASDHREHDT"
     gene            <643203..>644348
                     /locus_tag="LMJF_26_1755"
                     /db_xref="GeneID:5652907"
     mRNA            <643203..>644348
                     /locus_tag="LMJF_26_1755"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684131.1"
                     /db_xref="GeneID:5652907"
     CDS             643203..644348
                     /locus_tag="LMJF_26_1755"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684183.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1755"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1755"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652907"
                     /db_xref="UniProtKB/TrEMBL:Q4Q915"
                     /translation="MSASTLPNREGLGVSPAREVVGIRGPFASTPKAAATDSTSEEGA
                     GAPSECDAATAGVSKGSAFEVRVKSTGHHERRRPRCCSDASGTLQTARSERSSCARQD
                     NVTDTDASATAPATCMKTQNITSETAGRGPLHSSAESTTTPSLLEHHVQDALQHSSYS
                     DGENASVPASAANTVNSIGCTEVPPTTAVTIWVPTQFTTAAGRAICLRERRLLTAASP
                     YWRLLCFDPAREAIVAPPGSSADECDHDEEAVLGDAGELSDTMPTAKNAAEQLPADAA
                     AAALRGAIGESCCAGTVSAASPLTSTYAGYAWVHRCVRRRRAASCPERVLGSWSYASV
                     GRDADYSLPLFSGFCAADGRPFYCHYPSASAEGQDRQQRRSGSAEGA"
     gene            <645072..>645710
                     /locus_tag="LMJF_26_1780"
                     /db_xref="GeneID:5652908"
     mRNA            <645072..>645710
                     /locus_tag="LMJF_26_1780"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684132.1"
                     /db_xref="GeneID:5652908"
     CDS             645072..645710
                     /locus_tag="LMJF_26_1780"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684184.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5652908"
                     /db_xref="UniProtKB/TrEMBL:Q4Q914"
                     /translation="MGSTPNVVSSPEAHSHPSDTRDALQEALTNFVTDSMYDRPQDIL
                     EYMVTWARKQLLQKQGRGEAVTAQDAKVPRLSISPTGITSVIQAPVFMETAAEADPAP
                     EAEAANRLRHLAENRQKRYRDIAQGCLDNYLISLEDSDGDLFHIDALRRKMEGTRQQA
                     MQARGDTAAIAAQLKAIEEGEGTATQRAREQAALLHEYEQRWAHEALDKCRA"
     gene            646921..646989
                     /gene="LM26Cs1H1.1"
                     /locus_tag="LMJF_26_snoRNA0477"
                     /db_xref="GeneID:12981819"
     ncRNA           646921..646989
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H1.1"
                     /locus_tag="LMJF_26_snoRNA0477"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460651.1"
                     /db_xref="GeneID:12981819"
     gene            647036..647116
                     /gene="LM26Cs1H2.1"
                     /locus_tag="LMJF_26_snoRNA0454"
                     /db_xref="GeneID:12981875"
     ncRNA           647036..647116
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H2.1"
                     /locus_tag="LMJF_26_snoRNA0454"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460628.1"
                     /db_xref="GeneID:12981875"
     gene            647160..647258
                     /gene="LM26Cs1C1.1"
                     /locus_tag="LMJF_26_snoRNA0600"
                     /db_xref="GeneID:12981893"
     ncRNA           647160..647258
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C1.1"
                     /locus_tag="LMJF_26_snoRNA0600"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460774.1"
                     /db_xref="GeneID:12981893"
     gene            647313..647390
                     /gene="LM26Cs1C2.1"
                     /locus_tag="LMJF_26_snoRNA0495"
                     /db_xref="GeneID:12981823"
     ncRNA           647313..647390
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C2.1"
                     /locus_tag="LMJF_26_snoRNA0495"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460669.1"
                     /db_xref="GeneID:12981823"
     gene            647446..647530
                     /gene="LM26Cs1H3.1"
                     /locus_tag="LMJF_26_snoRNA0436"
                     /db_xref="GeneID:12981840"
     ncRNA           647446..647530
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H3.1"
                     /locus_tag="LMJF_26_snoRNA0436"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460610.1"
                     /db_xref="GeneID:12981840"
     gene            647560..647627
                     /gene="LM26Cs1H4.1"
                     /locus_tag="LMJF_26_snoRNA0582"
                     /db_xref="GeneID:12981911"
     ncRNA           647560..647627
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H4.1"
                     /locus_tag="LMJF_26_snoRNA0582"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460756.1"
                     /db_xref="GeneID:12981911"
     gene            647639..647719
                     /gene="LM26Cs1H5.1"
                     /locus_tag="LMJF_26_snoRNA0564"
                     /db_xref="GeneID:12981929"
     ncRNA           647639..647719
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H5.1"
                     /locus_tag="LMJF_26_snoRNA0564"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460738.1"
                     /db_xref="GeneID:12981929"
     gene            647788..647857
                     /gene="LM26Cs1H6.1"
                     /locus_tag="LMJF_26_snoRNA0547"
                     /db_xref="GeneID:12981947"
     ncRNA           647788..647857
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H6.1"
                     /locus_tag="LMJF_26_snoRNA0547"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460721.1"
                     /db_xref="GeneID:12981947"
     gene            647911..647984
                     /gene="LM26Cs1H7.1"
                     /locus_tag="LMJF_26_snoRNA0617"
                     /db_xref="GeneID:12981965"
     ncRNA           647911..647984
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H7.1"
                     /locus_tag="LMJF_26_snoRNA0617"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460790.1"
                     /db_xref="GeneID:12981965"
     gene            648009..648074
                     /gene="LM26Cs1H8.1"
                     /locus_tag="LMJF_26_snoRNA0530"
                     /db_xref="GeneID:12981982"
     ncRNA           648009..648074
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H8.1"
                     /locus_tag="LMJF_26_snoRNA0530"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460704.1"
                     /db_xref="GeneID:12981982"
     gene            648269..648387
                     /gene="LM26Cs1C3.1"
                     /locus_tag="LMJF_26_snoRNA0417"
                     /db_xref="GeneID:12981999"
     ncRNA           648269..648387
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C3.1"
                     /locus_tag="LMJF_26_snoRNA0417"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460591.1"
                     /db_xref="GeneID:12981999"
     gene            648436..648505
                     /gene="LM26Cs1H9.1"
                     /locus_tag="LMJF_26_snoRNA0513"
                     /db_xref="GeneID:12981858"
     ncRNA           648436..648505
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H9.1"
                     /locus_tag="LMJF_26_snoRNA0513"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460687.1"
                     /db_xref="GeneID:12981858"
     gene            648570..648638
                     /gene="LM26Cs1H1.2"
                     /locus_tag="LMJF_26_snoRNA0478"
                     /db_xref="GeneID:12982016"
     ncRNA           648570..648638
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H1.2"
                     /locus_tag="LMJF_26_snoRNA0478"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460652.1"
                     /db_xref="GeneID:12982016"
     gene            648685..648765
                     /gene="LM26Cs1H2.2"
                     /locus_tag="LMJF_26_snoRNA0455"
                     /db_xref="GeneID:12981885"
     ncRNA           648685..648765
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H2.2"
                     /locus_tag="LMJF_26_snoRNA0455"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460629.1"
                     /db_xref="GeneID:12981885"
     gene            648809..648907
                     /gene="LM26Cs1C1.2"
                     /locus_tag="LMJF_26_snoRNA0601"
                     /db_xref="GeneID:12981903"
     ncRNA           648809..648907
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C1.2"
                     /locus_tag="LMJF_26_snoRNA0601"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460775.1"
                     /db_xref="GeneID:12981903"
     gene            648962..649039
                     /gene="LM26Cs1C2.2"
                     /locus_tag="LMJF_26_snoRNA0496"
                     /db_xref="GeneID:12981832"
     ncRNA           648962..649039
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C2.2"
                     /locus_tag="LMJF_26_snoRNA0496"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460670.1"
                     /db_xref="GeneID:12981832"
     gene            649113..649197
                     /gene="LM26Cs1H3.2"
                     /locus_tag="LMJF_26_snoRNA0437"
                     /db_xref="GeneID:12981850"
     ncRNA           649113..649197
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H3.2"
                     /locus_tag="LMJF_26_snoRNA0437"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460611.1"
                     /db_xref="GeneID:12981850"
     gene            649227..649294
                     /gene="LM26Cs1H4.2"
                     /locus_tag="LMJF_26_snoRNA0583"
                     /db_xref="GeneID:12981921"
     ncRNA           649227..649294
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H4.2"
                     /locus_tag="LMJF_26_snoRNA0583"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460757.1"
                     /db_xref="GeneID:12981921"
     gene            649306..649386
                     /gene="LM26Cs1H5.2"
                     /locus_tag="LMJF_26_snoRNA0565"
                     /db_xref="GeneID:12981939"
     ncRNA           649306..649386
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H5.2"
                     /locus_tag="LMJF_26_snoRNA0565"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460739.1"
                     /db_xref="GeneID:12981939"
     gene            649455..649524
                     /gene="LM26Cs1H6.2"
                     /locus_tag="LMJF_26_snoRNA0548"
                     /db_xref="GeneID:12981957"
     ncRNA           649455..649524
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H6.2"
                     /locus_tag="LMJF_26_snoRNA0548"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460722.1"
                     /db_xref="GeneID:12981957"
     gene            649578..649651
                     /gene="LM26Cs1H7.2"
                     /locus_tag="LMJF_26_snoRNA0618"
                     /db_xref="GeneID:12981974"
     ncRNA           649578..649651
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H7.2"
                     /locus_tag="LMJF_26_snoRNA0618"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460791.1"
                     /db_xref="GeneID:12981974"
     gene            649676..649741
                     /gene="LM26Cs1H8.2"
                     /locus_tag="LMJF_26_snoRNA0531"
                     /db_xref="GeneID:12981991"
     ncRNA           649676..649741
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H8.2"
                     /locus_tag="LMJF_26_snoRNA0531"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460705.1"
                     /db_xref="GeneID:12981991"
     gene            649936..650054
                     /gene="LM26Cs1C3.2"
                     /locus_tag="LMJF_26_snoRNA0418"
                     /db_xref="GeneID:12982008"
     ncRNA           649936..650054
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C3.2"
                     /locus_tag="LMJF_26_snoRNA0418"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460592.1"
                     /db_xref="GeneID:12982008"
     gene            650103..650172
                     /gene="LM26Cs1H9.2"
                     /locus_tag="LMJF_26_snoRNA0514"
                     /db_xref="GeneID:12981867"
     ncRNA           650103..650172
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H9.2"
                     /locus_tag="LMJF_26_snoRNA0514"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460688.1"
                     /db_xref="GeneID:12981867"
     gene            650237..650305
                     /gene="LM26Cs1H1.3"
                     /locus_tag="LMJF_26_snoRNA0479"
                     /db_xref="GeneID:12982025"
     ncRNA           650237..650305
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H1.3"
                     /locus_tag="LMJF_26_snoRNA0479"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460653.1"
                     /db_xref="GeneID:12982025"
     gene            650352..650432
                     /gene="LM26Cs1H2.3"
                     /locus_tag="LMJF_26_snoRNA0456"
                     /db_xref="GeneID:12981886"
     ncRNA           650352..650432
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H2.3"
                     /locus_tag="LMJF_26_snoRNA0456"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460630.1"
                     /db_xref="GeneID:12981886"
     gene            650482..650580
                     /gene="LM26Cs1C1.3"
                     /locus_tag="LMJF_26_snoRNA0602"
                     /db_xref="GeneID:12981904"
     ncRNA           650482..650580
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C1.3"
                     /locus_tag="LMJF_26_snoRNA0602"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460776.1"
                     /db_xref="GeneID:12981904"
     gene            650635..650712
                     /gene="LM26Cs1C2.3"
                     /locus_tag="LMJF_26_snoRNA0497"
                     /db_xref="GeneID:12981833"
     ncRNA           650635..650712
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C2.3"
                     /locus_tag="LMJF_26_snoRNA0497"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460671.1"
                     /db_xref="GeneID:12981833"
     gene            650777..650861
                     /gene="LM26Cs1H3.3"
                     /locus_tag="LMJF_26_snoRNA0438"
                     /db_xref="GeneID:12981851"
     ncRNA           650777..650861
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H3.3"
                     /locus_tag="LMJF_26_snoRNA0438"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460612.1"
                     /db_xref="GeneID:12981851"
     gene            650891..650958
                     /gene="LM26Cs1H4.3"
                     /locus_tag="LMJF_26_snoRNA0584"
                     /db_xref="GeneID:12981922"
     ncRNA           650891..650958
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H4.3"
                     /locus_tag="LMJF_26_snoRNA0584"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460758.1"
                     /db_xref="GeneID:12981922"
     gene            650970..651050
                     /gene="LM26Cs1H5.3"
                     /locus_tag="LMJF_26_snoRNA0566"
                     /db_xref="GeneID:12981940"
     ncRNA           650970..651050
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H5.3"
                     /locus_tag="LMJF_26_snoRNA0566"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460740.1"
                     /db_xref="GeneID:12981940"
     gene            651119..651188
                     /gene="LM26Cs1H6.3"
                     /locus_tag="LMJF_26_snoRNA0549"
                     /db_xref="GeneID:12981958"
     ncRNA           651119..651188
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H6.3"
                     /locus_tag="LMJF_26_snoRNA0549"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460723.1"
                     /db_xref="GeneID:12981958"
     gene            651242..651315
                     /gene="LM26Cs1H7.3"
                     /locus_tag="LMJF_26_snoRNA0619"
                     /db_xref="GeneID:12981975"
     ncRNA           651242..651315
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H7.3"
                     /locus_tag="LMJF_26_snoRNA0619"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460792.1"
                     /db_xref="GeneID:12981975"
     gene            651340..651405
                     /gene="LM26Cs1H8.3"
                     /locus_tag="LMJF_26_snoRNA0532"
                     /db_xref="GeneID:12981992"
     ncRNA           651340..651405
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H8.3"
                     /locus_tag="LMJF_26_snoRNA0532"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460706.1"
                     /db_xref="GeneID:12981992"
     gene            651600..651718
                     /gene="LM26Cs1C3.3"
                     /locus_tag="LMJF_26_snoRNA0419"
                     /db_xref="GeneID:12982009"
     ncRNA           651600..651718
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C3.3"
                     /locus_tag="LMJF_26_snoRNA0419"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460593.1"
                     /db_xref="GeneID:12982009"
     gene            651767..651836
                     /gene="LM26Cs1H9.3"
                     /locus_tag="LMJF_26_snoRNA0515"
                     /db_xref="GeneID:12981868"
     ncRNA           651767..651836
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H9.3"
                     /locus_tag="LMJF_26_snoRNA0515"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460689.1"
                     /db_xref="GeneID:12981868"
     gene            651901..651969
                     /gene="LM26Cs1H1.4"
                     /locus_tag="LMJF_26_snoRNA0480"
                     /db_xref="GeneID:12982026"
     ncRNA           651901..651969
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H1.4"
                     /locus_tag="LMJF_26_snoRNA0480"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460654.1"
                     /db_xref="GeneID:12982026"
     gene            652016..652096
                     /gene="LM26Cs1H2.4"
                     /locus_tag="LMJF_26_snoRNA0457"
                     /db_xref="GeneID:12981887"
     ncRNA           652016..652096
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H2.4"
                     /locus_tag="LMJF_26_snoRNA0457"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460631.1"
                     /db_xref="GeneID:12981887"
     gene            652144..652242
                     /gene="LM26Cs1C1.4"
                     /locus_tag="LMJF_26_snoRNA0603"
                     /db_xref="GeneID:12981905"
     ncRNA           652144..652242
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C1.4"
                     /locus_tag="LMJF_26_snoRNA0603"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460777.1"
                     /db_xref="GeneID:12981905"
     gene            652297..652374
                     /gene="LM26Cs1C2.4"
                     /locus_tag="LMJF_26_snoRNA0498"
                     /db_xref="GeneID:12981834"
     ncRNA           652297..652374
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C2.4"
                     /locus_tag="LMJF_26_snoRNA0498"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460672.1"
                     /db_xref="GeneID:12981834"
     gene            652430..652514
                     /gene="LM26Cs1H3.4"
                     /locus_tag="LMJF_26_snoRNA0439"
                     /db_xref="GeneID:12981852"
     ncRNA           652430..652514
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H3.4"
                     /locus_tag="LMJF_26_snoRNA0439"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460613.1"
                     /db_xref="GeneID:12981852"
     gene            652544..652611
                     /gene="LM26Cs1H4.4"
                     /locus_tag="LMJF_26_snoRNA0585"
                     /db_xref="GeneID:12981923"
     ncRNA           652544..652611
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H4.4"
                     /locus_tag="LMJF_26_snoRNA0585"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460759.1"
                     /db_xref="GeneID:12981923"
     gene            652623..652703
                     /gene="LM26Cs1H5.4"
                     /locus_tag="LMJF_26_snoRNA0567"
                     /db_xref="GeneID:12981941"
     ncRNA           652623..652703
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H5.4"
                     /locus_tag="LMJF_26_snoRNA0567"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460741.1"
                     /db_xref="GeneID:12981941"
     gene            652772..652841
                     /gene="LM26Cs1H6.4"
                     /locus_tag="LMJF_26_snoRNA0550"
                     /db_xref="GeneID:12981959"
     ncRNA           652772..652841
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H6.4"
                     /locus_tag="LMJF_26_snoRNA0550"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460724.1"
                     /db_xref="GeneID:12981959"
     gene            652895..652968
                     /gene="LM26Cs1H7.4"
                     /locus_tag="LMJF_26_snoRNA0620"
                     /db_xref="GeneID:12981976"
     ncRNA           652895..652968
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H7.4"
                     /locus_tag="LMJF_26_snoRNA0620"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460793.1"
                     /db_xref="GeneID:12981976"
     gene            652993..653058
                     /gene="LM26Cs1H8.4"
                     /locus_tag="LMJF_26_snoRNA0533"
                     /db_xref="GeneID:12981993"
     ncRNA           652993..653058
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H8.4"
                     /locus_tag="LMJF_26_snoRNA0533"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460707.1"
                     /db_xref="GeneID:12981993"
     gene            653253..653371
                     /gene="LM26Cs1C3.17"
                     /locus_tag="LMJF_26_snoRNA0433"
                     /db_xref="GeneID:12982010"
     ncRNA           653253..653371
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C3.17"
                     /locus_tag="LMJF_26_snoRNA0433"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460607.1"
                     /db_xref="GeneID:12982010"
     gene            653420..653489
                     /gene="LM26Cs1H9.4"
                     /locus_tag="LMJF_26_snoRNA0516"
                     /db_xref="GeneID:12981866"
     ncRNA           653420..653489
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H9.4"
                     /locus_tag="LMJF_26_snoRNA0516"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460690.1"
                     /db_xref="GeneID:12981866"
     gene            653554..653622
                     /gene="LM26Cs1H1.5"
                     /locus_tag="LMJF_26_snoRNA0481"
                     /db_xref="GeneID:12982027"
     ncRNA           653554..653622
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H1.5"
                     /locus_tag="LMJF_26_snoRNA0481"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460655.1"
                     /db_xref="GeneID:12982027"
     gene            653669..653749
                     /gene="LM26Cs1H2.5"
                     /locus_tag="LMJF_26_snoRNA0458"
                     /db_xref="GeneID:12981888"
     ncRNA           653669..653749
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H2.5"
                     /locus_tag="LMJF_26_snoRNA0458"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460632.1"
                     /db_xref="GeneID:12981888"
     gene            653795..653893
                     /gene="LM26Cs1C1.5"
                     /locus_tag="LMJF_26_snoRNA0604"
                     /db_xref="GeneID:12981906"
     ncRNA           653795..653893
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C1.5"
                     /locus_tag="LMJF_26_snoRNA0604"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460778.1"
                     /db_xref="GeneID:12981906"
     gene            653948..654025
                     /gene="LM26Cs1C2.5"
                     /locus_tag="LMJF_26_snoRNA0499"
                     /db_xref="GeneID:12981835"
     ncRNA           653948..654025
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C2.5"
                     /locus_tag="LMJF_26_snoRNA0499"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460673.1"
                     /db_xref="GeneID:12981835"
     gene            654090..654174
                     /gene="LM26Cs1H3.5"
                     /locus_tag="LMJF_26_snoRNA0440"
                     /db_xref="GeneID:12981853"
     ncRNA           654090..654174
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H3.5"
                     /locus_tag="LMJF_26_snoRNA0440"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460614.1"
                     /db_xref="GeneID:12981853"
     gene            654204..654271
                     /gene="LM26Cs1H4.5"
                     /locus_tag="LMJF_26_snoRNA0586"
                     /db_xref="GeneID:12981924"
     ncRNA           654204..654271
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H4.5"
                     /locus_tag="LMJF_26_snoRNA0586"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460760.1"
                     /db_xref="GeneID:12981924"
     gene            654283..654363
                     /gene="LM26Cs1H5.5"
                     /locus_tag="LMJF_26_snoRNA0568"
                     /db_xref="GeneID:12981942"
     ncRNA           654283..654363
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H5.5"
                     /locus_tag="LMJF_26_snoRNA0568"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460742.1"
                     /db_xref="GeneID:12981942"
     gene            654432..654501
                     /gene="LM26Cs1H6.5"
                     /locus_tag="LMJF_26_snoRNA0551"
                     /db_xref="GeneID:12981960"
     ncRNA           654432..654501
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H6.5"
                     /locus_tag="LMJF_26_snoRNA0551"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460725.1"
                     /db_xref="GeneID:12981960"
     gene            654555..654628
                     /gene="LM26Cs1H7.5"
                     /locus_tag="LMJF_26_snoRNA0621"
                     /db_xref="GeneID:12981977"
     ncRNA           654555..654628
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H7.5"
                     /locus_tag="LMJF_26_snoRNA0621"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460794.1"
                     /db_xref="GeneID:12981977"
     gene            654653..654718
                     /gene="LM26Cs1H8.5"
                     /locus_tag="LMJF_26_snoRNA0534"
                     /db_xref="GeneID:12981994"
     ncRNA           654653..654718
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H8.5"
                     /locus_tag="LMJF_26_snoRNA0534"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460708.1"
                     /db_xref="GeneID:12981994"
     gene            654913..655031
                     /gene="LM26Cs1C3.4"
                     /locus_tag="LMJF_26_snoRNA0420"
                     /db_xref="GeneID:12982011"
     ncRNA           654913..655031
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C3.4"
                     /locus_tag="LMJF_26_snoRNA0420"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460594.1"
                     /db_xref="GeneID:12982011"
     gene            655080..655149
                     /gene="LM26Cs1H9.5"
                     /locus_tag="LMJF_26_snoRNA0517"
                     /db_xref="GeneID:12981869"
     ncRNA           655080..655149
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H9.5"
                     /locus_tag="LMJF_26_snoRNA0517"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460691.1"
                     /db_xref="GeneID:12981869"
     gene            655214..655282
                     /gene="LM26Cs1H1.6"
                     /locus_tag="LMJF_26_snoRNA0482"
                     /db_xref="GeneID:12982028"
     ncRNA           655214..655282
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H1.6"
                     /locus_tag="LMJF_26_snoRNA0482"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460656.1"
                     /db_xref="GeneID:12982028"
     gene            655329..655409
                     /gene="LM26Cs1H2.18"
                     /locus_tag="LMJF_26_snoRNA0471"
                     /db_xref="GeneID:12981889"
     ncRNA           655329..655409
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H2.18"
                     /locus_tag="LMJF_26_snoRNA0471"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460645.1"
                     /db_xref="GeneID:12981889"
     gene            655453..655551
                     /gene="LM26Cs1C1.6"
                     /locus_tag="LMJF_26_snoRNA0605"
                     /db_xref="GeneID:12981902"
     ncRNA           655453..655551
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C1.6"
                     /locus_tag="LMJF_26_snoRNA0605"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460779.1"
                     /db_xref="GeneID:12981902"
     gene            655606..655683
                     /gene="LM26Cs1C2.6"
                     /locus_tag="LMJF_26_snoRNA0500"
                     /db_xref="GeneID:12981836"
     ncRNA           655606..655683
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C2.6"
                     /locus_tag="LMJF_26_snoRNA0500"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460674.1"
                     /db_xref="GeneID:12981836"
     gene            655748..655832
                     /gene="LM26Cs1H3.6"
                     /locus_tag="LMJF_26_snoRNA0441"
                     /db_xref="GeneID:12981854"
     ncRNA           655748..655832
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H3.6"
                     /locus_tag="LMJF_26_snoRNA0441"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460615.1"
                     /db_xref="GeneID:12981854"
     gene            655862..655929
                     /gene="LM26Cs1H4.6"
                     /locus_tag="LMJF_26_snoRNA0587"
                     /db_xref="GeneID:12981925"
     ncRNA           655862..655929
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H4.6"
                     /locus_tag="LMJF_26_snoRNA0587"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460761.1"
                     /db_xref="GeneID:12981925"
     gene            655941..656021
                     /gene="LM26Cs1H5.6"
                     /locus_tag="LMJF_26_snoRNA0569"
                     /db_xref="GeneID:12981943"
     ncRNA           655941..656021
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H5.6"
                     /locus_tag="LMJF_26_snoRNA0569"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460743.1"
                     /db_xref="GeneID:12981943"
     gene            656090..656159
                     /gene="LM26Cs1H6.6"
                     /locus_tag="LMJF_26_snoRNA0552"
                     /db_xref="GeneID:12981961"
     ncRNA           656090..656159
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H6.6"
                     /locus_tag="LMJF_26_snoRNA0552"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460726.1"
                     /db_xref="GeneID:12981961"
     gene            656213..656286
                     /gene="LM26Cs1H7.6"
                     /locus_tag="LMJF_26_snoRNA0622"
                     /db_xref="GeneID:12981978"
     ncRNA           656213..656286
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H7.6"
                     /locus_tag="LMJF_26_snoRNA0622"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460795.1"
                     /db_xref="GeneID:12981978"
     gene            656311..656376
                     /gene="LM26Cs1H8.16"
                     /locus_tag="LMJF_26_snoRNA0545"
                     /db_xref="GeneID:12981995"
     ncRNA           656311..656376
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H8.16"
                     /locus_tag="LMJF_26_snoRNA0545"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460719.1"
                     /db_xref="GeneID:12981995"
     gene            656571..656689
                     /gene="LM26Cs1C3.5"
                     /locus_tag="LMJF_26_snoRNA0421"
                     /db_xref="GeneID:12982006"
     ncRNA           656571..656689
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C3.5"
                     /locus_tag="LMJF_26_snoRNA0421"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460595.1"
                     /db_xref="GeneID:12982006"
     gene            656738..656807
                     /gene="LM26Cs1H9.6"
                     /locus_tag="LMJF_26_snoRNA0518"
                     /db_xref="GeneID:12981870"
     ncRNA           656738..656807
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H9.6"
                     /locus_tag="LMJF_26_snoRNA0518"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460692.1"
                     /db_xref="GeneID:12981870"
     gene            656872..656940
                     /gene="LM26Cs1H1.7"
                     /locus_tag="LMJF_26_snoRNA0483"
                     /db_xref="GeneID:12982029"
     ncRNA           656872..656940
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H1.7"
                     /locus_tag="LMJF_26_snoRNA0483"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460657.1"
                     /db_xref="GeneID:12982029"
     gene            656987..657067
                     /gene="LM26Cs1H2.6"
                     /locus_tag="LMJF_26_snoRNA0459"
                     /db_xref="GeneID:12981890"
     ncRNA           656987..657067
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H2.6"
                     /locus_tag="LMJF_26_snoRNA0459"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460633.1"
                     /db_xref="GeneID:12981890"
     gene            657109..657207
                     /gene="LM26Cs1C1.7"
                     /locus_tag="LMJF_26_snoRNA0606"
                     /db_xref="GeneID:12981907"
     ncRNA           657109..657207
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C1.7"
                     /locus_tag="LMJF_26_snoRNA0606"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460780.1"
                     /db_xref="GeneID:12981907"
     gene            657262..657339
                     /gene="LM26Cs1C2.7"
                     /locus_tag="LMJF_26_snoRNA0501"
                     /db_xref="GeneID:12981837"
     ncRNA           657262..657339
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C2.7"
                     /locus_tag="LMJF_26_snoRNA0501"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460675.1"
                     /db_xref="GeneID:12981837"
     gene            657404..657488
                     /gene="LM26Cs1H3.7"
                     /locus_tag="LMJF_26_snoRNA0442"
                     /db_xref="GeneID:12981855"
     ncRNA           657404..657488
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H3.7"
                     /locus_tag="LMJF_26_snoRNA0442"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460616.1"
                     /db_xref="GeneID:12981855"
     gene            657518..657585
                     /gene="LM26Cs1H4.7"
                     /locus_tag="LMJF_26_snoRNA0588"
                     /db_xref="GeneID:12981926"
     ncRNA           657518..657585
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H4.7"
                     /locus_tag="LMJF_26_snoRNA0588"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460762.1"
                     /db_xref="GeneID:12981926"
     gene            657597..657677
                     /gene="LM26Cs1H5.7"
                     /locus_tag="LMJF_26_snoRNA0570"
                     /db_xref="GeneID:12981944"
     ncRNA           657597..657677
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H5.7"
                     /locus_tag="LMJF_26_snoRNA0570"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460744.1"
                     /db_xref="GeneID:12981944"
     gene            657746..657815
                     /gene="LM26Cs1H6.7"
                     /locus_tag="LMJF_26_snoRNA0553"
                     /db_xref="GeneID:12981962"
     ncRNA           657746..657815
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H6.7"
                     /locus_tag="LMJF_26_snoRNA0553"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460727.1"
                     /db_xref="GeneID:12981962"
     gene            657869..657942
                     /gene="LM26Cs1H7.7"
                     /locus_tag="LMJF_26_snoRNA0623"
                     /db_xref="GeneID:12981979"
     ncRNA           657869..657942
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H7.7"
                     /locus_tag="LMJF_26_snoRNA0623"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460796.1"
                     /db_xref="GeneID:12981979"
     gene            657967..658032
                     /gene="LM26Cs1H8.6"
                     /locus_tag="LMJF_26_snoRNA0535"
                     /db_xref="GeneID:12981996"
     ncRNA           657967..658032
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H8.6"
                     /locus_tag="LMJF_26_snoRNA0535"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460709.1"
                     /db_xref="GeneID:12981996"
     gene            658227..658345
                     /gene="LM26Cs1C3.6"
                     /locus_tag="LMJF_26_snoRNA0422"
                     /db_xref="GeneID:12982012"
     ncRNA           658227..658345
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C3.6"
                     /locus_tag="LMJF_26_snoRNA0422"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460596.1"
                     /db_xref="GeneID:12982012"
     gene            658394..658463
                     /gene="LM26Cs1H9.7"
                     /locus_tag="LMJF_26_snoRNA0519"
                     /db_xref="GeneID:12981871"
     ncRNA           658394..658463
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H9.7"
                     /locus_tag="LMJF_26_snoRNA0519"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460693.1"
                     /db_xref="GeneID:12981871"
     gene            658528..658596
                     /gene="LM26Cs1H1.8"
                     /locus_tag="LMJF_26_snoRNA0484"
                     /db_xref="GeneID:12982030"
     ncRNA           658528..658596
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H1.8"
                     /locus_tag="LMJF_26_snoRNA0484"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460658.1"
                     /db_xref="GeneID:12982030"
     gene            658643..658723
                     /gene="LM26Cs1H2.7"
                     /locus_tag="LMJF_26_snoRNA0460"
                     /db_xref="GeneID:12981891"
     ncRNA           658643..658723
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H2.7"
                     /locus_tag="LMJF_26_snoRNA0460"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460634.1"
                     /db_xref="GeneID:12981891"
     gene            658767..658865
                     /gene="LM26Cs1C1.8"
                     /locus_tag="LMJF_26_snoRNA0607"
                     /db_xref="GeneID:12981908"
     ncRNA           658767..658865
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C1.8"
                     /locus_tag="LMJF_26_snoRNA0607"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460781.1"
                     /db_xref="GeneID:12981908"
     gene            658920..658997
                     /gene="LM26Cs1C2.18"
                     /locus_tag="LMJF_26_snoRNA0512"
                     /db_xref="GeneID:12981838"
     ncRNA           658920..658997
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C2.18"
                     /locus_tag="LMJF_26_snoRNA0512"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460686.1"
                     /db_xref="GeneID:12981838"
     gene            659062..659146
                     /gene="LM26Cs1H3.8"
                     /locus_tag="LMJF_26_snoRNA0443"
                     /db_xref="GeneID:12981849"
     ncRNA           659062..659146
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H3.8"
                     /locus_tag="LMJF_26_snoRNA0443"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460617.1"
                     /db_xref="GeneID:12981849"
     gene            659176..659243
                     /gene="LM26Cs1H4.8"
                     /locus_tag="LMJF_26_snoRNA0589"
                     /db_xref="GeneID:12981927"
     ncRNA           659176..659243
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H4.8"
                     /locus_tag="LMJF_26_snoRNA0589"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460763.1"
                     /db_xref="GeneID:12981927"
     gene            659255..659335
                     /gene="LM26Cs1H5.8"
                     /locus_tag="LMJF_26_snoRNA0571"
                     /db_xref="GeneID:12981945"
     ncRNA           659255..659335
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H5.8"
                     /locus_tag="LMJF_26_snoRNA0571"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460745.1"
                     /db_xref="GeneID:12981945"
     gene            659404..659473
                     /gene="LM26Cs1H6.8"
                     /locus_tag="LMJF_26_snoRNA0554"
                     /db_xref="GeneID:12981963"
     ncRNA           659404..659473
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H6.8"
                     /locus_tag="LMJF_26_snoRNA0554"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460728.1"
                     /db_xref="GeneID:12981963"
     gene            659527..659600
                     /gene="LM26Cs1H7.8"
                     /locus_tag="LMJF_26_snoRNA0624"
                     /db_xref="GeneID:12981980"
     ncRNA           659527..659600
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H7.8"
                     /locus_tag="LMJF_26_snoRNA0624"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460797.1"
                     /db_xref="GeneID:12981980"
     gene            659625..659690
                     /gene="LM26Cs1H8.7"
                     /locus_tag="LMJF_26_snoRNA0536"
                     /db_xref="GeneID:12981997"
     ncRNA           659625..659690
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H8.7"
                     /locus_tag="LMJF_26_snoRNA0536"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460710.1"
                     /db_xref="GeneID:12981997"
     gene            659885..660003
                     /gene="LM26Cs1C3.7"
                     /locus_tag="LMJF_26_snoRNA0423"
                     /db_xref="GeneID:12982013"
     ncRNA           659885..660003
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C3.7"
                     /locus_tag="LMJF_26_snoRNA0423"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460597.1"
                     /db_xref="GeneID:12982013"
     gene            660052..660121
                     /gene="LM26Cs1H9.8"
                     /locus_tag="LMJF_26_snoRNA0520"
                     /db_xref="GeneID:12981872"
     ncRNA           660052..660121
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H9.8"
                     /locus_tag="LMJF_26_snoRNA0520"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460694.1"
                     /db_xref="GeneID:12981872"
     gene            660186..660254
                     /gene="LM26Cs1H1.9"
                     /locus_tag="LMJF_26_snoRNA0485"
                     /db_xref="GeneID:12982031"
     ncRNA           660186..660254
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H1.9"
                     /locus_tag="LMJF_26_snoRNA0485"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460659.1"
                     /db_xref="GeneID:12982031"
     gene            660301..660381
                     /gene="LM26Cs1H2.8"
                     /locus_tag="LMJF_26_snoRNA0461"
                     /db_xref="GeneID:12981892"
     ncRNA           660301..660381
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H2.8"
                     /locus_tag="LMJF_26_snoRNA0461"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460635.1"
                     /db_xref="GeneID:12981892"
     gene            660425..660523
                     /gene="LM26Cs1C1.9"
                     /locus_tag="LMJF_26_snoRNA0608"
                     /db_xref="GeneID:12981909"
     ncRNA           660425..660523
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C1.9"
                     /locus_tag="LMJF_26_snoRNA0608"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460782.1"
                     /db_xref="GeneID:12981909"
     gene            660578..660655
                     /gene="LM26Cs1C2.8"
                     /locus_tag="LMJF_26_snoRNA0502"
                     /db_xref="GeneID:12981839"
     ncRNA           660578..660655
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C2.8"
                     /locus_tag="LMJF_26_snoRNA0502"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460676.1"
                     /db_xref="GeneID:12981839"
     gene            660720..660804
                     /gene="LM26Cs1H3.9"
                     /locus_tag="LMJF_26_snoRNA0444"
                     /db_xref="GeneID:12981856"
     ncRNA           660720..660804
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H3.9"
                     /locus_tag="LMJF_26_snoRNA0444"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460618.1"
                     /db_xref="GeneID:12981856"
     gene            660834..660901
                     /gene="LM26Cs1H4.9"
                     /locus_tag="LMJF_26_snoRNA0590"
                     /db_xref="GeneID:12981928"
     ncRNA           660834..660901
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H4.9"
                     /locus_tag="LMJF_26_snoRNA0590"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460764.1"
                     /db_xref="GeneID:12981928"
     gene            660913..660993
                     /gene="LM26Cs1H5.9"
                     /locus_tag="LMJF_26_snoRNA0572"
                     /db_xref="GeneID:12981946"
     ncRNA           660913..660993
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H5.9"
                     /locus_tag="LMJF_26_snoRNA0572"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460746.1"
                     /db_xref="GeneID:12981946"
     gene            661062..661131
                     /gene="LM26Cs1H6.9"
                     /locus_tag="LMJF_26_snoRNA0555"
                     /db_xref="GeneID:12981964"
     ncRNA           661062..661131
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H6.9"
                     /locus_tag="LMJF_26_snoRNA0555"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460729.1"
                     /db_xref="GeneID:12981964"
     gene            661185..661258
                     /gene="LM26Cs1H7.9"
                     /locus_tag="LMJF_26_snoRNA0625"
                     /db_xref="GeneID:12981981"
     ncRNA           661185..661258
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H7.9"
                     /locus_tag="LMJF_26_snoRNA0625"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460798.1"
                     /db_xref="GeneID:12981981"
     gene            661283..661348
                     /gene="LM26Cs1H8.8"
                     /locus_tag="LMJF_26_snoRNA0537"
                     /db_xref="GeneID:12981998"
     ncRNA           661283..661348
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H8.8"
                     /locus_tag="LMJF_26_snoRNA0537"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460711.1"
                     /db_xref="GeneID:12981998"
     gene            661543..661661
                     /gene="LM26Cs1C3.8"
                     /locus_tag="LMJF_26_snoRNA0424"
                     /db_xref="GeneID:12982014"
     ncRNA           661543..661661
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C3.8"
                     /locus_tag="LMJF_26_snoRNA0424"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460598.1"
                     /db_xref="GeneID:12982014"
     gene            661710..661779
                     /gene="LM26Cs1H9.9"
                     /locus_tag="LMJF_26_snoRNA0521"
                     /db_xref="GeneID:12981873"
     ncRNA           661710..661779
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H9.9"
                     /locus_tag="LMJF_26_snoRNA0521"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460695.1"
                     /db_xref="GeneID:12981873"
     gene            661844..661912
                     /gene="LM26Cs1H1.10"
                     /locus_tag="LMJF_26_snoRNA0486"
                     /db_xref="GeneID:12982032"
     ncRNA           661844..661912
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H1.10"
                     /locus_tag="LMJF_26_snoRNA0486"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460660.1"
                     /db_xref="GeneID:12982032"
     gene            661959..662039
                     /gene="LM26Cs1H2.9"
                     /locus_tag="LMJF_26_snoRNA0462"
                     /db_xref="GeneID:12981876"
     ncRNA           661959..662039
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H2.9"
                     /locus_tag="LMJF_26_snoRNA0462"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460636.1"
                     /db_xref="GeneID:12981876"
     gene            662083..662181
                     /gene="LM26Cs1C1.10"
                     /locus_tag="LMJF_26_snoRNA0609"
                     /db_xref="GeneID:12981910"
     ncRNA           662083..662181
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C1.10"
                     /locus_tag="LMJF_26_snoRNA0609"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460783.1"
                     /db_xref="GeneID:12981910"
     gene            662236..662313
                     /gene="LM26Cs1C2.9"
                     /locus_tag="LMJF_26_snoRNA0503"
                     /db_xref="GeneID:12981824"
     ncRNA           662236..662313
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C2.9"
                     /locus_tag="LMJF_26_snoRNA0503"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460677.1"
                     /db_xref="GeneID:12981824"
     gene            662378..662462
                     /gene="LM26Cs1H3.10"
                     /locus_tag="LMJF_26_snoRNA0445"
                     /db_xref="GeneID:12981857"
     ncRNA           662378..662462
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H3.10"
                     /locus_tag="LMJF_26_snoRNA0445"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460619.1"
                     /db_xref="GeneID:12981857"
     gene            662492..662559
                     /gene="LM26Cs1H4.10"
                     /locus_tag="LMJF_26_snoRNA0591"
                     /db_xref="GeneID:12981912"
     ncRNA           662492..662559
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H4.10"
                     /locus_tag="LMJF_26_snoRNA0591"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460765.1"
                     /db_xref="GeneID:12981912"
     gene            662571..662651
                     /gene="LM26Cs1H5.10"
                     /locus_tag="LMJF_26_snoRNA0573"
                     /db_xref="GeneID:12981930"
     ncRNA           662571..662651
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H5.10"
                     /locus_tag="LMJF_26_snoRNA0573"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460747.1"
                     /db_xref="GeneID:12981930"
     gene            662720..662789
                     /gene="LM26Cs1H6.10"
                     /locus_tag="LMJF_26_snoRNA0556"
                     /db_xref="GeneID:12981948"
     ncRNA           662720..662789
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H6.10"
                     /locus_tag="LMJF_26_snoRNA0556"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460730.1"
                     /db_xref="GeneID:12981948"
     gene            662843..662916
                     /gene="LM26Cs1H7.10"
                     /locus_tag="LMJF_26_snoRNA0626"
                     /db_xref="GeneID:12981966"
     ncRNA           662843..662916
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H7.10"
                     /locus_tag="LMJF_26_snoRNA0626"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460799.1"
                     /db_xref="GeneID:12981966"
     gene            662941..663006
                     /gene="LM26Cs1H8.9"
                     /locus_tag="LMJF_26_snoRNA0538"
                     /db_xref="GeneID:12981983"
     ncRNA           662941..663006
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H8.9"
                     /locus_tag="LMJF_26_snoRNA0538"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460712.1"
                     /db_xref="GeneID:12981983"
     gene            663201..663319
                     /gene="LM26Cs1C3.9"
                     /locus_tag="LMJF_26_snoRNA0425"
                     /db_xref="GeneID:12982015"
     ncRNA           663201..663319
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C3.9"
                     /locus_tag="LMJF_26_snoRNA0425"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460599.1"
                     /db_xref="GeneID:12982015"
     gene            663368..663437
                     /gene="LM26Cs1H9.10"
                     /locus_tag="LMJF_26_snoRNA0522"
                     /db_xref="GeneID:12981874"
     ncRNA           663368..663437
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H9.10"
                     /locus_tag="LMJF_26_snoRNA0522"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460696.1"
                     /db_xref="GeneID:12981874"
     gene            663502..663570
                     /gene="LM26Cs1H1.11"
                     /locus_tag="LMJF_26_snoRNA0487"
                     /db_xref="GeneID:12982017"
     ncRNA           663502..663570
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H1.11"
                     /locus_tag="LMJF_26_snoRNA0487"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460661.1"
                     /db_xref="GeneID:12982017"
     gene            663617..663697
                     /gene="LM26Cs1H2.10"
                     /locus_tag="LMJF_26_snoRNA0463"
                     /db_xref="GeneID:12981877"
     ncRNA           663617..663697
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H2.10"
                     /locus_tag="LMJF_26_snoRNA0463"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460637.1"
                     /db_xref="GeneID:12981877"
     gene            663741..663839
                     /gene="LM26Cs1C1.11"
                     /locus_tag="LMJF_26_snoRNA0610"
                     /db_xref="GeneID:12981894"
     ncRNA           663741..663839
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C1.11"
                     /locus_tag="LMJF_26_snoRNA0610"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460784.1"
                     /db_xref="GeneID:12981894"
     gene            663894..663971
                     /gene="LM26Cs1C2.10"
                     /locus_tag="LMJF_26_snoRNA0504"
                     /db_xref="GeneID:12981825"
     ncRNA           663894..663971
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C2.10"
                     /locus_tag="LMJF_26_snoRNA0504"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460678.1"
                     /db_xref="GeneID:12981825"
     gene            664036..664120
                     /gene="LM26Cs1H3.11"
                     /locus_tag="LMJF_26_snoRNA0446"
                     /db_xref="GeneID:12981841"
     ncRNA           664036..664120
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H3.11"
                     /locus_tag="LMJF_26_snoRNA0446"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460620.1"
                     /db_xref="GeneID:12981841"
     gene            664150..664217
                     /gene="LM26Cs1H4.11"
                     /locus_tag="LMJF_26_snoRNA0592"
                     /db_xref="GeneID:12981913"
     ncRNA           664150..664217
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H4.11"
                     /locus_tag="LMJF_26_snoRNA0592"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460766.1"
                     /db_xref="GeneID:12981913"
     gene            664229..664309
                     /gene="LM26Cs1H5.11"
                     /locus_tag="LMJF_26_snoRNA0574"
                     /db_xref="GeneID:12981931"
     ncRNA           664229..664309
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H5.11"
                     /locus_tag="LMJF_26_snoRNA0574"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460748.1"
                     /db_xref="GeneID:12981931"
     gene            664378..664447
                     /gene="LM26Cs1H6.11"
                     /locus_tag="LMJF_26_snoRNA0557"
                     /db_xref="GeneID:12981949"
     ncRNA           664378..664447
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H6.11"
                     /locus_tag="LMJF_26_snoRNA0557"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460731.1"
                     /db_xref="GeneID:12981949"
     gene            664501..664574
                     /gene="LM26Cs1H7.11"
                     /locus_tag="LMJF_26_snoRNA0627"
                     /db_xref="GeneID:12981967"
     ncRNA           664501..664574
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H7.11"
                     /locus_tag="LMJF_26_snoRNA0627"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460800.1"
                     /db_xref="GeneID:12981967"
     gene            664599..664664
                     /gene="LM26Cs1H8.10"
                     /locus_tag="LMJF_26_snoRNA0539"
                     /db_xref="GeneID:12981984"
     ncRNA           664599..664664
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H8.10"
                     /locus_tag="LMJF_26_snoRNA0539"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460713.1"
                     /db_xref="GeneID:12981984"
     gene            664859..664977
                     /gene="LM26Cs1C3.10"
                     /locus_tag="LMJF_26_snoRNA0426"
                     /db_xref="GeneID:12982000"
     ncRNA           664859..664977
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C3.10"
                     /locus_tag="LMJF_26_snoRNA0426"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460600.1"
                     /db_xref="GeneID:12982000"
     gene            665026..665095
                     /gene="LM26Cs1H9.11"
                     /locus_tag="LMJF_26_snoRNA0523"
                     /db_xref="GeneID:12981859"
     ncRNA           665026..665095
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H9.11"
                     /locus_tag="LMJF_26_snoRNA0523"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460697.1"
                     /db_xref="GeneID:12981859"
     gene            665160..665228
                     /gene="LM26Cs1H1.12"
                     /locus_tag="LMJF_26_snoRNA0488"
                     /db_xref="GeneID:12982018"
     ncRNA           665160..665228
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H1.12"
                     /locus_tag="LMJF_26_snoRNA0488"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460662.1"
                     /db_xref="GeneID:12982018"
     gene            665275..665355
                     /gene="LM26Cs1H2.11"
                     /locus_tag="LMJF_26_snoRNA0464"
                     /db_xref="GeneID:12981878"
     ncRNA           665275..665355
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H2.11"
                     /locus_tag="LMJF_26_snoRNA0464"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460638.1"
                     /db_xref="GeneID:12981878"
     gene            665399..665497
                     /gene="LM26Cs1C1.12"
                     /locus_tag="LMJF_26_snoRNA0611"
                     /db_xref="GeneID:12981895"
     ncRNA           665399..665497
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C1.12"
                     /locus_tag="LMJF_26_snoRNA0611"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460785.1"
                     /db_xref="GeneID:12981895"
     gene            665552..665629
                     /gene="LM26Cs1C2.11"
                     /locus_tag="LMJF_26_snoRNA0505"
                     /db_xref="GeneID:12981826"
     ncRNA           665552..665629
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C2.11"
                     /locus_tag="LMJF_26_snoRNA0505"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460679.1"
                     /db_xref="GeneID:12981826"
     gene            665694..665778
                     /gene="LM26Cs1H3.12"
                     /locus_tag="LMJF_26_snoRNA0447"
                     /db_xref="GeneID:12981842"
     ncRNA           665694..665778
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H3.12"
                     /locus_tag="LMJF_26_snoRNA0447"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460621.1"
                     /db_xref="GeneID:12981842"
     gene            665808..665875
                     /gene="LM26Cs1H4.12"
                     /locus_tag="LMJF_26_snoRNA0593"
                     /db_xref="GeneID:12981914"
     ncRNA           665808..665875
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H4.12"
                     /locus_tag="LMJF_26_snoRNA0593"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460767.1"
                     /db_xref="GeneID:12981914"
     gene            665887..665967
                     /gene="LM26Cs1H5.12"
                     /locus_tag="LMJF_26_snoRNA0575"
                     /db_xref="GeneID:12981932"
     ncRNA           665887..665967
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H5.12"
                     /locus_tag="LMJF_26_snoRNA0575"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460749.1"
                     /db_xref="GeneID:12981932"
     gene            666036..666105
                     /gene="LM26Cs1H6.12"
                     /locus_tag="LMJF_26_snoRNA0558"
                     /db_xref="GeneID:12981950"
     ncRNA           666036..666105
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H6.12"
                     /locus_tag="LMJF_26_snoRNA0558"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460732.1"
                     /db_xref="GeneID:12981950"
     gene            666159..666232
                     /gene="LM26Cs1H7.12"
                     /locus_tag="LMJF_26_snoRNA0628"
                     /db_xref="GeneID:12981968"
     ncRNA           666159..666232
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H7.12"
                     /locus_tag="LMJF_26_snoRNA0628"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460801.1"
                     /db_xref="GeneID:12981968"
     gene            666257..666322
                     /gene="LM26Cs1H8.11"
                     /locus_tag="LMJF_26_snoRNA0540"
                     /db_xref="GeneID:12981985"
     ncRNA           666257..666322
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H8.11"
                     /locus_tag="LMJF_26_snoRNA0540"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460714.1"
                     /db_xref="GeneID:12981985"
     gene            666517..666635
                     /gene="LM26Cs1C3.11"
                     /locus_tag="LMJF_26_snoRNA0427"
                     /db_xref="GeneID:12982001"
     ncRNA           666517..666635
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C3.11"
                     /locus_tag="LMJF_26_snoRNA0427"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460601.1"
                     /db_xref="GeneID:12982001"
     gene            666684..666753
                     /gene="LM26Cs1H9.12"
                     /locus_tag="LMJF_26_snoRNA0524"
                     /db_xref="GeneID:12981860"
     ncRNA           666684..666753
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H9.12"
                     /locus_tag="LMJF_26_snoRNA0524"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460698.1"
                     /db_xref="GeneID:12981860"
     gene            666818..666886
                     /gene="LM26Cs1H1.13"
                     /locus_tag="LMJF_26_snoRNA0489"
                     /db_xref="GeneID:12982019"
     ncRNA           666818..666886
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H1.13"
                     /locus_tag="LMJF_26_snoRNA0489"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460663.1"
                     /db_xref="GeneID:12982019"
     gene            666933..667013
                     /gene="LM26Cs1H2.12"
                     /locus_tag="LMJF_26_snoRNA0465"
                     /db_xref="GeneID:12981879"
     ncRNA           666933..667013
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H2.12"
                     /locus_tag="LMJF_26_snoRNA0465"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460639.1"
                     /db_xref="GeneID:12981879"
     gene            667057..667155
                     /gene="LM26Cs1C1.13"
                     /locus_tag="LMJF_26_snoRNA0612"
                     /db_xref="GeneID:12981896"
     ncRNA           667057..667155
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C1.13"
                     /locus_tag="LMJF_26_snoRNA0612"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460786.1"
                     /db_xref="GeneID:12981896"
     gene            667210..667287
                     /gene="LM26Cs1C2.12"
                     /locus_tag="LMJF_26_snoRNA0506"
                     /db_xref="GeneID:12981827"
     ncRNA           667210..667287
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C2.12"
                     /locus_tag="LMJF_26_snoRNA0506"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460680.1"
                     /db_xref="GeneID:12981827"
     gene            667352..667436
                     /gene="LM26Cs1H3.13"
                     /locus_tag="LMJF_26_snoRNA0448"
                     /db_xref="GeneID:12981843"
     ncRNA           667352..667436
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H3.13"
                     /locus_tag="LMJF_26_snoRNA0448"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460622.1"
                     /db_xref="GeneID:12981843"
     gene            667466..667533
                     /gene="LM26Cs1H4.13"
                     /locus_tag="LMJF_26_snoRNA0594"
                     /db_xref="GeneID:12981915"
     ncRNA           667466..667533
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H4.13"
                     /locus_tag="LMJF_26_snoRNA0594"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460768.1"
                     /db_xref="GeneID:12981915"
     gene            667545..667625
                     /gene="LM26Cs1H5.13"
                     /locus_tag="LMJF_26_snoRNA0576"
                     /db_xref="GeneID:12981933"
     ncRNA           667545..667625
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H5.13"
                     /locus_tag="LMJF_26_snoRNA0576"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460750.1"
                     /db_xref="GeneID:12981933"
     gene            667694..667763
                     /gene="LM26Cs1H6.13"
                     /locus_tag="LMJF_26_snoRNA0559"
                     /db_xref="GeneID:12981951"
     ncRNA           667694..667763
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H6.13"
                     /locus_tag="LMJF_26_snoRNA0559"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460733.1"
                     /db_xref="GeneID:12981951"
     gene            667817..667890
                     /gene="LM26Cs1H7.13"
                     /locus_tag="LMJF_26_snoRNA0629"
                     /db_xref="GeneID:12981969"
     ncRNA           667817..667890
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H7.13"
                     /locus_tag="LMJF_26_snoRNA0629"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460802.1"
                     /db_xref="GeneID:12981969"
     gene            667915..667980
                     /gene="LM26Cs1H8.12"
                     /locus_tag="LMJF_26_snoRNA0541"
                     /db_xref="GeneID:12981986"
     ncRNA           667915..667980
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H8.12"
                     /locus_tag="LMJF_26_snoRNA0541"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460715.1"
                     /db_xref="GeneID:12981986"
     gene            668175..668293
                     /gene="LM26Cs1C3.12"
                     /locus_tag="LMJF_26_snoRNA0428"
                     /db_xref="GeneID:12982002"
     ncRNA           668175..668293
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C3.12"
                     /locus_tag="LMJF_26_snoRNA0428"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460602.1"
                     /db_xref="GeneID:12982002"
     gene            668342..668411
                     /gene="LM26Cs1H9.13"
                     /locus_tag="LMJF_26_snoRNA0525"
                     /db_xref="GeneID:12981861"
     ncRNA           668342..668411
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H9.13"
                     /locus_tag="LMJF_26_snoRNA0525"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460699.1"
                     /db_xref="GeneID:12981861"
     gene            668476..668544
                     /gene="LM26Cs1H1.14"
                     /locus_tag="LMJF_26_snoRNA0490"
                     /db_xref="GeneID:12982020"
     ncRNA           668476..668544
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H1.14"
                     /locus_tag="LMJF_26_snoRNA0490"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460664.1"
                     /db_xref="GeneID:12982020"
     gene            668591..668671
                     /gene="LM26Cs1H2.13"
                     /locus_tag="LMJF_26_snoRNA0466"
                     /db_xref="GeneID:12981880"
     ncRNA           668591..668671
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H2.13"
                     /locus_tag="LMJF_26_snoRNA0466"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460640.1"
                     /db_xref="GeneID:12981880"
     gene            668715..668813
                     /gene="LM26Cs1C1.14"
                     /locus_tag="LMJF_26_snoRNA0613"
                     /db_xref="GeneID:12981897"
     ncRNA           668715..668813
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C1.14"
                     /locus_tag="LMJF_26_snoRNA0613"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460787.1"
                     /db_xref="GeneID:12981897"
     gene            668868..668945
                     /gene="LM26Cs1C2.13"
                     /locus_tag="LMJF_26_snoRNA0507"
                     /db_xref="GeneID:12981828"
     ncRNA           668868..668945
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C2.13"
                     /locus_tag="LMJF_26_snoRNA0507"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460681.1"
                     /db_xref="GeneID:12981828"
     gene            669010..669094
                     /gene="LM26Cs1H3.14"
                     /locus_tag="LMJF_26_snoRNA0449"
                     /db_xref="GeneID:12981844"
     ncRNA           669010..669094
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H3.14"
                     /locus_tag="LMJF_26_snoRNA0449"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460623.1"
                     /db_xref="GeneID:12981844"
     gene            669124..669191
                     /gene="LM26Cs1H4.14"
                     /locus_tag="LMJF_26_snoRNA0595"
                     /db_xref="GeneID:12981916"
     ncRNA           669124..669191
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H4.14"
                     /locus_tag="LMJF_26_snoRNA0595"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460769.1"
                     /db_xref="GeneID:12981916"
     gene            669203..669283
                     /gene="LM26Cs1H5.14"
                     /locus_tag="LMJF_26_snoRNA0577"
                     /db_xref="GeneID:12981934"
     ncRNA           669203..669283
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H5.14"
                     /locus_tag="LMJF_26_snoRNA0577"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460751.1"
                     /db_xref="GeneID:12981934"
     gene            669352..669421
                     /gene="LM26Cs1H6.14"
                     /locus_tag="LMJF_26_snoRNA0560"
                     /db_xref="GeneID:12981952"
     ncRNA           669352..669421
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H6.14"
                     /locus_tag="LMJF_26_snoRNA0560"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460734.1"
                     /db_xref="GeneID:12981952"
     gene            669475..669548
                     /gene="LM26Cs1H7.14"
                     /locus_tag="LMJF_26_snoRNA0630"
                     /db_xref="GeneID:12981970"
     ncRNA           669475..669548
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H7.14"
                     /locus_tag="LMJF_26_snoRNA0630"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460803.1"
                     /db_xref="GeneID:12981970"
     gene            669573..669638
                     /gene="LM26Cs1H8.13"
                     /locus_tag="LMJF_26_snoRNA0542"
                     /db_xref="GeneID:12981987"
     ncRNA           669573..669638
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H8.13"
                     /locus_tag="LMJF_26_snoRNA0542"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460716.1"
                     /db_xref="GeneID:12981987"
     gene            669833..669951
                     /gene="LM26Cs1C3.13"
                     /locus_tag="LMJF_26_snoRNA0429"
                     /db_xref="GeneID:12982003"
     ncRNA           669833..669951
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C3.13"
                     /locus_tag="LMJF_26_snoRNA0429"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460603.1"
                     /db_xref="GeneID:12982003"
     gene            670000..670069
                     /gene="LM26Cs1H9.14"
                     /locus_tag="LMJF_26_snoRNA0526"
                     /db_xref="GeneID:12981862"
     ncRNA           670000..670069
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H9.14"
                     /locus_tag="LMJF_26_snoRNA0526"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460700.1"
                     /db_xref="GeneID:12981862"
     gene            670134..670202
                     /gene="LM26Cs1H1.15"
                     /locus_tag="LMJF_26_snoRNA0491"
                     /db_xref="GeneID:12982021"
     ncRNA           670134..670202
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H1.15"
                     /locus_tag="LMJF_26_snoRNA0491"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460665.1"
                     /db_xref="GeneID:12982021"
     gene            670249..670329
                     /gene="LM26Cs1H2.14"
                     /locus_tag="LMJF_26_snoRNA0467"
                     /db_xref="GeneID:12981881"
     ncRNA           670249..670329
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H2.14"
                     /locus_tag="LMJF_26_snoRNA0467"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460641.1"
                     /db_xref="GeneID:12981881"
     gene            670372..670472
                     /gene="LM26Cs1C1.15"
                     /locus_tag="LMJF_26_snoRNA0157"
                     /old_locus_tag="LMJF_26_snoRNA0614"
                     /db_xref="GeneID:12981898"
     ncRNA           670372..670472
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C1.15"
                     /locus_tag="LMJF_26_snoRNA0157"
                     /old_locus_tag="LMJF_26_snoRNA0614"
                     /transcript_id="XR_002460589.1"
                     /db_xref="GeneID:12981898"
     ncRNA           670373..670471
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C1.15"
                     /locus_tag="LMJF_26_snoRNA0157"
                     /old_locus_tag="LMJF_26_snoRNA0614"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460590.1"
                     /db_xref="GeneID:12981898"
     gene            670526..670603
                     /gene="LM26Cs1C2.14"
                     /locus_tag="LMJF_26_snoRNA0508"
                     /db_xref="GeneID:12981829"
     ncRNA           670526..670603
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C2.14"
                     /locus_tag="LMJF_26_snoRNA0508"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460682.1"
                     /db_xref="GeneID:12981829"
     gene            670668..670752
                     /gene="LM26Cs1H3.15"
                     /locus_tag="LMJF_26_snoRNA0450"
                     /db_xref="GeneID:12981845"
     ncRNA           670668..670752
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H3.15"
                     /locus_tag="LMJF_26_snoRNA0450"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460624.1"
                     /db_xref="GeneID:12981845"
     gene            670782..670849
                     /gene="LM26Cs1H4.15"
                     /locus_tag="LMJF_26_snoRNA0596"
                     /db_xref="GeneID:12981917"
     ncRNA           670782..670849
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H4.15"
                     /locus_tag="LMJF_26_snoRNA0596"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460770.1"
                     /db_xref="GeneID:12981917"
     gene            670861..670941
                     /gene="LM26Cs1H5.15"
                     /locus_tag="LMJF_26_snoRNA0578"
                     /db_xref="GeneID:12981935"
     ncRNA           670861..670941
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H5.15"
                     /locus_tag="LMJF_26_snoRNA0578"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460752.1"
                     /db_xref="GeneID:12981935"
     gene            671010..671079
                     /gene="LM26Cs1H6.15"
                     /locus_tag="LMJF_26_snoRNA0561"
                     /db_xref="GeneID:12981953"
     ncRNA           671010..671079
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H6.15"
                     /locus_tag="LMJF_26_snoRNA0561"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460735.1"
                     /db_xref="GeneID:12981953"
     gene            671133..671206
                     /gene="LM26Cs1H7.15"
                     /locus_tag="LMJF_26_snoRNA0631"
                     /db_xref="GeneID:12981971"
     ncRNA           671133..671206
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H7.15"
                     /locus_tag="LMJF_26_snoRNA0631"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460804.1"
                     /db_xref="GeneID:12981971"
     gene            671231..671296
                     /gene="LM26Cs1H8.14"
                     /locus_tag="LMJF_26_snoRNA0543"
                     /db_xref="GeneID:12981988"
     ncRNA           671231..671296
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H8.14"
                     /locus_tag="LMJF_26_snoRNA0543"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460717.1"
                     /db_xref="GeneID:12981988"
     gene            671491..671609
                     /gene="LM26Cs1C3.14"
                     /locus_tag="LMJF_26_snoRNA0430"
                     /db_xref="GeneID:12982004"
     ncRNA           671491..671609
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C3.14"
                     /locus_tag="LMJF_26_snoRNA0430"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460604.1"
                     /db_xref="GeneID:12982004"
     gene            671658..671727
                     /gene="LM26Cs1H9.15"
                     /locus_tag="LMJF_26_snoRNA0527"
                     /db_xref="GeneID:12981863"
     ncRNA           671658..671727
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H9.15"
                     /locus_tag="LMJF_26_snoRNA0527"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460701.1"
                     /db_xref="GeneID:12981863"
     gene            671792..671860
                     /gene="LM26Cs1H1.16"
                     /locus_tag="LMJF_26_snoRNA0492"
                     /db_xref="GeneID:12982022"
     ncRNA           671792..671860
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H1.16"
                     /locus_tag="LMJF_26_snoRNA0492"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460666.1"
                     /db_xref="GeneID:12982022"
     gene            671907..671987
                     /gene="LM26Cs1H2.15"
                     /locus_tag="LMJF_26_snoRNA0468"
                     /db_xref="GeneID:12981882"
     ncRNA           671907..671987
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H2.15"
                     /locus_tag="LMJF_26_snoRNA0468"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460642.1"
                     /db_xref="GeneID:12981882"
     gene            672031..672129
                     /gene="LM26Cs1C1.16"
                     /locus_tag="LMJF_26_snoRNA0615"
                     /db_xref="GeneID:12981899"
     ncRNA           672031..672129
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C1.16"
                     /locus_tag="LMJF_26_snoRNA0615"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460788.1"
                     /db_xref="GeneID:12981899"
     gene            672184..672261
                     /gene="LM26Cs1C2.15"
                     /locus_tag="LMJF_26_snoRNA0509"
                     /db_xref="GeneID:12981830"
     ncRNA           672184..672261
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C2.15"
                     /locus_tag="LMJF_26_snoRNA0509"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460683.1"
                     /db_xref="GeneID:12981830"
     gene            672326..672410
                     /gene="LM26Cs1H3.16"
                     /locus_tag="LMJF_26_snoRNA0451"
                     /db_xref="GeneID:12981846"
     ncRNA           672326..672410
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H3.16"
                     /locus_tag="LMJF_26_snoRNA0451"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460625.1"
                     /db_xref="GeneID:12981846"
     gene            672440..672507
                     /gene="LM26Cs1H4.16"
                     /locus_tag="LMJF_26_snoRNA0597"
                     /db_xref="GeneID:12981918"
     ncRNA           672440..672507
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H4.16"
                     /locus_tag="LMJF_26_snoRNA0597"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460771.1"
                     /db_xref="GeneID:12981918"
     gene            672519..672599
                     /gene="LM26Cs1H5.16"
                     /locus_tag="LMJF_26_snoRNA0579"
                     /db_xref="GeneID:12981936"
     ncRNA           672519..672599
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H5.16"
                     /locus_tag="LMJF_26_snoRNA0579"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460753.1"
                     /db_xref="GeneID:12981936"
     gene            672668..672737
                     /gene="LM26Cs1H6.16"
                     /locus_tag="LMJF_26_snoRNA0562"
                     /db_xref="GeneID:12981954"
     ncRNA           672668..672737
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H6.16"
                     /locus_tag="LMJF_26_snoRNA0562"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460736.1"
                     /db_xref="GeneID:12981954"
     gene            672791..672864
                     /gene="LM26Cs1H7.17"
                     /locus_tag="LMJF_26_snoRNA0633"
                     /db_xref="GeneID:12981972"
     ncRNA           672791..672864
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H7.17"
                     /locus_tag="LMJF_26_snoRNA0633"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460806.1"
                     /db_xref="GeneID:12981972"
     gene            672889..672954
                     /gene="LM26Cs1H8.17"
                     /locus_tag="LMJF_26_snoRNA0546"
                     /db_xref="GeneID:12981990"
     ncRNA           672889..672954
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H8.17"
                     /locus_tag="LMJF_26_snoRNA0546"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460720.1"
                     /db_xref="GeneID:12981990"
     gene            673149..673267
                     /gene="LM26Cs1C3.15"
                     /locus_tag="LMJF_26_snoRNA0431"
                     /db_xref="GeneID:12982007"
     ncRNA           673149..673267
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C3.15"
                     /locus_tag="LMJF_26_snoRNA0431"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460605.1"
                     /db_xref="GeneID:12982007"
     gene            673316..673385
                     /gene="LM26Cs1H9.16"
                     /locus_tag="LMJF_26_snoRNA0528"
                     /db_xref="GeneID:12981864"
     ncRNA           673316..673385
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H9.16"
                     /locus_tag="LMJF_26_snoRNA0528"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460702.1"
                     /db_xref="GeneID:12981864"
     gene            673450..673518
                     /gene="LM26Cs1H1.17"
                     /locus_tag="LMJF_26_snoRNA0493"
                     /db_xref="GeneID:12982023"
     ncRNA           673450..673518
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H1.17"
                     /locus_tag="LMJF_26_snoRNA0493"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460667.1"
                     /db_xref="GeneID:12982023"
     gene            673565..673645
                     /gene="LM26Cs1H2.16"
                     /locus_tag="LMJF_26_snoRNA0469"
                     /db_xref="GeneID:12981883"
     ncRNA           673565..673645
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H2.16"
                     /locus_tag="LMJF_26_snoRNA0469"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460643.1"
                     /db_xref="GeneID:12981883"
     gene            673844..673921
                     /gene="LM26Cs1C2.16"
                     /locus_tag="LMJF_26_snoRNA0510"
                     /db_xref="GeneID:12981900"
     ncRNA           673844..673921
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C2.16"
                     /locus_tag="LMJF_26_snoRNA0510"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460684.1"
                     /db_xref="GeneID:12981900"
     gene            673986..674070
                     /gene="LM26Cs1H3.17"
                     /locus_tag="LMJF_26_snoRNA0452"
                     /db_xref="GeneID:12981847"
     ncRNA           673986..674070
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H3.17"
                     /locus_tag="LMJF_26_snoRNA0452"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460626.1"
                     /db_xref="GeneID:12981847"
     gene            674100..674167
                     /gene="LM26Cs1H4.17"
                     /locus_tag="LMJF_26_snoRNA0598"
                     /db_xref="GeneID:12981919"
     ncRNA           674100..674167
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H4.17"
                     /locus_tag="LMJF_26_snoRNA0598"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460772.1"
                     /db_xref="GeneID:12981919"
     gene            674179..674259
                     /gene="LM26Cs1H5.17"
                     /locus_tag="LMJF_26_snoRNA0580"
                     /db_xref="GeneID:12981937"
     ncRNA           674179..674259
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H5.17"
                     /locus_tag="LMJF_26_snoRNA0580"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460754.1"
                     /db_xref="GeneID:12981937"
     gene            674328..674397
                     /gene="LM26Cs1H6.17"
                     /locus_tag="LMJF_26_snoRNA0563"
                     /db_xref="GeneID:12981955"
     ncRNA           674328..674397
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H6.17"
                     /locus_tag="LMJF_26_snoRNA0563"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460737.1"
                     /db_xref="GeneID:12981955"
     gene            674451..674524
                     /gene="LM26Cs1H7.16"
                     /locus_tag="LMJF_26_snoRNA0632"
                     /db_xref="GeneID:12981973"
     ncRNA           674451..674524
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H7.16"
                     /locus_tag="LMJF_26_snoRNA0632"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460805.1"
                     /db_xref="GeneID:12981973"
     gene            674549..674614
                     /gene="LM26Cs1H8.15"
                     /locus_tag="LMJF_26_snoRNA0544"
                     /db_xref="GeneID:12981989"
     ncRNA           674549..674614
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H8.15"
                     /locus_tag="LMJF_26_snoRNA0544"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460718.1"
                     /db_xref="GeneID:12981989"
     gene            674809..674927
                     /gene="LM26Cs1C3.16"
                     /locus_tag="LMJF_26_snoRNA0432"
                     /db_xref="GeneID:12982005"
     ncRNA           674809..674927
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C3.16"
                     /locus_tag="LMJF_26_snoRNA0432"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460606.1"
                     /db_xref="GeneID:12982005"
     gene            674976..675045
                     /gene="LM26Cs1H9.17"
                     /locus_tag="LMJF_26_snoRNA0529"
                     /db_xref="GeneID:12981865"
     ncRNA           674976..675045
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H9.17"
                     /locus_tag="LMJF_26_snoRNA0529"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460703.1"
                     /db_xref="GeneID:12981865"
     gene            675110..675178
                     /gene="LM26Cs1H1.18"
                     /locus_tag="LMJF_26_snoRNA0494"
                     /db_xref="GeneID:12982024"
     ncRNA           675110..675178
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H1.18"
                     /locus_tag="LMJF_26_snoRNA0494"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460668.1"
                     /db_xref="GeneID:12982024"
     gene            675225..675305
                     /gene="LM26Cs1H2.17"
                     /locus_tag="LMJF_26_snoRNA0470"
                     /db_xref="GeneID:12981884"
     ncRNA           675225..675305
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H2.17"
                     /locus_tag="LMJF_26_snoRNA0470"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460644.1"
                     /db_xref="GeneID:12981884"
     gene            675349..675447
                     /gene="LM26Cs1C1.17"
                     /locus_tag="LMJF_26_snoRNA0616"
                     /db_xref="GeneID:12981901"
     ncRNA           675349..675447
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C1.17"
                     /locus_tag="LMJF_26_snoRNA0616"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460789.1"
                     /db_xref="GeneID:12981901"
     gene            675502..675579
                     /gene="LM26Cs1C2.17"
                     /locus_tag="LMJF_26_snoRNA0511"
                     /db_xref="GeneID:12981831"
     ncRNA           675502..675579
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1C2.17"
                     /locus_tag="LMJF_26_snoRNA0511"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460685.1"
                     /db_xref="GeneID:12981831"
     gene            675635..675719
                     /gene="LM26Cs1H3.18"
                     /locus_tag="LMJF_26_snoRNA0453"
                     /db_xref="GeneID:12981848"
     ncRNA           675635..675719
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H3.18"
                     /locus_tag="LMJF_26_snoRNA0453"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460627.1"
                     /db_xref="GeneID:12981848"
     gene            675749..675816
                     /gene="LM26Cs1H4.18"
                     /locus_tag="LMJF_26_snoRNA0599"
                     /db_xref="GeneID:12981920"
     ncRNA           675749..675816
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H4.18"
                     /locus_tag="LMJF_26_snoRNA0599"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460773.1"
                     /db_xref="GeneID:12981920"
     gene            675828..675908
                     /gene="LM26Cs1H5.18"
                     /locus_tag="LMJF_26_snoRNA0581"
                     /db_xref="GeneID:12981938"
     ncRNA           675828..675908
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs1H5.18"
                     /locus_tag="LMJF_26_snoRNA0581"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460755.1"
                     /db_xref="GeneID:12981938"
     gene            <676331..>677320
                     /locus_tag="LMJF_26_1785"
                     /db_xref="GeneID:12981956"
     mRNA            <676331..>677320
                     /locus_tag="LMJF_26_1785"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721758.1"
                     /db_xref="GeneID:12981956"
     CDS             676331..677320
                     /locus_tag="LMJF_26_1785"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721806.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1785"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1785"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981956"
                     /db_xref="InterPro:IPR015418"
                     /db_xref="UniProtKB/TrEMBL:E9ACT4"
                     /translation="MSRRQNGGSKSANPEQQLRQEAAIFLSPEVEDELAQILQRRESI
                     ERALQRMDVEVYDLETAFLKHCVSHGGSLFDGFGLERRDNAHRNPVAVLTPLATSSSS
                     IGGGGCAIAPLGTEAISGFSPSSPVLSTVANGEHARTYRVLSSLFGAGGASGGGNGGA
                     AADLAVASHSPTSLKAVGSVAPPSTAAAVFQVGSKGSTAPAFHYRIHFFSPSERVFSA
                     CSVGALSRVEIAKSTLAGSRGASTSSTWSTTAAAGGRGRGLGKRGRFSSGEDELRGGR
                     NGTASLSSALDRHSNAPPSRRHQRYAKEEDDVDDDGAAENGSDDRRRRRRQTE"
     gene            <678429..>686729
                     /locus_tag="LMJF_26_1790"
                     /db_xref="GeneID:5653101"
     mRNA            <678429..>686729
                     /locus_tag="LMJF_26_1790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684133.1"
                     /db_xref="GeneID:5653101"
     CDS             678429..686729
                     /locus_tag="LMJF_26_1790"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684185.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653101"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q913"
                     /translation="MTSPLASQLQRLQQRPDGSQHRLAKSFLFSTQDAQSFSREQIHQ
                     LALNGLQALTAIDNRFHPFIQDLFDVKRVRQERSMLTTTEDSTLRVRLEQFLTFLSPH
                     LFLTAAQQVFEFLVRVYEVHIYDVASVLRAFLPYHDHNIFARALLLLDLRDTGFDFLA
                     TNQLHGAPLLREHLVLACAESRKAVRLVCLTVAMPFRYEIRHHAANALFASVVTQLTT
                     HKDAEALWRTFLPFVLELLSGAVSGAEAGTEESKRARQSDNARGGSSRVSMESVATAL
                     VVLAAWSAHVRFSKAMLITMLKPIFRYTTAAAFAATSEGHHGAGVSYLPVRDLLALLE
                     IVLATQHHALSDVSVAPLLQTLLTLPWRTLASQLPFAEMTVMMAGPNGAPTASPRHSA
                     LLATLLQTALERLSSVSEARLLPSDVVEFLTCAAEDLPLSNYMVTRYLRVLMTAEAGT
                     SPAGAVGDTPARAAEGASNQSLYYRLAAALERRYAIVFDGVLSEVLLHPETTAAATAF
                     LARHFRGTRYGMVEVGSALSGATETLPLFACLLHPVAEVRALAAKTLQGMPTAQLISD
                     ASTASGSGQSLVDLLAHVISYERNCTAAEAFVATAAAVIERLAARWSSEKSMGRDELG
                     CRAACQLVRSVYSMVLAWSPSVASAASASVATRVEAQRRVVLPLVTTLLRPALLTWTR
                     GASAVTSDAQDFRTSVLYHATLLYAQWAGTPSAAMQTPGEDVAMATQVVGGLVATLEA
                     GCGGPDAVALLFRARSASNKKQGKKTVRNGSSGEKERQRVGRRCIAAAESDSDDKEQQ
                     QSQAGSSGRSGCIATGTRIACFTDLIQCDALLDAIRTEAQRRLPDAFAAARTAVREGA
                     TDLSSAAACEVEVAVALAAAVLPAIGTEKPANVLETVSAVMTFLHGGDAANDAAASET
                     AMASSATSAAADRGYLDMVYATLLDNSSGRRVAQAGRGTVDVSTAAREQLYEVPLVAR
                     VGAVLRAALTRVLARAATAAAASVSSLTSLVLQLCQGLGFVGAALPSIAAQPDVLAPA
                     YLELISSMNAVTTTAEATSGAAAALRQVDWYALVADAVFSAAGQSEVNDAPYAKPMTL
                     AALALVLFLPLRAPSTQRLAQLRALQDAVVTAGAQHDSACGGANGRTGEQVILAAAMQ
                     LQQGTSSSTSSSACSVTALSCLIECMAVEERQYQLTPSAAALVCSLLNMKNGTDGGAQ
                     AYVVPVGWAHRVVRYFFRSHNSHGGGRARAGSSAAAALLPAEITPQQVCLIEAMLPRV
                     EGILTSIESVDASSSSSTRTVTADAADLVDAVCSRLQLWGSASAKEDAVANNASVRLV
                     ELLLKHPYVHVHHGGGARPVYRYALAALVVGLSYGLEDRQSTQSTIFKSRKSASTAAS
                     RKGEYALSAEYQRLVAARLQPVVLHAIDVIGTDVALACMGTLGGYEYFFLPLVATVES
                     ATASAAGHPPVTSKAKAARGRPSQAMSTDRETASEAVAVLLKRVHEMLETLAPSTAAA
                     ADETLSAKHNGVTELAAEGEDCAASALEARWRPPASAAVANPLTFADARRVLRLPSVC
                     AAAAGGTGKWPLGALSHESLRLLRTLLRVLPTIAMDEEEDGESVFALVIECVELYPLQ
                     GMEVLLRHAASSAASDEVAMLPRVKQLRLGARGSLQVEGVLRFVETLVHVCTDQTQLL
                     SEKVTDGAHRIKSLLLREMMVLMARILVDDRSEDNSAEKDEEASAASPRRAEADTEAA
                     ERRQGELHFHVDTIAGLLRATAPLLKAPTAAAAAAVTARSSMAESSTYLHIPLVSLLI
                     KLEPFDNTEALGFRSARDVCQEILSNFDVRTQVECLGQLMRLVADPAAQLSSGANAGE
                     DGEEQQRLQHLFRRMVKPNQVTNRQEAIMHLVNLTVKSDLFLEPFLALQRHARSSQPS
                     RAAERRRQQQQQQRSERSTGADKADEKASDADEEAEEQAEGAVQREDGGCMGLLVSAL
                     ELFARYHDLHETTRSGAASESADAEAEAYTSLLELLAGNTLACVLAGINEPTFVVCQQ
                     RLLEDERAALRKIGLEVLLDRLHHSLPTLENVVSDEEMEAHRRRLRDPRQRLSLADLV
                     RIKARPLTTKRSIQLFPLLVAEIKSSVAQFHAAAQSANAAGELLTTAQLGIAAVEELI
                     RIVSSGGSLQSEKTLLNANRSKRVTEAALVKLFGNRSRVAAVHELVDLICNHWMPLLT
                     RCEMRLRSRAEQPGTDGGAYDSTAASRSGAEENVLGCMTCLVTALATITQVMGTAFAS
                     THCLHLLHTLVSAGVYQVLEMPGVVSRSEAGALLRHSTLSSMIRCFPACWQMAQPYLP
                     SMLFLVTHLRNVTDAESHYLSAEMLAVLEAVMEPQLLLDAGITCLQGLPYLNGAVVPA
                     SEQHQLANLAAEAAASASEPGKAKKGTVRVRQIRAQVHTHSFALLFTCFERRVENMSK
                     EELLHMRTLTEGTTPQQNFWLAAFQSLASAPSAPSSEAVMPVLQAFTVFLLKFKAKHS
                     VRLLRIVADWAFAESSGGVAGASRKHAAGPGDSANTAAEEEQNGRGHDGAAQSISRVT
                     LQSWIVFFALSNHLLGKLGSILDFAFPIFLPHVVTALRTYCAATATASKAMDSLVALA
                     LEGALECMRNMALAQTPGPDHDYSIQVDVYFAKADVFPGVMPALVHQLHNLHYLEDSQ
                     RDYRFRVEHNVIPAIRAFMACLGSSKLQSRTQAEVVRALRHPSRHVRREALICLDGIY
                     ADGGDELASRLMAEMLPTVVELTEDRDDAVVEEARKLCNNLSHMTGQDVLYAMS"
     gene            <687600..>688445
                     /locus_tag="LMJF_26_1800"
                     /db_xref="GeneID:5653102"
     mRNA            <687600..>688445
                     /locus_tag="LMJF_26_1800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684134.1"
                     /db_xref="GeneID:5653102"
     CDS             687600..688445
                     /locus_tag="LMJF_26_1800"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684186.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653102"
                     /db_xref="GOA:Q4Q912"
                     /db_xref="InterPro:IPR001497"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR014048"
                     /db_xref="UniProtKB/TrEMBL:Q4Q912"
                     /translation="MTAQAKLARRASKAVAASKKASKEAPCLPKSTSASPGQRAQAAS
                     ALLQSTDPVQVYLRTVPTPLGPFSLYVDADGAVRFCRWQGSAPGDAAALFTEAQEVCA
                     IIQSRWYKSTPVTVAGVSADGASELPGERAVTLMRNYFNPSTAKTGRTEELERLLLQV
                     PIIYPPTTAFMTQTWATLRHTVPSGKTISYKGLGVRVNKALNLPASAAVAPRAIGVAM
                     GANPIPVIVPCHRVLSSTNSLCGYGLGLRFKVWLLRHEQADVAADKLRVGEEETAVST
                     AASRR"
     gene            <690835..>692331
                     /locus_tag="LMJF_26_1810"
                     /db_xref="GeneID:5653103"
     mRNA            <690835..>692331
                     /locus_tag="LMJF_26_1810"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684135.1"
                     /db_xref="GeneID:5653103"
     CDS             690835..692331
                     /locus_tag="LMJF_26_1810"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684187.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653103"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q4Q911"
                     /translation="MHLPPATTANVAPPASAGSTSAAANVNPAQSCSLLLPQRADPAA
                     FTCEDCELEIRSRAKLRRHRRYYCPFRENIFADPVKDAVDLYRTQQQQQGHRQRYGSV
                     SSSCDSDEVDFAEEDTHNGDGDRTSSVDGRLGRCSRATSVPLALTEGEWYYLSHVAER
                     SGLKFVEDAYASDVSADDGLHGGMFSDTSSSSTPSRSPYRVTVAPLARRHPRSPARVR
                     GRLPSPKRTPLHGLLPSPSPSPKGRVLRSSQTTASASLLVLPNTSPLTCHTGGVNRLL
                     NVGSGTPKGESIAAEDAKGDDEDDMIGAWPPADLRHLHHHRRGSGHRRERHILQKRLR
                     AQEGALMALATDSPHRQPRKPRVARGGAPRCGSDAAVGEAEATRLHVTPSADFAHPST
                     STAAAAYSYTGPSQSLLTPQVVAQAESLLVLNWSRPRRGKDGAANAFVCPYCADYTTL
                     ASQRGLRAHAMRVHAKEVAKARVRVVETEAAPVEEGRGHESEEGKASP"
     gene            <698015..>704968
                     /locus_tag="LMJF_26_1820"
                     /db_xref="GeneID:5653104"
     mRNA            <698015..>704968
                     /locus_tag="LMJF_26_1820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684136.1"
                     /db_xref="GeneID:5653104"
     CDS             698015..704968
                     /locus_tag="LMJF_26_1820"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684188.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653104"
                     /db_xref="UniProtKB/TrEMBL:Q4Q910"
                     /translation="MYPSSRRQGGAAASVGVRSTLPRAGVSSTAMPAAHGGGEDVNGE
                     SLASNTGYYYSKHYGSDQASYYISSTYGYYNNQGEYPGGGGGSGCSTSMPYGSTSGPM
                     AGSTSSGAGANDGQSVPVYSFPYQPSSSATANPQQHPNQPSTQYQQSQRQQPPPPPQQ
                     QQQQSQYSPQQQSPYSSQTPGTEQGSSAYQSYYQQTYQPPPQQPQPRPHQFSMTASTS
                     QTLGEESQYYSYYYSSGSAQRRGNARTASGGSGAHYYNLQQQQQQHGYPPPSSGEGEA
                     LYNQGSNMPSSSQGGATEGYYQQYAQCPAYSFQGSPPSAQQQQPQPQQSPYTGGEGQS
                     SAVSASYGHAIHAASRSSQPCSTSTSAYGGESDAAQGTSAARYAGGAYGQPDNAGSNM
                     NGSEGGGVGGRGYGSGTATAAAGNGGPGVGGASASGGYYGAGYATGYSAPAPHASRTR
                     GVPYTDAGGDTGGMPLVPASGKSGQAAASGSYPSPQQGSGAEVEDGGQSYHGYAANGY
                     RDYYAAANPIGSSGISPGYTYPVGHASPQQQTIAYQASYACGEAQPGSSAAASPPAAE
                     NHQRSSGGPPQAPQQQFQRGGSFYATDPRYSGGGDSNGGSYDAHGYTPHNLQQQQQQG
                     YYRGYSGPSHPQHRADARPGGASMPVSRTSQYVSQPPETAPRRYDVAEAQGKNDRAEE
                     LARTQASDDMVPMSSVRSMGHSRSNSSGNGRGDGGVGSAAPVPSRKRGKKRGNSGTER
                     VQSAAHTEGAPEAAEKDGKHGPCGQRSAEVSTHVAPASAKSAECQWQASSQQADAPIP
                     EQTLVTREPLVSLELPSSSLNAPRPQQPPPQNAGEDSTTGRSDGVPKDAVRSQQASDR
                     CILPKGSTTAAAHDSGESSLSRTEDDADEEAEADYATETFMDSKRDTATSAMAAILVG
                     RQGAGSTGSESCRQPQQRSSSTERSAAHASSASHGSGSGSGAQSFLRPSPLTQCLGAP
                     FHTYICGAIVEQAAQLQTSACSSSATGGGSGVAAGSAGNPPASLSTAALAVRPAMYAP
                     VQRLLSREMSRGAYNAAGERDRGLARPSMDSGDVDAEEAPACGEEDEGYAHGGAEAAE
                     AAGEGSKDEGAEGGLESVHDLGGVKPATKPLTADALAAARDTSDTTAPPPRPSTTLTD
                     SSLRSIGGRPQHLHLVAHHHSHHMRRSTPASGVSSPSVPIQHHCHAYHGTSPFLQPAS
                     LAAGCTASLSAGGGAAANKYAQSPKSGSSAALPPRLPSGGGGSTPHLHRAGGGSREGS
                     GAAATMQQPPSMISYTHRYPNQPSFDLDGGRCAVVMEGASGDAEDHLQYCYQGNNTRA
                     CNATKLPLRQQQQQQSTGAEGAISGRRAGPGGTSLTSSPATVVCGSTFLNTPSQSSLL
                     LANGATARPGSATPSPTIQQHQHQRVANSGSASRFTTSPNGGGQQGSMNGPANKISST
                     GGSSHRVGSPAHNRYTSPTHTNGYHAGGSQISLQAGGRYPMPATRPPYIYEHHVGQEL
                     LLEEFHAAMRFNAASFGNIACLVDAFSPQVPVASDLEFPCNEDQCQLICTRGNRGLSS
                     SPGGGSSQHGSAQGSRSSRGGTFLVPQSEDARTTGGAGHNSTSVGSGGQEGSALPILR
                     PAQADRTHYWDFAGPSYCEPVMTLKSIWQSFDSPFGCVVNLAEPIYPAPMRPAEGELV
                     YTPLLSGFRIRFHPASPACKRLTALREVRRQRRREEAAASEIVGVSAEDEHATTGVEG
                     VVRGGGSSHTTGSYAEEDGVLTWSATDRPNNRNIIVEQIVELAKCDESYAELLTATTA
                     DVDHQSWVALMWQPVFCGGHSSKHSCGTFLAYYLLRAPRHLFVPFADKSEGAAMNSSW
                     NSPVFRGDRAALSFDLWSLQRHYHVARWVSPPPMTHIMTALSVDGEDDEPDNGSFSCA
                     STSRGRNSWEEGQTGCASNHTTESFAVSTNGDSRVRLRDVYPGSTGAGAVVGGESSSI
                     TIAGAVTALHTMTGTANAAACPTREKTATFVRIPLVGLIPNRCRSEVWFKPVYDASLM
                     DAHRHGGGSGGDGAGAGASGGGAGMGASSGLGGAGGGGSSAGGNVSDNGDHTGLYAFY
                     APLFLIVTALQLMCWDAYNEWERKSPTSAAAAGRPSTFAEVRRDAEDSEAAIGGASGA
                     AGTPSSSFTPSPATAEEAMAAAQRQQQQQQQSDYELEATAGAGTGGGNPSRGAAAHRK
                     NPWSSYVAKGVELMTEAARQYRAVREVANLDGSAEEGTNGCAVVFSSGGSAATTSEGC
                     IGSAEEKRPVEGDKSVAKQQRGGCAVVAGGTSSSLCDPAARVIAGLLDYYQWAQYDTS
                     LTALAAAYCAT"
     gene            <706724..>708985
                     /locus_tag="LMJF_26_1830"
                     /db_xref="GeneID:5653105"
     mRNA            <706724..>708985
                     /locus_tag="LMJF_26_1830"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684137.1"
                     /db_xref="GeneID:5653105"
     CDS             706724..708985
                     /locus_tag="LMJF_26_1830"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684189.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653105"
                     /db_xref="UniProtKB/TrEMBL:Q4Q909"
                     /translation="MTDIFSSLLGDPVRDVVTEGDGECGNTRQSATAGVACSPCPAPS
                     LPRHCSAAPPSPSSPLPSPPLHVVVNHGGDLSEHPSSASSSHCFKVLLARQQPPLPPP
                     PLPSSSHSPPTVHAEVLVEALEAKAAGQRRRGHTLGWCSRHHREWRRRHKRHRLCENP
                     GDSSRGTNAMTESSGEEAADTYAKVQQQQRRRQRMEKQAGWESRPSSSIDDSSDSYLH
                     RRDRVTQCKEQQRRPPSRLRVAEQSVDCIAVQLPLQRAKEAPASASMHTTVISSPNTT
                     SHPGAPSSSLPCSERREAQTRLAHDDGHSLPGGMAIKVAADTFRRDSCSNTLATGTIV
                     NCSGGVVGRPSHAFESAPGCCDGGVGTCDVEEEILPWHVSPLTSMVGFPMKCPEHEVT
                     PIFEDQPLNWYPQPQAQATQHVLDEYVSAAGGVVRVEGDNQLRCRVASLLGPDWCVAE
                     PSSTLAATPGGGGEADLWMPGAGSPSFTAWSQLGADCGTCVGAYSLPDDRVMAPGRGL
                     ALGLGDTRARFYGGTPQGSSWWLSPADQDCRDAEDGSDWQYRVGCCPTSSTRLSTATA
                     LPGSRGISTAAPPLAGLLSSHAVPRKSPTTPAFPWMAADEGESRAGVSERGGDGDCIF
                     SERALSPRLPHYSSGRAMGSSCGHGDQDGGGHPLYSAQMPPPRSHHGSYAPQPPGHFP
                     PFFGLPASSSVASASSNTIAAAAPAPHRVGRATRQHRRRSNGARPPRALNGTTERCRR
                     FWERCRQSNVPDW"
     gene            <710660..>713638
                     /locus_tag="LMJF_26_1840"
                     /db_xref="GeneID:5653106"
     mRNA            <710660..>713638
                     /locus_tag="LMJF_26_1840"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684138.1"
                     /db_xref="GeneID:5653106"
     CDS             710660..713638
                     /locus_tag="LMJF_26_1840"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684190.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653106"
                     /db_xref="UniProtKB/TrEMBL:Q4Q908"
                     /translation="MDAWFEYARGVGEVIYKMKLHEYEGACASLLLTAAEVEASAVAA
                     TDNEASKARRSGTEFHHERSGLDTTVAPSPAWGAHLQPPALMSSSAGSLLIPVGETFF
                     NVSATSSATAGSVPSRGAAATPDSRPVVDPCTLSSATTALNESCRTRNGSIGQSKAPT
                     LSSSATYLSAIPGDCNRRAVTLAAGAAATPAEAFGALMDAMQLRKPMRAATSRSQHID
                     DIQVEADFVFQELEDVFTLQPGDAAAAAAAAAAAAASTAGVAPRPSPTLPSSAQTRCQ
                     PTENEEEHGVAAAQSRPLPAPPPASVADSSERHLLYGELTSVGVRQLQAISMVSSCVV
                     REEHGRSSSRDHGIGGAGLSVNPSTKVACSRDSSSAQAFGSTPPVNHNVSAPLSCTRD
                     HSHGHGHTSRGAVVVAVDVGSGNGRLLFEWGRLAAAACRRPHTSSPPRYSDEGSTLVS
                     AAPTSVTLHSTTSAAGSTTAEMTQAASMRFRNLLAAAYAPLGIASPATVWHGWLGVGI
                     EVVPSRMRIARKALMPHYLNLRQALVVPSAGGSVSAPVTHLDPCPLEATVATDTSASC
                     SPSASLQSGVATHTTIIRSVVGSPASTGTSVAMAPGCRVPQPSARVLLYEGDALAPGV
                     LSNTTLCRFPSPNHHIAPLPLCESYAARDDGGGVQGWGADSGSFRCTAALTASVSATA
                     AAMNGPGLFNSICSDAHEPGGARPPANMSLASITTASSDCSARPRPLEQNYYLLCSVE
                     GGPLLTGREEPHLVVFCCGLGFDEAQVRRLCQRLEDMLLYRSATAAETTPSFVGSAPM
                     TYQQLSKDANSSPLHHTCHHHNRMPQGEDGEAAASPAERASPSLTSSDKSKEENIETR
                     FGIQPMTSTAADPVIGVDTGIGAGFASHRHWESVTCVLLLRPMDVLLPTFPLFRYARR
                     VYDTVCQPIAAEDTALLLSTGRRSDGSSVPFSVRATPPLEHLPESSVAGGIVDSDLWR
                     TTLETTWMNAAPAWVVRFHF"
     gene            <715104..>716360
                     /locus_tag="LMJF_26_1850"
                     /db_xref="GeneID:5653107"
     mRNA            <715104..>716360
                     /locus_tag="LMJF_26_1850"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684139.1"
                     /db_xref="GeneID:5653107"
     CDS             715104..716360
                     /locus_tag="LMJF_26_1850"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684191.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653107"
                     /db_xref="GOA:Q4Q907"
                     /db_xref="InterPro:IPR006816"
                     /db_xref="UniProtKB/TrEMBL:Q4Q907"
                     /translation="MAEPTSSSTVPFTPLPTSSFRTPHIIAAAVTAAAALGAGILFAV
                     VSSGSVGGGGGRRCAFRSEGAIQEPRQAVVEALEAIRGGRCKTCGELVFFLRGPPQSP
                     VSPAACLGVLGAAAATATEKLPPSNAHCLRVPASVLHYIQESYLPATRRQLVEARRKQ
                     QPSSATPALQVEHNLFAQMVAADLTLRALNVERATPFDKDNRSHMNLLQQLWMAAGKS
                     AATYSPLGQHWVSIGFQGVDPVTDLRGGGVLALRQLVHFAQVHNTAFREMLAYNERVQ
                     REGKHSWYLLAVVSIQLTTQLMLEQDHPLHVAHLEMIYDTLRLGAAGDATAKTVGRRA
                     VAEQKGVRLGSTRAADTAAFWDFCKSACSAEAGMFALHHALLLHFKECWTRDKPHVME
                     YNTYMSAKVFSTFFTTKWADKTLAAP"
     gene            <717566..>719218
                     /locus_tag="LMJF_26_1860"
                     /db_xref="GeneID:5653108"
     mRNA            <717566..>719218
                     /locus_tag="LMJF_26_1860"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684140.1"
                     /db_xref="GeneID:5653108"
     CDS             717566..719218
                     /locus_tag="LMJF_26_1860"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684192.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653108"
                     /db_xref="UniProtKB/TrEMBL:Q4Q906"
                     /translation="MTDLALPPTTAQPDDPAAASAPAGSAGELSPMATPPAASAATAG
                     VIANTLPSYIPSYMTGGDPAIAEQLANIDWDAEFKKLMELTGQMIDRQLNGQNGDERP
                     AASSGGASAGHGSDAARALGDARLCGSNSVGASPAVAASPIPLTYANAVKSATAAARK
                     PATLGVASTGTAAAAAAAAAAAAAANMADMDDDSVSLTATSKAGTGKHHWKKLTKAQQ
                     RHEQSQRNAFEAFANALLHSVSPFMAPLRAKCKTSLPHIKVDQRFGKSGHPETAIAQF
                     LVAPLVTNYRPRHFHDVAPGELMEFHYDFALVLQAIPSAHAIHIGYGPTWKRYAVPYC
                     YLACREYRKEVLALCPEEIPNSRSEAIYEDDVVKDITELLLKRGEGLEMLETMSIVEA
                     MRKRVDLYPLYDAFATVFQSLENYQVEITDIRSAPSCFLVKASRLAVEAMPQPIVLDD
                     EVLWDELPEVSRVLVQGGVAASGGAGSEADGGAARLASQQKALSTSAPAAGAASVKRG
                     TGSAGAPAASGAASSWQALAPMIVCVACVSATLAVVLMKKQP"
     gene            <722879..>730768
                     /locus_tag="LMJF_26_1870"
                     /db_xref="GeneID:5653109"
     mRNA            <722879..>730768
                     /locus_tag="LMJF_26_1870"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684141.1"
                     /db_xref="GeneID:5653109"
     CDS             722879..730768
                     /locus_tag="LMJF_26_1870"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684193.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653109"
                     /db_xref="UniProtKB/TrEMBL:Q4Q905"
                     /translation="MSSGGGTAARSARAVTLCVPAETTAQEDGHAARRTRRCVSLPVS
                     SAPSAVVAATSSISDVWVQQERRNQALRRGHGEFAEEAEATADVTRSGTHASVNHAGA
                     GENNGGDSVTEPIAIGHLTLRSLTEEYNRFSTECTVGWIGLQVHLRRHTQTSHIFALD
                     LTCCHVRRDQWTWFSQDILPQLRALEVLRLVQMHLEDDEVAELVRGSCGLSAAADGRR
                     RAGGSWQQTSFSASRHKADSSQGGSGSGDPAVQSAPLAHLRVLDLSGNAFTQRSCTHL
                     GKMMLWMAGTLEEVRLLGNPLKDYGMQTLSVYVAKLNLEALEQDPSLFPAALRDCCAQ
                     VSQKCGRGHARRSRMAGPAPSSPQPAAAAGVVHAGYSEDESRGDARGLVAALPLGPVL
                     LDLRDCRASARGLSDILAAASRAHRLRTLVLSHNVAGVTSLLPLPASAYHEASNLAKG
                     EAMESEEREARAKSDDDRGPLRRLRPLPCRLRLAKTPLVYSGALMRRQHTAFSDVAEF
                     APSCALSTLVLYGVPLSQTCSPLGFRALLLNIFFSCPLLDLVDLSDTFEWSLVPPEAQ
                     KALLAEANRRDAVEQHLRSPEVQRVLHVHREGHGEVEFSLDSATVSNQTRLGDMFGEL
                     MAHVAFNAVVRRRLPPAAFLHVRELHLSNTGLTDAGACGLCVSVRRGRAQTGMLASLA
                     VLNLSDNLLTVRGCVRVISTFLLDGDAEVDVDATRSCPALSTTTSAAGRPVAIARLTA
                     LALQRNSGFVSARGDGTVGGFNGVSDDGVEHLQQVCTAAETAVLRRATLRSAVCSNQV
                     YRSSSSGAANADAATQEELAPPLMVYFSAPPSVEATSSISSSGAGGQRRPSASLPSTA
                     SVDVFYAGCDDQGDVYCTCPCSRFYVAKPASAQAVETKGIKARGPSYFPQQKPCSSTE
                     VSRALAGTATAHGDQTASASAVSEMARGGCGALGTDATPTAREKQQHHAQGGPQRSLF
                     AALGAPRDAVAAAGTGAGGESPNGLVNTTPLHHLRSLTSDVEAGAAASAASVSSSSFP
                     LVPPPPSDSMSVVVAAQRTSDLAAAGVGPRFVPPQQQQQTALPSRRENGLSVPGESSF
                     GALFMSKAEKTPPVTLGAPAGAAVADAAGAVPVAANVDVGAGVSDTLVSTAASARRLG
                     GRRARLRRTRTFVLSYDHVAGHLLCRALGVLLRPPPDPLGEGARAALEQDLLAALKRA
                     SAASQTRSTSEQGGDEGGDDGGGAGKTASSTTTTESVRYLPPEQPSATVADGGDSSQL
                     GADVHWMRFEVTTSERKGDMAQLLQEVLNVPLSEQRVLFERLLQFLTQHVTCGGEPHG
                     APSAEDLWDPVRAIEQAARSSAAVRARLEIAYGGVAEAAVHARHQYHGAADATLVPIS
                     DASGCAAAATTGALDGTDGTEGIVRLDRLYFALWRELGIPVGDTAWDALPHLLPSVCM
                     KERGAETPAGSDGRPDLLGRATDAGGLHTSFSTPHDVPSCRSSEAAIALSPQPSAATR
                     SPRSHVVDFYDGVGDKSKPRQRQSLPATVYKGRCAGAFVPAAATGGDQGGAKWATSGR
                     EGAEREEGDEETSVDSTSVTTPEKQLNHAHCIELGSAAAALSPSPLALANSNVEALQP
                     DSPSVEVVLTDKVMRLSPPAKTCDVAGAAVAPPLTPQQPVSRASLTAAEEGEKGQQHV
                     DDFTAERNVLRAVTSRLLIDKRSDEERSGSSGRAGSPARSGGTLLSQPQQEQSEGCQQ
                     TQPESVHAGATGVQAEEVEGEEDIAIVSPIRVQRRSSQLIGRVKTFTLSYTHQEGTAV
                     CRAWRLLHTATHVCRSGSASSNNGTSAAPADAVAPIAPSSPPSLATLAKEARRCLCDD
                     FLAFLQPPDEDAEHAVLSVSLHCDSGVATSMLQVQVQTNERRAVLADRLQHSNHGVRR
                     GVGRGSRSGFVSLSVQEVDQFYFPRLTRLLRQYKTVADTAAQVQAFLQPRAVVQARLL
                     QSHGSVAALVHYYHGSQAALEHELGISSWQVLMDPAPPSTARAEQLTEEVMSPTVTVD
                     RVLRRERAGVESNQGGSAPREGSGDTGEHAPGTPFPQGANATPSSPPQPTAAGTRQPS
                     CPTSADGSVTGATNRQGRPPPHPRRPPTPPHAITHTSSISFDEVTEEPTSESGPVVVL
                     RGTAPNPAQRSPSSPQSLNPQYFPAMYRQAVSTALPSRTGVEDVRTRSALNEPGGQPD
                     GGSDTGLVSPLTAVSSAAGSPSSKHLDLVLEQPAPTGAVAASEASLAPLPVPRLVRQP
                     AEGTDSVVAPASKKGGDSTQLRRSDASGNPSAAAVAASSSPSVMPPSKTRPVGGTNAG
                     VSLVLQPRLPVERGHSSTAGHSNASSRSLEPNQRQPDAAAGAGSSSSVAGSDRCKSEY
                     ERVLEGKYRRLMRVAYDGVARGSVPLDPQHQQKTVIGRGKWGAQKVELSLEWEILFVL
                     TFEKSRKLGRSSRRAQMLVHPVGCGFECAAGDDPIHTASSGIYGGDTSSLHSSAINGE
                     FGDGGHHPPATAMSKIPRKRESSKSAASHLIITIQRPFTPDEVGSSAHDMEETLMAGA
                     LLTVSSSSKAAWLLVGGNDDTSTTSRASAGVNQVTHEYVSQLCQASLTLDIEMKSSKH
                     VQEALRLLKNSIRRATQAVKKSMLNAHLPPPSR"
     gene            <731710..>733914
                     /locus_tag="LMJF_26_1880"
                     /db_xref="GeneID:5653110"
     mRNA            <731710..>733914
                     /locus_tag="LMJF_26_1880"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684142.1"
                     /db_xref="GeneID:5653110"
     CDS             731710..733914
                     /locus_tag="LMJF_26_1880"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684194.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653110"
                     /db_xref="InterPro:IPR027986"
                     /db_xref="InterPro:IPR028031"
                     /db_xref="UniProtKB/TrEMBL:Q4Q904"
                     /translation="MYKKALNAFFLKVHPDFFHHNLQQQTVNQNSVAQLNELLAWARE
                     FKQGTLRAPPATSISFSFYRRIDENEGGDADVVTAQRSARRSDAGSSGGEGENGNDRP
                     KESVFAKRASRAADWTSDGSGFAGSGAGGGTPLHDDSQTVLIHSTFELPQGFVANESN
                     RGLVERSVNKFLRDLLRRAECIDSVTESIPVAEDAAAARREAKPLRRRRADPRAKAKS
                     GGKTLLDEASEVMTMQWTLTSVPTLEELMDADQVLFAKTLSPLQCSAALHTLRASLGE
                     LHYDQWSSMPLIIDDHFAIGADITGGLTVPWDFTALQFVSFLHQNAAAIAQCRTLAAT
                     FATEVEQLIAELCTALELDDVLISCSHKEAMNVLRLLHRNKELLHGYGLTNLTLEIGM
                     RHATRANGVVIVDVSMRTTEELREWLQALHGKLDLQRKLYSVSKQMLETTMWHLKEFR
                     GMVEPGGVDAFVHNDCTYAQRLAWAKELFRIGPALAHWDWQEFTFLLSPELDVDWSRR
                     QLRLPHNFDGDALVRYVEDVQQSAKEKEKEALLRASAVRRLSDEELRAQTHAADLQLN
                     DGPNEPESKEQARRQLLEDPLVPGMQPVSEAMRHLYRQSSPHMDEYITSSEDRVDPLS
                     VERPLSHAVTFNSDTEAEEQLKWEGFYQEPYVDQMPTGDLDDMAHTYRLTNRWHREAA
                     AKKLLEELQSTYGKKSRRFDYQKMGDVLEINNARVQPKGFPVVARGMKPSEG"
     gene            735899..736002
                     /gene="LM26Cs2C1.1"
                     /locus_tag="LMJF_26_snoRNA0472"
                     /db_xref="GeneID:12981820"
     ncRNA           735899..736002
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs2C1.1"
                     /locus_tag="LMJF_26_snoRNA0472"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460646.1"
                     /db_xref="GeneID:12981820"
     gene            736096..736186
                     /gene="LM26Cs2H1.1"
                     /locus_tag="LMJF_26_snoRNA0475"
                     /db_xref="GeneID:12982033"
     ncRNA           736096..736186
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs2H1.1"
                     /locus_tag="LMJF_26_snoRNA0475"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460649.1"
                     /db_xref="GeneID:12982033"
     gene            736220..736306
                     /gene="LM26Cs2H2.1"
                     /locus_tag="LMJF_26_snoRNA0434"
                     /db_xref="GeneID:12982035"
     ncRNA           736220..736306
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs2H2.1"
                     /locus_tag="LMJF_26_snoRNA0434"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460608.1"
                     /db_xref="GeneID:12982035"
     gene            736458..736561
                     /gene="LM26Cs2C1.2"
                     /locus_tag="LMJF_26_snoRNA0473"
                     /db_xref="GeneID:12982037"
     ncRNA           736458..736561
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs2C1.2"
                     /locus_tag="LMJF_26_snoRNA0473"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460647.1"
                     /db_xref="GeneID:12982037"
     gene            736655..736745
                     /gene="LM26Cs2H1.2"
                     /locus_tag="LMJF_26_snoRNA0476"
                     /db_xref="GeneID:12982034"
     ncRNA           736655..736745
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs2H1.2"
                     /locus_tag="LMJF_26_snoRNA0476"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460650.1"
                     /db_xref="GeneID:12982034"
     gene            736779..736865
                     /gene="LM26Cs2H2.2"
                     /locus_tag="LMJF_26_snoRNA0435"
                     /db_xref="GeneID:12982036"
     ncRNA           736779..736865
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs2H2.2"
                     /locus_tag="LMJF_26_snoRNA0435"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460609.1"
                     /db_xref="GeneID:12982036"
     gene            737017..737120
                     /gene="LM26Cs2C1.3"
                     /locus_tag="LMJF_26_snoRNA0474"
                     /db_xref="GeneID:12982038"
     ncRNA           737017..737120
                     /ncRNA_class="snoRNA"
                     /gene="LM26Cs2C1.3"
                     /locus_tag="LMJF_26_snoRNA0474"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460648.1"
                     /db_xref="GeneID:12982038"
     gene            <738100..>739053
                     /locus_tag="LMJF_26_1890"
                     /db_xref="GeneID:5653118"
     mRNA            <738100..>739053
                     /locus_tag="LMJF_26_1890"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684143.1"
                     /db_xref="GeneID:5653118"
     CDS             738100..739053
                     /locus_tag="LMJF_26_1890"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684195.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653118"
                     /db_xref="GOA:Q4Q903"
                     /db_xref="InterPro:IPR006722"
                     /db_xref="UniProtKB/TrEMBL:Q4Q903"
                     /translation="MSLETWAVAAVAIVDVEGTPLLLRTYTSPKDVLDSPAAPLHAHL
                     YVGPEDTIKLHFVLFASLDRCEDMRETAALPSMGAAAPSSAALVGGGTEASLVANKSG
                     ESSTTEVGCLVVRTSPATASMMNASAANAARLISPTTDARFLGKLLESYRMRSYGFRS
                     ATGIHTLLVTVGGDAPADAMVPLCRALYECASAALCNPFRSPAQCWRAQEQLLWRAPP
                     SALGGEMAGAATSQLAEGAEGKYESQRLPPCTQGRAAAAAARWTSVPSRAMEWSWPRP
                     APTSAAALTAEPTLALSHAFNTQLEKLLSSFTVTARSCIVR"
     gene            <740256..>743924
                     /locus_tag="LMJF_26_1900"
                     /db_xref="GeneID:5653119"
     mRNA            <740256..>743924
                     /locus_tag="LMJF_26_1900"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684144.1"
                     /db_xref="GeneID:5653119"
     CDS             740256..743924
                     /locus_tag="LMJF_26_1900"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684196.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653119"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q902"
                     /translation="MGSVEEIDSLAESMYASPDPEARRLAQERLTALTQENADVAPLE
                     AIFARSNNQYALMFVSQGVVTWFRANRKWLSNEQRFEVVVNMCGTCVQRVSLAGAPRH
                     VTLGLMNAYAKLTKLCFEKGTLLVEAVAFALQMLHDASPSYAKSVSQNGGCGTAAGSH
                     RGSDDKAHLIGSSNGGVSSSSAVGGGASSISASSGGGGPSSNDGGPLGYGIIRHSRFP
                     PTGYRNEEERRTAYYVALLLLSTVVNEFSKYDSAKSQTYMNFSSHRRCSNNFRDECML
                     DIFVASVAELEGVNGTSPMVLEVTEFVRDCLTYDFMAIMVDETEEALSAQFPSSWKGV
                     LLAPHTWDVLWGQHATLPYPHCATLLTGLTSMCGVRRTFFESTEERVQYLNGALTHLV
                     RTMQLTDGRLKVPHYVTVLAEACHRFVSPFGYRDLHLSSVFETWVSAVRAVSLDVFRI
                     PFGQSGSFTTATTLLNFWSRLATSRRMYSMSEESAKDLELISPELVMCFFEARVQVSG
                     GSGQQGPSRRDTNNANGDLEGMEYNMEFDEDFEATMESILAQSDAAATLALLEHTEAM
                     RLLANYVHNGLGSNVLTSPSATTWLFYLAGGLVRHVLSAVEESAVEACSGFFMFCVDC
                     ANHRRSGAAAPPRSSLYSSYVERALLHFLTMVQSVLSSSRLHEALNTVVTNVFQSRVA
                     LFQFILNNTGHNIMRGVTGNRTTDEETAHIIRESIELIRNACMDVPHAMLVELHLELP
                     PVVELPLAQSVQTYKLRTNLSAVLWRLLSVTPYSQANLKVFLQPIELCMQNTLGGGGG
                     NDALFTAGWMRDLRGVVLALRDSADGLSDFVEWVCDHASSFHEVLHRSAAQHSMVIVS
                     LLRFLEDLVSQMGGRCTLPCCTAHSSCGLMLFKHMCSLIQSIIEQCITDEHIQRVSSA
                     GGGGMVDGAYDMMLKPLALSLSVLRKSIQGGFVPLGAMAFYHDETYDNVLLGLLRMVG
                     VFPFVYFREYPKVPYAVVNMLRIVTEEFAYRPLMSLDASELEKLISFVVYLCEDVDTQ
                     TGTLLHGLSFLSFIAGLIREVKALSTQTVSPALEARPHGTPPPSPMQLPSFYASPSGR
                     LSGTPGSLGGRSGGGAGGRSGGGASAPRATRLAREALARTLEPFNSLWERLISVAMNV
                     IVCQDRALSVSCAVVYPIFEVHPPFWYSFVENFVRTYPERKQLMVREALSTLSHAAES
                     QDKFFSEVFTFRQTMRNL"
     gene            <745244..>746221
                     /locus_tag="LMJF_26_1910"
                     /db_xref="GeneID:5653120"
     mRNA            <745244..>746221
                     /locus_tag="LMJF_26_1910"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684145.1"
                     /db_xref="GeneID:5653120"
     CDS             745244..746221
                     /locus_tag="LMJF_26_1910"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684197.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653120"
                     /db_xref="GOA:Q4Q901"
                     /db_xref="InterPro:IPR004155"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="InterPro:IPR027517"
                     /db_xref="UniProtKB/TrEMBL:Q4Q901"
                     /translation="MSASNSCTVEEVRKEYAKLLDPQEPLDSRMRELYRLKEDCLKTV
                     AGVTVILEAIDTTDSVLLQHELAYNAGQSGREEAVPELERILRTTSYDVVTRHEAAEA
                     LGAIGSPLALQVLETHSAPTTEPEASIRETCELALARIAMKETKGDAAVAPPSGCEFV
                     SVDPSPAFSALYSSTDEPVPLTVEELEAVLLDTSGRTRLFRRYMAMFTLRNLATEAAV
                     AALCRGLREDTISALFRHEVAFVLGQLERPSSQPALIAALKDEEEAPMVRHEAAEALG
                     AIADPATLPVLESYATHHEPIVRDSCVVALEMHKYWAHFNSLAHQQQEA"
     gene            <748280..>749194
                     /locus_tag="LMJF_26_1920"
                     /db_xref="GeneID:5653121"
     mRNA            <748280..>749194
                     /locus_tag="LMJF_26_1920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684146.1"
                     /db_xref="GeneID:5653121"
     CDS             748280..749194
                     /locus_tag="LMJF_26_1920"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684198.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653121"
                     /db_xref="GOA:Q4Q900"
                     /db_xref="InterPro:IPR006634"
                     /db_xref="UniProtKB/TrEMBL:Q4Q900"
                     /translation="MGFASAYDTWVTPMAREAVIFGPMVCFWFLLQYIFTRILPSCMP
                     NWKRLTRAQQDDMIVRCCSIVNGCIMSVSAVLFFVNLIKNGGLVASDLYATVPYYRFS
                     RVTISAYFVWDIFVCFYYNWTWAWKLHGFCSFVGSYILLFPFSEYYAGYYTGCFELSN
                     GFLHASVMLRTMSAISDQRTQWLLIGTLNHCATVCEYIFGGLYALIRVLGGTYVTGSW
                     MCNLLSAWRSDIVHGGEPGYAPKLHNEVAVGIALLALSVLQLLQYFWFGEIFKRAMGG
                     GVGAEDKKGAASGAAAAGESKAVDKKRS"
     gene            <750582..>756011
                     /locus_tag="LMJF_26_1930"
                     /db_xref="GeneID:5653122"
     mRNA            <750582..>756011
                     /locus_tag="LMJF_26_1930"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684147.1"
                     /db_xref="GeneID:5653122"
     CDS             750582..756011
                     /locus_tag="LMJF_26_1930"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684199.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653122"
                     /db_xref="InterPro:IPR026704"
                     /db_xref="InterPro:IPR027859"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8Z9"
                     /translation="MEDAKVAADAVGPRRVPGGSCSPSSIDTVPPSTRASECGSGQVS
                     REDGTPKAALKHVAFNVTSTSPRAEEAPFFAATPVAMHGTQRTQGLSPTDLQGHKGFH
                     TVDAESPHPRCGFPIKSLFMTRSTRISIPSHHSHNTSQTQLSTAVPTTAGDAISDAVD
                     DAPELVGAESSPSHSSAPLPLTPPATTPCRLSCLSRSAATVSAATSASEVPERHYSDS
                     RAPAEPFASSSRAAPAAAVASVAHAADFDIHRDSHAREAALLRSVVQEGDQTTSNSLD
                     GALPPPHLLTQVHRTLTSAAGLTGDSTGFSSAQPLFSSSAVDAAAQRAQTRMEANHAR
                     SQRPSRTSELSARHHPRASSFVDASLSSAPSPLLTQLLPQRAQATPRSSVYRDIHDAP
                     EGMSGRSAPLPRRGLRVPGGSAHPTYTTAVATVTDAIGVGDRGGEDVLGQREVALSSA
                     DPPFLHRDLVENTASCSPAVAAAAEFGMPTEAEVARRVPATTEPSIASCVSTSPVSLT
                     ASQHPTSLIPYSTESPSRSALVSPEGSCVLAAPPLVLPTTLPPTAPSCGESAKALLTA
                     PRTSACGDCQIVNGGGGALHLDGGQAANELPYSGGAVSCAECCNTFAGVVSDTIRLAP
                     MLADTLPHGRCFTLNMLTTWGDAHEVGLCGLELFDDRGQRLLPCCVAATGTTAVVSQT
                     ASEEGDVVILAATTPNGFVCAFAEYTATETNLAAASNTAATGGEDAAQVGPSDDAVCG
                     DPRRQLRTLIYPHPLNTHDETHMFAVPYTAGKPHLVSFVFAEPVRLSVMRLHNYAGRG
                     RVHTTKGVRIAEAWMEATMVFRGEVRANSGELCRGESAEEAEDGVAHGQGDQHASRPS
                     SLPPSTSFSPYGLENCENVLWTTDAAVLARVMAHGPPSTTPPLREVDDSDGTHGRRRT
                     AGVSVEGGAAVPRCLAPTSTARDDLLSGDPAPCRRVSARPSTTTRRSRAPPVRFSFCS
                     ARQADAAMPRHRRASAGGAPRLRGDKDTVTSLQVCPDRFPRPSGAVEAWADVATDARV
                     HQMPAGSTTDSAQPELHNGPGQDDRQLRKQRRRHLNRQSVLDPARCPRRVTAICVMVL
                     STWGATQHVGLSCLRLRDASGDVVGSVDVQCAALHYPDGTSSVCASHSCRGSSAAGTV
                     ENRHHAPSAACNNDDSNGSVKVQGDVDCGGECRLSRSVRGLLHSEAYSEEAARGVNQQ
                     DCPSGPCLLPFQSTMQLVFIFRDPISSLGFLDVANYSVGDQTGCGVKDARVFFAEEAE
                     EGATAATSPRPSAEVFRQLWYVGASSQSRHALAAARVYEVTPSAGVTLRKAPAFLDSA
                     RFQSYDVSLYGPGLPPPRIAFPPTPTVRDDDTATAATAAAPAATAILDAQLPRSNLQR
                     ALPPSTHDTGMPFADHLGRYEIASGPGTGGAGSSSIETEVFSISGMNLNGEGGQPCAQ
                     RHHGRASSFSLTSSLGASMNIRANVAMHRARMSLLQERPAWLLEYQPYVTPLLPVGYV
                     CKLRLTVCARDVPAAEPLDPSAGCRAGAKEAKPPYTSAAATSSLATASVVGEAPAQVA
                     TVITAGDSLKAYLKEWLVKPLRACSFVNERGDVVKPMRPDKYRAMMHDEAARRHSTSW
                     QDGNDDGDAQHERALARCVPMVAESMVSVVPANRHNSAASTHAMSLPQPPLQVVAELL
                     YVADVPFCISLVALHKPLVVCGSAAWVRQVQVFVDDALVFSSGEASVRLTQTSSGNGA
                     ARDPGVGAGARAGDATGPAASGSFGPQLNNGRGGAADAASEGAQLWGDLPECATSLKP
                     YVVFTLDPDLLGDLRAEATGASSSS"
     gene            <757762..>758832
                     /locus_tag="LMJF_26_1940"
                     /db_xref="GeneID:5653123"
     mRNA            <757762..>758832
                     /locus_tag="LMJF_26_1940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684148.1"
                     /db_xref="GeneID:5653123"
     CDS             757762..758832
                     /locus_tag="LMJF_26_1940"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684200.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653123"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8Z8"
                     /translation="MALAHILRCQRFFWLGLRDRVRVSKMISGTLLIPASDALTSVVP
                     VKAIRAAAAVPPQTPRPRLPWFVWPWRRQLPPDPAFSQFVAQPMVVPMYCGLRLIDEF
                     GHVNNAKYLELCELARWRQLSFLGIGTMMARLRVAFVVSDLSVTYQREIRPWSRVWLS
                     TRILLPPSSTAFAGPPSSPLTGAASSSDKRRLYIEHEIWSKDGRKLHAAITLAAALIG
                     PVKYEQELARRYDPTAAAAAAAPPHAPAGTRARQHTTLNCEHVLADALDLSSVAELRK
                     LFESAEHIYTPAIGNGDAGAAAKSGEMPDQESAARQERIMRLARIWRTTRDRLRHTSL
                     VSSPPPPPPSSNTLNSETGPKL"
     gene            <762333..>770180
                     /locus_tag="LMJF_26_1950"
                     /db_xref="GeneID:5653124"
     mRNA            <762333..>770180
                     /locus_tag="LMJF_26_1950"
                     /product="putative mitotubule-associated protein Gb4"
                     /transcript_id="XM_001684149.1"
                     /db_xref="GeneID:5653124"
     CDS             762333..770180
                     /locus_tag="LMJF_26_1950"
                     /codon_start=1
                     /product="putative mitotubule-associated protein Gb4"
                     /protein_id="XP_001684201.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653124"
                     /db_xref="GOA:Q4Q8Z7"
                     /db_xref="InterPro:IPR026983"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8Z7"
                     /translation="MTAVSANENELVHLSVGDFVTILTHHMKDGKLHWILGSVETPPY
                     LRDVEIRLWEKQRFEYYGEGDTPTDPETVALMDRIAQVKEELQKSIDQAEDLTEQLRD
                     RRAAIIQKIADADRYVAESKAVRDAAREDVESISDRNWQELKSYRIPPKMVSVIIRAV
                     MLLLSEDKARTWPLMQRVLRDFYFKRRITSYDPGKQLSPERRDYILQECVSKKSFRYD
                     RAMQGSVAVGPIYYWVLAQLDSGEAQSQRENVEQEKIARQKELRGVLKQISEQQERIS
                     EYQELMDDLDDQLRLCNQRNSDGSSVALLSQSPSASRSRRRISISDRYGESFAAREGK
                     EYLRPAFYAWKPTDRVIIVLRKNIVCNFGGVTSQEQGEGYNLSEPQIRMLDEALMRSQ
                     QALETIHGDSEGEDDALEEDMLKQNDNETDHTVRKDEDILEERQRNAAECEPTPIPTP
                     QASDTAKVGIGAAEATSKLQRTFEGRNWHCILGRKREAMAAAFTEDSSECLKVPPYSI
                     IIESLKVGSLIVDFSAQHDGQRSDAELQERVKTFEFPKVMSLYDEEDEEDVEEDVEED
                     VEEDVEEDVEEDVEEDVEGDVEGDVKEDVEEDVEGDVEGDVEGDVEGDVKEDVEEDVE
                     GDVEEDVEEDDGPEHQMKFGGDRWADITPEHHGEIEAAFLADTSAATGVLQDEIVVHD
                     IRADADEGLTVDYSMLDKGHDPEVVQEQVDAYVYPAVWALYQRLAGLDEAVPIHQVRF
                     RGERWADIMPGAEEAIRQAFAEDTADALGIAPQQVIPDEIRYEKGLTVPYTVLDCSLD
                     GDEVDAMAEDYHYPNTWALYDRLVAEAVGATYQKSFEGEHWETVLHAARPEVSEAFCT
                     DTANAVKSEPCDVDPRSVDTDQNRLLVSYNVGDTQQRAEVRADTQEYPYPEVWALYQL
                     VIAEEAEGTRKLSQTFDGEAWDAINAEMPEQVRESFTEDVAVATRVDPACVTIRDIKT
                     SKKGMTVEYGIVREEGQSAYATRKAAKSFDYPVTWSLYEVNKKSAPAHALSVFGEGES
                     VILERRFEGDDWDIVVEGCPEELGDAFRAGTARVLGVPEQSVRIISTEIVSPTVKYQV
                     IDPPCEDREIERRMEEDELPEVMDLYRRCTHAEAEDATPVLQDLEAMPPKVFDGDEWG
                     FVMANQRAELEKAFVKDTADALGVSDEQVKVKEMKVGPYALQVQYSVRDCPSDEAATQ
                     ATVEDYPYPSMWEMYPDEEDLDNYQKTFDGTGWEEIVAFREDDVRAAFAKDVADALKA
                     DEQSVVVKSVRANAEGLEVRYNVTSEACDSEQIMETQQEYGYPNTWALYEEDEGNWVT
                     TSHQVGFDGEDWVYVVQDKMPELQEAFVGCTADLFHVRPEHITNTKYTSGSLIVDFEL
                     THPARLSEEEIKRQLATCPYEPVWELYGYHPWVPTEVTETTHNICFEGPGWATVLESQ
                     REELEERFKQGTAAALEVEPSDVRIDSADCAEECLFIRTTVTHHIFQDNELLQEQLTR
                     YPYEEVWKLYAEDPNQSWVVTSHQVGFDGEDWVYIVSAKKEALEKAFRTCTGESLDLT
                     DEYITNIVLEANEAALLTTFEVKHPKEQSAEEVNQRLAECEYIPVWELYIDHPYNPEE
                     NEVTAHEIGFEGDEWNKVIETQPKQLEEAIMLDASEALEVTPNDITAITTSFENGNLL
                     VVRLNIQHPVLQDEELIKEQLSRYPYERVWALYEDAPITPLSEEDAVRFSGAGEGESA
                     ILERRFEGDDWDIVVEGCPEELGDAFRAEAARVLGVPKQSVRIISTEIGSLIVKYQVI
                     DPPCEDREIERRMEEDELPEVMDLYRRRIRAEDEGATATTHIKPEGKEKITTLEDCGF
                     EGEDWDYVWSIKQEAMCKAFAKGVADALGIKPTDIQNINMEKSADGIVLGANVTHPLM
                     QHHQMIQQTLKNHPFAELWALYETRPYNPAESVSTEHIIYFEGEEWDAVMAGKREEVM
                     EAIRKETASALDLPADDVVSVSTKVEPTGLSATVVVRHSPLQDDELIHEELTKYEYGC
                     VWALYCPESGPLHGTKHFDGLNWASVIGSDKDGLVRAFREDTAAAVNMRPGDVDVGDI
                     RTTGTGMDVDYMVNLANTSGEDIEHTLQTYPYPSVWGHYRVADEITTLEDCGFEGEDW
                     DYVWSIKQEAMCKAFAKGVADALGIKPTDIQNINMEKSADGIVLGANVTHPLMQHHQM
                     IQQTLKNHPFAELWALYETRPYSQSDLKGALGGTGDRESGQLQRLFDGDDWDLVLEGC
                     PEDAKDAFRKGVADTVHVSKSEVVVVDCCLGSLVMTYKVRNCDMEDAEINERVCAHDF
                     PELMALYLARVRRSEKGEGGDAEGRAVHKEEVITVDIADETELPAGYTRVALSVSFEG
                     ELWEPIVKTRTQELADAFRADTAKSIGAALGDIHIRECVVSKLLLLVHFSARYEATVA
                     EAELRKKIDEHSYDNVWALYDEMEAALVADISEVMVKHFVGVHWDVAMEACPTLVEDA
                     FKEDTANVLRTHASKVLVEDIALGSLIVRFRVRGLTISEAKATQMTNNYAYPKVWALY
                     MSCEEANGRALLKSRKNGSGGSLSRRRTQQLVAEEGVEFQDTVTYLRKALADARRERD
                     MYMEQVEQAEEAQRASKSR"
     gene            <772194..>774617
                     /locus_tag="LMJF_26_1960"
                     /db_xref="GeneID:5653125"
     mRNA            <772194..>774617
                     /locus_tag="LMJF_26_1960"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684150.1"
                     /db_xref="GeneID:5653125"
     CDS             772194..774617
                     /locus_tag="LMJF_26_1960"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684202.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653125"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8Z6"
                     /translation="MSEISFSEMSLHEVPLASEATPSSAVVLGGRTDLRVGDFVGFQR
                     ISPSKEWKLSLGKVIALPTALTVKVAHFDAVNETTVTQDPISEQMVRQKAAETQKMDI
                     WHNREALRENLAQESAKEKAATQRLLAARDQTVTRQMATGDKVTASLENLDNARRRLR
                     EVPVKEWGALRSSYLPSAEILGVMRSVMLILYEDSVTKWEHIQEVMHRQDFMERILGW
                     DCTATPMSLSRRKRIVALCAGKDVEGAPSKKLHPSGTRSRSPSRPLVVAAKSTNPSNV
                     VILDKNVRTWINAQLSCSEAAREQEMMINSCFAEQQEQRALLREINDMRVGISTIEVQ
                     MLEMKNAILGIDDAPRPIMPLDAYPTDTTFYKRTYPDADGRFVQEIILREAVILNFGP
                     IAEEDAEGYVRLNSAQVERLRDAVVSTNVRHDAEEMEELLARKEREEEEIAELKSRIS
                     ELRNKVSLTAEEEEELAQLEKLLADAERRHHATLSRIADLYACGRGAREITLAIKRPE
                     FRYTRLHCKMSGDWETILSDAERYSEMIAAFCDDVSTLLNIPASYVLDIDTCCGSLLI
                     DFTVKHSGDLDDEQLQDLVNKGCFSALCMFYEKVTFKKTSPLNTSQQQLAYDLEQRLN
                     GPAPISGMGIKQILTDYYNADGTLDEEFSDEVKAHKDYRKALITIPPLREDYDDVTVR
                     GPFEQHAEDEGEALSAAVPVSIMASSVAGNRNKGEDELAGATQTSIDLTDTGAATHDM
                     TESAPAMEVHSHDMNLSYNPQPAVDAAAPAAPAAPSVSAPAENVGQPGVPNTDAGSLS
                     RSSEMSRVN"
     gene            <780379..>781239
                     /locus_tag="LMJF_26_1970"
                     /db_xref="GeneID:5653126"
     mRNA            <780379..>781239
                     /locus_tag="LMJF_26_1970"
                     /product="putative electon transport protein SCO1/SCO2"
                     /transcript_id="XM_001684151.1"
                     /db_xref="GeneID:5653126"
     CDS             780379..781239
                     /locus_tag="LMJF_26_1970"
                     /codon_start=1
                     /product="putative electon transport protein SCO1/SCO2"
                     /protein_id="XP_001684203.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653126"
                     /db_xref="InterPro:IPR003782"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8Z5"
                     /translation="MSEAVDEMRDNPVWMLWALGFLTLGVVTVVISIRIRREQMRFDP
                     KLRAVKSFDSPEGPSIGGPFSLVDVKTGRRVTDVDMKGKWLYIYFGFTNCPDVCPEEM
                     AKMARVIKHLDKKVGKDYWQPIFISLDPKRDTPAKIREYLSDFSPRIMGLVGTQAEVE
                     AAARQYRVYFAIPDEEAMSEDDYLVDHSIIMYLIDPEGRFSDYTTKEFQWFESYSKLL
                     RRMMDYERHRATAEQQRAQRGEAPLADGEAPANLEIANLASMLDNAEAKAMQEEALQN
                     QPKGLSSLRS"
     gene            <782069..>782689
                     /locus_tag="LMJF_26_1980"
                     /db_xref="GeneID:5653127"
     mRNA            <782069..>782689
                     /locus_tag="LMJF_26_1980"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684152.1"
                     /db_xref="GeneID:5653127"
     CDS             782069..782689
                     /locus_tag="LMJF_26_1980"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684204.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653127"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8Z4"
                     /translation="MSRRESCIWHPMPEEVRRSSVQSRRASLAAGRRKSLNVNGPDWD
                     VEAPPTPCYGDYSARGNAAEAHTLREAAAPLAESSKKLQQAHEAACGEVSPGTVVVPS
                     KPMEDDEAFRMSRTRHTVRFHGEKWAKVLRKRRDEIIACFVEDIRDGASVMADEARRL
                     KIRMNDCMEVTFITYSGSRARQKAIHMALQQYSFPKTCQRYTTFEA"
     gene            <787764..>788444
                     /locus_tag="LMJF_26_1990"
                     /db_xref="GeneID:5653128"
     mRNA            <787764..>788444
                     /locus_tag="LMJF_26_1990"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684153.1"
                     /db_xref="GeneID:5653128"
     CDS             787764..788444
                     /locus_tag="LMJF_26_1990"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684205.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.1990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.1990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653128"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8Z3"
                     /translation="MPASVHSDDSETRRKTARNSDDDSGDRIIDGLRYPRPERQIDQF
                     GFELTTHSLHFHGCDWDIPLTQKRDELTKAFMQDAAEATNEPEENIRNLRFIVTPTHL
                     DAKFTVRHKVHVSKDKVHKMLSSSKWMLVKALYEPRQKMRRPNKPAKARAGHSGAQDD
                     QPMLGSNRRTPSHNLSFFGRANVGAEGPEFEDHADDSEEPVAYEHQVSAKTRRTTSGL
                     FISVGLAA"
     gene            <790936..>791973
                     /locus_tag="LMJF_26_2000"
                     /db_xref="GeneID:5653129"
     mRNA            <790936..>791973
                     /locus_tag="LMJF_26_2000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684154.1"
                     /db_xref="GeneID:5653129"
     CDS             790936..791973
                     /locus_tag="LMJF_26_2000"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684206.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653129"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8Z2"
                     /translation="MQQLQARLSDKLNELTKDWTAEQRKLYGAVALTAVVASGATLIV
                     VKVMRRCCGAGNDATRSESHSKSSDIYESETAARQYMEFHYTPSCESYTQRLRSVSEA
                     YDFPTRVAHKFRTYMQPGKRKLRGLDIGCATGASVLEMSKVFDGGVIGIDFSEVFIHL
                     AKEVVSQPTSGKKVTYTAPVQGEITEKRELELPRAVRPERCEFYAGDAMNMFEEDGKI
                     ATTTSRLYPDVKYWQAKKGETFDGVLCLNLIDRVPDPQRLLNSVVRLLAKDGILILAD
                     PYSWWEDATEKSRWLGGRNDDGVRSEDAVKAALGGKLELLSESDEAFLIRDHIRHYQL
                     GFSHCTVWRRK"
     gene            <793313..>795496
                     /locus_tag="LMJF_26_2010"
                     /db_xref="GeneID:5653130"
     mRNA            <793313..>795496
                     /locus_tag="LMJF_26_2010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684155.1"
                     /db_xref="GeneID:5653130"
     CDS             793313..795496
                     /locus_tag="LMJF_26_2010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684207.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653130"
                     /db_xref="GOA:Q4Q8Z1"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8Z1"
                     /translation="MTDLSDRQWRALAQAYPFYLAGEVGVGGLASDRSPDRQAGLTES
                     ELAATSLSSSDEFVQYVVPRVAKAFSEELQAYERASGCGGQPAHPNGDRVCCASSRSA
                     AEAVDALLVYLFDCTTSALSRGSSTKQRRPVASACFASLITPLSRREQQLLGLYHRKQ
                     EQYTYVLSTQQQLLAASQLAVQALQEVSSSILSYAQRGAGASQRGAGESLAASTRGSV
                     VFPGDQKLSVWSPLTRATASGDGNSAGAVQAASSSCAPTASGANSCDASRAFTSALAN
                     VPYESHPRETPAAACVSVDGSSVVSTWRDSPLLHACADTAPLLIAMSRCAGCHEAGGD
                     LLICTQCEEMRHEACGGPHPPEPGMAGKRVSTMSVCKRCANALNLSSSSSSLRSTTSS
                     SERAELDKYFSSDDDVSSLSGFIVNTSDDDEAEEDDQSAEDDGSSDVKRAKGTEKGEK
                     RQRQHQSRGASAPPRKGQHANKNRKQRSAAGATDAASDVSSASSAASGSSSRIWSRSA
                     SLDRALAMAAKRRSKKHDSANKVHAVDNESVAGASAPRNEGHEGQRRKRRRARHEDEE
                     SGRRLHKRKRPAAEASDASSLTSSTSSGSSSLSTKKVRLLRQPKKKASSQHQSNAQVP
                     PSPPRQEDARRVPTCASKEGTTHSPVDRRRAEPPSAQSRHLAVLEDEEELSALGIASS
                     SASGMPPPPPPSSSKRRQSCSANRSGGRKRLMNAASSSSSSDDSN"
     gene            <796369..>796653
                     /locus_tag="LMJF_26_2020"
                     /db_xref="GeneID:5653131"
     mRNA            <796369..>796653
                     /locus_tag="LMJF_26_2020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684156.1"
                     /db_xref="GeneID:5653131"
     CDS             796369..796653
                     /locus_tag="LMJF_26_2020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684208.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653131"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8Z0"
                     /translation="MGRSNNQRRRTAKARGKPFIPKTVKSKVRNQNRRMKIMAAKKDP
                     RLHKKLSYDKVQTKSGKITQRKFQSGGYNHSGKFGKAAGAKRNTAKGKIK"
     gene            <797364..>799742
                     /locus_tag="LMJF_26_2030"
                     /db_xref="GeneID:5653132"
     mRNA            <797364..>799742
                     /locus_tag="LMJF_26_2030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684157.1"
                     /db_xref="GeneID:5653132"
     CDS             797364..799742
                     /locus_tag="LMJF_26_2030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684209.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653132"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8Y9"
                     /translation="MQCCTRFSLPTDAEGTATRPPIHHLHTHINALWSELRMLRRTWL
                     RLISLTEAQHLVLDAQGQQTPTPRAPLPQLLAALAEHYRAGCETFTKAALQHVVQLDQ
                     SDEDTRHIAAARLAAPLLPSRLLTDVTGVQPHTATPPEAPPHLITEVLRAYPHTPEVR
                     ERCCRCIANMCQLSADTPTSSQLVSAACHSGTPATNTLPLADTLVEEGAVELVLGTLA
                     IAGRLSSKGRCWTAMAMLNLTCMSHNGAARATAAGAVDRLAEFILFVLEDASRASAAS
                     TAAPICGLVEEATIALDAALGALTGVLSAEAPENASGISFNYEAASYVAVDAVVRSLL
                     VASALMVRDGRNDGTYDASLLSRRCGTVHFSSASETQQAAVAVLLPLLHKGWMALQSV
                     CSCPANLPMVFDVIYEAANANQESMVMANEADGGTEEVLQVTGQTERQYVAALSCLVD
                     AALFLTTELEGLEAISADKLACLQNDIRLYVMDAMQAMTASRKDLASKDAAAASASAG
                     GAGGDAEEEARDSATAETSAVYPTAAAMGVTGVLTAGTVSNMALACAVRLHIEHQERC
                     SRSEHQDRHGTSSAHSQCRRGVPTPYTARDLTLLSKSLAVLANVAEIGDEAATSANAV
                     AALQSILQDAAEGIMSLPPAYGAELAELFRPTENAEDKAEARDGSGIHPEDRLSFLQQ
                     AALVGQVYAVLWSTLRTAQGVATVSQMSVMQTAKGVQTSLRESYLPALAAARERFGAH
                     PAAGAGDEAANLAAVSWVANTAEETVTRLLKLSDEFISNTQRLSESAQHTPV"
     gene            <800704..>801774
                     /locus_tag="LMJF_26_2040"
                     /db_xref="GeneID:5653133"
     mRNA            <800704..>801774
                     /locus_tag="LMJF_26_2040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684158.1"
                     /db_xref="GeneID:5653133"
     CDS             800704..801774
                     /locus_tag="LMJF_26_2040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684210.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653133"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8Y8"
                     /translation="MEALKVCFQVALVIAPHIGYCAQHAEIHRTQSIEGYSPVVSLIL
                     LTSNTLRIYYYIGHHFLLALLFQAILGVAVHGVLLCKVLEVHVQQLLDARVTDIYDED
                     SAAVIETAAEGAPTVAPSSSVAGAGGAAERQNRAFGDRDDTVPSPNTAAVPAADWPAS
                     SSAVRHGYEGSGDTPPSLAASADVECVTSKFLQVFFRIEDCIEASLLWNTPPQLVYNY
                     VITAAAALVAVLLYYGSIGRVWKNAAEVVGYTALGIEALLVLPQILRNARRRSTEGLT
                     MLLILTWVGGDVIKVLYFLYAKQALPFIVCGCFQVFLDTVVVAQLVYYRLIVKRESEV
                     LIEGDDGAGAIPQLCRAHGGPV"
     gene            <803201..>805867
                     /locus_tag="LMJF_26_2050"
                     /db_xref="GeneID:5653134"
     mRNA            <803201..>805867
                     /locus_tag="LMJF_26_2050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684159.1"
                     /db_xref="GeneID:5653134"
     CDS             803201..805867
                     /locus_tag="LMJF_26_2050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684211.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653134"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8Y7"
                     /translation="MESTLENVEHGIRNALQRLSDARARLATRRSALDENRLVLVRAM
                     SPLLLLYPAESALPAPSYSPGGATDTFFTPLLRGQSTKLAIAAGSSPRHDGLLCEVDR
                     AEDVEDTIIISPAAAARERVSALPTLLAQQPLLPMPSPRALPQTSTCASFYSAMAART
                     QQLGEQCSNYHREHVKHAARLQIAQVWVGEVQPWFEKVVHRGFFQHVILRLDMLNRRV
                     VRLCRRLALDRPQYIPSHQCTTPIGRGMCAHGQMVGEEGHLHGCQPCSQWRPHLARGG
                     CNRGQSDGLLGVNGQVRSASDGGGEGQAAQQCSCAAEVASLSAPPSQQGRTSDVVLKL
                     DSADGNRHSVCSLWRQYIQMVSQPDAMDDEHRHSGEESYSPPSPLLRTPRSLRHVWHV
                     IMEGLTSNDVGAVSDSMTMEPPSVLLAADGDAVGDAMPHPGRRLYQRGHIDALVRNLS
                     NLVRRCPLLHPPLPPQQSTLRLCSHDEHEHEVGCHDDCDDAAGDGRRGATALVRVRLS
                     SDTGSPTVDLPHSHLSALLCCAMQLCSLARLCNAIRAGQPLCYVTPPPQLAYDGDVGG
                     CSGDDNVADDGIGGVEVVHLRPREPLGYGRATDSPSISQRTCEGQVAEALAAVYHTLP
                     CLLSQLGLALQKRRGGAEYSSGAQREERSEVEAAETDESTAPKPCAASAEGDHFRVTN
                     SLADAGAGKDSAIGTALWPTVGDAARDRDAFVRRWLSFASSLLTTELSPPSAPLTEVP
                     SVYARALRVGSLFRSLLDAAEDECGERLLQPAAGAVSAVLSPTTPTPFTTARADPSTL
                     AIHELHIAQRNTAAAHHVVRAVPASSPPLAATTRLSSLRQMELQTRQQWQSIETSLSV
                     ARSMAAAALKRAARDDGEAGDLAGLRAPMPLA"
     gene            <808870..>812169
                     /locus_tag="LMJF_26_2060"
                     /db_xref="GeneID:5653135"
     mRNA            <808870..>812169
                     /locus_tag="LMJF_26_2060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684160.1"
                     /db_xref="GeneID:5653135"
     CDS             808870..812169
                     /locus_tag="LMJF_26_2060"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684212.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653135"
                     /db_xref="GOA:Q4Q8Y6"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8Y6"
                     /translation="MGCKSFKGRLGPLHRGDASGPDDPLASGKKGKALHNVNGVVFRG
                     VGAPAQNNGKAGDKGISAFRPDDETAKAYHKYVMELRCVAVAQGILPAVTDDAVLAPD
                     VTGDKGGTPAGTKGTTGPAFHRNTNGDSTNAGGQHVSPPARTLTVYQLQPLAGDTCIA
                     KGMYSEVHLAHLSVFTGLSEEAVNATSPRYAPARRGNTGSAAACAAGRDRSSPSFGGD
                     VSSAKSLNSGGDIIDASAIAGPVSAPASTPTAAPTCTAVSHYIIAMKEFFLYNNYTSS
                     CVLEQVCLEVRRWARLSTYCPHLLRCYQLEYVFAEGISMAVPEASYQFFPGRENHGGN
                     GGAAAGGLSASGDLATGSAGRGEDHRKLLSRSGTHLLTSLLNRHSNSSLKSQQENAVG
                     GTPRKLRLYLEYAKHGTLRGFQVKEMPSRFERRRLHELTARAYMRDVLLALLQIHDRG
                     EMQYDLCAKAIFLHRPIQSVYYTYFPAYISDLPTGDLTSVTPSQLGKALGLLNPPPGS
                     LDLQWPPPPLTSASISQKRKDFENEPTNGTPSPLLKHRRGVPGEQRKNAFSSVRRTGK
                     AAGAKARPTHSVSMLAHKNSCTQQVSAIAANPNESPKTLGGQGAVAAQACKQGNGNTG
                     MIESGNGVEVSYGNNASFTSAGEVGLFDSPLQAASLTETGFRGGLVASGSPSTAHANA
                     DTHTLGKQTRANSVRAFGISEASGDDGTHQLLLHETYRRFMSEFEFTHTDEGDGVPFP
                     SPHDGVRGQADAEMLASTMLSEEALEVPPMRVVPLKNTSLGGIAILSSDHYVVKPVKT
                     PLHNSRGRLPILLSPPTSRATFFCGGPLHQRQVTHKAPSSSTPTVVGSLSTEQFCVPQ
                     TLSSGTTLFEAAGSLGRCRGGAPLVKLNHTSLIRRALGFADCRRLEDVPVHKYVTVTH
                     AAPEVLHRRLFSTASDIYAFAMTFVELVSEGGVIMKECLPENLPKPLTRRDEDVYGAR
                     LSENLNKWYQTRITALLQNHDAASKEKEQPESASPYAGSIAVRLPPHLSDECKKMLRW
                     CLQPDPAKRPTAAELLRSRYFMLGDWIAAPSVAEAEGKTVQMPEAPWMASISFDAAAK
                     AAGLPVLSAKR"
     gene            <813481..>817536
                     /locus_tag="LMJF_26_2070"
                     /db_xref="GeneID:5653136"
     mRNA            <813481..>817536
                     /locus_tag="LMJF_26_2070"
                     /product="putative cysteine peptidase, Clan CA,family C48"
                     /transcript_id="XM_001684161.1"
                     /db_xref="GeneID:5653136"
     CDS             813481..817536
                     /locus_tag="LMJF_26_2070"
                     /codon_start=1
                     /product="putative cysteine peptidase, Clan CA,family C48"
                     /protein_id="XP_001684213.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653136"
                     /db_xref="GOA:Q4Q8Y5"
                     /db_xref="InterPro:IPR003653"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8Y5"
                     /translation="MNLQPSTRHHCAAEGASLNSSSSPSFAVTADVAVEPCPAPQSTN
                     GDAFQSLTPFMSSSASSATADTQAHDPVARPGSVLPRPDAVGGPVRSPTIRPPPNMVL
                     SGHLHHRHSHLIHRSSASVAAPAETGSGRLQGLAAASSASAQTSSMAIRHSSTPPPYA
                     LVMDSLVRRYRAEEDRLSQWRQGGGGVCASAAFRRDDVQSRRQPRGAVEGEELTRAGL
                     RGTTGRVLSGHTSSAADSGLRGVLTSAVQRTALVRAAQAWWRSRRELQRMSSKVSKRI
                     HPATLSASPSAVAGAEAQHPSYAMPAAMPSAPAAPPAAPPFSSLSWLDAAGRSILGRL
                     SHSLSLSSDRGKSVRLELLRPADAAQPRGARRDHRDDTVDDSVMEGQQAPGAEMAEMT
                     AEAVPAGVATPVLSLSRMGSEALLAHPCESARQQAGAGGRGGALHRRQVDGEEGDLDT
                     SIASSTCSSRGSRVSGGGRVTLQSTEAAGDSIPRQEAGRTGRHENSGSFTFSRVGGLR
                     MHLLGGAATALSDAPEDSFRSAPRLLAQSRVRVARWLRRRQHLVAAKRSLRGVGVWPK
                     PTTAADAEHFDASSCARHSAAASPPFSTASELYRSAADAAPSPWESALPPTWADRSGG
                     DHMLRDGEVTEGATAASKRTTRAHVLEQLRAAIAAGMAACSAEQGGLVARQTTSEVQS
                     SSGEPPVLSLAAQRTREHADDLARLTESLVMLTEFDGGAADGSGSGIRAHRASNPEDV
                     KRASPMTLDQEQNVAAVPSHPSVGKATNAALPAWSPSCVHVSSIISAGQHRRSYHGNA
                     QDVRGAETRTRDGRSCVHEVAAETAVDAFRSLLTDTTHTPHDVAVRAVYEAIMSEVCV
                     PLVQRDVQHAMDVNSSAADRALTQWIERQLMVELTQPRPTKAQATALNDGSAASSAAT
                     LQPLVCTGVMRHIRSGVPVSLEHLRLDDADRQVLESVYARGASNAIAVKFDTGGYEIS
                     YRQLASLGPRSWLNDQVINNYLQLLCVEAEGAATASLPAARCRHRIASLGTHFYTKVE
                     SELSQSVDGFRSPPPRLPQLDSSSAVFRWLRHRKHLLEPYSPSDPRSVRAVLVPVNIG
                     TQHWALAVLDCADDRWVMYDSMSRSDRARQRGAVILAHLSHVWRECKRHFGLVNTECT
                     PAAAASVVAQDSPSSAAPQPSPWTSACVVAVPYVPFTDTLVTEGSSTAISPLDSLQPY
                     DSLDELHRAAKRIRHQEALFVEQTSQKVLQGGSDAGGVGAALAVRAAPTPPPPPLSLT
                     AATALPAEQLSDTEVEWFTGGFDHIPQQANGNDCGVFVCQVAWCVAQGVAVSFTQSDV
                     SRLREVILLELLSKRLLRRYPTANTSSSSGV"
     gene            <820642..>821769
                     /locus_tag="LMJF_26_2080"
                     /db_xref="GeneID:5653137"
     mRNA            <820642..>821769
                     /locus_tag="LMJF_26_2080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684162.1"
                     /db_xref="GeneID:5653137"
     CDS             820642..821769
                     /locus_tag="LMJF_26_2080"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684214.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653137"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8Y4"
                     /translation="MCGRDPSPCTVKHTFHPSPPLRPHPRHSSQEAKQNTKRRNTTKA
                     ALPKPESRETKTKTKMGGESSKHSNASAHVRSRERKRGAVSSALAGDSCRTDSCHERT
                     AHLRPSYGDILDSIPPSPVQCVASPIPLSGSLDPSLTWILDTEAALITEWNRDLQEVA
                     APSTGARGVPRGREAAAEESTLSWTKTSLKSGPSTAASNTPGLTSSSTFPALSGWPSP
                     THAKSPSGLALTCDSVDVRTGRSTGLTLRVTTTWTQQSSSRAKASTKESTSPKSPKAL
                     PKPLSDSVEGASPLVVSSLPVGIDYFRALQSRWLVQEQRSLPPATDEEDLNDSVILEA
                     VSESNGDVLSPPVPLGYMIDLFVPQWRSEGLFEAAQDHQMR"
     gene            <825355..>825696
                     /locus_tag="LMJF_26_2090"
                     /db_xref="GeneID:5653138"
     mRNA            <825355..>825696
                     /locus_tag="LMJF_26_2090"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684163.1"
                     /db_xref="GeneID:5653138"
     CDS             825355..825696
                     /locus_tag="LMJF_26_2090"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684215.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653138"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8Y3"
                     /translation="MNAASLPDRGDRALSVMESVPVGFDYYAALQKAWSRTPERQPSL
                     PPLATASEVNLSDIDEMLSGDSDYEELRPPVPLGLMISYFTVDWRDSGLYDVVQRREE
                     SLSQQSQKKKP"
     gene            <829140..>832163
                     /locus_tag="LMJF_26_2100"
                     /db_xref="GeneID:5653139"
     mRNA            <829140..>832163
                     /locus_tag="LMJF_26_2100"
                     /product="serine/threonine protein phosphatase-like
                     protein"
                     /transcript_id="XM_001684164.1"
                     /db_xref="GeneID:5653139"
     CDS             829140..832163
                     /locus_tag="LMJF_26_2100"
                     /codon_start=1
                     /product="serine/threonine protein phosphatase-like
                     protein"
                     /protein_id="XP_001684216.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653139"
                     /db_xref="GOA:Q4Q8Y2"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8Y2"
                     /translation="MRFSGTLMSANRTRGSDGVVHVEVAAADEHLYGPHTSTIRMNPY
                     VRCVHDSGVPKIRSLQELLSQKIQPDPAEPDTPCLRPSHGPTAAWPQAPEPSSFDDGH
                     ATTTSARCQSTFERHADPALAGAPAANNPSPVLTFTADSVATPNTFATVKTHEMRILS
                     RLTKRLRWCERHQDMPFGEPVEMMLAEADEGEDIEGGSEDRDSEVIDVVYAGRSGALA
                     PYPEDLTEKQDEAGVQLLPCSTRDKAEASALQETPRHFAAVSPPAAASNASPQHASDL
                     KEGTVPAPSSGGIFCTFAGGSTPPDGRKLHTTGGKHVDSSDSSPHQLRYTHGPQQQHS
                     RPAVVPLRTTYPAPVARLEESPYHYIMRNYIGGTFLYYSTPESKDYFLRLCHRVVAQV
                     RPLLEQETLSPHHGLFPRINAPAFVFGDIHGNFEDLSFFLKRLLIFHDFNLTPANILC
                     LGDYVDRGPFSLECVMLLFSLKIMNASKIVMLRGNHEDRVVCGDLRTYGRGCFLAQCH
                     TVFGYAEGTKLFREVTALFKYLPLAAELVIPSTPNLSFLRSQQTVMHPNLYVSQPAVL
                     LHDGNRTKRTASTTSLASASATRASPFGSQHHRTLHRDGEVASGDKEGDETLSKNSAS
                     MEAASPLPTGYSTIADASLARGQPSRHEAHEERILCTHGGIPRFDRSPCEENSLAFLR
                     SLSFPRMLTLFPNNPVAKDDAECMPDYFVKQELEALWRRYPSAAPPGFTAACRREAAE
                     AAAAAGAGAATATTGTPAASRSLNALPSSLQLQRKASNSSAGSSASGHEAAVEAVSPE
                     AEASSRLSSCSAASSVTPTATLVPGVQSEQQQPQGHKSPPAMRSSSDYLPQLTEDDVR
                     KGWYTMFDLLWSDPTPMELEEEAACADWESSRVAGGEHDAHRSSASSSSATAARGSTP
                     SVHVNEWGFTVNTRGSNVVSFSAKAVDTFLTAYHYSMLFRAHQEKAHGLRWSKSSKVL
                     TIFSSSNYMGHRNGAGCVVVAANGEVQMIEKVVTV"
     gene            <838659..>843977
                     /locus_tag="LMJF_26_2110"
                     /db_xref="GeneID:5653140"
     mRNA            <838659..>843977
                     /locus_tag="LMJF_26_2110"
                     /product="putative protein kinase"
                     /transcript_id="XM_001684165.1"
                     /db_xref="GeneID:5653140"
     CDS             838659..843977
                     /locus_tag="LMJF_26_2110"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001684217.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653140"
                     /db_xref="GOA:Q4Q8Y1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8Y1"
                     /translation="MSDRSLHGGHTTIHSNSAYHDAAKEERQHQEQRKSCMRGSHAAV
                     ERMTAVQVVDRLCWWRTHRVREQPIPVDHFVLRGSYVNYSSFGTRPLAPGVTRLLQKA
                     RTVREQYLRTQQQPQQEVLQQSRQVSRLLMTPTVGASVRSASSERLGSDARETERTTG
                     CISEEEEGQYGERQQLQLREMNDDAKEKVNNKRRAAVIASRPRSPRPLNEDAIACFGE
                     PAGQRDSATANIARTSVSASGSAGTSRPLVRAASGSAQGLDTLSGALYVPSEQEARAA
                     ERLLMLFRPRAASAPLRSRRYRYTAGHLDVKSSEFSGEPPLQRDWRPVEAIGLHHEHM
                     TPVSASDEITDVCRAPGAAEAVIVLHHAPRLVLYEKGLNPKAALRAARISSDTLESLD
                     GAAAESSAEVFALRNLPLCAFERFFYQQQLRGLAETRRSHTLGMRSASSTVTAARAES
                     AGGPESYTASAPKGAAADAAAAADTSVDDDIVANGDDAFFFGSPLTATLASSLKTVVP
                     MSSVGAAAVPGARGREGRDAAARQAVQYRGRGRDDRSNRRRGGRAALRAVSVPTLPPV
                     YKDGCPQMTVAASHHHLSSGARLQQQQQSSNRPSPILSAGLRSSKAPQDGAHLCLRVD
                     DLQDVYVFNPVVDIIGKGAFSKVYAAVPILRGKEGLRRFASPLLDGQAAPYGSDELSG
                     GGPRERVRRVSMMRKVSPVRRNSTSPALRMDPAAGAAVGDAAVSLRDDDETARRRPHT
                     QSLAVSPHSIPVVALKVIPRKARQKLKAVPDPPATTHSTAADAAGSVASNARQAAQND
                     QNSVRRELVEIEREVSILRSLHHTGCSQFFEAIRTPDAFVIAMRIFPGSMDAQRYLSR
                     YGVPSEARAALLLFQLVSTVQYLHTNFGLIHRDIKLENILLSEAGAGVPDARIREALG
                     PALHKSDMSTMMTEDDGGRKGCASTTTAAETRTAVQHRYSMLSRNVARLLRVTLIDFG
                     LARRTRASTLSPIVAASRGRSAGARHGSLNTTITSPTHLASFPPTSASLAAGHPQAPH
                     NPNSSSYSGSLGSPASPSAGYAAGVVTLAHGGNSYTPAKPAPPRLPLLCRPPSAAAGA
                     GTARLGLSNAGIGAMERSAPRVGMPSPMPSTANMFTRFLDLEEEMDEEENGGAAGASN
                     TTANTTTKAGDLGRSSRQEMAENEDNSGAFSTDVSASETDYESEGGSTAEPKEGSAPN
                     GEERRESGPQQEHMARNALMSPSVLSAQPQTPPGSAIIVSPPLPPAPMLLSSTTAFAL
                     DHFNAENSSSGCNTSGPAAGGAGLRNRCASCIYTFHQQLSPAPPVVAAGVSSAPDDTE
                     ATLLLTPCGTEKYLPPEVLSWILEHGWERRSTTVGLARAMDLYAIGIVAYVLLSGCFP
                     FNASSRATLFQQQQRVPRCNSARWAGVSSAAISFVQQLLEPDPRKRMTAKEALAHPFL
                     QEARQFAEKLSLVPHGEGEEASHPSTWRDGNHMDNHHRYSSGGTGRHYEDDANAHARS
                     HWATSTTAPANLPRSAPSPTHPHHTHSGAAIERVSTQPSGSVSLAVYDSQRPHAGGPF
                     ELAAADEPSPLSSSSSSSGAHHSGELLRHHVEGGTAPTATRASSGCHLSDAPRVCRSS
                     DECEEGDARASVTCDVPGKVQPMLQASKESPYPTRPSVPVTPTLAKLCTAALTRAAVI
                     ELPTLSSLAAHPVKPSVSSTLSFTVTGTAASADGGRAERATPPEPESAAAGSSAPALA
                     PGSKDAAAVKRSISLLPAATTSTARATEGGGDDLFESLYNNIMSSG"
     gene            <846229..>858708
                     /locus_tag="LMJF_26_2120"
                     /db_xref="GeneID:5653141"
     mRNA            <846229..>858708
                     /locus_tag="LMJF_26_2120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684166.1"
                     /db_xref="GeneID:5653141"
     CDS             846229..858708
                     /locus_tag="LMJF_26_2120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684218.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653141"
                     /db_xref="GOA:Q4Q8Y0"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8Y0"
                     /translation="MRTASSATFGSDFSNTCHEGSILEVEAREERVDPAGSGRHLPVP
                     ALRGGVTVGGTCHSSEAVLSGAAGTSLGEAFDGRRQSRNQRQFSAAHQQRLLPVPPSQ
                     RSEGGDDFMGTSRDVGFNDSFDGFPLYVDEDGVMKVSGHRRRDPFAFGYDAVEEADSA
                     TDGAREGDGGHRNSYHGGAGAALGSSSGTSDGALVSGSSSYSSSLYEEHYEPSHQQRG
                     RASIHGYRYSADTNAVARYLYTPLEMHYAGSAGIAAPYDDDGAPVPINAALPSHHHIV
                     SRRRRLVGAASSAEARLHNAKRRRPSRKTGKRARRRGTRGGRLGRRNTKAAAASHSSV
                     GRHGSHSGKHSSGCLPTRLSGSSPALLGTNPLLNIGGGNVAATASAAAAAGIHGGRST
                     LLSAGASINVGPSEAEKVVRMREYLLAREAAVKKRYPAARRNSAGTASTGATVGSDRG
                     AWKTAAADTLRVVASSRTGDRTGRTATSSGALASQRARGAGPFSPLPMPQKNLNRSIG
                     LNAGKAGAGSAFALAALRSARLRSKDATTQLQAVTTTGNSVYVRADPASAAAARARGS
                     DGKGISGGEGAPGAMHSTTLAAGTATHFEQRMMTLHDPYTGLAIAPAYTPLVTRTETA
                     VAVHTCAAGIQFFRDPTAPRPSAVAFLPSTSSALPDTPSRLVPTAYVLDVSNPPPAPT
                     PAGTATVSDEGSLRAFFGAPYTSTTPHMARSASAAYRRPTSFHPFGTSLKSTATPPQG
                     RQLASPGFLDKKSAKVHNPGSLVMDGNPSATSLSPQTLHSRDGVARVDNAATAAGDSA
                     QVRRCRPAKTDRFCDVRPRLTARDGNANAGAPPAVASSGNGCVALLDVSGPRSSDQYT
                     ATSLSFGDCARSWWRLQSGGAAAAGGYSSAAAPAAAADMSDSSDLFPWRWRGSASAFH
                     MRGGEGQDEVPIAAAWQDEAVRGCYGVWPAAVYLRGAADEYDVSLPPAGTSSSASAAM
                     PRFFAWPHPTPQRSAYPPSIAPYAALRHPQQNTRYHAWTAEGVSATSNTSCVVHVFTV
                     SREMLRSVYEYVAYMCVAKRHAELQRRRRKREEHLSEELAAGRLTRDAQRYLRCPHCG
                     VVGKVVRSSAARCDSEAMLSNPLLSSTLTQSQHLHQGRKRHHHNHHHSSASRDPPLAS
                     ATTTPQPLLFPQSSTPAASAPLELPVAQQQQQQQQQHTERVGWSASKSPSPRPTPLPP
                     QPPRRSAFGMGSATEGGSRVAVENTNVKVDECASAHRAVVVDEVSDAVATPPVSAVPQ
                     SPATALASRVACAPLTRGGSGTSVSSPALPPLPRSASLPPLRLQPQKRLQEEDRSSQE
                     SSHIRSTSAPQLPGVGTALLSSSPSPLPPPPLFIPTVGATASPAPAKVHTSPPVPGTK
                     GAAPAGTTNSSDTRVEALLDTFAVSGELSQSLHMNSQSYEPSARAAFDRYAGASGNDL
                     RALRQQPPTTVLARGAHEARPLDESATALLPRKTAEERGRATSEDAALQQSSSRAALA
                     NSNSHSLRVGGIDSDAEDGRRGRAGSVAPHTSGSTASHPFTTPTATSPDRSMLMAPTG
                     TRDTTATHDTAAALSALVASADSSPSKCAPPTATSVATTTAAAVMTTLNAEVRVMGSS
                     SRSNPNTNNMSGTNSLLCLMAGSTLTPALPTLARWPTPLQSQAGEDDGDNPAVAQRWC
                     DTDAPETARDHDLSGGASYVCLGCHRDVIPKQSFLTSISDHSSSHRHSQHAHHSAARH
                     SHHTNNNTNSGGGDANVDDGRTEQTVGADIGVMAFEDLLQDDTFTYALHTALCELLMM
                     PSTREPPPLSPPLPTAPHKRSRKRSPRTSAARTDLNGFLHPVLPSAPVHQTDAPLQHS
                     SEDTAIAATDAEGEVRRAAAMDVGALSCLSPGVPHQQSPEAMGGGGAVSFERIGSYIG
                     DTEGELTQQQREPPTAPPSISAAPSSSSTSSMLTSLESSSTAADREGGCCSAASSPVR
                     LSLPCRGLTVSVLPYVEPQVPPAATQERASHSGIQRRGTTEKHLIRGRHAIRKTIGIE
                     RLPRQSFGTLASLSRPVIPRMREDAATRGLTPSTMLMSDAAASHQRRRRSCSKQRQGP
                     RIHPDTPPRQGWRRSTSTAASKLTSMESPPNAARMHSAAASKALIMKGTFSSEKHRIQ
                     VNPRTPLDAVIKNRIMKRIFRQERLGSRSDTTAAAVARLSETERRYGKGLDPIAAAAA
                     VSRRDGAGPAAGVPVSARGSDMRRRRCPPHHRCSYTQKLAQQHAQLLLPPGRVPKQLG
                     LDLGAYEDSSLVLEIDLAYPRLPRGNVRELLAEWKGTCQPHPVLVEAVIRNIVYAVLV
                     QLSTLHAAGRTHGSVKSTNVFPLWHAMEGTRESGLMMPPRPRQRPTSPSPLAVAHAKY
                     EAEPMHERGGKAEATITNEAEGERPRTASNAEGEGACESGGGSAAVPPATNQAATVPQ
                     WCTSETSTSPTNPRSLSNRQRHLAPHTAAAHLRLSQTMRSRNRGAQSRIKPARGFGAA
                     RGTPSAAKSSASAALPGRSGAATADASSTGLATAMAVYRPSSFSASTGCSLCTDSKQA
                     DPSTVPHMPVGLSPQSSMPSSPSAVLSSEPMPTPTVASACSPCAALLTTDAIQPYHPN
                     SCSRSTTTFSPAIGMMSNSTRLRRGGGAAARLRHGSIGTNVGGKDDVCDSNGDAEDED
                     DSALVPLVAEVLTLSSTVLRTSAAEPGTAEPQTQLQNGLWGTPPMNVMRPCASFAAVP
                     RHRDYRCGPHRSRQGRGSWSSAVEDPEEWLASAVPRRYVCGVELRPPAAVWFPRVAVD
                     KAALAGKKPSVDHGVSLSADAATVLERTSDVAAQPVLTQGPMGAVPHPRFDSIGSDDT
                     NAPEAATAHRERRRSSSAGPSPSSSAALHGASDGAGQYTPDPLQWSRQVLLVENVGAV
                     VAAALRTAMACVLMRHPPCQHPSPLSSPLALATSTKTPISHSEKACHAADALADPATA
                     AAERQGLRQAACSKPAAAAASQRRTRVAASAPALRVHVPDVVRSPPPLPPNLFSIQES
                     EYVPAPELIRFSADEARALRRPWPPHPSGAAAADEVEGEQAAGEHPGLCHSSMAAAVD
                     AGAEGAAQLREALARLEAAASPMTTLLNTLDPYPAVSAAADIWELGMMARELADGPPP
                     MTWLKQREPAPALRTYPWSSYFHAFVSLCLQRSPEQRGTAAELLRHPWFSVALVPQAS
                     LPSPPTAMRSNGSDWGQGTAGSGAAGAPVESRNSAAGFQGGKTGGAAPVSPSTLPLLP
                     VRPPGVMGVGCLTAEEKAEWENYDYTLLYASGAQSTRPLTTSAAAATAAVATAAENHH
                     PSGNSSVRLECPLAHQTQGATTSASAVSAGARNSREASAADAIGVGKTPSLLGQSLRG
                     TDAPSPLPAAAAAAVMASQSSALTVSSPGGGTAVGLPSVAAASASPAKASANDELMTS
                     MCAVDLAQSFAELIAQRWVTQQQQLVPSLATAAGAHDGAAKGRQSMSPSQRNFFTAAA
                     AVTSLDSASPVFLSVISPRCTTAGAAAAAAAYNAASPRCAPSTAGQGAVSQQQSELLR
                     PKISSDEMMVPMWGGHSTAFSNNASLSGQLAVVPVVSPRGASSPLLLPPPEFVGRGVG
                     RLLPAYLPTLYVPLLDPRGDPMLTPANAWVPPWTARTIGEWGGMAGIQSQPQPQQARS
                     SAALGAVPPWFQLSTRVSAGSSNSLMYPTLQRFSRGDGSVSGGGGSRPVLHCDRGDPD
                     GNASTGSDRSSNSQYHGRHARTASGSSSQSSPFSSTLSDSDSDSDRTASGGLQVVRSG
                     THVHASEGRFYDACMPKVGGEVPVPTRTPPQHLNDTLNTASPPLNNDTASRSVTFKVG
                     TSEQRAGGGYNVMVYDPTTDSSRAAVKEGVFSFCAAAPTLRPPGSDEHWSRHGRHGGS
                     SGRGDDGDYGAVPRVSSPSSSRPAHHLSGTIATALARLSMIAYLPTDADGNWSETSSS
                     SSSTIDSSSDSEDGTRYSDRSDSAILSLMWGPSVCQSTPLESDDKTAYMQGFVISGDG
                     TSCEEPNEDDDGPSMSAEVRCDELLRCLSVLQRNCPAAVSLWCVRVLQQAMRHPRTAA
                     SAARVLERIESLLPKGWVRNLDWLKQPDGWPSPPHSSADPLGKGDAQRRERVADTAGD
                     GSSSLSGVRVAVRVSSRSSAGALPPAELDTSPSTFQNYEMAKWMHALHQVLQRCT"
     gene            <859316..>860083
                     /locus_tag="LMJF_26_2130"
                     /db_xref="GeneID:5653142"
     mRNA            <859316..>860083
                     /locus_tag="LMJF_26_2130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684167.1"
                     /db_xref="GeneID:5653142"
     CDS             859316..860083
                     /locus_tag="LMJF_26_2130"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684219.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653142"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8X9"
                     /translation="MATSAPLSKSSSPPKQQPNAAVAKRGATLTGKPKSTSTLTSHKD
                     PVVYHGSVILNNLPVNYKKVYTHTVRRFFTSAQQQHIKDVRLIEEIGNATLCVEVDSK
                     ATAQLFFRQLQNRRVYGRRWKVQYVPTSATDCSPEACLVDCFLVPPASKNLAERALSG
                     IPGLLSFIDTPDEPLPATAAAAASEPSPIQDADNDSDVDGGEWDPYQGQQRHRLLVSF
                     ADEGSALHARAVLSGRLVGTSGVRMFLECRRGGDAVP"
     gene            <861115..>861456
                     /locus_tag="LMJF_26_2140"
                     /db_xref="GeneID:5653143"
     mRNA            <861115..>861456
                     /locus_tag="LMJF_26_2140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684168.1"
                     /db_xref="GeneID:5653143"
     CDS             861115..861456
                     /locus_tag="LMJF_26_2140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684220.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653143"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8X8"
                     /translation="MSRNTKEFNRQADRFTEEYTEQRIALEQCLQSRINDDINFVCQR
                     QKSAYLEGIAKIFCKREYDAGVVCQRAAGDKWASDCFKENVAFGQCTDRVLKQLYVYN
                     LEHNKKSPGAN"
     gene            <862627..>864303
                     /locus_tag="LMJF_26_2150"
                     /db_xref="GeneID:5653144"
     mRNA            <862627..>864303
                     /locus_tag="LMJF_26_2150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684169.1"
                     /db_xref="GeneID:5653144"
     CDS             862627..864303
                     /locus_tag="LMJF_26_2150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684221.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653144"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8X7"
                     /translation="MNGSLKLPPPPAATAAEGDVSATLYLTAQRWRSYLLEHSVAFRR
                     LQEERERGWRSAALDEWYARRQADTTRSLATSATVASPSRLASELAVKRGTQAGEGTT
                     AFVNADVTVLAERYRQHARRITQHVAGAFFRAAPKVNSSESSTADEKPVSSAPLFLDL
                     GCAPGGVSKYLVEDLGWRGVGVTLARADGGIEMDPLLLRKSTCGDASFVLLDGDVTQP
                     PSTWNRSAACALMEGESCATEMQAQAGFGASSAVYTADVLPLSASLFKSNSAAAPRFH
                     FVNGGAVLDHGQRQRRERAEEVTLASASVLSGGVMLRASASGGADYVATSLTDSSPSA
                     CAQAAAPILPWFSLLVPQLKTALTYVATGGALMLVHGAPHCASMFILMRCMEEVVGVA
                     AGTPTSASRGRVHVLETMHLAKAPVYLLWTGVRPPRKDLSDGAEARALQDAQTCLLEA
                     LSTTSPRIFPLCRTTSSTPSITATGDSRALLREKQRLWLGESDEGFELAVDGFQRYGH
                     LVEVVWGKMEAFLRQRRERAEREVHSGGGDPRRNRRAAPTAGLKRMRSDG"
     gene            <866355..>873146
                     /locus_tag="LMJF_26_2160"
                     /db_xref="GeneID:5653145"
     mRNA            <866355..>873146
                     /locus_tag="LMJF_26_2160"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684170.1"
                     /db_xref="GeneID:5653145"
     CDS             866355..873146
                     /locus_tag="LMJF_26_2160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684222.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653145"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8X6"
                     /translation="MFNTDAADAFYLRLGNTSCLDVSTKKYSPTSSRQGFLRHRGDSL
                     GGPGDSHAYAINDAYHHTSHSSKMLALPFQSQSGSSRAYTRLEGAVEPRTPYEPVNSC
                     PYPSTTTANPSSATTTGGALHLPAAHRRVGASLPVAGSGVWERADYLPRSCRVSSAAA
                     PPASVVHSSDASRVTAATSTRFAGGGGGANLPPQRVRVLNRNGVNGARLYGSMGATTL
                     SVARGVRAASGTGSTQRPSSAPSAMSAAASGRRDGAPSAAYTTNTYGSRGDEFGRLLA
                     ASASQSPLASAPRSQRATEHELRTSVPVAPSIHGLARYSSEDASVARRSAAASNGSGA
                     TSWTAGQRMRPYLPLSSSAMHKRTATAALEQDDGDYTKVSAVPAHSTRWSADPPSSMA
                     SVRSAPADASSPRGTGESALSAGSPKRLQSYKVSSTVAEQDPRSSEADAAEHDIDEGA
                     ATWWTVDIVINSAPCHGGSAYEEAAAMKAAALLRSPADMRTLRSVQCRAPVLPADASA
                     DEAWAMTQSLLRCIALASVGASSPPCAPQGYFCFNTDFNEYVQLSADTLPLASALFSV
                     VMVASSVDTALAEERRAGYAEMSDATTDEAQTALVSTSYPALHDDYLLTGAAPSCNHD
                     GAAPHHHWNDAAERGATAVTPRPPRGRRTSVLRHALRPSLQPHNWEGVTPSPLPPQPS
                     AAAGSTSRHRPAFDGSTSSHHHLTPVEEVSPYPQCPRRSYESAVMSPGARGDGDSADV
                     ILTYDGDTGEDDSYPMISYSVESDAGGAVYGAASSRAPPTSCKGPAHGHYVDGDCAAG
                     EAMNDAADSRCGNDAVGYIDDDGEAAPQAEAEEAIDANVVCTAKAAEHQLRASYGISS
                     SSSSPEGTNHLRCFHNAPPSSKPLTQPLSNPSTTHGDPARLERDSKASPQRPPTAPTQ
                     GYSRVGVFAAMQRPSPSALPAAPLQPPQQHLFFDDPVLQRYFESACKQAPPSPQHAAG
                     NAEGGSGGHYPIYVPSPPCAVPVPPSPPLPPPPPAHGAYRPGAHPYFNPSPSTASSVP
                     GFAPTPPFSACGTETLTTTMNRVQRDALNVLLQRSAQTRQQAPSSRVPFRPPPTPSSS
                     GDVAVSAAPLRATASTRPQAPRAAVDSAVDPAAAATGGIASTAHWLVTPSLSSLSRPL
                     PLLVTGAAVPQAVAAPPPTSAEESTDAPMRQDRSPPPRKEELSAATAVGVDVPREVEA
                     DASVSAHAAAAAIAALPKSRADAVEATSQDDQHNREEAQRHHSTHTAPTLEGGGKDKA
                     AAGMNADTDHGAERPTVVTTAAAAVEESRKSRGCGGDALGCLAGAETTPTPAAGSSAP
                     APAADESDAVAAGVEAPKESARTSPTDTDMELPASAVDAEEFGTLSASESAAAKEKNK
                     NDCSHSQNHAAAPDAYPVEAGDPDTILTVIAVAARQAAYKVADHLPEQATLSPEAPYT
                     AATARPAEYPTEAPRAQGDGDIAGGAKAPGESIRNCASAAEVVDIAAPDSTSDLGAHI
                     AAAEAVGKTPASDSAAEPVDAGQPGRQQEEAGCTPEDDTPDTNVCVAQLEASTCADDV
                     PLLLSEKQPSSVADDISMNAEGKREKGEEVDLACLAEPALEVSPEVHGDEHHAVVGEG
                     SKAASPLQSDHNAELSATTDNDGNKALSEAGTSVTQQLKRTSDASDSPQALGSDSDDE
                     MANAVAVDMLSSESVVAEKNPFGAATEAKALATQPDVAAAAAPVIVGGDSTPFLMIAA
                     AKFLPAPVILVATQREKDEDPDAPPQVLHHRAAAAAAAAAANAFYGLWEESMTEDGTG
                     DGDDAGGADHSDTTAVGGDEEEGGQQDRSATSEAVTTATITTSEDDIEGAVDVPMDVF
                     RDSLSLTNTPTLIRRDEGRDENTSVAATASLADPIDMLTRTIGSDMRLPLASRAVTLV
                     ANPDAGIGSTDVHFHLRQEFPSAVASKATGGAAAAVGEIGVAAEAPRHHAGNEASVFS
                     AEVAQRVQASSRAAHFVSPASASSPPSAASQPVASPNRSTVRTTVDANAGSDRLSSAL
                     REAEASPDAIDDGPRVEPHRSTATRVDGPVLPLFEVSGDVGGDGAATLKIPMPTAALE
                     VGAADAPQPSPLLLRPFAPTSQTSKPAVPLPLSPAQVLSLPTPSLLPSPPLSEGAMRK
                     TMVLLGFPGSAWEFIMTHHYEGMHDAFTKDSAVAANVPISAIQDVRYSKGSLMVDLYV
                     LHPASSSENFIRDQMSSYAYPTLWAFYEVKKRERKQLLHSHRMGVAGAMPAKRLSPLL
                     MPTLSSQEEVSWTAS"
     gene            <876624..>884969
                     /locus_tag="LMJF_26_2170"
                     /db_xref="GeneID:5653146"
     mRNA            <876624..>884969
                     /locus_tag="LMJF_26_2170"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684171.1"
                     /db_xref="GeneID:5653146"
     CDS             876624..884969
                     /locus_tag="LMJF_26_2170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684223.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653146"
                     /db_xref="GOA:Q4Q8X5"
                     /db_xref="InterPro:IPR003302"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8X5"
                     /translation="MQPPPLSSLQRGDSPQKIVCAQRAHDAISALASGHRSASSLPVA
                     RATEAAEKARPSTSRVLAGPSRLLGQQQQAPATCQRLQRRGDVDTLPAIGHLQAARRV
                     TNTDWFHPLRALERQRQTAAEAYIPYTIAAAEAEDAQRARLALAPMPLDWGCCEAKYA
                     DDLSVQRPSSAKAHRDVDAVIPAQTRLSNVGLLRRLSFVATEPSPRRLLTREPPSRSC
                     RGGGSCFSAAHPTTSRCGASVHTGTKDEMADTLTEKVDAVTPTRESLADMPALPALES
                     AADLDAHLRCISRQYARLDRLLRGYSTPDDHDVVAFRVVPTETPAPLPQEPAPPCLYP
                     QPPPFTSVVRLVVQPSIQLSLHSSLSLGAPFSSFYITPAVQLTRLSATQVQGLPSFAS
                     LTAATSGAVSTPLTSANTALRHFRAGKRLPQHPRHWHSVSYQDLSNRHSEHHPTSART
                     PPYTGAHDARFRRHSACLMEGPFHNLLYHEQHQRSQIDADAHRALSTVRTLHTQYCQY
                     LEVTRSQQKTCETAPEIHEISRLVPRYSSKKIENRQTGNHHHRQLLNFSHPNFTKKPA
                     SATHAGAPQEAYEDVEEACRAGAPQEAYEDVEEVGHAGAPQEAYEDVEEAGHAGAPQE
                     AYEDVEEACRAGAPQEAYEDVEEACRAGAPQEAYEDVEEACRAGAPQEAYEDVEEAGH
                     AGAPQEAYEDVEEACRAGAPQEAYEDVEEACRAGAPQEAYEDVEEAGHAGAPQEAYED
                     VEEAGHAGAPQEAYEDVEEVGHAGAPQEAYEDVEEAGRAGAPQEAYEDVEEACRAGAP
                     QEAYEDVEEACRAGAPQEAYEDVEEACRAGAPQEAYEDVEEACRAGAPQEAYEDVEEA
                     CRARAPQEAYEDVEEAGHAGAPQEAYEDVEEVGRAGAPQEAYEDVEEACRAGAPQEAY
                     EDVEEACHAGAPQEAYEDVEEAGHAGAPQEAYEDVEEACRAGAPQEAYEDVEEACRAG
                     APQEAYEDVEEACRAGAPQEAYEDVEEACRAGAPQEAYEDVEEACRARAPQEAYEDVE
                     EVGHAGAPQEAYEDVEEACRAGAPQEAYEDVEEAGRAGAPQEAYEDVEEAGHAGAPQE
                     AYEDVEEVGHAGAPQEAYEDVEEACRAGAPQEAYEDVEEVGHAGAPQEAYEDVEEACR
                     AGAPQEAYEDVEEVGRAGAPQEAYEDVEEACRAGAPQEAYEDVEEAGRAGALQEAYED
                     VEEACRAGAPQEAYEDVEEACRAGAPQEAYEDVEEACRAGAPQEAYEDVEEAGHAGAP
                     QEAYEDVEEACRARAPQEAYEDVEEVGHAGAPQEAYEDVEEACRARAPQEAYEDVEEV
                     GHAGAPQEAYEDVEEVGRAGAPQEAYEDVEEACRARAPQEAYEDVEEACRAGAPQEAY
                     EDVEEVGHAGAPQEAYEDVEEACRAGAPQEAYEDVEEAGHAGAPQEAYEDVEEACRAG
                     APQEAYEDVEEVGHAGAPQEAYEDVEEVGRAGAPQEAYEDVEEACRAGAPQEAYEDVE
                     EACRAGAPQEAYEDVEEVGRAGAPQEAYEDVEEACRAGAPQEAYEDVEEVGHAGAPQE
                     AYEDVEEACRAGALQEAYEDVEEAGHAGAPQEAYEDVEEAGHAGAPQEAYEDVEEAGH
                     AGAPQEAYEDVEEVGHAGAPQEAYEDVEEACRAGAPQEAYEDVEEVGHAGAPQEAYED
                     VEEVGHAGAPQEAYEDVEEAGRAGAPQEAYEDVEEACRAGAPQEAYEDVEEACRAGAP
                     QEAYEDVEEAGHAGAPQEAYEDVEEACRAGAPQEAYEDVEEACRAGAPQEAYEDVEEA
                     GRAGAPQEAYEDVEEAGHAGAPQEAYEDVEEVGHAGAPQEAYEDVEEACRAGAPQEAY
                     EDVEEAGHAGAPQEAYEDVEEAGRAGALQEAYEDVEEACRAGAPQEAYEDVEEVGHAG
                     APQEAYEDVEEACRAGAPQEAYEDVEEACRAGAPQEAYEDVEEACRAGAPQEAYEDVE
                     EAGHAGAPQEAYEDVEEAGHAGAPQEAYEDVEEACRAGAPQEAYEDVEEAGRAGAPQE
                     AYEDVEEVGHAGAPQEAYEDVEEVGHAGAPQEAYEDVEEACRAGAPQEAYEDVEEVGH
                     AGAPQEAYEDVEEACRAGAPQEAYEDVEEVGHAGAPQEAYEDVEEAGHAGAPQEAYED
                     VEEAGHAGAPQEAYEDVEEAGRAGAPQEAYEDVEEAGHAGAPQEAYEDVEEAGRAGAP
                     QEAYEDVEEVGRAGAPQEAYEDVEEACRAGAPQEAYEDVEEAGHAGAPQEAYEDVEEA
                     GHAGAPQEAYEDVEEACRAGAPQEAYEDVEEAGHAGAPQEAYEDVEEAGCAGAPQEAY
                     EDVEEAGHAGAPQEAYEDVEEVGRAGAPQEAYEGVEESTDAAEPLWGYESCDGVSGVL
                     VWEPGMQRWDDFGVVGMPEFGGDVESGRSAIDCVRKDGYRCGAPEVVYDESGNVVDVC
                     VWFPDLTLDAGAEESGVGEVFTETCGLWRSVVTSSKQLLRGPRWRQHLVSCAPRIREL
                     VIADVSAMLDCSAACVRNVRLYAASAAAASGEIAAVGRMEDDILCIELGIIQEATVAL
                     HPLGGVQFLLDSCSFPYLQQWRRSRDQLECKREGVAHGSLSPLSKVAALFTNMEGDER
                     SGRAQGVELQLWAYSTKGAAARFRGRSVVKRLPLPSARVVYQPERRNCSEGSLGSLSY
                     LEQETVLSDPTDGASSGRLVESALRGKVHTCKLPASAHAARGPLPTLPVPSMPLQMAT
                     PSGIEEIIKQEKEKARNLIATRPVATPLTVPAETLAMTSQPTEMAGLPKEAVQKANPR
                     GFFSSGKRTHM"
     gene            <886919..>891565
                     /locus_tag="LMJF_26_2180"
                     /db_xref="GeneID:5653147"
     mRNA            <886919..>891565
                     /locus_tag="LMJF_26_2180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684172.1"
                     /db_xref="GeneID:5653147"
     CDS             886919..891565
                     /locus_tag="LMJF_26_2180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684224.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653147"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8X4"
                     /translation="MRSRRQAVSDTVGTLSMDPWNDDRVRDFVAINTIQRLRAYHLPT
                     SAPMPVIDEVNTARALNLILLPRADPDYRPCLGEQPPSRTQLRARRRATARQERRERR
                     QRQQEGAGRGGQGGCSPESPSTTASTSSSSDDGSNVDDDTAIEHGATLSMTNSSFSTD
                     IATPTKPARPRSPVASGAAPSRQCAIDRARSLFFGALSFTSSTSPRRLVNSPHAPLTP
                     SIASTTTIAGRSSMHVPRSPKEAFLSTTASPLSSDARAGQRRAGREVAAAATEEGLVT
                     AMPTAPPALSATRSLGMELDAYIEANSTPLRPPPPMRYVGVSAEAQTPVSAEANASES
                     DVSANSSAVVGSHDASKSEADALCESTPTKTTPAAARPPSPRLVRAEGGRTTTPPPSH
                     GGGGRRSSSTDIMHTCDVCDAIIQYYQSMLTRGVVLDRYNHKDLAFVWWVLGRNMDVA
                     ALENRGPMRREALMITLRNFYYTLLTAEEARAKVAAGEAEKSHAEKKELAGTGVPAAS
                     AAPGVQMTLPRSADAAATGDQQAEAADTEEHSRCTSGKAAESSDNTADALADASVLRR
                     SPRARSRGSHTASASAASAASGRQRDSLRAARTASGTAALKRSRLDTPLVSSGSDDEE
                     RDDEHLVEEDVGDGADEQERLSVTPSRGRTSVPSPHKKLPHKEGTTLTARRRAVADGA
                     LGSSSSATGKGIAAALLAEDEETVMDVVAEGVDDALDKEADTLHSQTESSVVSRAGSV
                     AQSSTGEICRHHRRAAERSKAVEETWVSTRTGRRAAAVKAAAQLVHQGAADAMAHRKS
                     TKAVPFTNASGTSRTAASKTLKQEASTTAAAKDAGATAVAVIPSAPAGGSATSKLQPK
                     RRTGSKRARSPSRETSPGEGHRGRSSDSGGDSDMELTKAEAKGSNTEAPRMVSRVSAS
                     KSKSRAAVFTKASAVKAERVTPIVHPLSGKPTAPPFDAPTTTIPGSVAAAATASKKGG
                     RGEEHRGRPRGSFKIPRVDSSAREDQGNSLLASVTLSSQRRRDGGACSTAVFTGTSLE
                     TAAPHQRSDAVSMAVAPSSSSAPSKASEDAVPLKFPVYEMPLRLTPDQRAVRSRIQQR
                     MGVPLPAPPPRSSAGSISYDSGIDAQWATVYSSYTFLLSSFRTATWTRISQGGGGHER
                     RAITAPVLWYGQAISPVVAGRLTSTSSSGADHSRQVREKALAAMLSEDALVNGGAPSG
                     AAAIATAAGTLTRQRGRKRRIEGGVDPSLRGNVLRHDQVALERLVKERVVQVAELRQA
                     AVSRTVERGQGKCRASGSGTAQVKQEPRSGSEEEEKQDDEVHVLRAKPAVGLPMSPTG
                     VSPAVAATTPLDPAKRAGEGADATAEEALAPEQRRDNSAQLPLLPQASAFGDLPYAQQ
                     CLLVWSAAGLLERHIHRLQMEDARRERLLARCGRMATRRMAARVAAVIQGGIADGNAC
                     DNAEDAAAQLAGELRGGDEDRDSGASREDSDAPEERTRSRILGLPSGTSRKADVEEHI
                     DRLEHLSGRSASLRSPSAISSSASSEVRFHKSMRPLPRRVYDYWAAYRRAGDSG"
     gene            <892243..>893457
                     /locus_tag="LMJF_26_2190"
                     /db_xref="GeneID:5653148"
     mRNA            <892243..>893457
                     /locus_tag="LMJF_26_2190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684173.1"
                     /db_xref="GeneID:5653148"
     CDS             892243..893457
                     /locus_tag="LMJF_26_2190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684225.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653148"
                     /db_xref="GOA:Q4Q8X3"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8X3"
                     /translation="MLHFLTGVYNSLFSTPEYNVLIVGRECAGKSTLLEQLKFLYTPA
                     VQQQQQASLLADRSSSSAGEKTITATTNIVTEAPTTPPQQRRPRAHPLPPGTPLPATA
                     TQLAQKRIRPTVGLNYAVVQHRFSPPVSAVTLVKKSQLPLQAVASLPSLPQDLLYEQR
                     ARQQEVMANAPSDAVTRVVLRDLGGQAALRDLWEKYYPRSQGIVYVIDSTLPFRMPSA
                     SPSSPPSATEKPPRDHFTKQELTEAYKQDRDLLARLLQHPLLHGVPVLILSNKTDEVT
                     HIPLTILQEALQLAELAADPTFYLLQNSSDGNKASEELESQQRLHDKGSDGSGPSQLP
                     GAAASPIGAPLSRRCTSAEEVQLRVGGSGFGEVSMRVVEVSALDGVGVAGAMDWLMAQ
                     LLRHARDVDSSA"
     gene            <896340..>897935
                     /locus_tag="LMJF_26_2200"
                     /db_xref="GeneID:5653149"
     mRNA            <896340..>897935
                     /locus_tag="LMJF_26_2200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684174.1"
                     /db_xref="GeneID:5653149"
     CDS             896340..897935
                     /locus_tag="LMJF_26_2200"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684226.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653149"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8X2"
                     /translation="MAQQQPHRRYEGYAYPADFQSAPTGSRDSGGGAYFGRERIPSPS
                     ATSLSGATGLVRRSVQHTGAAAVATASTGANAAGYQGSYGYFHGQGNSIDIASGYNSD
                     AGSSTSNPLYGGGCRSGYIVPNTSSQHQEVVVGTSRSSAGASGANSAEPSPGVWAAEP
                     CVNGLTASGCRLSQLPPRLHEPSIFQLSSDGSAGSITNSTIGSTSARPPTQQTFLPSE
                     PLMQALPLPASQHRRHHYQQQPYVVSMPSSAASNLQRGTASGAAPPEAAFVQRSGSFA
                     ASPINVSGPRMPAAYDASASPNIAGGGVFSSGRTSGFLGRFVAQVLSVLDDSAGDPGR
                     GIGAGSAAPIGERPLHQLRFGNASDDLPLLEELGIVPRHILDKARAVLNPFKPISVDA
                     AKDTDLAGPVLFALSLAVLLSLRGKIQFSAIYGLFMLGVGFFKMLLSLMQPRGGVPLQ
                     FVASTIGYGLLPTVLLAAVRTVGSWIMGLRGVLPLTLLMVAWSAWCGTTLVAKGLGME
                     EQRYLVLYPMLLFYSTFNVVAVY"
     gene            <899145..>901757
                     /locus_tag="LMJF_26_2210"
                     /db_xref="GeneID:5653150"
     mRNA            <899145..>901757
                     /locus_tag="LMJF_26_2210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684175.1"
                     /db_xref="GeneID:5653150"
     CDS             899145..901757
                     /locus_tag="LMJF_26_2210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684227.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653150"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8X1"
                     /translation="MPRSAVTATPRARRAGGGSGSSPTQRPSRRSGKADTHASVPDAV
                     FQVETLLEEAPHAGREAEYESVVAFVSRRLSHETNTSLFVCGGCGCGKTSTVKRALRA
                     ISARVLPCDAKARSLIKRSTLEECGWQTCVEDGDDAASVTADATCRTRKALLTTPTST
                     PRSSRQLSAEEGRSPSDANGLTPSSSASLAAALSHTTSPDTSRTSASSLAAATATRSA
                     RLALHSPESSRPSDSSVNSTATLLEAASPACGVKRGRAADEWEENSIRSAELDRQATA
                     VLTRGEGAWRQAQGLEQEVPPRHQPEPYSLAYFSMRYPELFSSDGTLATASSSSPATS
                     QFRQIFGHYVNCADVSGPLLVEAVCDSIRATCSRTDGATQLLLQWLASIGKATSSRAQ
                     AIGGAAAESHAASTSAASKRRASPPALHVVALDEVEYLRGGGAKMLTLLAALAFHHPA
                     QLALIFISNQRAFVHVPQLMLELLLFQPYSEAQLREIGASATNAELQRCEQLVGAKVR
                     KTAARSSAAGHKRLRASDVDIKPRLYDYIARKALLEFSGDVRQVIAMCHRVVSVAWRE
                     VAEAKLEAAAAGAATAATSTPPAMARSDSSSTAVVRNTSVADFSSKLEAAVEAYRVDK
                     CAAATTQVSTTFSGTSQSSSDAAGIKDTSSTRPSGAAAASCASLTAAAQLAPVPSSWT
                     PSSGVMTLAKSVRVLQSNQVESDIDKHVGTLPEQTLYVLSCIVVLTLRKQEERTYAST
                     SVGGRIGTTRTPGAGRTAAQRAAPTLSLKMHEVHQLYTRLMAKLHFPAMRADGFPVQV
                     ECLADFGVLTRPQLRGTDRVFSLNGTWTLPAMQAALVKRGEAIKQDRTTAGAGAMMEN
                     RFEEVLRELANLVK"
     gene            <902508..>902759
                     /locus_tag="LMJF_26_2220"
                     /db_xref="GeneID:5653151"
     mRNA            <902508..>902759
                     /locus_tag="LMJF_26_2220"
                     /product="putative ribosomal protein L38"
                     /transcript_id="XM_001684176.1"
                     /db_xref="GeneID:5653151"
     CDS             902508..902759
                     /locus_tag="LMJF_26_2220"
                     /codon_start=1
                     /product="putative ribosomal protein L38"
                     /protein_id="XP_001684228.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653151"
                     /db_xref="GOA:Q4Q8X0"
                     /db_xref="InterPro:IPR002675"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8X0"
                     /translation="MPREIKTLKEFLAICSRKDARCVKVKHNPSATKFKVRCSRYLYT
                     LVVNDKKKADKIERSIHPSVKKIAVTARSHAKTNAGSKQ"
     gene            <903854..>905194
                     /locus_tag="LMJF_26_2230"
                     /db_xref="GeneID:5653152"
     mRNA            <903854..>905194
                     /locus_tag="LMJF_26_2230"
                     /product="putative GDP-mannose 4,6 dehydratase"
                     /transcript_id="XM_001684177.1"
                     /db_xref="GeneID:5653152"
     CDS             903854..905194
                     /locus_tag="LMJF_26_2230"
                     /EC_number="4.2.1.46"
                     /codon_start=1
                     /product="putative GDP-mannose 4,6 dehydratase"
                     /protein_id="XP_001684229.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653152"
                     /db_xref="GOA:Q4Q8W9"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR005888"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8W9"
                     /translation="MPLNGTAGAGAGVPSPSAHPQAGIASCTRNGTTGLTEHPAVLTA
                     HGDAHARDLLQHLPGHRILVTGGCGFIGSAFIRHLLMYAPASVHVFNLDTVEYCAGVD
                     AVLGPLAATRDDDRAAACSGASVSEDANGTVASCSLSCDVSPVSRYHFIAGSILDATL
                     VLHSLRTHHIDIIVHMAAQTHVDHSFSRSVLFTQVNVVGTHTLLECARQYGQLTRFLH
                     MSTDEVYGEVPATARPANEASTVLCPTNPYAATKAAAEHLVSAYYHSFKLPVLISRGN
                     NAFGPGQYPEKVIPSFIVHALRRERLPIHGDGHHQRRFIYVDDVARALCTILVRGGVG
                     EVYNVASEREFSVHEVAQRVVACVAGDDHDKVIAASRADFDASYVRYVADRAYNDARY
                     CTESEKLAALGWALEVSFEEGLRRTVAWYRRHPLKAGGYWRGASEAGATAPCSD"
     gene            <906024..>907430
                     /locus_tag="LMJF_26_2240"
                     /db_xref="GeneID:5653153"
     mRNA            <906024..>907430
                     /locus_tag="LMJF_26_2240"
                     /product="putative kynureninase"
                     /transcript_id="XM_001684178.1"
                     /db_xref="GeneID:5653153"
     CDS             906024..907430
                     /locus_tag="LMJF_26_2240"
                     /EC_number="3.7.1.3"
                     /codon_start=1
                     /product="putative kynureninase"
                     /protein_id="XP_001684230.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653153"
                     /db_xref="GOA:Q4Q8W8"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="InterPro:IPR010111"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8W8"
                     /translation="MRNAAAETLLSTVSATGMALTEDGFAEYMDEADPLREHRNSYHI
                     PMMRDGTQFSYFAGNALGPQHIGVEASMATFLKKWREQAVEGHFMQPTPWFEIDQMCV
                     KDMAAIVGAKDTEVAIMNTPTVNLHLLLSTFYHSQGSKKKIMIDLHSFPNDGYCLLSQ
                     FETRGLNPAEDLIKITAPGIKDWNGPAAVIPMEVFLSAIDKRGDETAVIIVSAVQHIT
                     GQWLDIPAIVKAAHAKKILVGVDCIHAVGNVPLHLHDWDVDFAFWSTCKYLNSGPGSI
                     GGVFVHNKHTSGAIPLNHLSRRWGNEIQSCFPKHHSLEPAPGASELHISTPSAACYMI
                     LAPSLKLMASVGMEAIRQKSLLLTAYLELLVSELVPPGCIEIVTPADPNQRGAQLSLR
                     ILPNKLKSGQAAAPGYQCGAGGAGEMDDASLLQRQLLDEGVMIHRCPPDVVPLAPAPM
                     YNSFVDVLRAVRIIASLF"
     gene            <908732..>911212
                     /locus_tag="LMJF_26_2250"
                     /db_xref="GeneID:5653154"
     mRNA            <908732..>911212
                     /locus_tag="LMJF_26_2250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684179.1"
                     /db_xref="GeneID:5653154"
     CDS             908732..911212
                     /locus_tag="LMJF_26_2250"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684231.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653154"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8W7"
                     /translation="MADYTCGTATRHTDGAGSTSTLDDPGLLRRLVKSAKSAHSTLGR
                     ALDTNLSNQRFGGAEMEPSALTINWLERRRQLRLQQEMQVACDDIHLRATGRQRKQRT
                     GVLGASATGKAPCATAASTLSAAGTAMGGTADTSQLFIPALPTMAPSMTAAADDGTEA
                     LGGTKIGGDDRGYVTLIGAVPTYNTTRLIEDNYELISSFRAYRTDALRTEQQAALRDV
                     SAPHPDLLQQLAPLVQQEQGSEAGQQHLLVDQETLPYHLRQRYTQAHASQSTLMVHAD
                     AAAAAANEGDDAAARSPVSPRQADGTAPLTTAAAKGTWAFTCQGRPDIAGAQYSGPVT
                     EAGGKGGSKPYRRRLIGHRQPCLGQYHVRYTVVEPRVVGGYVAPHAPKADKQPQGEAS
                     ARQDAGCAEATHRTNSSVGDNGSNFGYTQREDWILTTNQHGSRNGSSDAAARRGGSTH
                     GRNIKGSSMFISESPRQMKHGTAAPDIFYWPYPDVRSTVKRVPCLVQLDNPTTHRRRE
                     PLISGVPASVYEVCGDIAAHQPRIVTMDQTTGRDSHWYNRTLPKVLGEPLDVDEALRA
                     TRPKERAAAMLPRPHASNPNTNPAHALALVDTSVSVERNLAYPQSFIGGSTQLEHIRD
                     FGKILSRDKREALALRNIGSGAGNGVLPGEAEEACEWMRRRSHSALIHPRAPGHQPLH
                     TPNATELGEVPSLTLTKPRSGCTTDLGRGTARPMNLLPLHDLTYDPDPGYVLTGPRVK
                     GTPSIARTATRQQVRSWTAGKGCGAPVMYDPTDYLAPHVKLVPDFEKQITKEREFRGH
                     RVQSERYLQLFPSAPGPGHYTVNYTQVE"
     gene            <912950..>915178
                     /locus_tag="LMJF_26_2260"
                     /db_xref="GeneID:5653155"
     mRNA            <912950..>915178
                     /locus_tag="LMJF_26_2260"
                     /product="putative Sec1/Munc18 related protein"
                     /transcript_id="XM_001684180.1"
                     /db_xref="GeneID:5653155"
     CDS             912950..915178
                     /locus_tag="LMJF_26_2260"
                     /codon_start=1
                     /product="putative Sec1/Munc18 related protein"
                     /protein_id="XP_001684232.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653155"
                     /db_xref="GOA:Q4Q8W6"
                     /db_xref="InterPro:IPR001619"
                     /db_xref="InterPro:IPR027482"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8W6"
                     /translation="MRSGSPPQAVGVRLNSSPAAAMPTGELSSASSASAYAGGLSSVP
                     VQAGAKERVQDGKKATFTRRGILGCVKQRIFAEMLDPVEGDYNIVVCDNKGAEILSTC
                     VRMHDLMDHGVTLVEDLGMPRQPVLSSAAIYLIEPTEESVRRVMNDWQVKNMYREAHV
                     FFTSFSSERLIQIMASEPRLVQAIKTLKDMLLDFAVPESLLFNFCMHSDVQRLFLPDV
                     ALSGGCQNILSEVATRLVSVFFTIGAGVPTVQYQGNSQLAQQVARIFVDQAAQASRTS
                     PATFRMSSAATPCGGGAADESPLLILVDRSFDAVEPLMHERTYQCLLNDLMPIENNIY
                     EQTYEGRSGQEATRRCPIDEHDPYWCQYRHKFFPVCLLEFPKKLQSLMAANPNLVAGM
                     RRLNSGYGAGGKLGDVGSAIRALPEFQEQQAKISLHIDICTKIMDHYKQQKLAEVCEV
                     EQDVATGRRPFKELYDNIHRLTADVSLPLGVRVRLILLLIAGTNTREFSEAKKLMLLQ
                     EAGLSSQADLCNSFSMFISRTGQLPQEAAVQGTDSDASNGGGGGGNGGNGKNRSVSLA
                     RRSLRINRTGVQDVSGSPGGNAQANAANESDENASTPAADLYRNQAYLILRAAANGTL
                     STSDFPIFRTSFGGGRGGSLRGALQQRRTLRAAGGGNEGIDFGGLAGVNAQLTLDLGH
                     EGKFALKTRRRIVLFVLGGVTYGEVRAAYEIAQTAHVEVFVGGTSLLTPDRFLSSLNS
                     LR"
     gene            <916418..>917221
                     /locus_tag="LMJF_26_2270"
                     /db_xref="GeneID:5653156"
     mRNA            <916418..>917221
                     /locus_tag="LMJF_26_2270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684181.1"
                     /db_xref="GeneID:5653156"
     CDS             916418..917221
                     /locus_tag="LMJF_26_2270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684233.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653156"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8W5"
                     /translation="MRGRTLTLLARDALNAGSSMTLGSKGMRPSPEAHRRRMPWTAAK
                     EYVPGVVLNSKEKLVLDGTQLVELDHIDRASQVDPLEVLKAAVATRAYNTSTGFNIFQ
                     LASQTRFHGRGQKFFREEWRQGTYEKYVTLAAIDFDREGSKGTAYGYITFHGESTTRP
                     VEINYADTPGWQMEYDEAAAVPFDAAVPPPPSIGTEVPVDPSTYRLKAYPFYDAPNPP
                     AFVERLLKDRGVLPDLPMDASAPAENAAAASADGALVDGSHHYESKGSV"
     gene            <918955..>919794
                     /locus_tag="LMJF_26_2280"
                     /db_xref="GeneID:5653157"
     mRNA            <918955..>919794
                     /locus_tag="LMJF_26_2280"
                     /product="putative nitrilase"
                     /transcript_id="XM_001684182.1"
                     /db_xref="GeneID:5653157"
     CDS             918955..919794
                     /locus_tag="LMJF_26_2280"
                     /EC_number="3.5.5.1"
                     /codon_start=1
                     /product="putative nitrilase"
                     /protein_id="XP_001684234.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653157"
                     /db_xref="GOA:Q4Q8W4"
                     /db_xref="InterPro:IPR003010"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8W4"
                     /translation="MASVLPVTLCQMAVTREKAANIKKAVTMITEAAKRGSKLAVLPE
                     CFNCPYGTKYFDEYSEALAPGNETFDAMSQCAKANSIWIVAGSIPEKSADGKLFNSSM
                     TFGSDGALKHVHRKVHLFCINTDTVRFDESEVLSAGNDATAISLDEHTKFGVAICFDI
                     RYPFLAWKYAEQGTSFIVYPGAFNMVTGPMHWQLAARARAVDNQQYVFVCSPARDTSA
                     EYVAWGHSMVVDPIGNVLSELDEKEGFVDWKVDLSVIQDTRNRIPILKGVRDDLYTLH
                     WKK"
     gene            <920321..>921538
                     /locus_tag="LMJF_26_2290"
                     /db_xref="GeneID:5653158"
     mRNA            <920321..>921538
                     /locus_tag="LMJF_26_2290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684183.1"
                     /db_xref="GeneID:5653158"
     CDS             920321..921538
                     /locus_tag="LMJF_26_2290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684235.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653158"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8W3"
                     /translation="MLRCAQHLVLSCALSTRRSTHTLNILDSAVVNHPQSDQQLVQPA
                     EIIRETVHQSRAEDALKNCSVDPEDVNVMNKRDIECIELRKLQYMHSQDGPFIGSQTK
                     DSTPDQVSFRKRRHIVRVPQPEVEYRPNETSFRRLPKNYIIPNEFELRVLYPMSTSLK
                     IIEGKADCVDHSAFNIDEDPSPIAYSMIAPPDWKPDVEYPYMVVLPDHRGIPRDFEDV
                     CANFFERPIHYELMAQQRWVILSPVVNLRHNMHVPVEGVVARFCDWVKDNFRVENGKV
                     HLFGKGNGGYVALRTVLEHKDVALSVTAILGRSGSPFRPLDRAQDKVKNYNGVHSLVY
                     VPGLLRKQDWYYKFKFMLDMARVRPPLRNIHFADVRDHQVYYAINPQEFWNYMQYFRE
                     CNMRMITESGYSI"
     gene            <922285..>926013
                     /locus_tag="LMJF_26_2300"
                     /db_xref="GeneID:5653159"
     mRNA            <922285..>926013
                     /locus_tag="LMJF_26_2300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684184.1"
                     /db_xref="GeneID:5653159"
     CDS             922285..926013
                     /locus_tag="LMJF_26_2300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684236.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653159"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8W2"
                     /translation="MIGYEGRCVLLDDADEWVNIPFVVREFMKQLNDEAQASRAVVEM
                     LRQEQKETNLLLRRVMQKQADLEIDNARNIMSLNHHASRVAHDSTEKRHTEQIHYLRK
                     KADKLDDKMQHLSEHVEELSKSALSSISTGSGFDELKGLVTCLTTKVEATERLLKDHV
                     DACTVGLRSTESLVDSAALAVVTDVQKVLKGELDVYSAQQRSLEKSIGLLREASSSQK
                     EESRRIRGICEELSQIVEADQKASRERLTSCFSTVEKLECLCVAQHAELEVRMKGTED
                     TCLGSESRSREEAKSLYAELRGLVKEDQAETQQRYHELTEELRTVKEQQRRLTEQLAT
                     ASHEADALTQRAVKQMKDISARLDSVETEVEQLGSTLVARRDHQKERRQTQDALEAIR
                     TSLADTVATFQAQVQQLATSIKTMRAEQMEDNDWLHSELGRIGTMVGYASQQREKQER
                     QVTSLCEIVHNLSVAVEELQKGCGVAVAPPPAPAASPAQATAPESCTNIDIPAAWETW
                     RSTFVKDVEERITAAVSPNSQPHASPPVLERVSQQLNELTAKVDGGAKYTQAIMSQQT
                     DQMRSTVRDEVTHQLQSHAALREVTPALVEVEAVKRRVAGIELGLQTLSTRADRWCTD
                     TEAGSLSSTNSVLQRVLLVEEALDGFKRRLLELGEHVMSVDQRSSQLARGAHEMEAQL
                     HDQQRMALKLGTDLTAALEGLLHTEQSLSRHQNSTTQQLSEVHTRLEKWTRDAAAAPT
                     AAALSVESPASVQNGAAAASGMNADVSRRSLSVSVARLTETVEHLSAQVTRIETGTLQ
                     ALHADLEAVRGECAAAAARQSVRDGVSSPACDALHREAVHTAYEELRRRLDAEESSRR
                     EATAAALRAVEERLLAIERDVSELLSSPPNRGSPPTGDADSAAAAAAVKHCVDELARC
                     HERLDAVQQQLTSNACCCSSGVPRVREVERDAHHQDVRLLQQQLGRLQEDMHAFVTSQ
                     LRTEMREAEPALVEAAATAAVLRCQDALKAAAESNATAVDAHANTESLAALQAAVEEV
                     QHTLEERISTLLEGYDRVESMEKSLRSIFDDLNALEKAQSELRSELERARSAHQAYQR
                     DLSLQLETVVSGMETKIDELRANVKDSAVDTTAELFEAGDRAQKPSDDTKAAWVAEVV
                     DSMHATYYTRTLLEERLENIWSSMIGLLARKEDVSAVHDKLNGLHQLIQEEMQIEVQR
                     LEEGLANQLAEKVSLANLQDILEHHIAGSDADSDHAVM"
     gene            <927288..>927650
                     /locus_tag="LMJF_26_2305"
                     /db_xref="GeneID:5653160"
     mRNA            <927288..>927650
                     /locus_tag="LMJF_26_2305"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684185.1"
                     /db_xref="GeneID:5653160"
     CDS             927288..927650
                     /locus_tag="LMJF_26_2305"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684237.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2305"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2305"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653160"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8W1"
                     /translation="MLGRRVFSSTAIPRCMYTRLHISSPVQAARMLPVLVPLTPSLSH
                     SIGGMMNAVAQGSLESMPTLEVGEQDPASLKALLESISPLQLGVSRLLELWGIFRVNV
                     MVNTILGRSAAMLHCCCC"
     gene            <929521..>930366
                     /locus_tag="LMJF_26_2310"
                     /db_xref="GeneID:5653161"
     mRNA            <929521..>930366
                     /locus_tag="LMJF_26_2310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684186.1"
                     /db_xref="GeneID:5653161"
     CDS             929521..930366
                     /locus_tag="LMJF_26_2310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684238.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653161"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8W0"
                     /translation="MPNPHRGNEQAAAFVNFYASPSMVNSSVNRLYYGGLERKKRAEA
                     RAMEEAYPPTLSARRSPAQLEAYLNRCVQGELLRRQQHRAALQQELYPDAEETPRFLS
                     SKEMTHHIHHVYDEPLKVRRAREAELRRIFGTDKDVEKVKKETVYQYHRLPASSARAI
                     TGSSPRSAPSASGSNRGNVDVDTVANYCKQLEKGWRPPSVSIEHDDNRRLLVSQYDYY
                     ADPRKYTELTLRPRPLTAKERTALQSRLELLARPTRVNLPVVPSEEQDGPPPFRVCRK
                     IRYND"
     gene            <931491..>933683
                     /locus_tag="LMJF_26_2320"
                     /db_xref="GeneID:5653162"
     mRNA            <931491..>933683
                     /locus_tag="LMJF_26_2320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684187.1"
                     /db_xref="GeneID:5653162"
     CDS             931491..933683
                     /locus_tag="LMJF_26_2320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684239.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653162"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8V9"
                     /translation="MPSRVTIRCLAAYTGDAEDAGGGLVPLFVGREDGTVERYDDMKD
                     AELGIPTASFYAHRRAVTAIIAVSAAELCTCSLDGTVKWWTLEEVEDAASSPSTGTFR
                     VRATLVKTSTLPFPVRTMIRDGGEGTAAGQQRLFLGGENGSLTLMEGDRRSSWPAHNG
                     GALTAIALDWNNSGTVLTGGTDGRIYVWDMESGRPVCELRGHTGTITALFVVPVPSSI
                     PVVRSKRAPVNPVSFGSSNALPPALEKKDVLVYADAEDDGSGNGASCLVSCSEDGTLK
                     VWLLPDLQEAAAEADLMEKEQQEEQQRKDSEGPSSKQRRSVCIVFQELDPSRLIAEEV
                     MEETVGVAAAAESDADGAAVVAAATDGSGEEAAVDAASSPTAASSTLQSEVFDAKLRF
                     LQQQTKGATWKSALKAPERRPVPFQSALGTVELPHTPLACSGASSGLDGDEGGAAPLV
                     FIGAAQGHVYGLKDRLLVKEVCRHTAHNFQKVQQAVRSVQRTLKDGVKVYTKAAAATM
                     RAMEAKELKVAAKARQAQRAKEKAAKKKSAEERRAARRAAAAEERSDNDDYDEEDEAE
                     EETDEESDIDEEEEAEEEEAERPGDADEAADEEGHGVEGMAFAAATEPRPLRRPASWN
                     KLTEEQRASLEAFFAAQEKERDERITALQKAVEAHLAQLQPLAQTPYHRSRDQFANLP
                     YTTTGCVRGGSAVASLASASLVPGYDKVYATQSNSIAAVAVQFGVKKL"
     gene            <934921..>935304
                     /locus_tag="LMJF_26_2330"
                     /db_xref="GeneID:5653163"
     mRNA            <934921..>935304
                     /locus_tag="LMJF_26_2330"
                     /product="putative 60S ribosomal protein L35"
                     /transcript_id="XM_001684188.1"
                     /db_xref="GeneID:5653163"
     CDS             934921..935304
                     /locus_tag="LMJF_26_2330"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L35"
                     /protein_id="XP_001684240.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2330"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653163"
                     /db_xref="GOA:Q4Q8V7"
                     /db_xref="InterPro:IPR001854"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8V7"
                     /translation="MSHHMKIKDLREKSKDDLLKTLTEYKKELSQLRVVQQTGGAETR
                     LGRIRPIRKSIARILTVLNQNERSNLKMFYADRKLRCKTPKVLRTKLTHRRRLALKEN
                     EKNRKTSRQMRQAHKFPKRVYAVKI"
     gene            <936572..>936955
                     /locus_tag="LMJF_26_2340"
                     /db_xref="GeneID:5653164"
     mRNA            <936572..>936955
                     /locus_tag="LMJF_26_2340"
                     /product="putative 60S ribosomal protein L35"
                     /transcript_id="XM_001684189.1"
                     /db_xref="GeneID:5653164"
     CDS             936572..936955
                     /locus_tag="LMJF_26_2340"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L35"
                     /protein_id="XP_001684241.1"
                     /db_xref="GeneID:5653164"
                     /db_xref="GOA:Q4Q8V7"
                     /db_xref="InterPro:IPR001854"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8V7"
                     /translation="MSHHMKIKDLREKSKDDLLKTLTEYKKELSQLRVVQQTGGAETR
                     LGRIRPIRKSIARILTVLNQNERSNLKMFYADRKLRCKTPKVLRTKLTHRRRLALKEN
                     EKNRKTSRQMRQAHKFPKRVYAVKI"
     gene            <938152..>940815
                     /locus_tag="LMJF_26_2350"
                     /db_xref="GeneID:5653165"
     mRNA            <938152..>940815
                     /locus_tag="LMJF_26_2350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684190.1"
                     /db_xref="GeneID:5653165"
     CDS             938152..940815
                     /locus_tag="LMJF_26_2350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684242.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653165"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8V6"
                     /translation="MHACTECFFPRVSYLSFLPVLPAGMSNPQENDNDVPASMEVPLS
                     TSLFSRSADSNTVKHAKAVAETLSPVPSALGNGTAARQHGAVVDEAHMRSALPTPLQP
                     GMDTLRALRATEARLRQAQEAELSVLFRLRLLTEALVGVARLPNALAAAGAAATAAQG
                     SGDAEDVSAPPSEGTFRAALPAVIACPLTTGIEEATRAPAEARVTMQCVSMPPAGLSA
                     AARGQYAALRRALARHFCEPEDGGVGGTCDAAASSGRTPSTATPENPQSIEQYEATPS
                     VLRSRTTEVVDTNSTDAPGTHGVAENGAGASNYPDTRHRRAVETQRRTRFFSELRYCP
                     PSLPQRSVSPREQHASTASCDPETSMAAMNMDSRSASQGRRVPHSPPSSHVCGLADRF
                     ADTKRGEGAVALTLALPKFSPAYVEDSCAESAVNEERDELREEVEGGHHREEADEAAL
                     ASYTPAVSPSFATVLTCGSSPTVVKVGPCSTLFPCIPSLSAHRTSAVTAWESSNRAAP
                     DEQRSQDTPTPPTLKSSPHRLSQPRSATPTSTFGDADEEGMYFPRPPPAKTHRRAEVD
                     AELSSCFPAMGNGGSASTGADVTSVFFTMSSPTTSAPSLRRCLAFGSDHDESDAESAR
                     APHSEKRGRVAASSSMHMGDRSCKEAPQTVSAARDMPLPRTPTRVVTATDILATITAL
                     PRPSSSSSSSSLRLKRPTARRAHRGGKDTGATGKVNASPAEGQPTHRGVCKRRRGRGD
                     EWGRIDVNDEVLAAMPLAGLPSLGKDVSLSAVAGLGRPMCEETANDRHRRSATARRTE
                     SDGHQRTMFEGEHVPCGYVRTREQRIQDIVRTEQVFSAVRAACSPLPTTSSQTPPRCL
                     GADTECDGVLLSPSPPLSQNTPRQFWDINFP"
     gene            <941939..>943987
                     /locus_tag="LMJF_26_2360"
                     /db_xref="GeneID:5653166"
     mRNA            <941939..>943987
                     /locus_tag="LMJF_26_2360"
                     /product="putative SLY1 protein"
                     /transcript_id="XM_001684191.1"
                     /db_xref="GeneID:5653166"
     CDS             941939..943987
                     /locus_tag="LMJF_26_2360"
                     /codon_start=1
                     /product="putative SLY1 protein"
                     /protein_id="XP_001684243.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653166"
                     /db_xref="GOA:Q4Q8V5"
                     /db_xref="InterPro:IPR001619"
                     /db_xref="InterPro:IPR027482"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8V5"
                     /translation="MRGAGGPSARPPGGVFAGTPGAVAARPTPSQHWLRQRQEAVLAE
                     MIRMAVPLDAQGNMVAEPYSTAAAASSEPIITTWRLLIFDDWGRDIIAPLLKVGQLRE
                     LGVTLYLHIATERDPVPGAPAIYFCAPTEENITRIAKDCAQSLYEWVYLNFTTQIPRP
                     QLELLAQQLSASPLESIRHIHVYDRTLSYVALENDLFSLMLNNSFRLLNTTSTKDEEI
                     EAHLDQVVLGISHVCLSLQVLPILVHSRSGATAEVARRLSVRLNDALNDRQLTPAPSS
                     VLGRPLLLLVDRSSDLATALHHLFTYRGLLVEIGGMKLNKCTITTPDGKDEILEVDPD
                     KDEVYRENANLEFGTVGGNIEAALRRYKEEYAALAQETPGGAGGMMGDGSDGNDMSKL
                     LANAPALAERKRCLDAHTKLAFSILSKIRSRHLDHYHGVELAVLQQEGLDEQEFHNLL
                     TNGLGTTEDRQRLYLIAYLMCASEEEARYVQSHEGAVSEGAAGFPALAYLKHLRNWSL
                     TTQSPSAAQPNPSQGFGWGFAQQIAKNIASSLGSKTETMLPLTKLVDALMQDGHGGAP
                     GSASSGGASGVGGSYSSPTSALPGGSSGPSGSLRAKLLETVEAYDPRTKKPVDLREAV
                     FSQAIVFALGGGSVAEYDNLKAWEASKPRKSVMYGCTSVVSGEDMLRQLTILGASQNP
                     "
     gene            <946412..>958306
                     /locus_tag="LMJF_26_2370"
                     /db_xref="GeneID:5653167"
     mRNA            <946412..>958306
                     /locus_tag="LMJF_26_2370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684192.1"
                     /db_xref="GeneID:5653167"
     CDS             946412..958306
                     /locus_tag="LMJF_26_2370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684244.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653167"
                     /db_xref="GOA:Q4Q8V4"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="InterPro:IPR001870"
                     /db_xref="InterPro:IPR001876"
                     /db_xref="InterPro:IPR003877"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8V4"
                     /translation="MEPPSQPSAAVRCVHARFDPTAAIATYRVEEIMSMPADQLARVA
                     WPLLTNMERSLSMNDVYFTPSIRVSASPRATEAAFAAGIQSCMAELTESLSQTNCGEV
                     PLSTARLRAAALAYFISALPAPRKVLQASSPRAAAGASGSGAHATEAVAHHLRNEGHA
                     PFPPALSLSADVFEFAIQSLGDASERQLRDITSGGGSVGTLPRTSRPYTDTGGGASPS
                     ENASGTAAGASATCEAAVSTRAASIQLGRHNDNGTADSFGGATAASGEQAPSDSHSNT
                     AATGAAERGKLTSARPSRSGTVNCGNDDVNDRECYERKTRRFLAERIDMQWESVVASV
                     LVSDGGESCSGSGTTSIFSTSLSSVPPPSAGAGALLRQKMLRTAVMLCRRAPTCTEAG
                     HSFACLLKHSLRAVSATDAIRGADGGAVSAPVLHPPSCLSAYHRQRSPLTPAQKGGPI
                     QPVEKRETHGLVKQSLSPAASSLQPQHTSVAQQQAALWVELVLPLLHLVPLVQWSPDT
                     LTELGQVLETVTATAPAKLVALAQQQHQHGKRAGSGGAAGGHVGVYHRPSQGRKGGAA
                     VPAAAAATSVPAVTSGGGAEEVVNFSVRVPFEIGLPVPPVMTEVCLSDLVHDSGGATE
                     KGSHTVRRGAGETSATDPAALLAYTSESGPSTENRYPSYPSSAFHEVSDVRDNDDHMG
                     AAAVTEEMSVVDEEGGEEDETAYTDAEGEYAYDAGSNASTTTNASSQSRASRASPLSA
                     SASSHDGEDADGAGGAGGVGDGSLFNSAHGDFDALPCRRRRTQMVELCLPCATRVSVH
                     LTNAVQWDRALRGGDVLLLPLESDANSAESTSSALAGSSTSSTSPGATEALKSSSNYA
                     AVGKEAKKDTRLPLSLHSLKEEHGSGTLTYAGPCRVVIPSLPQDPVYMLPGEVSAQVQ
                     LILDTRWSTEWTVALSSAQRTVAERLLAWMERRVQGSGDQQQPQQRRSRIASSLLLRG
                     GLKSATGGGASASGSSQAAMADGGSGGSHVSIAAMTTAAPACAGAPATAAAAPLSDPF
                     IQALHEMPAAALRARVRCHAVHVDGVRAVLLVIAHMLLQDRTGYLHTDPLTWHSPTWS
                     DAVRRVSLASTTVGGTNSGEHALEVALFVLCNVASGPTAATVSSAQVVDAAIDLFSIP
                     GLSVADVKAALEDRRQLGSTMWVVVDLLTKCSATWRAPRHVALVSEAVRRLMLLGSTG
                     PAAAAQNHHVHSSPHRPTGATTAGGLAGASAAPMTTPGSAASPSLFAATAAAGHYLSV
                     VSGCGRVTEANLRRGVHALLAQLFRLLRALLHRVQSTQAAPHRFLLEPWEYGAFAAFT
                     VSLMSTPMDAADVQACSPHFAEVVTGLLPSFTRLSRTDSLVLTSETAEQEFLVEVLKY
                     VRGRIPSASLPTGSAGSADAGDSAEFGESETPASREPHILRRYQETASGNTVTYISSM
                     PSVLGDGGGLWDIPQSSASASWTPGHVRVELWNGTSRGFFIGLASADVPLANCTPETD
                     ANGIYFIGDGTVQYGDMTRRQRRLPRWRAGDVVELSFVFARGGWDVVMALNGVSLTRL
                     TLPRRDFRLVATNVRTGEYVPGHGHMHVLSVTPVHTRGGKDSDAARRRGVGGTGGHAP
                     SSGASSSLSLASAPADVRLSPFARLTLFGVSLLLELVLHYLVLRSSRHVRAAAAAAGT
                     AISSTAAGYGEGLRMVQACTIPLQHSVQQLVQLLHELDSSGAGGADDGAMYHVKHTAA
                     KHVTNAMLLDLVVTLSIAVPASPALLAIHIDVLTAVAECAAVARKTRSVALSALYNAI
                     SQRASAVGCDPTPASLPSTSAATAAAAPVSASAVQRLWAACHQLASSTPGYQPRFSNS
                     SVPSSCVTVFAGGRRIEHNQAGTTIGSGGGAASSNVRSMSYACNPIDLADPHTPDVVR
                     VSVRLQRGFQCETLGRYYYFGLAEMNAPPMVTPLDGNGELILYPGERSKQRRVYYISD
                     YLTEVPGTAVQRWDTERAENYLNPDTGILFGSGDVMTAVVYVKERCIGFERNGLPLNI
                     LHRGIPASVRHIFPFVELYNRDSRAKWMYPPDEAVVSARYTMRAMLLSWMPLVLPLVK
                     EHLSITAAAASGAPDLDVTLGVLGADGDEMQMVYVAPPQLDQPGGGTTSVHVERFEGG
                     MAVVSDEAGSIQRVCAAALEPDSTKDAYSLSALAAVRACVQACVPELAAVAAECLAGM
                     KRTSATPLVTSPRSFSYTDEHSGDGARRHVVLTHPATLLRTLRLIFSLQSSLPGKGGN
                     GSNGPSKPLSADSCVVAGGSDVSGPVSGIPTTPPPTTLPAAADKAIHALLPLLDAVLP
                     VTQLDLPPHVLLRESWNELWCNPRLRERLLIRVPQANAPQADATVAASAYTKPAGTTT
                     LTSVKRFEDRLVGHRRRGHALLCPTCGERWSACTARHSAPSSWCDLLARVLRRLQEQL
                     AQPEDQRASPYCSWYTEWTDGPLAAIGHATGAGGLPQSVPAAAAAVTGAENEVGAGGE
                     GYHNRTSAQSSDAMLWEDADDEDDAASEAAADGHGEPAVEAEEETNSGDAAAPGDDYS
                     VASGAEAMTSELVGLPRVEDSDEDNQGEEDAEVSAPAATSAARESLAGAAAGGVRDVE
                     APMTLTIRRVQNGATEEDDRVLVEGFGETKEASFTFTGYLVSSAVLRGRMEFDRIDLP
                     DGDGPDDGVASQEWACSMCTLINEPSAVRCAICSNARPGASWTCPMCSFAYNALAAAT
                     CVTCGCMRPSSVRRQEATGLCCYCAECHQREYVRDFHALRHRHFCSSCARVTRWLPKD
                     RFSTTIEARLTGDGATLEFQWALDGSKIICFGLQNRAYNADVLWGLVEAAAQQIGSCA
                     AAEVGRYVSPIPERPLTAHLAKPQERQTASAVPAPVEPCMVGAIVHYASAIVLRYAAL
                     LPSSQLSQPDFLRRIHVCSTDWLESWSQFPASTVTPIFFQCLQMLQDGIREPELVSTI
                     ASVALALIRQQPLELAAEKDALLYALCLNVVRHGDTAQRKASYECLSALMEENACARL
                     NVQPLVPVLSMEPLVEGQQRATVLALLHRASMRTTSAIAKASACLARAVVAMEQRRPL
                     PPMLGKPFPHVVALTETRLNEAGELLVGQVRGSVGVAPTKGGKFYYEVEVPPDFADRS
                     RTVVMGWGTLEHERIASAQHVGSDLHSWGYNCREHLRLMMTEQAMPVPRRPSAGDVIG
                     SMMDLETMMVCWTINGQEISWVSVPAQGDGEEIYPYVSASVEPHSLKIRLGNTQFKPP
                     GYQDYSPPSDKQLWGRDDEKGDGGNDASDAQVSVAAALPQTYEFYQQLSRALEEASIT
                     SLRESSVLPLLDAARAHSVLRQYPLLMAAVGSATVGDREGRLAAPVNIHGLLPYIQQL
                     RCVQELTIIVARHLWLIEKSPYLMSCYRKATDLLFSSGRWTIFELQPGGRPKYNGGHA
                     LRVLVSLCKANQVRAEADAAWIEEHSALLPSPSSALSPLSPPSRQNAHAGTAAVLAAV
                     PPLVDGTRQTGEAAVARFPFAEEPPAAFPHDVHDADEDDYAEDDTEDLVSAMEDEDED
                     AEEDEGDVLSMHAVNSGNEPRNSLRDIFGDASSLSPEERRLRCSVTGQLFTQLEKTRV
                     YQRARMFAVQLEGTLALDAGGVTRTIMSMIGDEVSYRFIRGVRVDPLLPLFQLCSHST
                     MFTVVPNMSALYASEAADDGAEGSVLRRMFEWLGKIMGNMVLCGTLKASFDFPQMLWK
                     TLTFQEDTITLADYAHDIDDNIIATLEDEEFVLSDDFFASLPEHVRASPALLRSLQGS
                     GAGAMDGTAAPFAARPLRPYACMTPGVSMHDMSHLILEELEDMAASAEAAEVNRRRAL
                     AQEALLHQYDPAFLAIRAGLTSVVPATSLRSVRWEDLRARVCGTGAASSEHVIAELDM
                     SPLSLSMRAMLTEVLNGFTESQLARFLLFCSGQSRIPLPEKVLVECGDEPGRLPTAHT
                     CFPISLLLQPCTEAADLQRSLETCLTHAAEFGFV"
     gene            <959489..>974713
                     /locus_tag="LMJF_26_2380"
                     /db_xref="GeneID:5653168"
     mRNA            <959489..>974713
                     /locus_tag="LMJF_26_2380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684193.1"
                     /db_xref="GeneID:5653168"
     CDS             959489..974713
                     /locus_tag="LMJF_26_2380"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684245.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653168"
                     /db_xref="InterPro:IPR003961"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8V3"
                     /translation="MPSSRTIAVDAAAALRQTTVTDTFNVAETAAPGADDVQIAHAAS
                     PPAPAAAADAPGSASGTPRPSAPQLNCQAAVVRIGDMFGEFSCSVFRVGASSNVCGAN
                     NPSLHTSRAAASSRAFYKRGGASTSSPAAATLTEMAANRQHDSQHEGAAAADAIATRD
                     GSLGTTSTMAAVDGAATADVGFPVNCEVEGVPRWELLIYAVLHEEQGGGTGAAASSGA
                     RNRYRGEHASAAPQLPGDASAAADDSSKDGGYDECPLPDGAKLYFQQTMPTTKLSKVV
                     KLEAGRRYTVRVRCYSRADVHWSAWSAPIQTATLFPVETRLGEIGSDYVHCTWDRLAQ
                     RNEDGLARETDVATTEWARSIPDFELRLLRESDMAEHYHGTFEAGCRSATIRDLQSGT
                     RYIVLMRYRTVIRTMREWTEVTRLITESALEVRLIARGEDTFTFSWAREVQEGTAKAS
                     ASKPTATTVANDPLLDDVAVAAFGYLQPQTTVHEYELTVESAGLRFDPIAVPASVCQY
                     TMTDMFPSTTYSVCVRALSAEGRWSGRSAPLKLRTATRPVVSVAVIGESFASFMWSRK
                     GGEEPHESQLQYRVQSMTSAYHQAETVDLAPPSSPTEHPRRLLHLEHLRSGSDYTVSL
                     RIAIEGTWGIWTEPQRFTTARSHVLTFLERGEDFLTLNWPSAGLAAALRQDDPSGAAA
                     EPLSVYNIVVVKVDGLGERTVVLNERVTRDPSQRGFRVNDLEADTTYDVQWRTWQHNP
                     LSGFEDWGEMSTPVRVRTLQAVALHVWDVGEDFIHITWRRGLSEANTAPAETASATGD
                     DAAAAAAEWDHLRYEVVMGCVETGEDAMLHRHVLDTSYTFTQLKPSTTYTIAVRACDE
                     HGQWGLWSRAKVRTPASMKTTIHEIGEDFVRLVWQRCAARDDGDLSGVMVADMFVAKY
                     SILVYGREPPGMPVVPHTESGYEAGGGRSDIARFEVVSSEHTSLRVGDLLPDREYVAV
                     VRAATSSGRWGLWSRPVRFRTNPQFRIPTHQLMIGENYVKVVWSRGEAEASRLAPAEQ
                     EDNSKDGEVHLGDWSVTGQELRISGVTTQYARQYALDADVRELKVCELLPASAYTIQI
                     RVRGRSGSWGLWSAPVPILTRGTIAVTTDEVAEDSITVRWERRKVANPHQYPTGHGVV
                     TSYHLRVYNAHEVHTETFLGDGDCPYRVTGLKANTYYCVDLKANYNDEEWGLWSVPLW
                     CLTMQPMRIHAKLISEEFCCLQLRRPSQQRRLPEDDDNPSTEDRVLAHGKLRPMILLC
                     VTSPVLSKAPYHSAAVAPEQSKAAYLNDALPPDAAHQRLIYQTELLSSAETVEYTVPN
                     LKCNTVYSVSVRTKLANGEWGMWSPSLVFATVPAMRVSFTTIGESFVSVEWVRHSQVV
                     PPQIANPEQVVFGVATITASRVRVRESGGAYQHTYTVEGATSSLRIDHLTPATTYMVC
                     VQTFNDNYEWGVWSEEQKVRTVPGMDIHVQHVSEDALWVSWSRRTDLDVAGDANTVFN
                     VNISARAYEVCLIGEGGFTYRQETDSTSLFFRGLMPDAVYTIYVRALFVQSEYWGLWS
                     AQAFRTKPRMRVTFGNIGEHFVMLEWRRHLPKPTDAEVRLLLEDDGTADVAYDSDELL
                     QNGVLPPLSDGGSGRSAVTVLGRAVAARHRFSIVETEDVVQLYRFKVQRVGEAHSVIY
                     NIAPTVSAFCLHDLQPSSEYRVWVCAKGHEGVWGFWSAESRVRTLPRLRLEVLNIGED
                     YVRAQWRRGAWEGACMTDGDGAEVRQVDGAVSGYEIRVLDGASTVAATSTTTFREIAA
                     TLSGLRLSTLYTIQVRAKDTYDAWGLWSDPVPFYTLKPVGVRLQRVGETFVDAQWSRP
                     MHRLHPQHAHDKMAEVGSDVAGMQMDEKGVLHPDERVTRWHLRVSCNRVFAGMPQTDD
                     YRELYTEEGEQALRIDGLLPHATYSIAVRGLSRGGDWGHWSPAAEVTTCPLLKVGVEV
                     AGETFLQLAWRRPATRSGLATTAAADQHGDNGSADVSASVSDGGVDDSTHSEVQLVEN
                     TSHVLRTAVSRAGASRGENGDGEGEYSALPFFHSTPLGTYLCFPSDSGVHNFQVTIRP
                     MPTESAFDETDEPLVEGARVYETTQPALRLGNLLPGTRYAISVREQQVDDEGCLVAGE
                     WGAPSEVLCTQTVPPMQVTTQEIGEDYCMVEWRRAAEAPATGNSAHGAPSVSAEGWTT
                     AAAAMLTTAAWTMACYKSVEFELQTRRLSMDGTALHDDPLTVDSVVSLPSSVSTHHIS
                     GLVPSSVYEVRVRAKIENAHWGMWSPALRFVTQSRVELHVDQVQEVAVLVSWCRPRAT
                     HTRSGTISHVQAEKREWCLTTGSAENQEDLNNEDAAEEQVESSGSEVTRPATTAGIFG
                     SQVIQVDYAVHEYELILEGISVDERRHLTFTQETQSTLIEDLQQDQLYCLSIRSLSEK
                     QHWSRFSTKVTVLTLACVQVQVVQRTECTARLEWFRPQPDVGKFTELLARHQRDALHQ
                     CDDRERRELLEMKRKIQEQESKGEPTTAVSGWINPVAREEHNTLLREEATRHYQAEHI
                     VVGDAGCTGYELLVTLQKGEVCLPFIAAIETLRRCRPSGLATAASAREGVMAAKRSVH
                     AGSMMTGGNRGFASAGNGSFPDCRRHELVKTPTSPDAAPAASLPATTDSVTLLTVQLR
                     SCVSQVLLQGLSPDAVFSAQVRARGVPDSWQPWSRPAMIQTLPLLQLDQSRFGEHYIN
                     LYWYRGDPDTMDAVSQEAEEFRRLQREFHNFTERGLEEQRSVLGAAAFASLVNRLRRL
                     RMLRRLSADRAKQHADGEMGLLVDPSCPVQGFQLRVIDEVGTISENYLPNNQYHDLTA
                     PPTLSFTATGLHPNSLYVCCLCPHYGDDVWGCWTAPLKFMTHHIIQLEMTYISETFVD
                     LQWWRLDNKPTSPLDEHDTLLSSRYTEEVQVYQLRITHEDPVTGQEVEEFRNMRACNV
                     LRIDALLPDMKYTIAVREWDPKGDWGLWSAACSCVTLPSIATTVTDVKESSARVSWRR
                     MTPRIDYENDMHVLEDNSEITGFYLRLEEVPLRTNSAVGSPTVRAMSAGHSSSPTGVS
                     EPCSDGVEVLSMSMGDVGMSNNSFHDAAGTPSEEKPRAAEADELEGTLAFGFQRGGPL
                     PPEAHPQLHDGLVPDSVDDNGGAARPSHDQCQHYLLVKRITSSTELESHLSDLHPQTV
                     YRVQVMAETTGGQVGPWSAPHFFITTPQLRLSADLIDEHYVSLQWGRRPLAPLAAQIG
                     GRGVTTTTSSGGAAGFFPESSTLESMDGGGSAAAAGVLVTLPTSKVLHYELEVRGGAG
                     MEFSFSTRIESAAASGAFRVKGLTMDSVYFARVRSFSDAGEASFWSPVLTFVTLRQLV
                     VYPQEITENTIEMNWARPEQIPEQYLACAAFDTAAGMEMNAALAAVPAMWEASASVTT
                     LVVQSAPAAMRVRRVVCVGDREAVKYQVRVYHATEETAPRMLMDKHLNGNITKFLVHS
                     LAPNSVYLLYVRAINCDGVWSEWSEGRCVYTMKPLVSSIATVGEDFVRVQWAREAPEE
                     LHYTLSTANTATAAGGHRRSVAAAATDTDGEGAEDEATEHIGRPLPDDADAEAQVSSP
                     NKPSTDSPDLSRMWQHERRFRLHDQPAEVGVVYCSALTSIQSFTISVRRSDEAEGCTV
                     EVPGHVSKHTLPALQPDCVYLICVRAHYRGGERGPWSDVVRSGTYNLLAMDVREVGED
                     YVSASWQRKPNTIHMASLQIGQVEETVCYEVRIRDYTDVPLGEEEGETAQHRDSEGRS
                     VFLHANQRHSILRELLSNHRYRLSVRRWYRPRDGFAKAALTTAPATSTSTTRSSVSNG
                     LEGHRSVGEGNDQDGADEEERKRATEEVEEMSLLPTAPTVLQLYEQTTHTVMDATLRE
                     SMEKAKAAPGVWSDSEYVVTLRDMVCSVERVGEEYFQLRWARDPRAIPLPVRRAMPVK
                     PVQNYQLRIDELLRNGSGVETNRGSNTLHLDELMAPTETSYFNKALKPNTLYKVEVRC
                     CIEKMWGRWSLPVYIITQPCLQVEVSRIGEECATITWHRPREGLTLPDGEVAVIGDEE
                     EVAGSYQLELSGVGFNYQISKRFKASRTSYTVKHLDADALYLVRVRSGDGINQACSLW
                     SATACFATLKPIQVAVSMPTEQFVHVEWRRPAQTAEEYAEQLEQQAGSAAAPSLTLAA
                     NAAAAQSQQQQDSGEGARSEAVSPTASAPHPSGAVQLGNPGSLAFHVCVFNTQKTPSV
                     AVVDKQFHKDVSHYRVGGLVADTPYAIIVRACCEATNDWGLWSEERTFRTLKLLAPTL
                     SSVGETYAELTWERSESDSRGAGGGSVGAPSAALGAPTLPTKYLLVIRSTQAGMLERE
                     ISAEECRTTATPMQEGYLDSSYRLTQLQPGTEYVVALQPCYGGGDWGLWSQAATFTTL
                     YPVRLTANITKDTVDLRWGRCRPSSAVGFVEDVDVTEAGTVGPCSGNSTGASQEPAAA
                     GTMPAGSRTVSRYQLVVYSEAEMAALHSCASSMEGSLAQQHFSSLLFFPSTSASQEGR
                     PGERSGAAVSHERSSLKHRQRQEGAAIHTAIPDMDVAALANLDGGKALSSPSKESLFL
                     KQYDLTDAAVSAALPSPHFQGNSPRGGTSALAGTWSSTSSMHERIDGLTPDTTYVARL
                     RAMDLFGNWGTPVEVRFVTPPPAPTQVTLRRVNAQFCSLQWSTPEGPAAEAEAAAPRE
                     RYRYVIEQCFVQTDRPPSAGTTTIIGGGGGGGASARKAGGAGASSGPVATLGAAGWHV
                     IDTVEDTNVCAVLISGLLSRMRCRVKCARRIAAASAHDACSGAVTAVPVPDDQLGPYS
                     DYSEAVAVSSGTPPEGVVDPHLTTLSQNTATLEWLPPPKPSEAAAGRYTRPIYRIYLA
                     NTTDQPYPVLLATVHRPTYVLTNLTPSTTYTVQVVAENPDGVSFLNPILRFHTKSEED
                     QTVSRRGEGGDTSAGAAEKAAPLAEIVPFHGLRAALTDDSAAAADGGADVADIPTAVR
                     RSLLQPTPPASRRRRGGRGGAAGRAHRSSSKRKARSGSGHAKTRGSSGATGRGAGKHK
                     SHTRVGSSSAVVSKRLSNAASEATRETPPTAGSFLPPLAKTL"
     gene            <977245..>980028
                     /locus_tag="LMJF_26_2390"
                     /db_xref="GeneID:5653169"
     mRNA            <977245..>980028
                     /locus_tag="LMJF_26_2390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684194.1"
                     /db_xref="GeneID:5653169"
     CDS             977245..980028
                     /locus_tag="LMJF_26_2390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684246.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653169"
                     /db_xref="GOA:Q4Q8V2"
                     /db_xref="InterPro:IPR015408"
                     /db_xref="InterPro:IPR015411"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8V2"
                     /translation="MSNDLFDIFKDDTSPLAQVDEVMVEVSDASAPSATLPGPRTSSL
                     TTTTPAMRLDGTGDAPTPPLPTHSPASPAVLNLLLTARTSSSASSPPPTATTALVDGF
                     RSPDSLPQSFSRYERGAAPSLPRTRCATSLPLPPSACGGVTVIKVAPASSATSTAENG
                     LRSSSHGDRGGAASREGAASRLASAPPPSALITEPLSRIRFRRATVSLDQFSVRLAEF
                     PFASFDLFRSMSRRSAEAVARTCVGVVTRKSDPKQSTAATGSSRYAVLTLWNMESISP
                     APETELSVLLCGSAFDLLYSRLVTGAVVALSNVARCARRGSAPAQDTDQVLLRVADSE
                     AVRQLGFAADLGTCESVSYKSKERCRAMVNMQRSQHCTYHVADLRKAARSGDTEGKER
                     NATHGARGASASSLGAPATMKGSTLTTHLTLSGAQQRLAVLAPAGVAQRPAGHHHPAG
                     SSGRAALRGGAVTNSRLAASQQMLRQTSFFAVRGATGLPVEDAALRNCVNSAASGVYG
                     GVQTGAPLALRQQVGLRPAASYPSAHKLGVTSRGRDVLEAARQQAVHHEEEKLLRRPL
                     RCGRTASTAGEGLPNHARTDGGGSRGGDALDADARAPNRSTEGGTASRGTGTPSTAGA
                     PKRARMEVPTSSSLATFTEHATSPCSYSSSSSSAPVASTSVAATATLGNGADGSRVET
                     LRQQFQPLCRGASSPFTPLKRHGAVHAVIASPRQRDHRHSVVMSSAVSSVTGASASQN
                     ALYRAAIEAARDITSNSTDSATSPPEVSTSASAKLREADDGAASALTLLGSVADGIHS
                     AHDHLRSESDRQQLLCFVNKQIAREKALEALEAITEQQIRAHYCYACRCWYGQPPTTC
                     VEQHHRMELKPALKKYIKCEHCNYKTFVIGGDEAKGWRVYPRCPRCHQSSFWVRGDAA
                     LQVPAVVEAPPPP"
     gene            <980519..>981199
                     /locus_tag="LMJF_26_2400"
                     /db_xref="GeneID:5653170"
     mRNA            <980519..>981199
                     /locus_tag="LMJF_26_2400"
                     /product="putative peroxisomal membrane protein 4"
                     /transcript_id="XM_001684195.1"
                     /db_xref="GeneID:5653170"
     CDS             980519..981199
                     /locus_tag="LMJF_26_2400"
                     /codon_start=1
                     /product="putative peroxisomal membrane protein 4"
                     /protein_id="XP_001684247.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653170"
                     /db_xref="GOA:Q4Q8V1"
                     /db_xref="InterPro:IPR003397"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8V1"
                     /translation="MSIAAPKAAPRCHTVPTFSGPHGAVLERINHMIASGDFDVFFTA
                     LKGFRNGLVYGTRVRAPHALVLNLVWSKSPYSSMPAKIFNVTKTHALGLGYSSVTFAV
                     VRGLLRKLQGTTHAWHNALAGFLIGALFWGDPSNGVHIQMMMYMLARIVCALYHLLTS
                     KCAASIPPVTYRLYMGCLWCLSIMFFMYSPDKLQSSMAQSLQYIFKDSGKFSSWYDLV
                     VVNSVQTP"
     gene            <981968..>983293
                     /locus_tag="LMJF_26_2410"
                     /db_xref="GeneID:5653171"
     mRNA            <981968..>983293
                     /locus_tag="LMJF_26_2410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684196.1"
                     /db_xref="GeneID:5653171"
     CDS             981968..983293
                     /locus_tag="LMJF_26_2410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684248.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653171"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8V0"
                     /translation="MSLSEVQRLQKLVFHHPNKENYETLVLEQILMVEQQLGTKTKAE
                     ERATAARREAEQLRGELEELRRETASAPTISAVEREDYYVSWTALLKEFCMRKEILSF
                     LLSYPAEDFKLVELTTVSHWLDTWTTFFAAAESSVRSLKRLERESANRNTLPPTRPLY
                     DALDEVCRLQLQARTLVGRERYRRSSSSEEFVKDFMDSQQQLREWCRKQHNTLAALTT
                     LGDLIEFNNSFYANVPVMDSNFLVLMEQSEALMSNVQVQDALREVNREWVMLTLETYG
                     KLQAASAREHGSSSLERQCAEWIQVMSPRLRRLLVSAQSTLAQGKDVPEAKLLATTCE
                     QLLKAHEAHDIVCTHLSDYTVREECVRPHLDALKAELQSSLTTTVLTFPLFDTSGGQA
                     DYKSRVEELQEWIDVKSQKGTYVKLLERLELTKAVIEEHADVLFPEDSP"
     gene            <984728..>986662
                     /locus_tag="LMJF_26_2420"
                     /db_xref="GeneID:5653172"
     mRNA            <984728..>986662
                     /locus_tag="LMJF_26_2420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684197.1"
                     /db_xref="GeneID:5653172"
     CDS             984728..986662
                     /locus_tag="LMJF_26_2420"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684249.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653172"
                     /db_xref="InterPro:IPR002083"
                     /db_xref="InterPro:IPR008974"
                     /db_xref="InterPro:IPR011333"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8U9"
                     /translation="MESVEAVELFSEHSARYRYRVPVSVIRELPYEGSHYSAEFNVGG
                     WFWRFHIQERSAEAQRFLALHLQSCTPGAVSVHFKLTAVCMRDPLQSRSKTFNCTFKK
                     AGSAWGLHQFIAIEQLLRPESGFVYMVQETGTRCVDFEAVLQVDNGSGNGRAPPVRSA
                     TRSVTPTRSVVGAGVAGTNGGQILPSRGPSVRPVGRRGGGTPLGRSGRMSYSPGRVGT
                     SALVPMEGSVDRPGASAGAAVRRGFYSDPNGGQMMTLDSASTIGGDGGGRGAGSAVVR
                     APLAYPFAHLEILCDMSFDVQGVRVKAHRCVIGARMQPLLPEQMLPLQVGCIVAIAVP
                     LDVFTTFLRYVYTEEYPESGVLPPESLLDLYLLAAACEFYDLGAVCIRYVRPLLTPEN
                     ILPIVLTRYNAADEVLTSLYLHVLLDNYDILIQDRQFEEIPGHLFRRLSLILYSKETV
                     PNALIPPMKNTLGKQLAWLAESGEYSDYEWVVGPQQYAVHAHRYILACRCVLFSQAMN
                     PRSPGPLPPFTTNEFDFSLRSWQKLLMGMYRRHLDTARDFSAEDIAIIFKMQQVLIMD
                     GQLKREADEAFNNTNALRLLIYSVKHQIPELRERAISYVARNFSAMIRNDSQAWELIS
                     ELPQAAVVSLFRTVTEQPPL"
     gene            <988284..>989294
                     /locus_tag="LMJF_26_2430"
                     /db_xref="GeneID:5653173"
     mRNA            <988284..>989294
                     /locus_tag="LMJF_26_2430"
                     /product="putative metallopeptidase"
                     /transcript_id="XM_001684198.1"
                     /db_xref="GeneID:5653173"
     CDS             988284..989294
                     /locus_tag="LMJF_26_2430"
                     /codon_start=1
                     /product="putative metallopeptidase"
                     /protein_id="XP_001684250.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653173"
                     /db_xref="InterPro:IPR000555"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8U8"
                     /translation="MNVADMPNTSAKLRESREPLSEVRISDQVVQSCLRHAFTTEEEE
                     VMGLLLGRIEVQPFTELHIDGSRDAGFPASPADGAVNGVRSRGSGTAVSIAGAAPVPL
                     SASAAKREKVAYIWGTHVGERNVQRSDRVEMSAESVASATEAADRMTTDTGVRTYVVG
                     WYHSHPRIPAVPSPVDLCTQGRFQQYMESGWVGLIASVFNTEANITCGHCALHCFQAG
                     LGNEHVEVPMRIVPQSALFASLDPIGALPDTTPRLLQVLQQEVRDAVAATVRESAHDA
                     ATSRAARGLAEVQLFQIDRLVAEPTRKELVHCSLPLLRAEVARLEAALAATAGAAPQP
                     QH"
     gene            <991546..>994677
                     /locus_tag="LMJF_26_2440"
                     /db_xref="GeneID:5653174"
     mRNA            <991546..>994677
                     /locus_tag="LMJF_26_2440"
                     /product="putative protein kinase"
                     /transcript_id="XM_001684199.1"
                     /db_xref="GeneID:5653174"
     CDS             991546..994677
                     /locus_tag="LMJF_26_2440"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001684251.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653174"
                     /db_xref="GOA:Q4Q8U7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8U7"
                     /translation="MVALKTPTSSSVHPVKASVSARPSSQIAAADQIAVELLQALCYA
                     EVQEAQEWLAGAGNAKQAWAVSRSVALVRPTEAVAADPRMSEGGGAAAALLEAAPVSL
                     DAAAHLRFSQFFRASLMEEDSDDAVMSDGGHGAVHGGAGKDTSTREAVEMTRTGDVRR
                     STGLTRSWGEAAPRSCQYGGAFPSPWPYVASEFDGPGADVGVEKGDDDDLTDSPITGV
                     PPSSPHLHRTSVDADGEAAAPLPDPLIFPSPSAPGTSAKCTLVWRASPLLVERDSSTP
                     PRRSLSPAATARRWSLSFFDIGRRIGHGHSGKTFLAREKHSKVVVALKVFNDDYAQRH
                     EGGTNTVERAMRLQAAARRHCPHIVRLYAFFTDARRCYAALEYADAGDLASHLLRQPH
                     QRLPEAQAQVIAYHVALALRHLHEQRVVHRAVTMRNVLLRRSEAGTTAKLGDFASAVQ
                     LADGRARWLGELGSSDDGGRSLEYAAPEVICGRGWSCKSDMWALGILVFEMICGHHPF
                     DHVSAAAMKRLICSGAACRSPHALSHTGMSFVRSLLCVDEAARSSAATALAHPFLSVK
                     AAATTPAVASAMQDTAASGSTKPARSAAQAVPASVAVAEESRMDAVALPVSRDLSSTF
                     SLAAVLANTEANCGSDGGHSRGTAAMKAGTNTAISCADAALVSPAPRDNIPYAWRGGN
                     PSVNSLAATSTSPTVTPFSTARRVTGATRHAHGAAWHTADAVAPAASLSSTSSPGPLM
                     SFAPLTHPWQGTALPPSATLSASSLFGALSNEEADTSSGRRPSDTRLRSPGNASHLSP
                     TTTLSDMSASVLSTTRTPTTLASGAAQPTGGAFTDSAAAESVLSASFKSCNTHNPIYL
                     FSQQHHARHGQQHEQQETPATYGAVSTARSGERRRSEDTRGDCSVTVSSLTPRPSCSA
                     RTEWATEDAEVSLSSLTVSSTSSSFMCAAVPQASFHTRAADAPLRQMTGRVASSMAAS
                     GALQAQRLPLTGRLASSTITLTSVRGASGAPKAAVTSSRSRRPRSGTNRLNKRPECSL
                     RLAFETLSDEDSW"
     gene            <995375..>996040
                     /locus_tag="LMJF_26_2450"
                     /db_xref="GeneID:5653175"
     mRNA            <995375..>996040
                     /locus_tag="LMJF_26_2450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684200.1"
                     /db_xref="GeneID:5653175"
     CDS             995375..996040
                     /locus_tag="LMJF_26_2450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684252.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653175"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8U6"
                     /translation="MPLDLVGKLHRTVYITDCPEDSQEDLLHMLLKRCGAIEAWDAAD
                     GRLIVVFQSMNSVSNALTFHGMSFVDLTRKICVWKATDTPPAEATHQLSIQGGSATAE
                     AAPMEATSTEEEDTRRAQRKERRAALQQILNSGAADLGDTASLEGRRAKMTELCYRQL
                     KALCVLSAAAAKDARVELQQKRENLARLQDLIRTQEAAPKRQWAGSAEVGEEEPARAR
                     RCV"
     gene            <996711..>998051
                     /locus_tag="LMJF_26_2460"
                     /db_xref="GeneID:5653176"
     mRNA            <996711..>998051
                     /locus_tag="LMJF_26_2460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684201.1"
                     /db_xref="GeneID:5653176"
     CDS             996711..998051
                     /locus_tag="LMJF_26_2460"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684253.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653176"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8U5"
                     /translation="MLLHRRAALLLWVRARRTAVLVGSSSLSATAEAAAAFSSATTPP
                     QRRNVGSASGAVDSHVAAVPAAGGPASAAAAAGAAPQYHSHDTPLQEHPRQAAYSKGG
                     YPLIGRLRTSGHGLTLGRVQAALTVYVLAASVGLLYVLYYLTTDTYVLTTNVSPYRHS
                     LFFHFPCDMAILENRLTHKRHTVEVVPAAGAPHPLVDDNREVDHAGFARPKPAVVERR
                     LHINAVLHRVFLYLQKTESLVTVDAQAEMAPYRFMDGANSLGKASRASVGFLRKDQLL
                     PDINDHRASTASSQRRWWQWWGRGASTAAAPLPLSASGSSAYAATATEVPATPTAPTK
                     ILLRSSVRLRDSMNGYQKGHISTYEQLIHHLAQENIKQRYYAYVLARGMAKSSGLRKA
                     YAEQLIRNGLISGDGVKLTELVPDVQRFADEVFAQVRERFGDDVIVYEYTATMW"
     gene            <998940..>999308
                     /locus_tag="LMJF_26_2470"
                     /db_xref="GeneID:5653177"
     mRNA            <998940..>999308
                     /locus_tag="LMJF_26_2470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684202.1"
                     /db_xref="GeneID:5653177"
     CDS             998940..999308
                     /locus_tag="LMJF_26_2470"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684254.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653177"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8U4"
                     /translation="MFHTAFLAASKRRLRWRCCQCTRLLPSEHFPKRSGPLNTMVCVD
                     CKEMCFGCGLRLLRSSFSDTDSNMCDRCLAKQQVAKDNVYFRYPILNYRACPFSVDEA
                     RDELRKEQQQQQPHRLHMPR"
     gene            <999943..>1000632
                     /locus_tag="LMJF_26_2480"
                     /db_xref="GeneID:5653178"
     mRNA            <999943..>1000632
                     /locus_tag="LMJF_26_2480"
                     /product="putative phosphatidyltransferase"
                     /transcript_id="XM_001684203.1"
                     /db_xref="GeneID:5653178"
     CDS             999943..1000632
                     /locus_tag="LMJF_26_2480"
                     /EC_number="2.7.8.11"
                     /codon_start=1
                     /product="putative phosphatidyltransferase"
                     /protein_id="XP_001684255.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653178"
                     /db_xref="GOA:Q4Q8U3"
                     /db_xref="InterPro:IPR000462"
                     /db_xref="InterPro:IPR014387"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8U3"
                     /translation="MAAMSPKPTSPSPVKVFFFVPNIIGYARIATSIMAYLVARDYPA
                     LCLVLYASSFLLDAADGMAARALDQCSNFGAILDMLTDRASTAGFLVVLDSVLQPMPY
                     RYTCVFAILLFLDVASHFCRMYASVFIQKDSHKDASDSIFWLLRMYYVKGSVMFILCI
                     GQEFAYIFLYAWANYASVAVVGDLLWYAFAVCVVPCFLKQVVNVQQLVDGLYRIACVD
                     AQKRGAQGKYA"
     gene            <1003498..>1007883
                     /locus_tag="LMJF_26_2490"
                     /db_xref="GeneID:5653179"
     mRNA            <1003498..>1007883
                     /locus_tag="LMJF_26_2490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684204.1"
                     /db_xref="GeneID:5653179"
     CDS             1003498..1007883
                     /locus_tag="LMJF_26_2490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684256.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653179"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8U2"
                     /translation="MLSNTLTKVCEENGRLSGQISALEEKVQALAQEPLKETPVLQSL
                     FEPEKTGWFGGSKSAAREQLEQLSDALQSEFISYKASHASSNDEVQALVEGLHNAHLN
                     AQELSNTVKEQQQLISSGPLAVAVHIVPVDEGNSCAATAQELQAQLRRVREQAARTED
                     ALRSSQAELLALKAENAKLRNDSVASSTPLEPAAAAPMPAGNSALLLSEMSATEALKR
                     MTSERDALQDALAEARDAIVEKDKDAELQKHKVAQLESKLAAKDSVHMEEVDKLRQQL
                     ETARRDVDASHITVQGLRSQILEMTVQQEERHNALEKRLADALDQLSAKDDQLRHLSS
                     VDDYENLKLEQESLTREIDLYKQRIAFLETSRSASDDAANATALNDAEVLETLNATKE
                     RISKLEFERDQLVMQLQQAQSYAVSRDAEARQLQQRSEDDKKRVAFLMKKCASLTADV
                     RSATTQLDTFKDQFEKQSLELKQERRNTEGMARLQKQFDDLSKEKKLLEDRLAATQEM
                     EERLVKAKETIAYMELAQSSTICMSQFAELKAEKEKLQNTMEPLDRRLEEAKQEIERL
                     KAVTDAQHAISETQNKNVRAWQDQVTALSESEAKLRDKVAVLTAENTRLTQVNASLEQ
                     QMDDMQDGIKEMAVHMEKDRASAKAAAEANAQKQIQTLSDELAQARKTIAEVQARDGQ
                     YVADGLYQSVVAERDRSLEENKKITVELEKCKSEISIYRQTIADLEQENDERVKEIES
                     LQDHYQSDRAALSDRLAKEQKRAAELSSGVADLTERVSAMEAEAAKHTSAITALQEKN
                     ARQQRVFEDKCRREEALTDEIKRLNGQISALQANLASVALQGQGSGSNGNDVDTTAAA
                     AFVAAASTVGVAAPAVERCSSAVVEPETEVRATDRAALLSSLNPAAATASRPLLDRPA
                     DGAAAYAASAPEPIAIDAFCKRIEDLQRDNDRLNSELKRIQLQHRTDSANDQHMITVL
                     QTQIKNRMSTNNRAAYEAEIAKSAALKKSIEALMEENVKLRKQAGVAQVSANMPASAS
                     SVAMAGAQQMDVLQLQSQLQAQKAAYDSAMEAAAKAAETYEARIHELEEQLHETKEAA
                     AAAAAAAAAGGTGTGGNAADDGDASLLDRPVKRRVKKIKKKKTLAEQVGATNDGDDIL
                     AASPQADGAAATENSAEAGQLQAPLMLVHQEVDQVKLENMRLTAENTQLKATVADLLE
                     QLQRAEEDVKAANEDMDMMQTAMNEERVDLGKRMDLLEQQSIQRLPGTDEQQLSTPLR
                     NTGSVRNGSENLSEVNRSFRNSTVVDFEMQLRRCQDEVERLTAENRNLQCRPEREEAQ
                     RTSSLSGTAAAVMAQKSEAGDVRKLQRQLKQKDAEIKVLADQLMPTKEKLAEYMAMAD
                     RLGLRYPFPPELEGATVLRLKALHLPVHPRSASAPTPAHQWVHRIRSGGKVDEVSPPP
                     RAPRARHIGGGVDTAREKGGDFSRR"
     gene            1010359..1011854
                     /locus_tag="LMJF_26_2495"
                     /pseudo
                     /db_xref="GeneID:12981821"
     CDS             join(1010359..1010781,1010784..1011854)
                     /locus_tag="LMJF_26_2495"
                     /pseudo
                     /codon_start=1
                     /product="putative phosphatidylinositol-4-phosphate
                     5-kinase"
                     /db_xref="GeneID:12981821"
     gene            <1012766..>1013197
                     /locus_tag="LMJF_26_2500"
                     /db_xref="GeneID:5653180"
     mRNA            <1012766..>1013197
                     /locus_tag="LMJF_26_2500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684205.1"
                     /db_xref="GeneID:5653180"
     CDS             1012766..1013197
                     /locus_tag="LMJF_26_2500"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684257.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653180"
                     /db_xref="InterPro:IPR009069"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8U1"
                     /translation="MSAARDDSAPCAVPSTLWRECLKQYDYGPDRPKGACEAHRTKFY
                     DCVKDWTARTQHKSYSYTQFELPKSCGHEAEKLHQCMMMNMFEVGHCQRDMAVLKRCA
                     ARVDPEVRKYLQDDEAIADLENDIDEATGLKRLWYKVIGKL"
     gene            <1014367..>1015812
                     /locus_tag="LMJF_26_2510"
                     /db_xref="GeneID:5653181"
     mRNA            <1014367..>1015812
                     /locus_tag="LMJF_26_2510"
                     /product="putative protein kinase"
                     /transcript_id="XM_001684206.1"
                     /db_xref="GeneID:5653181"
     CDS             1014367..1015812
                     /locus_tag="LMJF_26_2510"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001684258.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653181"
                     /db_xref="GOA:Q4Q8U0"
                     /db_xref="InterPro:IPR000306"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR017455"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8U0"
                     /translation="MSTGDLLTPGALWQDDTKVFVCSGRRCGRRFNRLFCPKHRCRWC
                     GRVYCDACAPKQTVYKRQLLRKCNRCRLPVVFRYSWNERTRAMDCTPFECIISYLTPR
                     SITALLQSCYTMMSEFPVCGYPFYDSIQQRFPSFYPGAQIGRGTFGTVFKCEDRSAAD
                     HKRAILKCISKATNLTYTRWMGALTELRILESVNHPNVAHLLGAFQTREDLVIVMEAG
                     EGGTARRAAAGVREYGQAAEEAFTANIIEGVAAGLNYLYREKHIIHRDIKLDNIVLSA
                     DYSTPMIIDFGLAEFVVNEEEQWYVVGGTRNYAAPESIAAVANGHVDMKEPGITMHKG
                     DLFSLGVVAYYLLSGHRPFRSRSFDKMHEEMRRGVACTGPLWDGVSSDARELVQALLS
                     YDPAQRPDYAAIKENPFITARTAGVKSIQMQRNARLLLDEEETHAEWVTLEPSDLREA
                     ADEGESEVLLPLSTPQRWYHAYLPRFSLLHL"
     gene            <1017478..>1018947
                     /locus_tag="LMJF_26_2520"
                     /db_xref="GeneID:5653182"
     mRNA            <1017478..>1018947
                     /locus_tag="LMJF_26_2520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684207.1"
                     /db_xref="GeneID:5653182"
     CDS             1017478..1018947
                     /locus_tag="LMJF_26_2520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684259.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653182"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8T9"
                     /translation="MEAVQIAKSILAADGQPFVILSFAQGFAPVTPETPVPVARRSYM
                     RLAGVIHPDRLQGSFDRATEAFQCLVRAFECFADPKARKRAAAAAQKKSKVESRVPTA
                     ADGRKAKAAPPSSTISRPSASQLMRQANSKAGAAPAVRKRRATAEGERESGSESEAED
                     DDASEASAADEKAWEALAATNTEPEVSTNRTPIGQPRLGGLHQPTTVGCPKCRSLWEP
                     DSRPQYSLFMGHWGKKVHCQLCLFQFGCATALHGCPHCSAPFDYDASMYDTVQTCQRC
                     KRQFGFPYYPVSQHLIDQIALEEWRERMERQKTSEREARARARHGGGGSDEATATEEK
                     MELLVGTCIMEEECPLCHKRVKSKHRAHVEECMATPPGELVTSTGRAARKSTRAAPPA
                     DKVAKAPASRAAKTTPKTKPKTATPGATKKSAVPRAPRAKASPSATAKGKKTSAPRKR
                     KRQRSDSDFSEGEDSLSGSEEDAISSESSFSDSDYDDSD"
     gene            <1020179..>1021678
                     /locus_tag="LMJF_26_2530"
                     /db_xref="GeneID:5653183"
     mRNA            <1020179..>1021678
                     /locus_tag="LMJF_26_2530"
                     /product="putative serine/threonine protein phosphatase"
                     /transcript_id="XM_001684208.1"
                     /db_xref="GeneID:5653183"
     CDS             1020179..1021678
                     /locus_tag="LMJF_26_2530"
                     /EC_number="3.1.3.16"
                     /codon_start=1
                     /product="putative serine/threonine protein phosphatase"
                     /protein_id="XP_001684260.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653183"
                     /db_xref="GOA:Q4Q8T8"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8T8"
                     /translation="MLLTDRGNPSVPPPNWEPLSSSALFDESGTARPDVVREHLRKEG
                     LLQEADALTIITQCALIWKDEPNVLRVDGPVAIAGDIHGQFFDLLNLISIGGDPSQQK
                     YIFLGDYVDRGCFGMEVILLLMCYKICYPDTMIMLRGNHESRHLTTYFNFKREVLYKY
                     SIAVYNAIMSAFDCLPLACILNNRFLCVHGGLSPELKRISDIGAIHRFREPPSSGPMC
                     DLLWADPLDEKEEDPAAAPLFVPNTTRGCSYVYSNAAACNFLEENDLITIIRGHEAQD
                     EGYHLYKKTSKGFPAVICIFSAPNYCDTYDNRAAVVMLNRNIMSIRQFNSSPHPYYLP
                     NFMNAFTWSLPFVEEKLLDIVANVLHPIDGGEDHLLVDGAEAAKAAPTPGANTESRDG
                     RVLEQRGENIREKILAMGRLSRMFHTLCEGSESSLPPKGLTGDIPPQGGLPCGPDSVQ
                     AACRGLQQSKELDSVNERWQDCLIESDLEPQPSAATTVLSAASSSTGSR"
     gene            <1025513..>1027600
                     /locus_tag="LMJF_26_2540"
                     /db_xref="GeneID:5653184"
     mRNA            <1025513..>1027600
                     /locus_tag="LMJF_26_2540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684209.1"
                     /db_xref="GeneID:5653184"
     CDS             1025513..1027600
                     /locus_tag="LMJF_26_2540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684261.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653184"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8T7"
                     /translation="MRDRTRSSPPLQRRLAEYLRCSTSKAETAEAFFLVARSHQEALM
                     PATISEFTSTMLRHHVAAQMGVKTYEEALEDAVGVAGESPWCHVEPAEARAFALYQAR
                     RLERYAVRGTSFQEKLGLTLEGADNAVVALTEHQMRKGAAAASALPVSFDALVELIHL
                     DVSWSTALQVYMYAKEVTRVDPPADMTARLMGLMTGYKTNALGSRPWEMALELYDRVL
                     ESGYEVPLDAHTAALDAVWRSGESFVKPHHSLSPTDRDCMWNALVRIRERVPDAQVMG
                     DAGCRFTEALIKAVGAAGRWEAALQLLSDMDITLAATSHRLLVPTAESFLFAMASCNA
                     AHNAAHANALYETFSALYTLRSAHPEALLAYLQSLRNVEHLSAHIGPQVEGLVTDGKG
                     LDRPCCVVCLQLLSSQRVHTKQAAKWRIAQSLLRMYDSNPWPQQPPVRKAELQTVFRC
                     CHLIAASSANDAKVSAAAAAPCSLVTELRAYLASVFGRDSCECQWLDDTEVYSLLTTQ
                     SWECALSIYQRQVTQRPPARLTDLPIPLRQVRHMFAQALLRCSRAATGEEGGRDRFLL
                     DEEREAQERAKTLDFLAFTVRTVREVYAGTGDTVSLGIVAELLLHQAMHAPRARERQQ
                     LALDAMRELSCGLASAVTPRLIDLVAQALSLTEEHVQSVLVDGSAQLRAKALVREEHR
                     RIRSSGCLEKIFT"
     gene            <1030304..>1030588
                     /locus_tag="LMJF_26_2550"
                     /db_xref="GeneID:5653185"
     mRNA            <1030304..>1030588
                     /locus_tag="LMJF_26_2550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684210.1"
                     /db_xref="GeneID:5653185"
     CDS             1030304..1030588
                     /locus_tag="LMJF_26_2550"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684262.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653185"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8T6"
                     /translation="MVTTVKVEIPRESIMKPSYMDDIYLLNQLDGVNDNPQEDGLPLR
                     KWILREVHEALAKNPRKTEVVVKLKSDKSARSEFAVTIIGDYVPNYLQQS"
     gene            <1033610..>1035160
                     /locus_tag="LMJF_26_2560"
                     /db_xref="GeneID:5653186"
     mRNA            <1033610..>1035160
                     /locus_tag="LMJF_26_2560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684211.1"
                     /db_xref="GeneID:5653186"
     CDS             1033610..1035160
                     /locus_tag="LMJF_26_2560"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684263.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653186"
                     /db_xref="GOA:Q4Q8T5"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR003616"
                     /db_xref="InterPro:IPR005905"
                     /db_xref="InterPro:IPR011095"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8T5"
                     /translation="MTDALAKPIRVCVLACSYEGSDSELRAYEGDLIQTPQNYFCSED
                     AQCTFHLELIKKATAYRQIRQLVMSGKFDVFYNQCDGAKDEDRAGVEVVEALEEFKVP
                     YTGAISKYYEMSKPDMKLVAYYYNIATANYIVLAPGDDIESLCGDLQFPCIIKHISGY
                     SSVGMDKSCKVYDMAHLVDRAARFMAEYQFALVEEFVNGDEATILACSDSTQPEGVRV
                     FPPVQVAFPEGEDFKHFQLKWASYEGMKWTQVPQEDPAMQNMIDIARSAFKRMMGGVG
                     YGRIDVRIDRQKNHKVVFLEINPNCGIMYPYGQEGSADWILRLNRGFQQREFAMLQIR
                     EAITRCQRERLLYVRRFDPVRGYHLRAAEDISVGTIIFQDECRPVRLCTKPYALQHFS
                     KADYVDFQHNAWPVGRDGHYYALWDHDPAQWRAFNHSCEPNMSFAPMRSLDVVALRNI
                     PKGEELTMDYRQFMDSTMPGFQCNCGTEKCEGFVSPGSLVDSPTAKIASQPTVALRHN
                     IAVRLNPI"
     gene            <1038070..>1039371
                     /locus_tag="LMJF_26_2570"
                     /db_xref="GeneID:5653187"
     mRNA            <1038070..>1039371
                     /locus_tag="LMJF_26_2570"
                     /product="putative protein kinase"
                     /transcript_id="XM_001684212.1"
                     /db_xref="GeneID:5653187"
     CDS             1038070..1039371
                     /locus_tag="LMJF_26_2570"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001684264.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653187"
                     /db_xref="GOA:Q4Q8T4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8T4"
                     /translation="MATPVTDPPKIIGRELHLDRLIGSGGFGEVYLAVRTKLATNPKH
                     NFTFPAECVVKVMRRGLCTEEDVAAMNREVATLSSMDHPYIVAYIGAWVEAARGKFFG
                     CYCLAMKYCEGGDLHGFIAQCIKAHRLPPVDVAVRIMAQVFSALNYSHSRRLIHRDIK
                     PGNVFLTLQKSGMPDKAMVGDYGLVRSLEATRQLVKTRVGTPTYISPEIAAGEAYSTK
                     TDIFSAGTMFYELLSLHRPFWKRMMTDQQLFREVLHRDPMPQFRAYTSSVYGTALADV
                     IEACLTKHEASRATAYDALVRLTSPITAYVLKYAIPVYPEKDALATSSPPRPPAASSA
                     PDGHASAADADGDAATARQRLERLFLVRKGTGVGARLTRLLSHNAELLFQVRVLVACR
                     SDNTDHLENGLAELLWAFPDAEVPFQEVIDLVMSGYGQLAE"
     gene            <1040848..>1041303
                     /locus_tag="LMJF_26_2580"
                     /db_xref="GeneID:5653188"
     mRNA            <1040848..>1041303
                     /locus_tag="LMJF_26_2580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684213.1"
                     /db_xref="GeneID:5653188"
     CDS             1040848..1041303
                     /locus_tag="LMJF_26_2580"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684265.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653188"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8T3"
                     /translation="MSSIAAKQVHRQQLLQPRLVLPAGRTVSLEEGRRLAKFVHDEED
                     RVQSEATRLLEVKEASPVVLEESVSRRILLLRQKKNSKANVKAAVAYANRLHRKSAVQ
                     VEDVTKMREAASRVLRPSSSIGSASLKQRRQRAEQTKKQRQPKQGKKRH"
     gene            <1043167..>1045635
                     /locus_tag="LMJF_26_2590"
                     /db_xref="GeneID:5653189"
     mRNA            <1043167..>1045635
                     /locus_tag="LMJF_26_2590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684214.1"
                     /db_xref="GeneID:5653189"
     CDS             1043167..1045635
                     /locus_tag="LMJF_26_2590"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684266.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653189"
                     /db_xref="InterPro:IPR007498"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8T2"
                     /translation="MTPYSQCLSAALFLSTLNFTSVSIPSFNESLLGVNAFNLTCFDV
                     YMSGFGTSWMPTTSYAGITDGGNIRCRTNLTAFAYSGVVWADVVVHPGVVRLARTIET
                     PGSPHMCITNASSITDCHVNVSVVDLHADPPSGLIDLILAQAKSYVNNHASDYVCKVL
                     VPRGESSIMNNTYPYTPEREDKGRKITPVSESPLIRALMSIANRVRVGNIRFFVGSQP
                     QRISILISHAGGTHAGFTGDLVPTRLGESAVDWAQGLVDAYVQGVVPQPLPVYGLPGE
                     IKDLVVGLNTSQTVFATFDVDVSVAASSANWVTIYLQPGVTIENLRIQANSDGLGNLL
                     THVAAPELEKLINAKIATAIAALAGSAGNGSHDNGTANGTLTFSFGENTVVRDSPLWL
                     PLILISCVGVVVGVLLVVRNVRRHREQPVVSSVTGAPLSTFRIVAEDVFLIVGVVVCL
                     LLFSASNTMTGATVVLGDELRTYAFSLSNTITDLWQAGLFPLSVCVLVFSGIYPYVKL
                     LGILFFTVWAHRPSSRALKLIDCIGKLSLIDTFALMVMVSGLEIPSIADVRVHLSFYI
                     FMYATIVSIALGNYATLLWRAGTTLRGDDTPVEDADANSTLGSAPGEAVTAPLAEQEA
                     SAPSMNGNSLPGDGASVQLQSGEHRTSCWRRFTGPALCIPLVFMIACSIPAWILPTFR
                     YTIGGFARLLTPPSKSLTLWTLSSLGGRDDALDILAVALFTILIAPCLYVAFYPRCTF
                     LASWCAADVLLIACVVGLLQLQQFVRFVLGDRRDILYTAHASLLWPLYLLAAAAMLVW
                     VYIARDILHYVFVRKELIAMPPSA"
     gene            <1048958..>1051063
                     /locus_tag="LMJF_26_2600"
                     /db_xref="GeneID:5653190"
     mRNA            <1048958..>1051063
                     /locus_tag="LMJF_26_2600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684215.1"
                     /db_xref="GeneID:5653190"
     CDS             1048958..1051063
                     /locus_tag="LMJF_26_2600"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684267.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653190"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8T1"
                     /translation="MEGALGIRAPAPASATVSPARSAMREVVNSWREAAGMWKRLRAD
                     DKTGDDAEMDAIKRVKREGGDEAEVWQRLRDSPPARPSDIPAWAVGLEAVLERCRELV
                     ESPNFAVAARQQERSRSLRAALTVPSATAALSASAPAQPVASATVAATPAATLDSRAA
                     LLREAELVCSRERTETLLPLYAELHALRRMRAEREQQAARKVEEQLEWEQLRLTDMLA
                     ECDAQLEMLDSNFLDSCKGRLAPLEMLQRRIDALHRFRRQLETHAAAMLPLPLKGVEA
                     PSTNALAAPELATHAPRPMGLVGDALSQRMSEECVAWRKRVEGLQARLDAQKKRNADL
                     QACYTQANRQLQASLDRDNYVSKEVVNALKAQHRADMEALVEKLGWTLINNTFDVLSL
                     RHPGSGATLHVNHAYSTINGQPCDDVVKALATYILKRNDDTASTVAPAAALSVNASEA
                     VKGGTVGEGHASSTSVHPTALPAQASYLQSGAASMDGAMRQEASQAAVESVSAVTEDT
                     VDQAASASPSASARDERVSAPSSLESSAPSGAEVTAAVEPPMCVGSASMDEEVAEVSP
                     QSRISSVAAAESTGEGTYGVNGAQEAHGGAAASSDGTGERDNDEDDVAAYVEEGNNAD
                     GDEEDGDGGVSDAEEEDLAGYSNVQTEEGSGNTSTLNVSGNLPSSGSKGSDAQATPLQ
                     PAPYESFFSSNQLWESEDE"
     gene            <1052042..>1053406
                     /locus_tag="LMJF_26_2610"
                     /db_xref="GeneID:5653191"
     mRNA            <1052042..>1053406
                     /locus_tag="LMJF_26_2610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684216.1"
                     /db_xref="GeneID:5653191"
     CDS             1052042..1053406
                     /locus_tag="LMJF_26_2610"
                     /EC_number="1.14.13.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684268.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653191"
                     /db_xref="GOA:Q4Q8T0"
                     /db_xref="InterPro:IPR002938"
                     /db_xref="InterPro:IPR003042"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8T0"
                     /translation="MRVVIVGAGLSGLSLAAFLRGLNVDCVVLEQVPFLQANYIAPYT
                     LFANALSCFKAFGMEGIFTSSGIQPEACFGIQNHKGKWLLKTANRNLHLPALGAEDVI
                     PLSTAPPANSESIVSQRLSEARKQEMGYVPLRCTLPASYLREALRRYIPEIKFSARVI
                     DLLPHDGVKGGVHAVLEDGSTEWGDVVVGADGMHSTIRRLLYPSEHVGTSSRSLGMMQ
                     VDGFVDCPHCPPHLMQPVECWGTGRTLQTVPLHRFGENTLAFSATLHSLPQELVDLRH
                     GVDAIEVLQVFQRLLGREYAGFGDRVATLLSQAKLAVPTEVLEVPVMPRWYNRRAVLM
                     GEAAHGSLPSFLNQDASLCVEDAALLAVALLDVPLQRDSGFEYAFRQYETVRRDRVER
                     YIRQSRRARKLTAMTNTALRNTLLRLTSPIAVDLAQRWLSSWTYSSQQLAVDPKIKME
                     TAFR"
     gene            <1054469..>1055302
                     /locus_tag="LMJF_26_2620"
                     /db_xref="GeneID:5653192"
     mRNA            <1054469..>1055302
                     /locus_tag="LMJF_26_2620"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684217.1"
                     /db_xref="GeneID:5653192"
     CDS             1054469..1055302
                     /locus_tag="LMJF_26_2620"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684269.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653192"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8S9"
                     /translation="MASTLEAEIAFLLSVAAHLGHSSEHVGENEGVAGGAPPVSSLTA
                     SEREVLAELLLLEKKESDYVFATRADTAAAGGVEALLAESPLTAMYRGEAVSPYTRFI
                     LSFYSSTLYAQVPTKVNTIAIRLFQRFLCGCRGDALQRLHHGFGRRSMEVVLRECLNL
                     AGNLSSTLQIAAPSEMTGLVIAELDYDAQEVSPLDYLDVILPHISYLSQMCQQASLLL
                     LAHEEMMRQPSSLVALFTIVFTIRNMGTGDDTVTLLLSSWPECRQAAFYRMNAFLNCF
                     T"
     gene            <1056017..>1056259
                     /locus_tag="LMJF_26_2630"
                     /db_xref="GeneID:5653193"
     mRNA            <1056017..>1056259
                     /locus_tag="LMJF_26_2630"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684218.1"
                     /db_xref="GeneID:5653193"
     CDS             1056017..1056259
                     /locus_tag="LMJF_26_2630"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684270.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653193"
                     /db_xref="InterPro:IPR007872"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8S8"
                     /translation="MEEFHYEEVQLSEMTLEDGVLRFPCPCGDLFELLLEDFISGSDV
                     AQCPTCSLTIKVLFSKEEKNHFLALNTVGDVCAAAA"
     gene            <1057700..>1058854
                     /locus_tag="LMJF_26_2640"
                     /db_xref="GeneID:5653194"
     mRNA            <1057700..>1058854
                     /locus_tag="LMJF_26_2640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684219.1"
                     /db_xref="GeneID:5653194"
     CDS             1057700..1058854
                     /locus_tag="LMJF_26_2640"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684271.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653194"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8S7"
                     /translation="MLRRLVAHAVAPAALCRHLIVSADIREGLTKPLSSLKDECKGQN
                     LDLADMAEAMKGATYKLQEVIKNSAVDDKQFKGKTATLSASLKAYNTRLANLQNETRS
                     IQAEIDAIMKLLWGTERPEGANFATPPAENAPNPTADFEVEPPPIARALGEATLSAPS
                     STAPPKLNVERVEGERVETTARMGTSSSAGASKEEEIEVETIEVDVEPPAQEDPVETM
                     KVTDITKELYERGVNFSDCMDARTLRQRYRDVLSGKIPTAANGSSSSASHGFTKPLTM
                     NTNQPRMPQSGPPPQNSYPYQQQGQSHTNNAGSGITNDPYPNAHRKMVDPMKFVYQIK
                     QELALEKGIDAGAVDLWSGKIKLDDNKRLYDYPSIQSYPIEVRQKGDIPA"
     gene            <1062857..>1064605
                     /locus_tag="LMJF_26_2650"
                     /db_xref="GeneID:5653195"
     mRNA            <1062857..>1064605
                     /locus_tag="LMJF_26_2650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684220.1"
                     /db_xref="GeneID:5653195"
     CDS             1062857..1064605
                     /locus_tag="LMJF_26_2650"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684272.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653195"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8S6"
                     /translation="MAEETCTTDSEAKALQQLAERYYEAYKRDRGSDSAPTVASSLMR
                     MMAVMGELSTMAFTSSSGMSPFEKDEVSLLIGKLSISVAMIAEAFHLNVGRSILQYLE
                     EELRTAQLSQRGALNNGCGTTAAESDGTSAGAPPLDAQASVSEAPAPPPPPPVTERER
                     SVMLGPTLNDDFFGHVDELAKLPREQFEKADLKWVAPLPNGTMEEIIPNGRWITVRYE
                     DFPHYLAHIARHRQARASQPQPSPPSSHSTGVAGRQGYKDPTAEYPANCAPAVSVATP
                     SVPSILAQAPGYDPDRESTLYSPGHFAGDLFSPMARASDVQTMSVVPPAAMMTEMGGG
                     AAGFERRSRPAVQHIGRPYDVSSFHDKVNLLRRGAVPSAAIAQLGLTFSVPDGQRVVE
                     LVNDGMQVDVTAANVSEFLRLLDNYPTAQAPSGRVHRTNSVRKIDVGRIISDVPATFS
                     PSHFSHGLFAPYQEPTSSVYVDYDKSERMLPLYLKEHHVSPADTRGLYVSAARSADYP
                     TLERIVQEVKVNPSALTKYGVTFSVPSSLEPYSTPEERRSGLHALFPSSALQAVQPAD
                     RLHFLSLARQYYPNIL"
     gene            <1066763..>1069246
                     /locus_tag="LMJF_26_2660"
                     /db_xref="GeneID:5653196"
     mRNA            <1066763..>1069246
                     /locus_tag="LMJF_26_2660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684221.1"
                     /db_xref="GeneID:5653196"
     CDS             1066763..1069246
                     /locus_tag="LMJF_26_2660"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684273.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653196"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8S5"
                     /translation="MWLQKSITLPDPIPEEEDRADTPTPVLVPATAGALPSTHTEASP
                     EDAMPPPAPPALEKKTAAGVEVDLTKMVLDTSSFLRASAQRPSMRYPSRASVSNSAFI
                     SAQEYDDLRARYSQAKRELLKVSDIQKDLDFARFELTRSQEEMKLLRASNHNLKNEVE
                     EYVQRAEKEHKARMSLEAKMSAEGATRTEEIEFLKKTIDELRAENAKRLDYMTQQQED
                     EFQARLQSMREELAGAAEELARLTAEAAQAQKARELSESKLTAALTDLEKSRAVVDDC
                     KARIDALQKECHALEQQHRDFVQQQERQNAAYLEEQKALNEERVHQVAESKNAAIAEM
                     QEELHLWKEKTKTTAEELAAARHAASQLQDDVKQLTADRAKEVRRLAEEHRLALCELQ
                     LQMEAAIREARGSKTSLEEEAQSLRRQLAQVSTELSTVAGVLAQRERQLAKAEEELLR
                     TKDRCVAAEQENAQLASDAQLNAEAADEAAARVERLMRQNSDMEEEFSKDLREAKDRI
                     RTLEATLMQSKGELSALRKEQIKSADDGLAATRDLRAQAEALMEECTALKAQAGERRR
                     LEEMARDYCQRFEAERTKVGTLEAELSAAVGRCTAVEAKLEELSRRVISQAVSRSPMQ
                     TLHPNATAASLSCHGKHRSVSSGQSYAPTGGSSMKRARTEDARVFAISGFDGNDVLLA
                     VKQLPNVAIAECKSNMPVPSNLTHLITNGQLTIKLLTALVRGCWVLPESYVVDSLKEQ
                     TWLREEDYGFQHEEPPLLKKRIALTEAFMACKHYSTASLLLKEGGAILVDDPEQADIL
                     LCTNAEARSTQNGWNWEKMVEIIYPLKIQ"
     gene            <1070625..>1074428
                     /gene="ABCB2"
                     /locus_tag="LMJF_26_2670"
                     /db_xref="GeneID:5653197"
     mRNA            <1070625..>1074428
                     /gene="ABCB2"
                     /locus_tag="LMJF_26_2670"
                     /product="putative ATP-binding cassette protein subfamily
                     B,member 2"
                     /transcript_id="XM_001684222.1"
                     /db_xref="GeneID:5653197"
     CDS             1070625..1074428
                     /gene="ABCB2"
                     /locus_tag="LMJF_26_2670"
                     /codon_start=1
                     /product="putative ATP-binding cassette protein subfamily
                     B,member 2"
                     /protein_id="XP_001684274.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653197"
                     /db_xref="GOA:Q4Q8S4"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8S4"
                     /translation="MSADKTVKAKQAIHDAKAPVSEKLRGHVPILTLLRYRAPSEWFA
                     VVVGSIAAFCSGGSTPLFMYFFGRMTNSAYDDEAAPKVTRNFAMLMVCIGILSMVLVF
                     IKTATYQVTATRLVGRIKCAYFSAVVNQDIGWHDRRKPGELISRLTGDTRVILNGVSD
                     RFASWIENLGAGLIGIVFAFIASWELTLLIMGSLPLIAVAVYFLTAASSRHVAVTRKQ
                     YAVASAIAQEVMQNIKTVQTFNREMHEAERFSETIVGSRKAGIKKEFLVAMAGGSVMG
                     IMLCVIGLAFILAAYLVHSGRTDVGSVSAAFLTVMYGAMGLGQVFPALISFVEACTAA
                     YPIFATIDEQPTIDLHRPGREVTFCRCIEVKDVTFAYPTRPDQLIFSGLSATIRKGEK
                     IAFSGSTGCGKSTIISLIQRFYDPTEGSVTVDGQDLRDLDLRSWRKRIGIVSQEPNLF
                     SGSVLDNVRMGRRSATFEEVVTACKQARIHDTILTLPRGYDTSVGSLGSQLSGGQKQR
                     LAIARAVVRGADILLLDEATSALDRKSEVEVQRAIDDLTENSKMTVITIAHRMATIAN
                     MDCIYFLDGSRDGGSCIVECGTYDELIRMNGRFASMVMMQNPSTGNLCTVVHDTSFYL
                     YPGALDKITGDSVSTEDSYSSNDSWDSNCNGFYEDDDRWSQYSHVDDVPFIHRTDWEE
                     RKTSVSMWRIMKMTKSRWWAIVLGFLGSIITSIVFPCVSLMITQLINTLGTYRLSHDT
                     THMQRQIALYVILLIILGAVYFLGSVLTGFYGYVGEYLTCELRSILFQQILRQDQTFF
                     DMPRRDPGALAALLAGDCESVHQLYGPTLGSRLRSVCAFAGGIAIGLIMEWKVALVCL
                     TTMPLFVGSIVAQQVFFADSQSARESGIDTVVSEALGSIRTVTSFNMQDRVIKKYKRT
                     INVAEQTAERRAVLVSILVGATEFTLMGSMALSFWYGGTLIEKGETHFSNVLVATMAV
                     TMGSTLAGVEAGSFATKLRDARLSSNRVFSVIDRVPAVDSYEYGKVNFEEQIGVEFRH
                     VGFTYPAREGVKVLNDVSLKFQAGSSNGLMGQTGCGKSTIVQILARFYPISTGKVLIN
                     GEDLSSLDLVTWRDQLSIVLQEPSLFSGTIRDNIKYSLPDATEEEVIEAAKIACIHDD
                     IMNMEKGYNTEVGYRGQQLSGGQKQRVAIARGVLRCPKLLLLDEATSALDNMTEVRVQ
                     RNLDEFQRRFGVTTVAIAHRLATIRHSNQIVLLDSGKIIEQGTHEQLLAQDGEYKSRW
                     ELAHT"
     gene            <1078599..>1079732
                     /locus_tag="LMJF_26_2680"
                     /db_xref="GeneID:5653198"
     mRNA            <1078599..>1079732
                     /locus_tag="LMJF_26_2680"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684223.1"
                     /db_xref="GeneID:5653198"
     CDS             1078599..1079732
                     /locus_tag="LMJF_26_2680"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684275.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653198"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8S3"
                     /translation="MISQCFYLAALITTAMTITTSNVTFYQEGLSTRIEGTPAVVRNI
                     APDWIETAAMTVSSTTKGLAVVLADPLRAHMTADVTIGDSPTAVAADVNVSIYGAFNI
                     SKIPHDEDCRTQSFVMNSCNVYMRVSGTVDTVTQLPGDEQNICDAVNRITHDLISPVA
                     FIPYPPLVDGATDIAKSTYLMKYRLVNVLSQNTGLPVEAHFVRKNVLRVAFGSFFRTS
                     ILFDSAYDYDVDVLNAMAVLSRWASKKLNISIDPKNSTTTTIPFHGGAVTVPTLRSIV
                     RQAIREDTLATLRTLVPRGASVSYDVVINDFQCKLFNTICSVPVSNGVQVINTRFRGM
                     GDLGTILDNTASASMDALLTNITTVAFKLVGSTFGDRIYLPVF"
     gene            <1085700..>1086374
                     /locus_tag="LMJF_26_2690"
                     /db_xref="GeneID:5653199"
     mRNA            <1085700..>1086374
                     /locus_tag="LMJF_26_2690"
                     /product="putative CAAX prenyl protease 2"
                     /transcript_id="XM_001684224.1"
                     /db_xref="GeneID:5653199"
     CDS             1085700..1086374
                     /locus_tag="LMJF_26_2690"
                     /codon_start=1
                     /product="putative CAAX prenyl protease 2"
                     /protein_id="XP_001684276.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653199"
                     /db_xref="GOA:Q4Q8S2"
                     /db_xref="InterPro:IPR003675"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8S2"
                     /translation="MCCLVSGAYLAFGAAPPRTAHRQSSLLRPIIRSSVSTLLLFAGP
                     IADACHQGTFDTPESTLRLWRNYVICPIGEELFYRGVLFSLLHRRSSPARIFVSAFLF
                     SLSHMHHLVSMACDAYRNGEDKGVAGSDRDEKERACWRSAGHAMCGIVVFTALFGLLS
                     GYYYEHVCERSIIAIAAAHALCNAIGPPEFMVLRSRHCTVREKVASAAIYVAGIVGWA
                     WTLWRY"
     gene            <1086826..>1087629
                     /locus_tag="LMJF_26_2700"
                     /db_xref="GeneID:5653200"
     mRNA            <1086826..>1087629
                     /locus_tag="LMJF_26_2700"
                     /product="6-phosphogluconolactonase"
                     /transcript_id="XM_001684225.1"
                     /db_xref="GeneID:5653200"
     CDS             1086826..1087629
                     /locus_tag="LMJF_26_2700"
                     /EC_number="3.1.1.17"
                     /EC_number="3.1.1.31"
                     /codon_start=1
                     /product="6-phosphogluconolactonase"
                     /protein_id="XP_001684277.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653200"
                     /db_xref="GOA:Q4Q8S1"
                     /db_xref="InterPro:IPR005900"
                     /db_xref="InterPro:IPR006148"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8S1"
                     /translation="MSSFAPNVKICEDISHISSAARDIILAAIDARVDKSAPVVLALS
                     GGSTPKRLYEELHEKDLTLLQQHAVQFILGDERLVATDDEQSNFSMATKALLRDVPIS
                     DVIAIEPSAALATSKDEKGGVDGAWAVAQDYEKKLRNRLPCTQVNGTDMSVPIVDIVL
                     LGFGADGHTASIFPDSVAATDESHVVSVSFPSPTMNPKVWRVTLSKTVIQHAKHVVVL
                     ACGKDKNWVVHGVLAEAPTGPLPVSRFLRECRGSVTMLLDAGSGEGLSA"
     gene            <1088377..>1089171
                     /locus_tag="LMJF_26_2710"
                     /db_xref="GeneID:5653201"
     mRNA            <1088377..>1089171
                     /locus_tag="LMJF_26_2710"
                     /product="putative glutamate 5-kinase"
                     /transcript_id="XM_001684226.1"
                     /db_xref="GeneID:5653201"
     CDS             1088377..1089171
                     /locus_tag="LMJF_26_2710"
                     /EC_number="2.7.2.11"
                     /codon_start=1
                     /product="putative glutamate 5-kinase"
                     /protein_id="XP_001684278.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.26.2710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.26.2710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653201"
                     /db_xref="GOA:Q4Q8S0"
                     /db_xref="InterPro:IPR001048"
                     /db_xref="InterPro:IPR001057"
                     /db_xref="InterPro:IPR005715"
                     /db_xref="InterPro:IPR011529"
                     /db_xref="InterPro:IPR019797"
                     /db_xref="UniProtKB/TrEMBL:Q4Q8S0"
                     /translation="MADILKSVKRIVVKVGSSILVDNQEIAAHRIEALCKFIADLQTK
                     YEVILVTSGAVAAGYTQKEMDKAYVPNKQALASMGQPLLMHMYYTQLQKHGILCAQML
                     LAAYDLDSRKRTMNAHNTIEVLISHKVIPIINENDATALHELVFGDNDRLSALVAHHF
                     KADLLVILSDIDGYYTENPRASTDAKIRSVVHELSPDDLVAEATPNNPFATGGIVTKL
                     QAAQFLLERGGKMYLSSGFHLEKAREFLFGGSHEIGTLFYPRGSSS"
CONTIG      join(FR796422.1:1..1091540)
//
DBGET integrated database retrieval system