GenomeNet

Database: RefSeq
Entry: NC_007271
LinkDB: NC_007271
Original site: NC_007271 
LOCUS       NC_007271            1403434 bp    DNA     linear   CON 18-JUN-2017
DEFINITION  Leishmania major strain Friedlin complete genome, chromosome 30.
ACCESSION   NC_007271 CT005267
VERSION     NC_007271.2
DBLINK      BioProject: PRJNA15564
            BioSample: SAMEA3138173
            Assembly: GCF_000002725.2
KEYWORDS    RefSeq; complete genome.
SOURCE      Leishmania major strain Friedlin
  ORGANISM  Leishmania major strain Friedlin
            Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae;
            Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Rogers,M.B., Hilley,J.D., Dickens,N.J., Wilkes,J., Bates,P.A.,
            Depledge,D.P., Harris,D., Her,Y., Herzyk,P., Imamura,H., Otto,T.D.,
            Sanders,M., Seeger,K., Dujardin,J.C., Berriman,M., Smith,D.F.,
            Hertz-Fowler,C. and Mottram,J.C.
  TITLE     Chromosome and gene copy number variation allow major structural
            change between species and strains of Leishmania
  JOURNAL   Genome Res. 21 (12), 2129-2142 (2011)
   PUBMED   22038252
REFERENCE   2
  AUTHORS   Ivens,A.C., Peacock,C.S., Worthey,E.A., Murphy,L., Aggarwal,G.,
            Berriman,M., Sisk,E., Rajandream,M.A., Adlem,E., Aert,R.,
            Anupama,A., Apostolou,Z., Attipoe,P., Bason,N., Bauser,C., Beck,A.,
            Beverley,S.M., Bianchettin,G., Borzym,K., Bothe,G., Bruschi,C.V.,
            Collins,M., Cadag,E., Ciarloni,L., Clayton,C., Coulson,R.M.,
            Cronin,A., Cruz,A.K., Davies,R.M., De Gaudenzi,J., Dobson,D.E.,
            Duesterhoeft,A., Fazelina,G., Fosker,N., Frasch,A.C., Fraser,A.,
            Fuchs,M., Gabel,C., Goble,A., Goffeau,A., Harris,D.,
            Hertz-Fowler,C., Hilbert,H., Horn,D., Huang,Y., Klages,S.,
            Knights,A., Kube,M., Larke,N., Litvin,L., Lord,A., Louie,T.,
            Marra,M., Masuy,D., Matthews,K., Michaeli,S., Mottram,J.C.,
            Muller-Auer,S., Munden,H., Nelson,S., Norbertczak,H., Oliver,K.,
            O'neil,S., Pentony,M., Pohl,T.M., Price,C., Purnelle,B.,
            Quail,M.A., Rabbinowitsch,E., Reinhardt,R., Rieger,M., Rinta,J.,
            Robben,J., Robertson,L., Ruiz,J.C., Rutter,S., Saunders,D.,
            Schafer,M., Schein,J., Schwartz,D.C., Seeger,K., Seyler,A.,
            Sharp,S., Shin,H., Sivam,D., Squares,R., Squares,S., Tosato,V.,
            Vogt,C., Volckaert,G., Wambutt,R., Warren,T., Wedler,H.,
            Woodward,J., Zhou,S., Zimmermann,W., Smith,D.F., Blackwell,J.M.,
            Stuart,K.D., Barrell,B. and Myler,P.J.
  TITLE     The genome of the kinetoplastid parasite, Leishmania major
  JOURNAL   Science 309 (5733), 436-442 (2005)
   PUBMED   16020728
REFERENCE   3  (bases 1 to 1403434)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 1403434)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire, CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR796426.
            On Jun 1, 2012 this sequence version replaced NC_007271.1.
            Data release policy www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1403434
                     /organism="Leishmania major strain Friedlin"
                     /mol_type="genomic DNA"
                     /strain="Friedlin"
                     /db_xref="taxon:347515"
                     /chromosome="30"
     gene            complement(<4620..>5897)
                     /locus_tag="LMJF_30_0010"
                     /db_xref="GeneID:5653926"
     mRNA            complement(<4620..>5897)
                     /locus_tag="LMJF_30_0010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684538.1"
                     /db_xref="GeneID:5653926"
     CDS             complement(4620..5897)
                     /locus_tag="LMJF_30_0010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684590.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653926"
                     /db_xref="InterPro:IPR012020"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7V8"
                     /translation="MTGDLSASGAAAPLLCRVPFLSKLKFLCLHVFCALVVDLVLRLT
                     RFLSRAQPGIQTTATHGSLQAKSFFKLDRLDKVPYPDPPYSGHVSTILCAFRPRRSIP
                     YQRVVHPGADGNPMHLDWMLTDSRAAKGVFLIIPGLASWSGTNYIEHFVWSAFTHHFH
                     CGVFNSRGMGNTPIETPRLMSGKWTDDLRAVLRDGPFSRAAIEERCGAGIPIIGVGFS
                     LGGVILSKYVGEECLAGRELVMDAVMVVNSPLDCLDSNAVISRGISKVLYQPSMAGSL
                     TAYARRHAKVLKDLPGLSPDVRAAFASGRLEKILAQVKTVHDFDRLITAPTLGFATPE
                     AYYHHISPIQWLPHFSVPVLCISAADDPVTGEPRMESLDNTMRSNPNVALLVIPHGGH
                     LGYIRSVRDEWLGRETMMEKIIYEVAAAITPRR"
     gene            complement(<6685..>7422)
                     /gene="CYP9"
                     /locus_tag="LMJF_30_0020"
                     /db_xref="GeneID:5653525"
     mRNA            complement(<6685..>7422)
                     /gene="CYP9"
                     /locus_tag="LMJF_30_0020"
                     /product="putative cyclophilin 9"
                     /transcript_id="XM_001684539.1"
                     /db_xref="GeneID:5653525"
     CDS             complement(6685..7422)
                     /gene="CYP9"
                     /locus_tag="LMJF_30_0020"
                     /EC_number="5.2.1.8"
                     /codon_start=1
                     /product="putative cyclophilin 9"
                     /protein_id="XP_001684591.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653525"
                     /db_xref="GOA:Q4Q7V7"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7V7"
                     /translation="MPFRVLKPRRDAPQALPTPPSREQVYNNIEERRLKEWENYQKAH
                     RFMEEAHTNRIFLDIGIGDALAGRLVVELFEDVVPETAARFHRLVTGEGGIHDATGVK
                     LDYLYTPLELIDRQHGYARFGDLLAYGVRLEPLRQETFKVRHTSRGLLTMTSYGPNLC
                     NTSFSITLAAAPSLDFKQVAFGKVVDGLHLLEKLESLPLDQVGRPLTPVMIAICGTLT
                     GERPPGKWASPQDRTGCDEDLAYEAIE"
     gene            complement(<8221..>8928)
                     /locus_tag="LMJF_30_0030"
                     /db_xref="GeneID:5653526"
     mRNA            complement(<8221..>8928)
                     /locus_tag="LMJF_30_0030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684540.1"
                     /db_xref="GeneID:5653526"
     CDS             complement(8221..8928)
                     /locus_tag="LMJF_30_0030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684592.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653526"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7V6"
                     /translation="MRRLQRRLLSAHTPVRFFDSDERFGKELGFGHKMRDIPVLTGNP
                     RPVAREESWRCAYKLSDRMEFVVRDILTKNKWSPLEVDRELAHIFERKEVGSRSSLNT
                     WSTVEEFQRTPWYRRYKPTDDTAAKFISYEAMKLLESALIPPSLRTDPYAHLRKRHME
                     DNWMNDKFSEDTARYITRKQLAQHTKGMPQYGQMSRRKYMEFEKKFRNMHGSNMHVNE
                     VYSAWLNSLDAQNGEKR"
     gene            complement(<9995..>10420)
                     /locus_tag="LMJF_30_0040"
                     /db_xref="GeneID:5653527"
     mRNA            complement(<9995..>10420)
                     /locus_tag="LMJF_30_0040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684541.1"
                     /db_xref="GeneID:5653527"
     CDS             complement(9995..10420)
                     /locus_tag="LMJF_30_0040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684593.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653527"
                     /db_xref="InterPro:IPR007919"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7V5"
                     /translation="MSLRNPHLPPIVAGILYGLSLILCIDGIVFAQQEANKANRFSFL
                     HCVPAIFSTVGLLLLHLVSPSEVKEGDGRGRVLLFMSWLAMIGSTVGALVILFFCYTG
                     QQTRTRAMPGVSLVLYTCTAPIITSMLWWGRRVVNSDEW"
     gene            complement(<11495..>13783)
                     /locus_tag="LMJF_30_0050"
                     /db_xref="GeneID:5653528"
     mRNA            complement(<11495..>13783)
                     /locus_tag="LMJF_30_0050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684542.1"
                     /db_xref="GeneID:5653528"
     CDS             complement(11495..13783)
                     /locus_tag="LMJF_30_0050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684594.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653528"
                     /db_xref="InterPro:IPR002083"
                     /db_xref="InterPro:IPR008974"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7V4"
                     /translation="MHCLSSLSQGDLSFYQSTLYQLIQDAPIEAKPGREMMRTLRKEL
                     VRSMEQEECPEYCAALADLYKTVTDTLISAAHRSAPHELINRTTSDCRIVTDEDEYQF
                     HQEEGFFDDEDEDEMDSNSDIKSTAKDAEQKQRKREETKRKRREEEDMLMKERKVTDE
                     KGKQYHTLGPFPPPRLTVRAPTNTFPSRKALQQRTIIETPSSTSSSSDDDEAINQLIS
                     SRSTEGGEAVNHLTDFLQPLSIDSLKKVGESAKAKLRPSSTHDEFVSQIVKTAVRLGC
                     EKACVLMEKQKIIEDMTSHVQTGPLPTAASIDFLNTLPDHLKQSLGSVLGLPEEKPPV
                     EDMWERMVAMGFLSVLTNLRLKPLKKIANELSIVLPDTNSTEKFCEFIVFAAFPRERI
                     RAKFSRAKQKKVKFTVPPDSMSIKGDMGFVTFHVNNISMLTKESERHYSPEFHFANLK
                     WSLLCMTNKESLALYLCQTGSVHCKFLITVVNKANPDDSICNEGTQSFSAMSQENDWG
                     FNNVIKFAELLSPDQGFVTADDDSITIEVGIVLVEPLKTPTAREKAPVAKEKKNEPRV
                     DEAAMLQLLADEKVEQTRKKLKQEISKTIREEEKTRKDITQRASKAYHDLCDRLRQET
                     KRTQKEVADRERKEEQERQRELDKIKQAQEQMAELKSRLQSLKKENAELAQLKQDATQ
                     AAKEAKKNSERIAQELKFVLDRVQSNQQKLHTQEKKLAAAKSRYESILAEEPDTPSPS
                     DDENDLMSEDLTRFINLMTDDM"
     gene            complement(<15022..>15744)
                     /locus_tag="LMJF_30_0060"
                     /db_xref="GeneID:5653520"
     mRNA            complement(<15022..>15744)
                     /locus_tag="LMJF_30_0060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684543.1"
                     /db_xref="GeneID:5653520"
     CDS             complement(15022..15744)
                     /locus_tag="LMJF_30_0060"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684595.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653520"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7V3"
                     /translation="MQRCLARLFQAGVHTPHGSRYNAARMKNWPVQEVPQNFNFTNEQ
                     RFKAKAVPRDTGKIPRDFLLSVLYRNQPCEVASLWEHCLHDPQIVLDSKRHLREVLQQ
                     ARAEGFVSFEKDAVTDRWVCHLTRERFEEVRALVGARAEAQDLYSGLRGASATETSAY
                     SESFREMNEDTKREHFRLLSEQVADTTTHLRKFQRMEMDYLPYTDLNGKVNFMWWYEM
                     SDTRDATALPEAAAEGSPKLSE"
     gene            complement(<16777..>17334)
                     /locus_tag="LMJF_30_0070"
                     /db_xref="GeneID:5653521"
     mRNA            complement(<16777..>17334)
                     /locus_tag="LMJF_30_0070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684544.1"
                     /db_xref="GeneID:5653521"
     CDS             complement(16777..17334)
                     /locus_tag="LMJF_30_0070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684596.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653521"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7U9"
                     /translation="MGGHGSMNPNAQITTRDAAGNMARARYRCHIESSGGMKLEMLVR
                     VQMGWISPRVVFSQIPYVIHLGKGIDVSIPFVLHFTMVSLLDEHGDNTGSFLYFSGTP
                     MLGFSSGFSRIKGGKMVLNPTKVVDPYVEVFDFIGHVHYRQMGFVLFKCLGYLLCFLA
                     CIPATQRMLQCVLPDPFHRHSEKPL"
     gene            complement(<18350..>19612)
                     /gene="CYC3"
                     /locus_tag="LMJF_30_0080"
                     /db_xref="GeneID:5653522"
     mRNA            complement(<18350..>19612)
                     /gene="CYC3"
                     /locus_tag="LMJF_30_0080"
                     /product="putative mitotic cyclin"
                     /transcript_id="XM_001684545.1"
                     /db_xref="GeneID:5653522"
     CDS             complement(18350..19612)
                     /gene="CYC3"
                     /locus_tag="LMJF_30_0080"
                     /codon_start=1
                     /product="putative mitotic cyclin"
                     /protein_id="XP_001684597.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653522"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7U8"
                     /translation="MSTDLAIVTTVSSDSVSRLFGPAGAMDFRSDPGMKDEYEDPKTI
                     FNKMKQKDVKPLSDISMLKGTIYNYKNRRIITRWLRDVCGAFNLRSTTLCLAVQLADS
                     YIVGNLQQLELQKCQLAAVTALWIAAKFEEMDADLPNLRAIVDVCDGAYSKEHVLGME
                     EAILGFYKWYLPHTTVVNHVYLQLHLMNDPALIDSQPEENVPPVVSVEVLVLDANEGR
                     TWVSLLLESHSSLQDCLDQLFSASNLLYSTSTSVFQLFGSCFLLAERLPLTAVVGNLP
                     LDGKGCRRLFLCSSSSQITSTFAERGSYVILRSINSGFLDLCDILTQEVVTHVEFLRL
                     YSYVTAFGVVGLALCLVSPDKDENKRILQHVHNKLEISATQGLAVADLLTSKYKEALP
                     TIREGNSLPRPPENFRDTLCYCFHRRLS"
     gene            complement(<24648..>25334)
                     /locus_tag="LMJF_30_0090"
                     /db_xref="GeneID:5653523"
     mRNA            complement(<24648..>25334)
                     /locus_tag="LMJF_30_0090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684546.1"
                     /db_xref="GeneID:5653523"
     CDS             complement(24648..25334)
                     /locus_tag="LMJF_30_0090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684598.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653523"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7U6"
                     /translation="MPRDDFDRRRLRALYERNRRRVSALADARDRRRGGEDDYSAPRR
                     YVVSERRTRIEGFGRGGTQVSRVVRRARGGRDEPRPRRFSDRGIFRRNVRDRFRRVED
                     FEREERRERFREVRGRRGDGRRVEGRRFGEARRLRLRMRGTRAGRVDRRRAEVEGRRQ
                     REERVSDGRRRQESGRQNNNNQGNRGGNKQGSLSRNNQPQRSNNKAQRSREPQITREE
                     LDRQLENYRS"
     gene            complement(<29219..>33907)
                     /locus_tag="LMJF_30_0100"
                     /db_xref="GeneID:5653524"
     mRNA            complement(<29219..>33907)
                     /locus_tag="LMJF_30_0100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684547.2"
                     /db_xref="GeneID:5653524"
     CDS             complement(29219..33907)
                     /locus_tag="LMJF_30_0100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684599.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653524"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7U5"
                     /translation="MNAAHDLYMECCQRHGVKPNSDIEAQVMASDLLHMRLIDASHTF
                     LGRLGVLAVLSFVRHHQCIEEVRLPQNSVDEACMSLLADIITDAHPSLRSVDVAGNLL
                     STPAIRRVWAAARQNTRFTHLVLEGCGVTDEWVTRLQTTLRANEDMELHSYEPYGIPR
                     SPHSWHTVFLLTLGAREAVLEYCEKCLPAVNKHMAAARVRVAVLTLSEGDSVEQVESK
                     LARCQDAFNHQLTWCVALLGAEPLSKPELSALGQVLRQKPPSQPPLRDKMGKLRPRVY
                     RASRSFFCYTPISWEMSGGVSDVVPASQWLRSAGFGGVACYESLTATVTAPAAALTPR
                     NRVVRWQSDLFTSLQMTFREPAVDGSTSAVVHADEVQGLEESQLFYTNADEIDMVRSF
                     VPCGRFHPKKTALVLEYVSGPYRDSSSPFILYGAGCIGKSSILCNVASLLWEGRPSVG
                     REVPARVVCHVVDVDHCSLAVFLYRLLHLFAPASPLWFTSVDALAEGVRDAIRTYAGP
                     TVALLLGRIDLLDTCWCHCSILAAWLPHILPRTVRIVVSLDTESPVLPLLRKRMPQPF
                     ECLCPPMVDINSLQLFKTCLKERNVVLPGMEMSELKSREALGMSERSYLQKEEALTVL
                     YPRLASSYVHHLLNTGNHVESEYEAHQLIEGALPPTVAELVQSLYDKTAMQHPQITVE
                     TLLVLVALAPLPASELVYICEELGSCPRHTTLSALLMLSDMGLLLWCKDATICVAHPT
                     LKTLFLDICCHHVPRLSVLLESHLYRLVITYSAEVPHAFWHLAPLMIENGNMRQAVQL
                     LRNPVLVDAMLQRGPVHRLHVLGAFLHLLQARTLLREVATLGGPPVPQVMTEGPLVCC
                     LREVANYSSDLYQTALLRRSFSPYASAEAATKCITPQLFLRPLNDGQENTAAVSAHVS
                     EACSWCHCRGGCVVAATNESVFVFTSDLGKPIAELHMPFERQMRITGVLHAAGTRVLV
                     ASKTQVLVWDYESNLNFLFADVSIEARAANLDTFGSALVATSTATNQLCLIDVLKKRI
                     VRELPDMEEGVRQRGFFCGNRLLLLSRCCLCLYDEEMKECVTFTHDSLVTTVSCNRDG
                     RVLVSYAGTYLHVWTSAGELLHRIDVGPDPLVQLRMSATGAHYVTQQGTILQVWRTLT
                     GAACSTLRSPFSEDSDIEYVTLTDDSAKVVARSGPYIIAWDADKGSLIGAESAPVGLI
                     QHVAVHDSNVFATTTTGDVHSWSLERGLSSIDQVKEGQCTTNILRNAKVSTQSVRSVS
                     TNRAGTLLVTVDAAHYLRLYSLITGAPIEHTVGRVRSAVAVGPDTVVFMPQEPNHLGL
                     YYLGGESQLDKRALPKTALPDADYALYVSPDELFVGVTVHQRHHSHTLIYEVEGGETT
                     SCQLLGHAGRIIEVSFFGSFAFTVGEKDACVRLWSLSRKAERTSYTHPCPLVAAAGNG
                     SGVLFCVDAEGDVVRLHVDNIVSVKHAALVITSLKLHAAVPLVQASAILQLSVYKNYL
                     ILVRATGELLLLDTLHDDVGHRVPFLDCQRVCVCTIKDAPVLLTGHGHGKVILNALLH
                     AGVREKSRRS"
     gene            complement(<34916..>36199)
                     /locus_tag="LMJF_30_0110"
                     /db_xref="GeneID:5653529"
     mRNA            complement(<34916..>36199)
                     /locus_tag="LMJF_30_0110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684548.1"
                     /db_xref="GeneID:5653529"
     CDS             complement(34916..36199)
                     /locus_tag="LMJF_30_0110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684600.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653529"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7U4"
                     /translation="MDTQGIRAVSEYVARGHGSGIVWAWCAASPAAFASMINSPSRTR
                     QAAHERSVHYLSSYEQKSGCVCTVRVDRMGITLNEFHHTVPLWLVTWHTQLLYRLFGP
                     VGVAVHVTDLDSLVLNSLLSAWEGTPVQVTALTSRHRLSTCVSAHRRSTGRVFSVLAG
                     LQDLVLLPSPSVHGSLVVAEYAPLLRRVTASKCCVEYLKPLSQLQHLQEVQLSQTLIR
                     DAELRILAQLPLLTTLDVSSCPHLSSLEPLACAASLRILRASSCERLMLVAQLGTLAT
                     LRIVDLSGNVFRPTEFASFITQPTLHLQAGYFAHMRWPRDDPPSTQVLGSVKHLHLSY
                     GTVPNIRWLCGAHSLEQLCLDHTNVTAVDMAVLVQHTPLLSVLSLSYCEHLHTNLDFT
                     RSLHFLAMLTITRSSLPSPFLELVELQQSLSLTLS"
     gene            complement(<38584..>40449)
                     /gene="ADS1"
                     /locus_tag="LMJF_30_0120"
                     /db_xref="GeneID:5653530"
     mRNA            complement(<38584..>40449)
                     /gene="ADS1"
                     /locus_tag="LMJF_30_0120"
                     /product="alkyldihydroxyacetonephosphate synthase"
                     /transcript_id="XM_001684549.1"
                     /db_xref="GeneID:5653530"
     CDS             complement(38584..40449)
                     /gene="ADS1"
                     /locus_tag="LMJF_30_0120"
                     /EC_number="2.5.1.26"
                     /codon_start=1
                     /product="alkyldihydroxyacetonephosphate synthase"
                     /protein_id="XP_001684601.1"
                     /db_xref="GeneID:5653530"
                     /db_xref="GOA:Q7YWB6"
                     /db_xref="InterPro:IPR004113"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="InterPro:IPR016164"
                     /db_xref="InterPro:IPR016166"
                     /db_xref="InterPro:IPR016167"
                     /db_xref="InterPro:IPR016169"
                     /db_xref="InterPro:IPR016171"
                     /db_xref="InterPro:IPR025650"
                     /db_xref="UniProtKB/TrEMBL:Q7YWB6"
                     /translation="MPADEAQAPTQTEVYDRLKWNGWGVEDVQMQIDDENPLWVRHVD
                     GKPIKNLLEFLYQEISGGVGPKEIPPLSPSIPLEKALAKLNKANINEAFMKDISAVLE
                     KSQIRPDGKSRLCHIAGKNYRDLWRVRKGMVEHAPDCILLPNSHKDCVEIMRLAHKHN
                     VVVIPFGGGTNVTGGVEADPFERARMIISVDMRRMNRMISIDRESRLATFETGVLGPD
                     LDAQLFRHGFMLGHDPDSYIYSTLGGWIGARGSGAMSNQYGDIEDMVVAVKVATPTGI
                     IETPTTSRTCGVDLNGLFIGSEGSFGIITEATIKLETIPETKLYEGYLFPTFEAGFSA
                     FYTCTAKGIHPCTMRLYDEDDFRMSMAMSTTKHSFFQRLVSMGVKSFLERYRGWNLRR
                     ISLVIVGFEGTPDRVKFQRSETAAVFKQYGGVGVGRSAGATWQDKKYDLPYIRDFALS
                     LSHWADVFETSVLYSQAIPCWRAVKAAVRQVWKEHGHRGWIGCHTAHQYKYGCCLYFT
                     FASAQKDDMDMKIFLAIKKRATEAMLAHTGNLTHHHGIGYEHVPWMSRYMGPDALDLL
                     FAVKQKVDPKNICNPGKLLPSPPRENESAAALKARQQRELMFDKMGVPGAVASHI"
     gene            complement(<41275..>42885)
                     /locus_tag="LMJF_30_0130"
                     /db_xref="GeneID:5653531"
     mRNA            complement(<41275..>42885)
                     /locus_tag="LMJF_30_0130"
                     /product="putative lysyl-tRNA synthetase"
                     /transcript_id="XM_001684550.1"
                     /db_xref="GeneID:5653531"
     CDS             complement(41275..42885)
                     /locus_tag="LMJF_30_0130"
                     /EC_number="6.1.1.6"
                     /codon_start=1
                     /product="putative lysyl-tRNA synthetase"
                     /protein_id="XP_001684602.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653531"
                     /db_xref="GOA:Q4Q7U2"
                     /db_xref="InterPro:IPR002313"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018149"
                     /db_xref="InterPro:IPR018150"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7U2"
                     /translation="MGGILFITIRSGEAQLQVLRQVNESFTKADLRAFASTLHTGDIL
                     GATGVPGRTAKGELSLYATEASILAPYVCTDQALCPDLKGFVPLADTGIKYRYRFVDM
                     MSNPSVVQHFRKRHAITRALRDFLDARSFVEVETPVLHSVASGANAKPFVTHHNANDA
                     DLFLRVAPELHLKQCVVGGMERVYEIGRVFRNEDADRSHNPEFTTCEFYAAYHTYEDL
                     MTMTEEILRHLALAANGTTKITVTSCVAKKPVEIDLAQPFRRVNAYDAVQEAAGVELP
                     PPTELSTPRGLAYMSAIMLRYNIPLPSVRTAAKMFDKLIDYFITDCVVEPTFVTDHPL
                     FMSPLAMEQRARPGLSARFELFINGTEYCNAYSELNDPQEQYYRFQQQLLDRQTGDDE
                     AMALDETFLKALQVGLPPTAGWGMGIDRVVMLLNGSSTIREDILFPLLRHDATSHDAK
                     RRYKTASFFGFHHNMTLFCLNALEEEMLKRAAPTELLDKIRQLRQCLSTMQQRNMVTC
                     APEDGTPRGWRYEATMAVLRLFCCRGKY"
     gene            complement(<44610..>45650)
                     /locus_tag="LMJF_30_0140"
                     /db_xref="GeneID:5653532"
     mRNA            complement(<44610..>45650)
                     /locus_tag="LMJF_30_0140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684551.1"
                     /db_xref="GeneID:5653532"
     CDS             complement(44610..45650)
                     /locus_tag="LMJF_30_0140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684603.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653532"
                     /db_xref="GOA:Q4Q7U1"
                     /db_xref="InterPro:IPR006977"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7U1"
                     /translation="MANPYESDVSADPFREQPYASTGAAVPPAGSAPSAALSSTGDHL
                     HGYSSATYTEVSKQLSDGNAGVPPMQLYAGNGSGTPPLTTMAPLPPTEPAAAEADAAA
                     ASQTAATSKFWTLPFYQQFFDINTRQLLLRLSNTLIPINPPDFLMDRNWHLNECVGVD
                     GAGGIAEDTTLEEAGVVLSRKPDLYGPFWICTTLWMTLAVVSNIMSRIAYTKNNNTAQ
                     PWRYDFSVASVAYAVIYLYCFVFGAVVWGIMQWKNLPATLTDTVCLYGYSMFIFELVA
                     ILCMIPYSTAQWAFIMFGGAWSTVYLLINMWHMWKTTLERNWFIGLVVFVAAFHMGLT
                     LSFKFYFFNYKL"
     gene            complement(<46805..>47455)
                     /locus_tag="LMJF_30_0150"
                     /db_xref="GeneID:5653533"
     mRNA            complement(<46805..>47455)
                     /locus_tag="LMJF_30_0150"
                     /product="putative leucine-rich repeat protein"
                     /transcript_id="XM_001684552.1"
                     /db_xref="GeneID:5653533"
     CDS             complement(46805..47455)
                     /locus_tag="LMJF_30_0150"
                     /codon_start=1
                     /product="putative leucine-rich repeat protein"
                     /protein_id="XP_001684604.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653533"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7T8"
                     /translation="MACRTLTELSLAFNLLGDEGGRIAAEILGSHPSLRTLDLSDNHI
                     GDLGAVAIAEAFILSSASRIESLNLSVNHMGDVGFAAIAEALTKTNNKHLTALDLACN
                     DAVTDAAREALMRAVPHMRYVYSLDLTSCNLSDDNAKALTEAIRSSRTSVGTVEWYNN
                     PRIKLPTEKALHEAIEAKAAARCSLKGDSPVVLYAGVALTAAMVISSIIMRRRQNS"
     gene            complement(<49148..>51037)
                     /locus_tag="LMJF_30_0170"
                     /db_xref="GeneID:5653534"
     mRNA            complement(<49148..>51037)
                     /locus_tag="LMJF_30_0170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684553.1"
                     /db_xref="GeneID:5653534"
     CDS             complement(49148..51037)
                     /locus_tag="LMJF_30_0170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684605.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653534"
                     /db_xref="InterPro:IPR015353"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7U0"
                     /translation="MQLSGAMSASAPLTTAVQWFAAQLNNSDSAEVKRRYLRWHAEDT
                     GVPYSDEDPLFVQVVLASRTGWTLLEVLWRARLVALDGRTLWECLDARMIAVRVRDVV
                     DPWNEQLSVKLAWHFIEEQQRGELPLASSLSALCEALDEYATATIKPHGNLSVTESSA
                     TRSALRDADHGRCATLADAWSDKVVFIPMEAGNDYSEGSLRCAAPVPSRGTLLQVPRS
                     EMFFTDSLLQYCALGRAIAAEPSLRDLLANEEAMLVICLVYERFVEGVERSHWRRLLT
                     HCPERYPTIPTAWELRDLAELDGLDMVDDVLAKRSQMQAFVDQLQNSLLLLFHRALSK
                     LHGASAAAPSLADMSAAFVWEHLVWAQSTFDSRAFNLNVDGAVVMALVPLADMVNHAN
                     HTDVLVRKVEPNGGPFTMQVGAALTAADVGRELWMSYGPLQNWELLQHYGFLLGPDNV
                     HDKLPFPLTLPAGSNEPQSESDATATSAPLSREGGTESSWDARRLTLMGRYALCLPGR
                     CWIPHDGVPPAALLALLRVQLAQADEFDIMESRRYGPFEPLSPVTEAAVVSVVKSTVQ
                     CVMGSFPTTLAEDEETLAEVHGDEGCDLDAGDEPTKNHMLCLQLRVGLKRIASRCLEW
                     CARHS"
     gene            complement(<53146..>54045)
                     /locus_tag="LMJF_30_0180"
                     /db_xref="GeneID:5653535"
     mRNA            complement(<53146..>54045)
                     /locus_tag="LMJF_30_0180"
                     /product="putative 2-hydroxy-3-oxopropionate reductase"
                     /transcript_id="XM_001684554.1"
                     /db_xref="GeneID:5653535"
     CDS             complement(53146..54045)
                     /locus_tag="LMJF_30_0180"
                     /EC_number="1.1.1.60"
                     /codon_start=1
                     /product="putative 2-hydroxy-3-oxopropionate reductase"
                     /protein_id="XP_001684606.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653535"
                     /db_xref="GOA:Q4Q7T9"
                     /db_xref="InterPro:IPR002204"
                     /db_xref="InterPro:IPR006115"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR015815"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR029154"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7T9"
                     /translation="MRVGYIGLGLMGKPMAVNILKAGFPVSVWNRTASKCDDLVAAGA
                     TACATPAELAAASDVVFTNLSDSPDVMEVVFGPNGVAAGICEGAIFVDNSTIKPSVAQ
                     EIARRLWKEKKVRALDAPVSGGDIGARNGTLTVMVGGDAAALATVLPVLLAVGKKVTH
                     IGDCGAGQVCKAANQIMVAAQMVALGEILVFCEKCGVSGPTVIEAIKSGSAQCWTLDV
                     KPDRLFAGNRAPGFKAALQSKDMGIVMDTAKEFGVPLPSTAVNTQLFQAMVQNGDGDR
                     DNSAVVSVLERMANVHISEAERE"
     gene            complement(55080..56335)
                     /locus_tag="LMJF_30_0190"
                     /pseudo
                     /db_xref="GeneID:12981163"
     misc_feature    complement(55080..56335)
                     /locus_tag="LMJF_30_0190"
                     /pseudo
                     /db_xref="GeneID:12981163"
     gene            complement(<57205..>58698)
                     /locus_tag="LMJF_30_0200"
                     /db_xref="GeneID:5653537"
     mRNA            complement(<57205..>58698)
                     /locus_tag="LMJF_30_0200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684556.1"
                     /db_xref="GeneID:5653537"
     CDS             complement(57205..58698)
                     /locus_tag="LMJF_30_0200"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684608.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653537"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7V1"
                     /translation="MTTVLDVSREASPNAPPHTQSIYLLTSTSISDVEFKDSAAQSQV
                     LVGLPQVQSIDAIHRFCDTYAATLSRVHHILLPGGVSPLQSSLIKQLLEHIPQARLVC
                     NGFGHALLTNATFHDGVQRAVLENEPDAPPELLRFAALPADRVSSMADGDTVAVDVAK
                     SEAESSAPVAARALRVVAVKSKGQQQRRREHSQTHHPAHFTNEALFYYDDVFNALFVG
                     HTLHRLPWLPTVLTEASRELFLPMPPPLATQRPLSRPSPLLDTWRVLESCEDVVEALR
                     RTPELERVLAGSYGELCGNVEDCIAGLESSSDALERLRSRLARRLTTDTSRDVHRWST
                     ALLKRIVHEVVCTQKASEPTSSEVQEAFLCWARTDGEWGRLSTCLAHAAMVLPPSTET
                     GEADGASSSAADSFAAHDSVPAAGATAAGESAAPEALQGTHGVELLVAVFNRKGLQGL
                     IRTVQRETIDVQVFLAMSEEDLKKVFKATFGITKRLMLLQDELRKNL"
     gene            complement(<59687..>60046)
                     /locus_tag="LMJF_30_0205"
                     /db_xref="GeneID:5653538"
     mRNA            complement(<59687..>60046)
                     /locus_tag="LMJF_30_0205"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684557.1"
                     /db_xref="GeneID:5653538"
     CDS             complement(59687..60046)
                     /locus_tag="LMJF_30_0205"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684609.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0205"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0205"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653538"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7V0"
                     /translation="MLRYPSRALPRLLPVCSRSGALRHPVLLTPSRRFTDKVLIGSCS
                     SFLTCSTTTGLFHLLVTPISPSVALATLATAAASGALCVVDGGSLNGTTFGAVVGIFI
                     GAMGGFYAKSQKEPWRK"
     gene            complement(<60842..>61966)
                     /locus_tag="LMJF_30_0210"
                     /db_xref="GeneID:5653539"
     mRNA            complement(<60842..>61966)
                     /locus_tag="LMJF_30_0210"
                     /product="putative ribosomal RNA adenine dimethylase
                     family protein"
                     /transcript_id="XM_001684558.1"
                     /db_xref="GeneID:5653539"
     CDS             complement(60842..61966)
                     /locus_tag="LMJF_30_0210"
                     /EC_number="2.1.1.-"
                     /codon_start=1
                     /product="putative ribosomal RNA adenine dimethylase
                     family protein"
                     /protein_id="XP_001684610.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653539"
                     /db_xref="GOA:Q4Q7U7"
                     /db_xref="InterPro:IPR001737"
                     /db_xref="InterPro:IPR011530"
                     /db_xref="InterPro:IPR020596"
                     /db_xref="InterPro:IPR020598"
                     /db_xref="InterPro:IPR025814"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7U7"
                     /translation="MPKEPRAVPMGIISAEPIHAASRKIKFGTKAITLGKSTPQGHRR
                     GTAAGGLKEKRASFGVKTGGSQSGIVFNKGFGQHILKNPLVIAAIVEKAAIKPTDIVI
                     EIGPGTGNLTEKLLQTAKKVIAFEIDPRMVAELNKRFQNTPLASKLQIIRGNCLEQDF
                     PRFDKCVANVPYAISSALVFKLLKTPTFKCAVLMFQREFALRVCAQPGSEAYCRLSVN
                     SQLLARCSHLMKISKNSFNPPPKVESSVIRLDPKYPPPDVDFEEWDGLVKMLFSRKNK
                     KSSSIFRTKAAAQALYDKYVSYRKMEGGQPVGTATSGAKPLTSSRNADASSSMSLEQF
                     RVLLAAVIADPMFEQRSRMLDEVALMTMLAHFIKHGIHFI"
     gene            complement(<64422..>65582)
                     /locus_tag="LMJF_30_0220"
                     /db_xref="GeneID:5653540"
     mRNA            complement(<64422..>65582)
                     /locus_tag="LMJF_30_0220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684559.1"
                     /db_xref="GeneID:5653540"
     CDS             complement(64422..65582)
                     /locus_tag="LMJF_30_0220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684611.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653540"
                     /db_xref="GOA:Q4Q7T7"
                     /db_xref="InterPro:IPR001876"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7T7"
                     /translation="MNYLRTVVADVKLKYRASRVVAECVLKREQPEFPKLLSECVTIA
                     DGHPELILSTIRLYLEYNQPERAHGGLLLLEQLVSLCNYAFHLALARDCNIQDRIIHL
                     AMKRGEGEAHQKAQRLARLTLLEYSRLFVDDRDLLRLSALVSSFEHRTHKSLMRCLNV
                     QNRRVRFRDVEKSDIIPISPKECAGFTSSSAGRPVKPLQLSSAPEVWPCRVCAYLNAP
                     SAARCAACETLRTTDMATHRSSPHTTPKMSPAYSTSVATANGTNAGRRSPVVPPLLIA
                     VEGEMETGDFQASRSADMEDVDATSPSSDWDNTYGAHLQPCHAPPTAVCADLAHVPHI
                     TTSTAVSKSTSDTLTRTSPSMASEPGDGAGKVYYGCIEGSTAHGVAPHELEK"
     gene            complement(<67517..>68584)
                     /locus_tag="LMJF_30_0230"
                     /db_xref="GeneID:5653541"
     mRNA            complement(<67517..>68584)
                     /locus_tag="LMJF_30_0230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684560.1"
                     /db_xref="GeneID:5653541"
     CDS             complement(67517..68584)
                     /locus_tag="LMJF_30_0230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684612.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653541"
                     /db_xref="GOA:Q4Q7T6"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7T6"
                     /translation="MSFDSSRGYRTTFGYRTDTPYQQPIAHRQGYTDTQLTMHQHGAV
                     IVGCSTACAFVTVPIEKLDRFYFLSDVPGESSRIYMSDKRAQFFRVVFHTRWWQGRSF
                     VWLAGHYGFLLSTFAVLRHELETAPVTAPWGNRRRGFAAGAMTGVLYATVVHPYDVLR
                     ATAEVTTGPRQFSGAADVLMTALRERPQVLLGVYRGFTVALLGRSLQFALQFGLYNWL
                     RYDGVYRHSMVLFLYCHLATFLGMAAQYPVQSLRQQLHIINSTTRGRPQNYRSLFLDL
                     RRRHGITKLYDGFFRGKPILSAVPMALLITAYDMSTRHYTEYLHPEATAKPTHTQSLT
                     SVAAPAYVTHPPPYEFARKAP"
     gene            complement(<69591..>71381)
                     /locus_tag="LMJF_30_0240"
                     /db_xref="GeneID:5653542"
     mRNA            complement(<69591..>71381)
                     /locus_tag="LMJF_30_0240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684561.1"
                     /db_xref="GeneID:5653542"
     CDS             complement(69591..71381)
                     /locus_tag="LMJF_30_0240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684613.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653542"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7T5"
                     /translation="MKPELAPIPPGAPRCEDGFESPSGIRVTCTKDWVKQHPVEGDGL
                     CVHLYQYLHKNVKGREHSMSAVLLPDTIVFDHNFPRAWYAYDRKNSEIMKRPGSMLDA
                     QTMYSHLSESVKGCDIVAQFFHTSVAVEEAWKEVLTPQQLRANKYANQQLTYVEFFTA
                     DALRCFLFDQKRKPDGVLQKFVIPKGEGSSRRNFQLQVIWTPYITTVYRRTNHSRLTD
                     HAVPLANRAATFDGAPYLSDETLVADETKRQVTQLCESIADHFYATERKRLSRLILYV
                     KTDDQSRMWVLWSSCIRVAPDAMNPTLLRVPVCLSMRTEVLNDGVSTLTRLQTRRHRQ
                     RQLLALDAELFEMTRDFEFALTLNASHKRQAKALGLRGRRHGAGPQVSPTRWRGEQKA
                     PVERENPLYASFLALEVGSGRTAPVSVAPFAGRDSGSMQPYQHSSMSELDDERVAGGE
                     DKLVLDPVAQVQEELVALAMDAWYATYSTILADDPHMMPTARAELAAPLVGTLTQEEL
                     QGLAEVLGLLPAPSDPAAVDASRSATNGAAATSTSHYVVAPYLVTSGRRLDRPSAEVE
                     LDVVSYLEEVFRRRGDEISRSFMEKFSHFL"
     gene            complement(<72262..>75657)
                     /locus_tag="LMJF_30_0250"
                     /db_xref="GeneID:5653543"
     mRNA            complement(<72262..>75657)
                     /locus_tag="LMJF_30_0250"
                     /product="putative ubiquitin hydrolase"
                     /transcript_id="XM_001684562.1"
                     /db_xref="GeneID:5653543"
     CDS             complement(72262..75657)
                     /locus_tag="LMJF_30_0250"
                     /codon_start=1
                     /product="putative ubiquitin hydrolase"
                     /protein_id="XP_001684614.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653543"
                     /db_xref="GOA:Q4Q7T4"
                     /db_xref="InterPro:IPR006055"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013520"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR028881"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7T4"
                     /translation="MSLSSQGSTPWKFRGDATASVGAITAVEFDPDVELLWVCDAFGT
                     LMSFSLQSQGQGEAPAWVNYSSFSVSSRPVTNIFFLNMGGERMVTVADREVIRGYKRG
                     GVLMMCLPQPTAVQNYIDLFQANNSTGAMFYTGNAGLTRLILNHQETDQLTVPMEATV
                     VALKQCDRWVATGSASGAVYVRSASDLSVVGQVSPSRNRVMALEVFDNTVMAAYSERS
                     ATSFVKVFDVRKMSEAVSTIQDIPSGNVTQMRRYQDGFGLSSDRAFLLSPAGFHIIQL
                     DQEKPVFSSSPLSEGSCTAVAVSPSNMCAAIGNDKGTFYALAHPATRDDYVMSTFVQP
                     VRPKHPVYHHSWEEPNIADGFDDSVDLGTLASNWPEEDYMILTVPQKLRCVNYESHSI
                     VPNEWGLMRADSCLPDPKDKLSSILPNPYPFNTQLGDDPACAQEALLELRKDMKRKHK
                     SSRGGGGEYSPMEDSLQVCYSVQHKLDWRSYNEIAQRVIGIDNSFPECWITPLLQSLY
                     LCQPPEFPIRKVILRHICKREFCMTCEIAFIFANMLTTSASVVGMKGEALPPIVPVAH
                     FIRTLRQIRAFANTDVFQRPKNRDDAVAKMHLAQRLVLETLHKDLQDQKAYPFMNYEA
                     PPEYEGAIAALFGTEFTSNGRVHIEPRFYWEVPGSALKVDEGLQHLLKQLEGYKDQVQ
                     IKQLPPIIVLLLNPEHSNLKPPTSLKISRAGKEDYNYVLNSNIVHLADDVEDTGNFVS
                     QQRIKDDSFSLVNDYRVTAPMKMQELERLVPALRSYSAVVTFYALDNLTTPPYARLDD
                     SRTPNLWHLLGPLLINDVLSRPLLRDPAKQAFRSPLSSYTEIRPGDLIAIDAEYVVLK
                     WASRDEGNEMFYVSQRKPHMGLARVSCILSSKDGDERTIVDDYVHIPEEIEDYVTQYS
                     GIHPGDLDPLESSKSLTSLKSTYLKLRALVDGGVVFVGHGLAQDFRVCNIVVPRKQII
                     DTLEIFHKPGSRYLSLRFLAYHVLGESVQEDEHDSIEDARTSLRLYRKYQQLKSEGTF
                     EGVLDHLLAKGAETSWYVPDTKSLFRDTPQTPPVSVMGSPVLEKMAKAVQEDDEKDVN
                     TFDMAAAAAVAAATDGDEDDEDGDDDAPTASEVLEAVRKSMER"
     gene            complement(<77271..>79184)
                     /locus_tag="LMJF_30_0260"
                     /db_xref="GeneID:5653544"
     mRNA            complement(<77271..>79184)
                     /locus_tag="LMJF_30_0260"
                     /product="putative Zn finger protein"
                     /transcript_id="XM_001684563.1"
                     /db_xref="GeneID:5653544"
     CDS             complement(77271..79184)
                     /locus_tag="LMJF_30_0260"
                     /codon_start=1
                     /product="putative Zn finger protein"
                     /protein_id="XP_001684615.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653544"
                     /db_xref="GOA:Q4Q7T3"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7T3"
                     /translation="MSHSALAYAACPMCTRVVHMGQMLHHILSTHKEQDPAYWMRLCN
                     ARLALYERVTGAPLEGTETMRDACLAQATAAVAEAADSEAMVPGGLSLSTPLSTHDAL
                     RPFLPTVSETGTYTCNWCALRSVAFSSRDAFLLHVAKDHPKLDFDVVESLVPQPLTVS
                     SRAARNEGTGTPAPRAPAAESDVTVSDSWTRQQRGGAGCVGAASNSHAAEGFDVAYPV
                     RRMPGVRTVQDTNVVTVKPEVHQLGTSVGRVGRNAFDPAPISTGGRRSRAAVSASSTA
                     SATAVANDLHFDKDCFPCELCFRVFVSELNLLQHLESKHTNPTTLASVSDASVERAAP
                     PGTASASSTAAASPSSVEVFVVCDRCTDRKKVFRSSSALFSHIRFRHPAEDAAYETER
                     MIEEQRQSRVFQCPHCRYRHPDMTRLDTHMRDAHGVVGCAGEKTIRGGRVVSGTAQPH
                     GSAELKTAQPSLFSALPPVTVRTRFWCSVCEKGFANASALYAHTESKHTTIASLYPCP
                     ACKREFRDVPSLESHVQLCHKNLSLKDMGLQSSVECPDCLRHFLNYESLHDHAVRHHG
                     KSAIAPVRSFVTPVSASTAGEGVGVAAAVPVPGTSTDASGSTTSPLAVAAPPKPRKVT
                     RRKKEPSTAATES"
     gene            complement(<81004..>82188)
                     /gene="ATG4.2"
                     /locus_tag="LMJF_30_0270"
                     /db_xref="GeneID:5653545"
     mRNA            complement(<81004..>82188)
                     /gene="ATG4.2"
                     /locus_tag="LMJF_30_0270"
                     /product="putative AUT2/APG4/ATG4 cysteine peptidase"
                     /transcript_id="XM_001684564.1"
                     /db_xref="GeneID:5653545"
     CDS             complement(81004..82188)
                     /gene="ATG4.2"
                     /locus_tag="LMJF_30_0270"
                     /EC_number="3.4.22.-"
                     /codon_start=1
                     /product="putative AUT2/APG4/ATG4 cysteine peptidase"
                     /protein_id="XP_001684616.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653545"
                     /db_xref="GOA:Q4Q7T2"
                     /db_xref="InterPro:IPR005078"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7T2"
                     /translation="MLRYVQDLWSAFFPTEAVFPLQVVGRSGAAVESREELEKALTDT
                     FLIFTYRDGFEAIPAVTRLIETDQGWGCLLRTSQMLLAHFLWVHGRPADRKLSLFFDH
                     SAETAPFSIHNMIRSVWNRRVFKAEYWSPSQGCEAIKRTVQGAVKTEQLQTRVMVVTS
                     TNGCIYADEVQHTFKQGADVVLVLASVRVSAAAQLTQESYLQIEKLMEQPQCLGVVGG
                     VPGRSYYFFAHNQTQLFYLDPHQRTAAALLCEGLSAAASVTPSVADVRCVHWSRVDTS
                     LFLAFAVTTRDEWAALEVHLSNRFMHVESQQTQRDCDHLGGARPGHADSTFVSPLQMG
                     HSCAMGGASISETAPLVHRRTLRLPRKRFKEGGVGTATAAAAERDDGEDELDTDSWEY
                     LD"
     gene            complement(<83470..>84120)
                     /locus_tag="LMJF_30_0280"
                     /db_xref="GeneID:5653546"
     mRNA            complement(<83470..>84120)
                     /locus_tag="LMJF_30_0280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684565.1"
                     /db_xref="GeneID:5653546"
     CDS             complement(83470..84120)
                     /locus_tag="LMJF_30_0280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684617.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653546"
                     /db_xref="GOA:Q4Q7T1"
                     /db_xref="InterPro:IPR001781"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7T1"
                     /translation="MYFYRRIPSLASKMNHMRQFSLPRSSAAIIMAASTAALAVPCRA
                     MHGKPASGHKVRTQHSRRWWMQSKAHHLTAVPHEEARSRPHFPAYTEDVDQPMVVPDG
                     VCCFNCDKPIDGDDINSYVWVPSGNARVPTTQGYFFHVKCFKCWNCKYRIIHNQFYSK
                     DSRAWCLSCALGRDIRVPTRRWHTSYVNTHRTGSRLTGQFFPRHRHQMEFLFSPKE"
     gene            complement(<86482..>91044)
                     /locus_tag="LMJF_30_0290"
                     /db_xref="GeneID:5653547"
     mRNA            complement(<86482..>91044)
                     /locus_tag="LMJF_30_0290"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684566.1"
                     /db_xref="GeneID:5653547"
     CDS             complement(86482..91044)
                     /locus_tag="LMJF_30_0290"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684618.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653547"
                     /db_xref="InterPro:IPR000372"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7T0"
                     /translation="MQLSEAVLAPAWSAGGFAYIVKGETTESPAGPSGPVCAHTRTSA
                     GGITAPFTFSMFDAQFSPVYLVSPSAVESTGDAASLTAHVAGRLDLQQGRYTTLTTPT
                     SLGTCAGVLRSSPAQCVLGELDTLHENWTAHSLAATANATRDDDSLTLSAKGLCAAEL
                     LTAFVSDYLPQRAWLRSAVPRVVDALSHAEQAARAYSAALLSLPDAAEAADMQRAVAE
                     QWGSYLWSTYVPQLQRKWTLLYRLAVATLTPSQVAPSLDDTANESITGEPGPAPKVSC
                     PIVDAWPQLRYSLTSSNHGRRTCARLVAYMEDALDSLEEFLSSGGDADTLSEKQTDAL
                     VLQLLQRTYCVTTTYFFSVAALFDAPFLDASASVWVEPATHMQAWAMRTMREASVADA
                     MANATAFQVATTARVTRSTESLPRSEKAFMACLAAFLDATTPLTSVAVTSPSDCAQAL
                     LKARAEASGVTARDSLVLLWDVSQMRAVKPSSDTVSGTTRYESTVLLPTRSADAKASA
                     PSESIRWTMFQQASTSFTSQTSLYTPSVVASVPKEPCAAGSAARRAPGTASNRAASKE
                     ARHGVLVGSHAAETCAAGTYAKPDTAACRACPSACSALLKAATPVYCPGDGLMHGCPA
                     LPAGAVLAGSPSTGLDNAKAACRYACIDIYQAPLHNGCVSTPGLFYNTTAVISDKRSG
                     GWYDACVGPASLLPSSFPAQSHDAHVFAFVGSGATDEPMSCRFVLMHRVVSSAVSAEA
                     LRAVGLLLQPLSVSAASATAKSSAGLPPYRDGIAWEAAMQLNATLLWEMHTSLLRSQQ
                     RASGTGTGAANTSIAHVLVALREGGEGVASQSRLSWSLVSSYQRPEGGETATTTSATG
                     AAPPPSVTFTLRLLLNVSMLPTPQSTDASGDRTRTPCTTPAPSSLTVLSAPWQWSVTS
                     MDVDHLTKTTYRVVLSRSTSTVVFYRGAAMVGNPVTVDWPLWGQSQMMSPPSGKTTMY
                     LSVAGWVAGYVEREQWVLKSPPLPASSSSKLAALPLHYDYVPGMVLRLSSAASPLSPL
                     HEALSRAEATWRSQAETFVEQQGRDVEALTDVHSLGLYVASFPAVTAKVSAALSALSA
                     RQSTGLDGVCRSGYGYDVTAGGTSATPVCATCTSGSYSVLSATPERNTCACVPQRALG
                     GVASLAGQPVRACLRRPAGPAAPSSYLRSPGRLFVDSNVVIGYGIPLGGYGRGAGATG
                     TVLPATTSLEGLVTCMYGLTVPRLMTTAPTGSLNLSVTLQYTTGLGAEECGVMAAARG
                     GATTVTTQPTYSALSSYGLRLRASRLPTHTITLVNNSRLFTNQTVLTVGVRGYALLPH
                     YAMDSLLHMRGISEYHAVFLTYMLRCATVSAVLRCGSPLRDAGNFTWAGFSSLDSSVL
                     RLNLTRMITEECQVSFTVRSATAAASEAAVPYTSWPYTYLATEADASLFFEASPTLHY
                     TLLPSVEAFETTKLRYEPLAESSSLIISFVMLALSFPLIGIILISVHPPSVQPLSWRP
                     YERARARRHCEHQQLHSIARSERGAS"
     gene            complement(<92840..>93286)
                     /locus_tag="LMJF_30_0300"
                     /db_xref="GeneID:5653548"
     mRNA            complement(<92840..>93286)
                     /locus_tag="LMJF_30_0300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684567.1"
                     /db_xref="GeneID:5653548"
     CDS             complement(92840..93286)
                     /locus_tag="LMJF_30_0300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684619.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653548"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7S9"
                     /translation="MALSGLLCRVSCYVAPSLSGPRFYRGFLSRASSTALALPISASL
                     TSSSVVPLSYAGSLREGRRGYAQERNPHDSNTEDISNTFFDVQDVDADRLTHFYWDSN
                     DDTDTPYDTISLDSLLGEGEADEWAGESLAFVDERDQLLLDEEYLK"
     gene            complement(<94527..>98246)
                     /locus_tag="LMJF_30_0310"
                     /db_xref="GeneID:5653549"
     mRNA            complement(<94527..>98246)
                     /locus_tag="LMJF_30_0310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684568.1"
                     /db_xref="GeneID:5653549"
     CDS             complement(94527..98246)
                     /locus_tag="LMJF_30_0310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684620.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653549"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7S8"
                     /translation="MYAVGALGEQRGDAAGGTTASQQQQLSYVFQPSASVAQLTQGSF
                     GFEGSVVGMREEDVRVFVVPAGFTTRVSDSLANVSAQGLVFVVRLVQVEHVDEEPTSA
                     RQAADSGQGAPPSVYAAAEDGDARQASAPSEQALMVVTAASTAAGVAPATSSAASAVP
                     AFLSTNGIPAEHMSVLRKIELGVNTAVATARDVHGVTAIFSQDWHRHMERPKPSLLSN
                     RALLEQVQRVVEEEETAQKHLDACDSTMQALEARSKEIQRRIDRAVSDSQRLLEEKNK
                     GATKSMEARLERERQLVKLKDELRVKEQAQEDLQRRVAALRRYIDTSSEELRQLQGRF
                     DVHEIQSRGLAERISAIQESLSEERRRSAALVSKSSATEEAVCKAQAQHRLADGQLTA
                     ARGLAERERLRYLQVMEDERSHRATDADILRKDIVDALDARERQYQVDRCRLAEEQFM
                     RGLRDGKAEGRRVAETDLLGHQDELRLNLQRAKTEVETRKEEVRRSIESAMALRRTLG
                     GKVTELEAQLASATRKQTNLHYKLSQWQTWCRTARDTVSQHWRALLSYATHPCTQDEL
                     LKMMEAVRTAEQASYASDDGDEGSDGTGGPVRVDLQFQLDHWRQTRIRCIAQRQRWLW
                     DDMLGLYTKGASVHFAREWLHPLIEAHDATLEAVAQLYAQQHGGRALFDCCVEEAQER
                     WSVQQQWWSTIHEIEEWLAAQRTAQENLKGEEATAREALWKEYMDGGEAVAQLCASQL
                     RAQVMLLHEEMQARDELVSEEQRRRRLLPEEAQQQWAATCSSALRLFEEEEEAARAGL
                     EAEAYMSYSGLEFQCAYALRATQQLSAQHAEQQRLLAEETAARQTVMQEAADAVERCR
                     LAAATAVSSAEAAAAPPIGAPREEGSPANVFCPSPMETMPSAPSPPPLAEETPASPLP
                     SPCSSSHARSPPSPTHLVEGRTSTADESATTPQVTGVLAPSHNIADAEPPVDPAVALQ
                     RVDSSPVPPPPPAAEIGFGFADPPRAAWGDQSSGSGGSNRLRDGGLAMTTDAFFSSEP
                     PPLPPPDKADSSAQAVAGPSELRSASTFHAVATVAAPPPPRRSSHAEFSAAPTLAITA
                     ESDDTPPPPSEAAGVDRQHMSAQHSASSACESTSSSSRTSSTSAVQRAGDAAAPFTAL
                     PLQHDPAGREEGAAAGRDSPPSTQRRPARAFGADSSSIGEDLSGDMASGQGSQKSPTS
                     APRRARGPTTKQSAAGSATQKPKLFDSSSDSEHGE"
     gene            complement(<99684..>101447)
                     /locus_tag="LMJF_30_0320"
                     /db_xref="GeneID:5653550"
     mRNA            complement(<99684..>101447)
                     /locus_tag="LMJF_30_0320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684569.1"
                     /db_xref="GeneID:5653550"
     CDS             complement(99684..101447)
                     /locus_tag="LMJF_30_0320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684621.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653550"
                     /db_xref="InterPro:IPR012919"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7S7"
                     /translation="MWPQERLMVLCTLLLLYMLFSAPLELLTVFWHCTTSTAVGISSP
                     SPLKRLSTGSVPGLSTNYASLYLGAAVVSMEPSSCHGGAALISESVDTYVLCPCGAPR
                     KQFVVQLIRDVQVRSVMVRNAEHFSSGVRNFTLLGSLQYPTSTWLVLGHFEAEQRRGR
                     QYFDVAPRSRVRFIKLQWATSYGPEPWCTITSFQVYGIDVLETLTRYDGGDDLLAGEY
                     AAVASGGLRDTPDVHRSHPPELPPTPGEVAALSLAGSSAVPSRNDATSAKGSTTPAVS
                     IDELAAGMWDGAAATVGASRGADADDLLLAPVDVGASAETGPLSQPGADATRSSPTNS
                     IALAATAPALQSLNCSAAQPIGWNTSLKCTITDLAALWGPCAVATCGASDCTAVVIPT
                     SAPALSVRTPSSKGLTASRSIYQSAAGSLLTNLLRQQRSTHHELTLLMQRERHLAQEL
                     NRTRILFSDFYARSKAMEREANEYRDRLHGLQSKLQLLQERFLLREHSSCCGEGGGAD
                     RSGSSMMRSDTAVAVASFVLLALTVILMFMYSSSSSRSVVGPPSGWGRYYNIGRGSGG
                     VALGGGNGPPLWPRQQRGRAR"
     gene            complement(<102408..>104723)
                     /locus_tag="LMJF_30_0330"
                     /db_xref="GeneID:5653551"
     mRNA            complement(<102408..>104723)
                     /locus_tag="LMJF_30_0330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684570.1"
                     /db_xref="GeneID:5653551"
     CDS             complement(102408..104723)
                     /locus_tag="LMJF_30_0330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684622.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653551"
                     /db_xref="GOA:Q4Q7S6"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7S6"
                     /translation="MSVLDNDEAARRGGTSLRSLQKMCMRVPQLSTELTRPQRFQLYC
                     LLLLEDGDDPAVPGGAAGQEDWTTYTKQALETHVHMAKQAAALFPTTLHITTDELAGL
                     FYRLGADATFYFNPAMMEVILCVTYVVAGSRSTDKNMLLRTLYRMLCVLQKDFIVAAA
                     SHLYEPATTSLLRLMLQFYDPQLATHMDQQQVNIGTYLFDWSRRLLVLQSDYDTALKV
                     LDWVFILGDPAMVPYVAHAYLITHRRSLMLLSTKQALTQHLDKMKFTLPACKADAINP
                     ELVDGRATAPTPVWGGKSLLQNADLLYRVTPLSTQRMLAFCFYPDAGALNKTSKELQE
                     YYAKAPSLPLERSDIASAFAKRGAAAQGGGDALPSHEYVIADCRSRESFEYARLPTAV
                     HVGDVLSYHHEDLAEALRRLESCRGHPLALFGTGRPIVEEVNLLKVLALYLVNRQAFP
                     FVCIVPGGFKTTIPLIRNHIIDAIMSPAAAAALENATGKRGVSSIDWGQQASKTAHKI
                     SAALNEVSGYLAQVEGAEVRQKAQELGTKAKEGVAAAGSWGWGMMKRVRESLSETSEQ
                     ALTALSSVSGKLAAAQMTTTAISGSAPSSATAPSAASKSSTGGQAAIPTAIAHPTAVR
                     PSRQPQQVFSLGEDCAEEDLDLITSIPARPLRGTVVLESPPVAAEVAPSAPAAPSSAA
                     VVSASERRHLTAPASSPAVAAAAVSLEPVSPPTSSAAPAAATAARGASAPQIAADLDA
                     EFDELFGDLTVTPAAASRVAGLSAAEADGFP"
     gene            complement(<106408..>108804)
                     /locus_tag="LMJF_30_0340"
                     /db_xref="GeneID:5653552"
     mRNA            complement(<106408..>108804)
                     /locus_tag="LMJF_30_0340"
                     /product="putative KU80 protein"
                     /transcript_id="XM_001684571.1"
                     /db_xref="GeneID:5653552"
     CDS             complement(106408..108804)
                     /locus_tag="LMJF_30_0340"
                     /codon_start=1
                     /product="putative KU80 protein"
                     /protein_id="XP_001684623.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653552"
                     /db_xref="GOA:Q4Q7S5"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR005161"
                     /db_xref="InterPro:IPR006164"
                     /db_xref="InterPro:IPR014893"
                     /db_xref="InterPro:IPR016194"
                     /db_xref="InterPro:IPR024193"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7S5"
                     /translation="MSKGAVVLVLDITLPRAAALVEACNLCDRILTDKMIYAPSDEVS
                     VILAGTEKSRSALYEQSVQARYNHITVAAELGPATSLTLAPIAATRAGVAVLPEGETV
                     RPSIAEAYDFIDALQVAVAVLQARTSQKKYNRCIYFLTDARHEVRHKEDLLSLIDILQ
                     RDQVALVVIGFDFQALPAPADSQGEFNESTTVVPSAWAALDRKAQNERILAALCTELG
                     PPSTLVSPAEALASLSLLRCRRIRQQPVLKVALRMGDVRLATQLFTLTQEERLPSLRR
                     STQDGVDVAQTIEYVVLGGVEERPCALAKEERVEAFFLGVDRISCSEADREAMRVKGP
                     RALEAIGFVGEAEVEPYLLMGGTRALLPLAGDHAGQRGFNALVDAMASSRKAMLVRLV
                     RTADAAPSLCVCFARTAGSSAAQRHLVLAPLPFAEDVRALRFSEYPELQFSAAEEQLM
                     DELIDGLSVDDSVLAPHDTFNPVLQQYYATLRAKLSAMNVSAEKGNTKATSPEAAVPQ
                     LLPTLRGTSTDFFAEGSEVYEVVSAHRSALVSCATAFPYEDEADALLSGSRDAGRKGK
                     PWYQDVAMTPSLIGPQAGSPPPAAQGSDGAPSTIAPAIAGGARCGGEADEASAGSHTA
                     SDANSISTVPHDTISGGVSFAITSVDPVGSFSMIVHHPAVTEAQLNKAKDDLSDVIWE
                     LLRSSIKDAIYRKCMACIMALRQFCVTQDDAAYYNDFLLKLEVVARQCSRDADFWVPY
                     VVERKDGANVWPITAQECKSAALPDDTAAKAFLQKDRFDPAIAFDDTADDDDWLAEIQ
                     "
     gene            complement(<112005..>113828)
                     /locus_tag="LMJF_30_0350"
                     /db_xref="GeneID:5653553"
     mRNA            complement(<112005..>113828)
                     /locus_tag="LMJF_30_0350"
                     /product="putative kinesin"
                     /transcript_id="XM_001684572.1"
                     /db_xref="GeneID:5653553"
     CDS             complement(112005..113828)
                     /locus_tag="LMJF_30_0350"
                     /EC_number="3.6.4.4"
                     /codon_start=1
                     /product="putative kinesin"
                     /protein_id="XP_001684624.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653553"
                     /db_xref="GOA:Q4Q7S4"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7S4"
                     /translation="MSRTQTSSKSVPKNIAVYCRVRPPVPNEKGHTFQNISYDDSDSR
                     AIAVARKSGTKALEKTYLFNRVFRPTATQKDVYETFAKGAVDAAFDGQHGVLFVYGQT
                     GSGKTFTISNDEPNNEGVLQRSMRDIWNRIASDTANDYSCSVSYVQLYNEILTDLLDD
                     AKGKVRIQMGSEGRGDVVMVSDSTGMAIEREVKDYKSTMACFQVGLARKEMASTSMNS
                     TSSRSHTIFTLNIVKAKKVVAVTVGTEAEGPTIALEGRLVLCDLAGSERVSKTHAEGK
                     TLDEATHINRSLLTLGKVVTALTDNAQHAPFRESKLTRILQYSLMGNGNTSIIVNISP
                     SDDNTEESLSAILFGQRASQIKQDAKRHEVLDYKALYMQLMAELDNKNDKTLEEALEE
                     ERGVYEERISALDEEMKLLSDENAMLRNENKQLRQYVPADRLKLIDETPSSGVSGANG
                     EVVSGGWAKVNQDLRKLVQQRDERLKVISDERVRLALVVAEEKRKCFQLAQKMRSFAM
                     RYKMEREQSTQRQEELCTELATLKGTDYLSAVGSFDATASPGSPNYPRENEEFNDAES
                     AQAQIRALRAERMELMVYQAKAANAIRKLVKERDAAQRKVA"
     gene            complement(<115409..>117271)
                     /locus_tag="LMJF_30_0360"
                     /db_xref="GeneID:5653554"
     mRNA            complement(<115409..>117271)
                     /locus_tag="LMJF_30_0360"
                     /product="putative endosomal integral membrane protein"
                     /transcript_id="XM_001684573.1"
                     /db_xref="GeneID:5653554"
     CDS             complement(115409..117271)
                     /locus_tag="LMJF_30_0360"
                     /codon_start=1
                     /product="putative endosomal integral membrane protein"
                     /protein_id="XP_001684625.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653554"
                     /db_xref="GOA:Q4Q7S3"
                     /db_xref="InterPro:IPR004240"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7S3"
                     /translation="MVVIVLCWASSITYGFSFPLMHDLGLAYSQGETVHVLAKSVTSR
                     AKIVPLRWSSVFPCAVSLSQSTLQPSRRSIGQVLMGDTLEDSGIRLKVLTDMKCVLVC
                     SARLSTAEREQYEKRILGRYRAHLVLDGLPALEAPSVDGAYRRIRTGFPLGNFSRATT
                     TGFIEVYNHVHLIVSYYPITSTDSRTVRIVQFEVQPRSVFHTGELGGDGTCTFPAMLK
                     PQITHMESIRFSYSVEWVVSTTPWKTRWDNYLDDNSRESKAHWYSIVNVFSLVLLQSV
                     LLWYILVRSVRRDISSYNEEDLLGDREDSGWKLVHGDVFRPPRGAVFLSVLVGNGMQI
                     MCMVFASLLVAVAGMLAHDSRGMLASLLVMLFVFFSSVNGLVTAALIKLLRRRSWQAI
                     FLTSVALPGFLFGVYLTLNLIHLGSHAASTLPFTSLLYLLALWLCVSVPLCFGGAVAG
                     FSSNLSIPAKINAIPRTIPPQPWYMKGVLSYVALGIVPLAASYVELQSIFSSVWLGVA
                     YRMFSFLLAAFVLVLVIVAQVSIFSTYHQLSLLNYHWWWRSFFVSASYGVWLMLYCVL
                     YYWLISVVKGFLGMVLFFGYMGLACVTVALMFGAVGFLASLVFICILFASVKAD"
     gene            complement(<118934..>120166)
                     /gene="MPK12"
                     /locus_tag="LMJF_30_0370"
                     /db_xref="GeneID:5653555"
     mRNA            complement(<118934..>120166)
                     /gene="MPK12"
                     /locus_tag="LMJF_30_0370"
                     /product="putative mitogen-activated protein kinase"
                     /transcript_id="XM_001684574.1"
                     /db_xref="GeneID:5653555"
     CDS             complement(118934..120166)
                     /gene="MPK12"
                     /locus_tag="LMJF_30_0370"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative mitogen-activated protein kinase"
                     /protein_id="XP_001684626.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653555"
                     /db_xref="GOA:Q4Q7S2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR003527"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7S2"
                     /translation="MILTKVEGPNAAGNKVYVFGVNDYRLEVPERYNVQHFVGRGAYG
                     FVCSAVDAVTNEPVAIKKVMHLFDDAVDAKRVLREVKLLAYLKHPNILSLKDLFKSPD
                     PVDTYSELYVVTDLMESDMDAILRSPRIRLAAGHGQYFTLQLLCALQYIHSAHVLHRD
                     LKPGNLLTDSECNLKLGDFGLARGIGHDDTMTQYVFTRWYRPPELLLVCKHCNYSADM
                     WAVGCLAAEMFTGKPLFPGKDYINQINLIVELLGIPDLARDLPPSTSKEAIHYLSSLP
                     PSKGKKLEEYAPELRRRFDETTFYDSFDTELEEAIAVEGAIIARPRPHPPEEYYAEFV
                     DFIFGLLCYNPAKRRTAKESIAHAWLSDVRGPQETIGGCEAERIYRWDADGTAFTIPQ
                     LRQLFIDEIGKFASTRSS"
     gene            complement(<123493..>124647)
                     /locus_tag="LMJF_30_0380"
                     /db_xref="GeneID:5653556"
     mRNA            complement(<123493..>124647)
                     /locus_tag="LMJF_30_0380"
                     /product="putative phosphatase 2C"
                     /transcript_id="XM_001684575.1"
                     /db_xref="GeneID:5653556"
     CDS             complement(123493..124647)
                     /locus_tag="LMJF_30_0380"
                     /EC_number="3.1.3.16"
                     /codon_start=1
                     /product="putative phosphatase 2C"
                     /protein_id="XP_001684627.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653556"
                     /db_xref="GOA:Q4Q7S1"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7S1"
                     /translation="MGLMLPKPILSKVVDRAGNSFVNAACASQNGFRNSMEDAHMLVA
                     TDDADVAYFGIFDGHSNAECSAYVARELPQRLKKLPESITAEMLEKVCIEVDEAYMKT
                     STEGGTTGTFCVIRKDLTVTIANVGDSRILVCRGGKLIFATEDHKPYIPGETERIVAC
                     GGSVVSNRVDGDLAVSRAFGDASFKVKGTKDYRMQKVIAVPDVSVLQCEPNDFIILAC
                     DGVFEGNFSNEDVCQFVWEQQQNCWDDLAVVACRVCDEAIRCGSKDNISCLVVQLAEG
                     ASRVKAFGATSFVPGPPFPRNQQPCRAAYAQMAELGHTTTAAALQTRYQLLQAFSKNK
                     LNSQPPVMRTAFEMSDEVDVETEWSFFGKGPAPGNEKNFFEALANTGNSS"
     STS             127501..128760
                     /standard_name="ha3000"
                     /db_xref="UniSTS:515621"
     gene            complement(<130265..>131017)
                     /locus_tag="LMJF_30_0390"
                     /db_xref="GeneID:5653557"
     mRNA            complement(<130265..>131017)
                     /locus_tag="LMJF_30_0390"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684576.1"
                     /db_xref="GeneID:5653557"
     CDS             complement(130265..131017)
                     /locus_tag="LMJF_30_0390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684628.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653557"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7S0"
                     /translation="MLSLSPGSLPRLLQMKLALRHVCILLRAAALVSLVAVSGSSSST
                     AVSSASSSHHYSGSVNSASDASIDSGHQPSPSPPSNKPPLDADEWVNITLKFFIIFVS
                     VCAGVAVVAFSAILCAYCREYKLLETSDDSDTESVSSHTTSQSSSSGESDSSSDDVPA
                     YVTPRQRHMPPPPIVTEITVPVAYEEESDNADLPDRVMQADMQSNESSEFLFVPPETT
                     PGFSDGAATAFRRTGSRLSLAYSRRGLYRKER"
     gene            complement(<133360..>134634)
                     /locus_tag="LMJF_30_0400"
                     /db_xref="GeneID:5653558"
     mRNA            complement(<133360..>134634)
                     /locus_tag="LMJF_30_0400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684577.1"
                     /db_xref="GeneID:5653558"
     CDS             complement(133360..134634)
                     /locus_tag="LMJF_30_0400"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684629.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653558"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="InterPro:IPR029059"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7R9"
                     /translation="MISARDAILQLTSGPSLMDSMCNFIIRPPRSTYEIDDLGPGVFR
                     IGDDCTERFMRHDFELENMRGLRFQCSWFKPYPARRVPCVVYCHANCGGRYDGLEALF
                     LLQEGFSLFCFDFCGSGMSEGEYISLGFYERQDLVAIVEFLSLKSDEVDGVALWGRSM
                     GAVATIMYASKDPWIRCIVCDSPFASLRLLIDDLVERHGGRTARVLPKILVHGIVERI
                     RKRIMKRAAFDIDDLDAVKYAKACGVPSLLFHGADDDFVSPVHCEMIRDAFPIPCLQQ
                     FTPGGHNCERQEDIHVLIRAFLRLYLIDKPQGAREMQAVRELQLANTASPAAVSSAAA
                     AAATKAATPRPSEPAAPAPKQLVPPACYGMRCAGTALISSSSTSATASSPTTSLSTSA
                     SSSTSFDSSLPSPAALSVPLSPENRLVYDCSN"
     gene            complement(<135581..>136399)
                     /locus_tag="LMJF_30_0405"
                     /db_xref="GeneID:5653559"
     mRNA            complement(<135581..>136399)
                     /locus_tag="LMJF_30_0405"
                     /product="putative dolichyl pyrophosphate phosphatase"
                     /transcript_id="XM_001684578.1"
                     /db_xref="GeneID:5653559"
     CDS             complement(135581..136399)
                     /locus_tag="LMJF_30_0405"
                     /EC_number="3.1.3.4"
                     /codon_start=1
                     /product="putative dolichyl pyrophosphate phosphatase"
                     /protein_id="XP_001684630.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0405"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0405"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653559"
                     /db_xref="GOA:Q4Q7R8"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7R8"
                     /translation="MLLLETARLVWGYTHLSAVEMRHGEGLALEHRQHAAALATTSET
                     SVTSSEPPHWKLWAMTAVVYRQHDLLSKLFAISSIVPVAMMVLLAGLTSAPCRERRIP
                     AMNLILYLILSVCLNVVLKAAVRSPRPAHPAAGMSYTTAYGMPSDHAQFMAGFSVYLM
                     RCWARARRHRTGRRKSGHLQRRESASASAALPSTSSPYALAALLLLATLFIGAGRVYN
                     GYHTVGQALVGWMVGIALAFACTTAHVQRGFTWVSEKVLVPAMLVCTFWTEAIC"
     gene            complement(<136885..>138315)
                     /locus_tag="LMJF_30_0410"
                     /db_xref="GeneID:5653560"
     mRNA            complement(<136885..>138315)
                     /locus_tag="LMJF_30_0410"
                     /product="WD-40 repeat protein"
                     /transcript_id="XM_001684579.1"
                     /db_xref="GeneID:5653560"
     CDS             complement(136885..138315)
                     /locus_tag="LMJF_30_0410"
                     /codon_start=1
                     /product="WD-40 repeat protein"
                     /protein_id="XP_001684631.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653560"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7R7"
                     /translation="MDRGYPRRREGGASFGGGGFGGVGGFSGGSGGPPAGGPRRRFRS
                     DFDPEEYAPRRKLHGQRPVDFYSPAIRHVLTRLVPRSTPYSYHVAPHEYYTKDLVTAS
                     VTNYNASTALCTQWVNTSYHPDSKGGRIRTPLYALQWSPSGRRLLCSTGRGEFLLFNG
                     QSFGVEVKTVAHEDNRPCRAIAWGRRHDLILSGDDAGKLKMWMPNFVFMSEVDTSHRA
                     VREISWAPLELKFCTAGQDGSAKVWDTNTVGAHTATAGASDGNQAVLEEVKLEGHGGD
                     VTTAHWHPYRALIATGSQDTQCRLWDPRTASRGSIAALHGHSQALTCVRWHPDGRTLL
                     SASKDGTVKLWDIRKTQPEVKRFTGHTDAVDKVDWHPTVSDLFASTGADGSVMYWMVA
                     EGDGTMTHGVEEVVHDAAMIEAAHEKFRDKPNPVHCVAWSPLGNILASSGHEVKYWTR
                     NKPGALEEKERGVESDILDEQGHVMV"
     gene            complement(<139302..>140402)
                     /locus_tag="LMJF_30_0420"
                     /db_xref="GeneID:5653561"
     mRNA            complement(<139302..>140402)
                     /locus_tag="LMJF_30_0420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684580.1"
                     /db_xref="GeneID:5653561"
     CDS             complement(139302..140402)
                     /locus_tag="LMJF_30_0420"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684632.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653561"
                     /db_xref="GOA:Q4Q7R6"
                     /db_xref="InterPro:IPR001206"
                     /db_xref="InterPro:IPR016064"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7R6"
                     /translation="MPFLKRCMLVVNNRSGSRHAVQAFASTLKGYLDRAGIVHHDVHI
                     PNDDVAEQLQRALLQAEALVLCGGDGTVNSALNLIAAMTSSGRGPSTAVSLPSVLESV
                     PLLLVPTGLHNSIATSLGVTSVERAVSSLVVGRTVRVPLWAVHLHHPHSPSGALPVRY
                     MCSYIATGTYAASVRRHGNWKKVQEEYVFLPAALGCFTAIALFTTIEHALPDSTAVLT
                     HINKDTASSSVGPLRLLVASQMPQLQPGYSLTPAATYHRRQLTVTTATAEATRMRMWH
                     LLHREAREGYILAEDGVSMQEQVRDLRIDFPAVSHLPDVATRSTQPLESDGGEGRLGS
                     ALLVVDGESVKVPTGSSVTVTPTELSVQLIVS"
     gene            complement(<141186..>142844)
                     /gene="QSOX"
                     /locus_tag="LMJF_30_0430"
                     /db_xref="GeneID:5653562"
     mRNA            complement(<141186..>142844)
                     /gene="QSOX"
                     /locus_tag="LMJF_30_0430"
                     /product="putative quiescin sulfhydryl oxidase"
                     /transcript_id="XM_001684581.2"
                     /db_xref="GeneID:5653562"
     CDS             complement(141186..142844)
                     /gene="QSOX"
                     /locus_tag="LMJF_30_0430"
                     /codon_start=1
                     /product="putative quiescin sulfhydryl oxidase"
                     /protein_id="XP_001684633.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653562"
                     /db_xref="GOA:Q4Q7R5"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR017905"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7R5"
                     /translation="MARLHGPAVAALCLCALAVLYCPGVAAGFSESRSLFRDAFEVVD
                     INSMSLKELHKSAHTCPWILVTYLDTCGHCRHSAPLVARIAAETLEDSGDVLNEVTVA
                     ALNCETSMSDCQELRVVSVPSFYFLFPSDMPVNATTLEPVVANKNLLDKGNAEAKPIA
                     MTRALIGQGANPNAHFDTARKMWMGASSNLWGATRKELCLHMRTYLRNSKESDAAEAG
                     AGGALAAASTANFVEETTFHVVDVANAFFETLFHEVALRGLESAARRRALFRFLRLVQ
                     QRLPGLGADVLLYSMTVNRSVDGAQSSVAGFASSVDDWQKLVLSAGIPYEGNPRHLSW
                     RTCKGSSWRYRGFPCGMWLLYHSLTVNAAHVDADDNNTEVLFIILDYARHFFACDACL
                     THFLRFQPGDKDPVLQLWRFHNEVNRRLASLGEGGDPLVPKRIFPTVEQCPACIRSDV
                     TGKEEDRFVETEVSKYLRSRYRWNPTALHEGTVKVTESTRKRSINDRGRAVNVYHSLL
                     SMDTFLIIVLVIAAVVLGMVYVLRRHHSSAAKRRRPILPLRARD"
     gene            complement(144079..144181)
                     /gene="LM30Cs1C2.3"
                     /locus_tag="LMJF_30_snoRNA0001"
                     /old_locus_tag="LMJF_30_snoRNA0023"
                     /db_xref="GeneID:12981410"
     ncRNA           complement(144079..144179)
                     /ncRNA_class="snoRNA"
                     /gene="LM30Cs1C2.3"
                     /locus_tag="LMJF_30_snoRNA0001"
                     /old_locus_tag="LMJF_30_snoRNA0023"
                     /transcript_id="XR_002460968.1"
                     /db_xref="GeneID:12981410"
     ncRNA           complement(144080..144181)
                     /ncRNA_class="snoRNA"
                     /gene="LM30Cs1C2.3"
                     /locus_tag="LMJF_30_snoRNA0001"
                     /old_locus_tag="LMJF_30_snoRNA0023"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460969.1"
                     /db_xref="GeneID:12981410"
     gene            complement(144330..144434)
                     /gene="LM30Cs1C1.3"
                     /locus_tag="LMJF_30_snoRNA0002"
                     /old_locus_tag="LMJF_30_snoRNA0019"
                     /db_xref="GeneID:12981411"
     ncRNA           complement(144330..144430)
                     /ncRNA_class="snoRNA"
                     /gene="LM30Cs1C1.3"
                     /locus_tag="LMJF_30_snoRNA0002"
                     /old_locus_tag="LMJF_30_snoRNA0019"
                     /transcript_id="XR_002460970.1"
                     /db_xref="GeneID:12981411"
     ncRNA           complement(144331..144434)
                     /ncRNA_class="snoRNA"
                     /gene="LM30Cs1C1.3"
                     /locus_tag="LMJF_30_snoRNA0002"
                     /old_locus_tag="LMJF_30_snoRNA0019"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460971.1"
                     /db_xref="GeneID:12981411"
     gene            complement(144543..144645)
                     /gene="LM30Cs1C2.1"
                     /locus_tag="LMJF_30_snoRNA0003"
                     /old_locus_tag="LMJF_30_snoRNA0021"
                     /db_xref="GeneID:12981412"
     ncRNA           complement(144543..144643)
                     /ncRNA_class="snoRNA"
                     /gene="LM30Cs1C2.1"
                     /locus_tag="LMJF_30_snoRNA0003"
                     /old_locus_tag="LMJF_30_snoRNA0021"
                     /transcript_id="XR_002460972.1"
                     /db_xref="GeneID:12981412"
     ncRNA           complement(144544..144645)
                     /ncRNA_class="snoRNA"
                     /gene="LM30Cs1C2.1"
                     /locus_tag="LMJF_30_snoRNA0003"
                     /old_locus_tag="LMJF_30_snoRNA0021"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460973.1"
                     /db_xref="GeneID:12981412"
     gene            complement(144788..144892)
                     /gene="LM30Cs1C1.1"
                     /locus_tag="LMJF_30_snoRNA0004"
                     /old_locus_tag="LMJF_30_snoRNA0017"
                     /db_xref="GeneID:12981413"
     ncRNA           complement(144788..144891)
                     /ncRNA_class="snoRNA"
                     /gene="LM30Cs1C1.1"
                     /locus_tag="LMJF_30_snoRNA0004"
                     /old_locus_tag="LMJF_30_snoRNA0017"
                     /transcript_id="XR_002460974.1"
                     /db_xref="GeneID:12981413"
     ncRNA           complement(144789..144892)
                     /ncRNA_class="snoRNA"
                     /gene="LM30Cs1C1.1"
                     /locus_tag="LMJF_30_snoRNA0004"
                     /old_locus_tag="LMJF_30_snoRNA0017"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460975.1"
                     /db_xref="GeneID:12981413"
     gene            complement(145001..145103)
                     /gene="LM30Cs1C2.2"
                     /locus_tag="LMJF_30_snoRNA0005"
                     /old_locus_tag="LMJF_30_snoRNA0022"
                     /db_xref="GeneID:12981414"
     ncRNA           complement(145001..145101)
                     /ncRNA_class="snoRNA"
                     /gene="LM30Cs1C2.2"
                     /locus_tag="LMJF_30_snoRNA0005"
                     /old_locus_tag="LMJF_30_snoRNA0022"
                     /transcript_id="XR_002460976.1"
                     /db_xref="GeneID:12981414"
     ncRNA           complement(145002..145103)
                     /ncRNA_class="snoRNA"
                     /gene="LM30Cs1C2.2"
                     /locus_tag="LMJF_30_snoRNA0005"
                     /old_locus_tag="LMJF_30_snoRNA0022"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460977.1"
                     /db_xref="GeneID:12981414"
     gene            complement(145246..145350)
                     /gene="LM30Cs1C1.2"
                     /locus_tag="LMJF_30_snoRNA0006"
                     /old_locus_tag="LMJF_30_snoRNA0018"
                     /db_xref="GeneID:12981415"
     ncRNA           complement(145246..145349)
                     /ncRNA_class="snoRNA"
                     /gene="LM30Cs1C1.2"
                     /locus_tag="LMJF_30_snoRNA0006"
                     /old_locus_tag="LMJF_30_snoRNA0018"
                     /transcript_id="XR_002460978.1"
                     /db_xref="GeneID:12981415"
     ncRNA           complement(145247..145350)
                     /ncRNA_class="snoRNA"
                     /gene="LM30Cs1C1.2"
                     /locus_tag="LMJF_30_snoRNA0006"
                     /old_locus_tag="LMJF_30_snoRNA0018"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460979.1"
                     /db_xref="GeneID:12981415"
     gene            complement(<146408..>147043)
                     /locus_tag="LMJF_30_0440"
                     /db_xref="GeneID:5653569"
     mRNA            complement(<146408..>147043)
                     /locus_tag="LMJF_30_0440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684582.1"
                     /db_xref="GeneID:5653569"
     CDS             complement(146408..147043)
                     /locus_tag="LMJF_30_0440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684634.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653569"
                     /db_xref="GOA:Q4Q7R4"
                     /db_xref="InterPro:IPR002661"
                     /db_xref="InterPro:IPR023584"
                     /db_xref="InterPro:IPR024946"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7R4"
                     /translation="MGKTRDQRESREQLAQEAQVMVSEDFPEELEAIYAKTSEKANIS
                     AMKVLNMAKCLELLEVEVAGGHTVLLVKVAQVVKTGTTTIEITPNSASFGNAILQRVS
                     RFDSALQVSKEGTKIRVVIPPITTARRDRTVAEVSNLISTFRQRVKQSRTKAVKVLQD
                     AGLDDGVQQELTALVDSTANAFVEEKAAELELLSEEVMSMGIDESDVAAGR"
     gene            complement(<148839..>149765)
                     /locus_tag="LMJF_30_0450"
                     /db_xref="GeneID:5653570"
     mRNA            complement(<148839..>149765)
                     /locus_tag="LMJF_30_0450"
                     /product="putative eukaryotic translation initiation
                     factor 4e"
                     /transcript_id="XM_001684583.1"
                     /db_xref="GeneID:5653570"
     CDS             complement(148839..149765)
                     /locus_tag="LMJF_30_0450"
                     /codon_start=1
                     /product="putative eukaryotic translation initiation
                     factor 4e"
                     /protein_id="XP_001684635.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653570"
                     /db_xref="GOA:Q4Q7R3"
                     /db_xref="InterPro:IPR001040"
                     /db_xref="InterPro:IPR023398"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7R3"
                     /translation="MNPNATEFMPGRRNGPDGGLEALPTSTADMELAKTPAGAAAAAV
                     HAPSLPGAVRRSLQNSPIIQPSRLSVKSASEIEAISKNSALNAAAAAYVPQRTLARVV
                     LTQPSPLALAPSEDPAKNNIEMMLDDLWCLFYLPTTLGENIKEEDYNPTLVFRVDSIL
                     TFWRVVNNIAAPSELQLSTLYLFRDGIDPKWEDPANRDGGIVKVKATAAQVDEAWELL
                     LCRTIGDSWSPSVRETVNGVVLKVRERAYWLELWVTKNSSALQKDLAELWHPILGASF
                     ATTYLTHAMMQERSHAAAALAAEKQKKNRRRY"
     gene            complement(<151775..>153427)
                     /locus_tag="LMJF_30_0460"
                     /db_xref="GeneID:5653571"
     mRNA            complement(<151775..>153427)
                     /locus_tag="LMJF_30_0460"
                     /product="putative aspartyl-tRNA synthetase"
                     /transcript_id="XM_001684584.1"
                     /db_xref="GeneID:5653571"
     CDS             complement(151775..153427)
                     /locus_tag="LMJF_30_0460"
                     /EC_number="6.1.1.12"
                     /codon_start=1
                     /product="putative aspartyl-tRNA synthetase"
                     /protein_id="XP_001684636.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653571"
                     /db_xref="GOA:Q4Q7R2"
                     /db_xref="InterPro:IPR002312"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR004523"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018150"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7R2"
                     /translation="MSANHADAGAPAVAKKMSDKEARKAARLAEEKARADEKAALVEK
                     YKAVFGAAPMVQSTTYKSRTHIPVSELSRPELVDKTVLIRARVSTTRKKGKMAFMVLR
                     DGSDSVQAMAAVEGDVPKEMIDFMGQIATESIVDVEATVCKVEQPITSTSHSDIELKV
                     KKIHTVTESLRTLPFTLEDASRKESAEGAKVNLDTRLNSRWMDLRTLASGAIFRLQSR
                     VCQYFRQFLIDKDFCEIHSPKIINAPSEGGANVFKLEYFNRFAYLAQSPQLYKQMVLQ
                     GDVPRVFEVGPVFRSENSNTHRHLTEFVGLDVEMRIDEHYYEVLDVAESLFNYIFERL
                     ATHTKELKNVCQQYPFEPLVWKLTPERIKELGVGVISEGVVPTDKFQARVHNMDSRML
                     RINYMHCIELLNTVLDEKMAPTDDINTTNEKLLGKLVKERYGTDFFISDRFPSSARPF
                     YTMECKDDVRFTNSYDMFIRGEEISSGAQRIHDPDLLLARAKMLNVDLTPIKEYVDSF
                     RLGAWPHGGFGIGLERVVMLYLGLSNVRLASLFPRDPQRTTP"
     gene            complement(<154328..>155977)
                     /locus_tag="LMJF_30_0470"
                     /db_xref="GeneID:5653572"
     mRNA            complement(<154328..>155977)
                     /locus_tag="LMJF_30_0470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684585.1"
                     /db_xref="GeneID:5653572"
     CDS             complement(154328..155977)
                     /locus_tag="LMJF_30_0470"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684637.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653572"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7R1"
                     /translation="MLSPQEVANTFVLYVPTYYVSFQCVASLLPDAIREEITGRGRLV
                     NLFKKFPFIFDVLVVDSGRINVRLHPDLIHPQRGVADDKYMMSDVGQTTSYVVKPEFI
                     VCAENIESNGMQRVLLTPPAPPPAMRVRLEERVPVLDRLRSLVPAEFTAIDALEESIS
                     EDILFHPYFNCQGGLFSIAGKMPEEFQVVDGRIRRRPPHLAPLALDEFTLDTSPLPEV
                     AALIKLHVCNSDIPHWVSITPLYEQLTRAQKQEIKRRYRSFAGFLRAHGRSLAVSTDM
                     LQVSMWIFVSSPSPPTSASANAASAGADDQAVTARDSSAATPSAASSSSSQQGVPSEP
                     PVSPAAAAGSSGATSAPPTPVVYTREQILNAWYDRFPPHKTLNLRDAMQLLPVEMRTS
                     GLPTKIAPWLATHPHYFSLDFAEEEDPTKVLIRRASERQPLDLVAALYAKIPDKDTPY
                     PSAEVLQKLDPSVRRVIEGIGLAQLGRVLPQWLLIEECRGGGGAVEGEPPQQEAFTMR
                     RLQDMEALEKAQRRDSKIVRKREVVKVDAGMAGLEESVTRT"
     gene            complement(<157059..>158468)
                     /locus_tag="LMJF_30_0480"
                     /db_xref="GeneID:5653573"
     mRNA            complement(<157059..>158468)
                     /locus_tag="LMJF_30_0480"
                     /product="putative bystin"
                     /transcript_id="XM_001684586.1"
                     /db_xref="GeneID:5653573"
     CDS             complement(157059..158468)
                     /locus_tag="LMJF_30_0480"
                     /codon_start=1
                     /product="putative bystin"
                     /protein_id="XP_001684638.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653573"
                     /db_xref="InterPro:IPR007955"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7R0"
                     /translation="MPGKEKAKRELHRSNPLGDDIHAERFASAKSASRHAADENDVDQ
                     AGYLIPNHTTKRILRTAKKQLEAIQGEVTAEKHTTAVCGEDYRDTGLQDLIDTEEMTT
                     EGREHRYEMEAAADDEDVVLEYDDNESIASEMPMDVPDVSSEMYGINEEEARLLNAFQ
                     PASRVQSRNLADMIMEKIREKEQGTRSGAAPSSSDNARVADEDSEDKIDNRVARVYTA
                     IGTVLKRYTSGKIPKAFKILPNVKNWEQLLMLTRPDQWSPHATYQATRIFAANLNESM
                     LQRFYAAVLLPIVHERLLEEKKLHPALYMAVRKALFKPVAFFKGFLLPLAMDEECTLR
                     EALVVASVLQRCHLPPVPTAVTIYKIAQQPFSGRCSVFLRVLIDKKMALPYQAIDELV
                     KYFHRFLETHTKEEALPVLWHQTLLSFIQHYKADLTEAQLGLLSNVCNVHFHYMITPE
                     IRREIAAALRMKQGAAPVS"
     gene            complement(<159391..>161541)
                     /locus_tag="LMJF_30_0490"
                     /db_xref="GeneID:5653574"
     mRNA            complement(<159391..>161541)
                     /locus_tag="LMJF_30_0490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684587.1"
                     /db_xref="GeneID:5653574"
     CDS             complement(159391..161541)
                     /locus_tag="LMJF_30_0490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684639.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653574"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7Q7"
                     /translation="MSGSTQRAEQQRRIQQLHERLELYNIADRHTDPTSNSAGGVGFA
                     SAGGLETGGGDKAPTTKPSRAAPMSGSPNLKPTSAPTSNAFFFTSSLPRRAADAGAPS
                     STLGLQQGNGSGSRATAAPSATEIAEVSRASPTPQQQPQVQMPPPAPAPQLARNLAQE
                     FFGSAASPTHASPTRAASRSSAMTSGAAASPVAPERPSVTAAYPESATEATAAATAAK
                     AGSPPLAANVFDYYEDFKSDGSEGDEYEVEEVEECMEDEEDYVGDGEDTDEHARGKAS
                     LTLEDVLRRLHRACSGSVDHAAAASPLEQAMAAASASSPLARDPSLATATPAAAAATR
                     VTLTAAAASPIGTTYPFLQQATEVYRQRHLYKATQEHQQHHSPFNTGYAWSTDEETSV
                     TDTSTSEPTEGLGDASESRSASVSSSASAASKGHLTAANAAAAVQNSGLLAAALQPLA
                     DTAIATPTASDRASAEKVLPSSALCFDQLETAYRRLLILQQGAKYVSELAGPECFPRP
                     LPRQEEARALAEQRDMVVKRDTEMRAAPPAGSSLEDLRQRESAAIERTLGLLREKFDA
                     AMKSLKPVADREAAIEGKRRTLKQRELDIAKQREARLIVEREVAAAEKRLMERSEQLR
                     KREEDYSARLQQHDHQQKAAQEQIGEVEQLSKQVSSWLAILEERDRRLARKEKRLQRV
                     QADLLKRTEDIIVWKRATQRIKQIPPPPSPPRIS"
     gene            complement(<162171..>162497)
                     /locus_tag="LMJF_30_0495"
                     /db_xref="GeneID:12981164"
     mRNA            complement(<162171..>162497)
                     /locus_tag="LMJF_30_0495"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722324.1"
                     /db_xref="GeneID:12981164"
     CDS             complement(162171..162497)
                     /locus_tag="LMJF_30_0495"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722372.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0495"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0495"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981164"
                     /db_xref="UniProtKB/TrEMBL:E9AEF1"
                     /translation="MARLRTITSIHLRILTENWVEKRLHSRVYPTSALPLPPQSDGAP
                     DQGARAVCALLRPHHRCCHTRKRAPDSLAHSCAAARAAQRQQRRRERVDGGQLLVGRC
                     YIYIYI"
     gene            complement(<164014..>165471)
                     /locus_tag="LMJF_30_0500"
                     /db_xref="GeneID:5653575"
     mRNA            complement(<164014..>165471)
                     /locus_tag="LMJF_30_0500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684588.1"
                     /db_xref="GeneID:5653575"
     CDS             complement(164014..165471)
                     /locus_tag="LMJF_30_0500"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684640.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653575"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7Q6"
                     /translation="MSFLRPTMSSLRRAVNGGKDEQHLHGDPSATAGVAQPLPAQPIF
                     HNAATADYSHVSSRVDTGLRSRVRTSSLTRRPAATAVPRSPSLREFSDRCDSVIQRAQ
                     EMLERTREQELKVTKALEERKSQSPARQATPPPQREMTPQRTPANMQAGLASPSSSPA
                     MLNAPYTTPVAPPRASSTLTTTSPTLPPLPAPPPTPAGLPHSPPPTQPDTDKGPSDPV
                     GRFSPPSLFQRLRQSWQRGSGLAWEAHATSPTPSSPDGALSVGIARVSPRKSVRFASP
                     DKLETVTPTKVVVLSSDDDDEDEEDEETSEDGEEEEQGQLPPTKKTRAESSGCRHTPH
                     RDSIVVPPAPPPSAVKPGSRSRSGSSNSLPSSRSPPPSRGTVSPPSSHREGTRSPSST
                     RATSPRQCSGSSGDGSRSGRSSTSSSRPPMNHDEVKEYVIQHTIRRSLSRISRANMED
                     YLREEGVTLPAEGHWLKRQLLAHIRALIKQELAPH"
     gene            complement(<167015..>170461)
                     /locus_tag="LMJF_30_0510"
                     /db_xref="GeneID:5653576"
     mRNA            complement(<167015..>170461)
                     /locus_tag="LMJF_30_0510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684589.1"
                     /db_xref="GeneID:5653576"
     CDS             complement(167015..170461)
                     /locus_tag="LMJF_30_0510"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684641.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653576"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7Q5"
                     /translation="MCASPSATVHVPTVYDSMHEQSRSIGTFASTELENVYSLSARMS
                     AARHATSPSSATRSLADFLDDIFFSYTGVPSWSTFLHIQQEGAALRRQLGDGATFAHE
                     AVHPSLSPVLKQWAQTLRSQRAARARAIGAGDSPRNPIVVSAAAPRGATSTGKPPFRS
                     ELSASVTAAAPAATLNYNATKSVAFMTAGTSDDLDSSSSLMERGLAAENARAHRPAEE
                     DGVLPLWKDLKPTKRCGPLALQGLRAAVGAYYLVLLRLVDITESLADHWGLLSPKELK
                     GLHRAMAAEKAAHVPPSFLFSVFTELNASGERLNNVVADFCKCTRLETVQLNGNAALT
                     ELSVLPPHCRVVTACGCSLDRFLEEARSTPPSPPSGAPRAVYASVTTLGLAYNCLRHL
                     HFLQQLPSLRVLNMSFNYVSDLEAAVRDVAAHGSLTEVTLQGNPISLLDAYRTVVVRG
                     CVHLDRLDGVTVTGEERALSCLTVDGGDAAQEDSPGRPLLDSALAGAERKPSCTALPD
                     ICGRRRLTVSASPASPSQQHSPSTRGCVTFGALPIPKSNSVVAMVDSQPPVPGEVLRT
                     TVAAGLDLVMVRGLASLQPAPQTCLADSLLPSSGFLLELAGVDTSAQASVPRGGCTSP
                     IQASSLVTSPLASPRTSSVQAGSRKGRHHGGAAGDSGGRGASADCNSTSGKRVVPPLY
                     EVSSRVTVEGCWGGSSVSSGDAPLGSADGVRVAVEVCLEPPAPLCTHSAGRHAGALGA
                     PPPRVSSAAQSRQRRTGGTAAAANGETPPLPIPDPYIPARCTAGAGGGGGASCVVSLP
                     VTDTLVCALQQPLVLRVMVQDTFRFAEGEAALRSQLDTSASSAARGNPVGRSGAAARS
                     VPGELPSNVALTSAFSLGGAPPWATSCQRGSEDAEEEEAVLLLRRELGVITLDPRNLF
                     MAADGNPATCTGAPCAPTPLPRCRVLYVHDAVLERDSHTLKSAEREVRQCQRRLREAL
                     ATYSDMHHQYKEASRKGLENPDSLSPAPSAALGKDSVATGTTSPQSNRRRTSVAVNSS
                     TVVLPLSSASSNKQSARSRPASVVAPPAHTSQLQGLYASLKAEQLRVAQRALRVLALR
                     TRLDELSGASLSVSVRFCVGRGAAPPPSTAADAELEALRHPTGSPKGRKGRQQAAKGT
                     RR"
     gene            complement(<171275..>173965)
                     /locus_tag="LMJF_30_0520"
                     /db_xref="GeneID:5653577"
     mRNA            complement(<171275..>173965)
                     /locus_tag="LMJF_30_0520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684590.1"
                     /db_xref="GeneID:5653577"
     CDS             complement(171275..173965)
                     /locus_tag="LMJF_30_0520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684642.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653577"
                     /db_xref="InterPro:IPR019183"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7Q4"
                     /translation="MDAERAAVRIFDLIDARQIGQAEGALETALQKFPDDDSLRAAEA
                     LIVMRNGNYRLAKAKAVALSERNITKPKAVNALVHVLQNCCCWDALAATYERLKPLQN
                     ERQISENLVQTYTRMGAYAKVQQAAMQLYRQHSDPKYQVWMVQAMLAQVPADNSDHIL
                     LKLSTKLLDAAVLTEKGHIVPSTVQTYVDVLAQQGQYATAVDFLLSERAAKIGLLATR
                     LEALARMLQKAGRVSAANAVARYLWSQESDNWASFTIYKDTLVLAADVDAGEGEGEAS
                     ALEILGPTPEMRTTVDCTMAHHSLEKAVQLARELQEQEESKHPNKHRRGPYLAELDLL
                     HSLQSTDMQARVIAYVERFYRKPSCYLDISTFLTPAIAASVYEWSRSCACAAPRDEID
                     VHTRRILGLRCLVGSWEETPAAGEPRALFCECVEAYQSSRHLSESLAWSEEGLCDGYV
                     TVALNIALRCYAAETTSPDYSYLVEGLDLMSIVDRRMNNPTWLIYAVCFANLLGLTER
                     AALHQLAFKNVQRDTMAHVGYWPLLTGLALEDVANWDCWAEDYYSLQERDCSLLRAKV
                     FNYTSWPAMQDVQRFEAAQTNSLYRWQCPANEFTSALLECQTQKDVKESLKARVEGLW
                     AAWERLSVAGAADTLIDNTDWVVAKSVVLGNIHSTTVQQLADSLVVVPSRDWQVRRSR
                     QLLSSIFLVHDLAAVSSHREAAAQASKSRKGKNARADSDSAAVPVLYSSRLGTPSASV
                     EYLPAVKPLAGVLRAYVGSLGEVAPEASSATAELRTYLKSLVADSEHSAGAFEAFLYP
                     QAHILSALLKMAPAAKLPVKQWVSDVRETLETAQHRYKSRSWSTLATTVGRTPVPSAC
                     AVESITLAPDSFTAKLEAEKVHRILGYVSSLKVEMGAYAR"
     gene            complement(<174877..>176190)
                     /locus_tag="LMJF_30_0530"
                     /db_xref="GeneID:5653578"
     mRNA            complement(<174877..>176190)
                     /locus_tag="LMJF_30_0530"
                     /product="putative glycosyltransferase family 28 protein"
                     /transcript_id="XM_001684591.1"
                     /db_xref="GeneID:5653578"
     CDS             complement(174877..176190)
                     /locus_tag="LMJF_30_0530"
                     /codon_start=1
                     /product="putative glycosyltransferase family 28 protein"
                     /protein_id="XP_001684643.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653578"
                     /db_xref="GOA:Q4Q7Q3"
                     /db_xref="InterPro:IPR007235"
                     /db_xref="InterPro:IPR013969"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7Q3"
                     /translation="MWFLIALLLGCAFLASLWHSVVRYVPLAIRSPHRCAMKIGVVLG
                     SGGHTSEMLRAITEIPLSYWLDTRPFYVVSATDPHSASLASQLEQQRFERRVVVYTIP
                     RAREVGQSYLMSIITTIRATLACFRFVCTEKPDVLLTNGPGVCVPVIAAAVCVASCAP
                     WWYGRPAIVYMESFTCVSHLSLTGSLLAPWLADVFTVHWRALERAVARRRRRGTLVYV
                     GSETARVTDGAPHRLRSLAAEQEAYALVTVGSTKFSSLVQAVVQPGVCATLHQRFGIK
                     RLYVQHGTAEVVAPPEATLLPALPMAAGADASHPTQQWSCGGLLVEAFPYRPCLDAVI
                     RGATLVITHAGAGTILEGLQAQRPLVVVPNRQLMSDHQLDLAEALANGGFLFCVQVAE
                     LAERLPLLDLTTLRPHGGMDAAQLQEALRLVLTGHSASGERAKAD"
     gene            complement(<176909..>177475)
                     /locus_tag="LMJF_30_0540"
                     /db_xref="GeneID:5653579"
     mRNA            complement(<176909..>177475)
                     /locus_tag="LMJF_30_0540"
                     /product="putative nuclear cap binding protein"
                     /transcript_id="XM_001684592.1"
                     /db_xref="GeneID:5653579"
     CDS             complement(176909..177475)
                     /locus_tag="LMJF_30_0540"
                     /codon_start=1
                     /product="putative nuclear cap binding protein"
                     /protein_id="XP_001684644.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653579"
                     /db_xref="GOA:Q4Q7Q2"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR027157"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7Q2"
                     /translation="MSSDLVDTVPRMEYVDRHELLRSLLTAEEFRERRQEQLNYSTTV
                     YVGNLSFYTTEEQVCNHFSPCGHIRDIVMGLNEATRCPCGFCFVVFESQAAAVLAVHG
                     LDGSLLDDRVVSVSWDVGCDGSRRWGRGAHGGQVVDGVRQNLDEGRGGLGALRRDALG
                     VPASTAEDELVAYDWVEASPKRRGAHTK"
     gene            complement(<178531..>180360)
                     /locus_tag="LMJF_30_0550"
                     /db_xref="GeneID:5653580"
     mRNA            complement(<178531..>180360)
                     /locus_tag="LMJF_30_0550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684593.1"
                     /db_xref="GeneID:5653580"
     CDS             complement(178531..180360)
                     /locus_tag="LMJF_30_0550"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684645.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653580"
                     /db_xref="GOA:Q4Q7Q1"
                     /db_xref="InterPro:IPR006876"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7Q1"
                     /translation="MSGGYIAVTVIFFVLALGVCLLTYHYYTKVSIKQIPLACAVWHV
                     IALYMCMLPFPLLVVDIDASLVAQSETSQKQDWMRPIWITIFAVTYFCAWVSLPLAQM
                     YTEVGEFTVKGRLLHSIKLNLILYAVIIVIVLAALGYFVVITNSYSSVANVMKVVISL
                     ANAWGLLILTLFMPAGLVGVPRMLWRYADAKRLLRRQLYEATDIQEDLDLAAMDLASI
                     KAELISIDPQVSEEDRPHLASMLEIISAADREIPMYHVAALRVKTVPSTERDDVSLLH
                     LETLNQRLKKAIKIANRANYRWNSTVRKCDSLDQIVRGVKGTNNRLKRMWFPIRQYVY
                     YTGCFVCSVLTIFILWSELTMPLRDWAGKPLGVIELVMKSSIHFIGSVVLLFYMAYCA
                     YWAAFQFKVHDVYVVYPSIADNASLCFNETFLVRLLMPLCFNFLLISGLSSTASETRV
                     DVAYGHVYRSNMDIGLLFGSYVNKLLPLMIPFIAATVFFQLTQQVLSVVGIEVHNPND
                     VENPAVRQRIMDGRKLVEAELGYQLISPFLPEEGTTEAKSPSPSPRAARPGRDGVDES
                     DTKRGQRYRDYLQKKHGSAAGGADGGSEMTNFRIAGTSREGEP"
     gene            complement(<182467..>183444)
                     /locus_tag="LMJF_30_0560"
                     /db_xref="GeneID:5653581"
     mRNA            complement(<182467..>183444)
                     /locus_tag="LMJF_30_0560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684594.1"
                     /db_xref="GeneID:5653581"
     CDS             complement(182467..183444)
                     /locus_tag="LMJF_30_0560"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684646.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653581"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7Q0"
                     /translation="MSGNKDIYTFQYGELKKGQTYALAMARVVDNFVHSSFHDSPNYE
                     RLLLSIFEHISKDPSMDDKMLQALENALMARQNAVLKEARDNDKDRKKFVFEKRTTGR
                     DPNEDSGSDAEEVTEEELAARKAAQEAEEKRKEQEWIKAQERYAALQLQKRENEERLR
                     AQARKVDIDAFQRQLQSRGAVLVDSGLPAKKKGGKGAAKVGQLSAEDAAKMREEVALI
                     VKEKERLDTALHTSDEELPAALEEARRSLAEYKQRAAAIGEPAAPTKEMSKGELTQLQ
                     QKLAKQTMDKNRRALQLKAMEPNPLRDELVSVLEQRDELAVTVERAENA"
     gene            complement(<184067..>185485)
                     /locus_tag="LMJF_30_0570"
                     /db_xref="GeneID:5653582"
     mRNA            complement(<184067..>185485)
                     /locus_tag="LMJF_30_0570"
                     /product="putative spliceosome-associated protein"
                     /transcript_id="XM_001684595.1"
                     /db_xref="GeneID:5653582"
     CDS             complement(184067..185485)
                     /locus_tag="LMJF_30_0570"
                     /codon_start=1
                     /product="putative spliceosome-associated protein"
                     /protein_id="XP_001684647.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653582"
                     /db_xref="GOA:Q4Q7P9"
                     /db_xref="InterPro:IPR006568"
                     /db_xref="InterPro:IPR007180"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7P9"
                     /translation="MAKSKKEKKAARREREAQLKKISQKIQEKILLAEVATAEGEVEE
                     IVYTLPPTPAELRAAEEEQERQKAAIAAEAEERAAAAAAEVVQAAAAASAEKDEEDRV
                     VLPSLDGGEGNAKGRRHSSVLSGRKHHRMTWEELKLRAAEMYGLEATELVDQHDGNAV
                     DPLFTVRMKMEPHTVPVPHHWHLQRTFLSRQADREEAVGIVPAEVAALGIEKIRATKD
                     KMANPNQVAFISCFMTGTPLQCKTYNVELSRCGDVFYEGKWRPKAHHTPGVLSKRLRQ
                     ALGIGPTAPPPWLYSMQTMRRLPPAYPDLRIPGLNAPIPAGGQWGLGQDQWGEPPRAE
                     DNSFLFPGVMDEAAAAGSTQAELRWGTVPPLVTSHEEAPSVAGASSSGAASPAPATAA
                     QALQRPTPAAGRPVITPVPFQPQAYVLQQAVPAARVTPQEYVQVQDNTTNSTVAVGYM
                     MMPKDGVQSQPPLSRYPRPQGS"
     gene            complement(<186899..>188338)
                     /locus_tag="LMJF_30_0580"
                     /db_xref="GeneID:5653583"
     mRNA            complement(<186899..>188338)
                     /locus_tag="LMJF_30_0580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684596.1"
                     /db_xref="GeneID:5653583"
     CDS             complement(186899..188338)
                     /locus_tag="LMJF_30_0580"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684648.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653583"
                     /db_xref="GOA:Q4Q7P8"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7P8"
                     /translation="MPAYSEVKGTCGTPVLDQLIGYYVNIQSRKMYYKDFLRIEHQAV
                     RWAFADIRKNSEALAHGLLQTGVRPGDRVLAIQPCNCETFVLQLSCAKIGALLCIVPQ
                     DTISADKLRFYLNEFQPRHLVAREWINVPEMKQGELVERNMHFWDTIYNVIPELGLSY
                     PGQKFQWVHSQEFYYLKKIIITDHNMNLLGVTPMRKMLVWGPFSYYEQRLRRLSALLH
                     PDDPVLALEDPNPAMEDKLHITYSHRNCVNAGFLFGQLMQLKAETRFGVMPNHHTDPI
                     GAIIAPYAALTSGAVLVHIHSDMFTDDHAINGIEKLCVEEVETLVGRKADFDLILKHA
                     GNFDADQFEHLRSVVIFEDGIEAPVSEEYLNKLSKALSLDDVYVFRGPIEASYMLTWR
                     TLKKGSQGMVPHVEAKVVGDRGTSDAKVLVAGTRGNLRLKGPHVTAGYYNNAGLMTEL
                     IDEHGFASTSREAMIDGKDNITLMSAQTY"
     gene            complement(<189642..>191606)
                     /locus_tag="LMJF_30_0590"
                     /db_xref="GeneID:5653584"
     mRNA            complement(<189642..>191606)
                     /locus_tag="LMJF_30_0590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684597.1"
                     /db_xref="GeneID:5653584"
     CDS             complement(189642..191606)
                     /locus_tag="LMJF_30_0590"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684649.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653584"
                     /db_xref="GOA:Q4Q7P7"
                     /db_xref="InterPro:IPR016616"
                     /db_xref="InterPro:IPR029333"
                     /db_xref="InterPro:IPR029429"
                     /db_xref="InterPro:IPR029430"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7P7"
                     /translation="MKPSSISGEAPPLAVVGGNCSVFGFDRFGAERYWTVTGDQVTAM
                     ALMPWTSVSDSGSAPLSLLVASDDFEVRVYDGEEAIATVHEVDRVQKLVPLWQPSRNL
                     DTETAAADSAGRYAYLLENGTVGMYERGERVWRVRGKSVPVSAAFCDVDGDGVAELVI
                     GWSNGRVEVRTDRGGGLEKGGSVLFRDTYSSAVAAVLSEDYRQDGVPLPVICTVDGTV
                     RGLTLLETRKDEAAEVRQLQVLEALVQEKQQLAAQLTSLEEQLARRAAGAQDTTMPES
                     GVEVRCCCSANLATKHVEVHVEVTGPAAKRGDIVVHSCLLQCEIWATAAEQDTIAFAN
                     AEPSTTLVCSFAHADDLPLNVSASVAVGPAFGDSYRIHEVTVRVPRFVMYQLPYTIPP
                     EQQRQRQGKTVTYQQPDGCVLLQWRELLRLDVIERWLRHSFCVPEDVALLDANAPTDP
                     VLHLELIHVRDGSSFGIEVRNAAASGAAFNTITLWSDHLAPCGAVIDAFVEDLKGGWA
                     DGRADPVAVRCEMPLELERLRAIFARVDEFNEVRMKLTTDMADAATVVKTLLGRAEDA
                     RLLGDMASMKKSYAVLYDVDQELLCENAKRINNYEELKLALKEVNTCIQQAGMVRIGP
                     ARAQLIASCRNALKENQVNSLLEIIRTGSE"
     gene            complement(<199530..>202316)
                     /locus_tag="LMJF_30_0600"
                     /db_xref="GeneID:5653585"
     mRNA            complement(<199530..>202316)
                     /locus_tag="LMJF_30_0600"
                     /product="putative protein kinase"
                     /transcript_id="XM_001684598.1"
                     /db_xref="GeneID:5653585"
     CDS             complement(199530..202316)
                     /locus_tag="LMJF_30_0600"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001684650.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653585"
                     /db_xref="GOA:Q4Q7P6"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7P6"
                     /translation="MHSRQNVGYARPGGVDIDLPTEGSIPISRGCTASRRIVRSLKNP
                     LACVMQLVPLDSGENSRPPHLLSRFNTASIPSEASVSEVRSELCSVAMEEQTEDSTSS
                     FFDHRRLRHGGKVSSSMSRSRASRVGHEIRARMRRSFPSGSSREVEESFPSYSDDPSF
                     YACDSDASSNSAETEGSSHSMSYTAISESVPSCSLTGLTENKYAATGWASRFRKPNVP
                     PPHRESNSFGSIFGSGGIDPYNGASVNAHHQARDSAAADVAVGIAAEPRIAAAVPQRD
                     PPVVVISPSASSARANTARTSHVAASTAAQSAPSASAARLCDGGLQFTDDNSSAGQGT
                     DRGSPLSNSLGQRPRVQSVKLLERVGRGTFGDVYRAQDLDSGNIIAVKEIIVPHDFTK
                     DVEKQLAALESEIRVMRRLHHPHVVTYLGAVRENNSLRIFMEFVGGGTVGSKLESVGG
                     LSEEKTRDYTAQLLEGLEYLHVSHILHRDLKGDNLFLTEDDQLKLGDFGQSKELADTL
                     ITRSVQGTPSFMSPEMIACSGYSFEADVWSVGCCVIQMLTGKPPFANLDNQMAVMFAI
                     ISSKIEDQIPACASEGAKDFIRMCTKTNIKDRWTASQLRRHPWLLGQGAPAAVTASAA
                     LTKAAGERKEGAGHKPIAAHPPLKTKEPAHPNPHPGKPPRSILLDATALRLRKGGDDM
                     TKDPSSSSPGGYQYSLEDETGDHEAGGTTSSNLSSPQSETLSSKNAVVTRHAGIPFSG
                     SSPLSEGASMESHHGSPMALPEALPGGGRLHRTRVSARRATPGQGDSLVMMGQEGSGG
                     SGARGRRKSPPEPAQRPQRPAQLHKERSPRQRALVAGSAAAVVSSSKRRSNPSPVPRA
                     LNTPVHNRTNLSTSPSKQRADLRPAGSSIYRVSSVANQSSSTTPNRTSSPGKKRQATA
                     ARATGHALKDDHKA"
     gene            complement(<207067..>208677)
                     /locus_tag="LMJF_30_0610"
                     /db_xref="GeneID:5653586"
     mRNA            complement(<207067..>208677)
                     /locus_tag="LMJF_30_0610"
                     /product="putative nitrate reductase"
                     /transcript_id="XM_001684599.1"
                     /db_xref="GeneID:5653586"
     CDS             complement(207067..208677)
                     /locus_tag="LMJF_30_0610"
                     /EC_number="1.7.1.1"
                     /codon_start=1
                     /product="putative nitrate reductase"
                     /protein_id="XP_001684651.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653586"
                     /db_xref="GOA:Q4Q7P5"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR001834"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR018506"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7P5"
                     /translation="MGSKHPRGSTSAPAHEEEQQAHVDTEHHTEPPSFTAGPEVAEMQ
                     VTVTPTMPPTSMEQASMTVSGEGPSTLAVPKQQHLRHKSFTMTEVQQLISVNPDRTLV
                     IIRDKVYDVTTFLASHPGGKSALRRNNGKDVTDAFFSMHSAMAVRKLPDFLIGELAPP
                     ESTSAAGEETPTAALVPARLRMADITKALSEDLNRIILILFSDAYDVTSMRDKHPGGL
                     SVLVNNNGRECGDTFMRIHGLLAKEMVKQFYLGPVEGLAQGRSPLRPAVAAEVESTAI
                     TPAGPKAQSTRILEIESVNSTVTIRYFTFSCPKPLYMIPGGHIKLYSNLHEKESRFYT
                     PFKTGVSSFTICMKHYPNGRTSGYLFDLKEGDEVFFDGPLPPSWQLNTDAAVQRAAPE
                     ERHVVLVGGGTGIAPLYSMSSNALETQFSSVTLVCSVRTPDDLILATELRQLANRYST
                     ALPIQKHTLRIVLLFSRASPQDISVESTSFASHVLCGGRLTAESFKGTEIHPAQAVVV
                     CGPPTFNDAVAAAVLEAGICTATQVHHL"
     gene            complement(<209737..>210474)
                     /locus_tag="LMJF_30_0620"
                     /db_xref="GeneID:5653587"
     mRNA            complement(<209737..>210474)
                     /locus_tag="LMJF_30_0620"
                     /product="putative ribosome biogenesis regulatory protein
                     (RRS1)"
                     /transcript_id="XM_001684600.1"
                     /db_xref="GeneID:5653587"
     CDS             complement(209737..210474)
                     /locus_tag="LMJF_30_0620"
                     /codon_start=1
                     /product="putative ribosome biogenesis regulatory protein
                     (RRS1)"
                     /protein_id="XP_001684652.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653587"
                     /db_xref="GOA:Q4Q7P4"
                     /db_xref="InterPro:IPR007023"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7P4"
                     /translation="MPQTRDYQSPYVPALAQCPPRFPYLKTDAMSEYQLDVGLLTVTD
                     VSTVSGPMRREEDLMSSCTNSLKALLGEFVDLPTEVKKTKYESAMTLVQLPQPVMQLP
                     REKAPPKPKPLTAWQKFALKKGIDIHRKKANRVFDEDRQVWKDKWGKRAREDRDKYDW
                     LREVKPGYMPAEDGGDPFLDDRRAKQARLEKQKKKEEHNKRRTEHLMQAQEEVKHLSA
                     AARNLATASNGKFEKTKKFKKNTKRLA"
     gene            complement(<211159..>212580)
                     /locus_tag="LMJF_30_0630"
                     /db_xref="GeneID:5653588"
     mRNA            complement(<211159..>212580)
                     /locus_tag="LMJF_30_0630"
                     /product="putative histidyl-tRNA synthetase"
                     /transcript_id="XM_001684601.1"
                     /db_xref="GeneID:5653588"
     CDS             complement(211159..212580)
                     /locus_tag="LMJF_30_0630"
                     /EC_number="6.1.1.21"
                     /codon_start=1
                     /product="putative histidyl-tRNA synthetase"
                     /protein_id="XP_001684653.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653588"
                     /db_xref="GOA:Q4Q7P3"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR004516"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR015807"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7P3"
                     /translation="MSSTASPNAALLAEINDLKVKLAEKEALLQPEGVVSKKSKKKSQ
                     ANMIEKEPVQGCRDFPPEDMRVRRHLFGVFHETARKFGFEEYDAPVLESEELYIRKAG
                     EEITDQMFNFVTKGGHRVTLRPEMTPSLVRLQLAKGRSLLLPAKWYSIPQCWRYEAIS
                     RGRRREHYQWNMDIVGVKSVAAEVELVCAACAAMESLGLTAQDVGVKVNSRKLLQCAL
                     AGAGVPDSLFAPVCVIVDKMEKLPEEQIRAELEDLALDGQQADDIIRTLSLRSVDDFD
                     KNLFDKNGALSELAEFFSQMQMYGYGDWIQFDASVVRGLAYYTGIVFEAFDRSGEFRA
                     IYGGGRYDNLFTLYGSPQPISCVGFGFGDCVIIELLKKKKLINSLPHKVDDVVIPFNE
                     SQRGTALKVLKQLRDKGRSADIIMDSKKVAQTFSYADRIGADRAVLIAPDETEKGMAR
                     VKMLREGQRGEDDRGDLVPFEDL"
     gene            complement(<214299..>214895)
                     /locus_tag="LMJF_30_0640"
                     /db_xref="GeneID:5653589"
     mRNA            complement(<214299..>214895)
                     /locus_tag="LMJF_30_0640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684602.1"
                     /db_xref="GeneID:5653589"
     CDS             complement(214299..214895)
                     /locus_tag="LMJF_30_0640"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684654.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653589"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7Q9"
                     /translation="MFRVCSVWCSNALHNSTPFVDGALQLMKLHLAHRNATADKNKVA
                     CHAIEQEFFREVEVFRPCFTMSASLEVAQQYSRRLYAALKYFRMDDDPLIRQLDLLLG
                     RRAMQEGRHEGRRSFFKGARTSNTSAFGKGGEITHETLAEHAETTLPSELPHAPKVDL
                     AAPRRPGALRINQRYRGHWVLQEPDIAITRSERREDPW"
     gene            complement(<215713..>216906)
                     /locus_tag="LMJF_30_0650"
                     /db_xref="GeneID:5653590"
     mRNA            complement(<215713..>216906)
                     /locus_tag="LMJF_30_0650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684603.1"
                     /db_xref="GeneID:5653590"
     CDS             complement(215713..216906)
                     /locus_tag="LMJF_30_0650"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684655.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653590"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7Q8"
                     /translation="MLRRTSRRLLGYTPINPDTSPMLMYSQCHWHYNLPQGMERPSSV
                     NRSLPAPYQPHHSSVNKYRGVWISTEMHPAFLVGLAPQLKKLPHGRVVPQTPVAEVID
                     EFNKLSPLIDDAAARDGWLAKIFQHCAFQRSGAEAMALWDKHCAPRFMRDDSASAPPL
                     PLVQAILFCCSKSDSAEWRPIFTKCLKDGWNYTPSFDTPQWSYLLKSLGRQGDEEGVR
                     LVLEEMADVQADLDRVEARSLVYALNAVHDKAIYNYVKKYLFYLGERKVKFLRITYAD
                     LRGHGAEKLRVPLKENDSMFYHVCWHASIRQPRQFSPRQLYFDYAPSQLATSGHSPNA
                     KVDGIVKDKIDKWKAEGLLPEDYVHEDRVYDRTAAFKSVARQEKWKKVPRIVKSKRFG
                     YSGEP"
     gene            complement(<218931..>221123)
                     /locus_tag="LMJF_30_0660"
                     /db_xref="GeneID:5653591"
     mRNA            complement(<218931..>221123)
                     /locus_tag="LMJF_30_0660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684604.1"
                     /db_xref="GeneID:5653591"
     CDS             complement(218931..221123)
                     /locus_tag="LMJF_30_0660"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684656.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653591"
                     /db_xref="GOA:Q4Q7P2"
                     /db_xref="InterPro:IPR000909"
                     /db_xref="InterPro:IPR001478"
                     /db_xref="InterPro:IPR017946"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7P2"
                     /translation="MGCLNSKSTAEKTGTSSPKRFGYHPQSNKHHNEEKGVVSKYSAV
                     KGWAGSLDNDERTEEVGSDANKAAKASAERFLRSIVEGAELFFSGLPDSQVVKQLIAL
                     TFTNSCAEVTRTKFRLKLDLITVLLTSLARQLKLPLIEASVPQVEERAMDDGFSRILL
                     AWFSNNPSFGKTIPVTAGQAVLNTLYIRYVVNKSVSFEDILAYQFRWVSANDAATEVF
                     NKFTDGKESMTSEQLGKFLRDVQRSDVTDRQIVEKFKYCFGGGIHKYNFISYNGSVLT
                     NNAIDPARTSDVWQDMTQSFTHYMVSCARIEAEEDLKRAAADGTRALVLNINKASNGK
                     LMVGSCELQTILEGVKKNGFATNTYPIVLCLSPGTPMPTPVQDEVAKMINDILESAVA
                     EGLMFEGAMINDPKFSPGALRNKVLVMSHQSRLKPFIGFLVADMNKDGLGVRVTDVME
                     GTPASKGGVLKDDWLTHINGIPIQNKQHLRETLARLKAGDEFTVRRENLHDVKVVVGG
                     AIDPQDTTASASLSSITFFKYSDSNDPKPWDTERIPASSLATTKLTRKDLLTHFAFCT
                     VNSAEASTELPDAEGKAASLGIQFVDVDNSERCLPWTRGRFSDNGRCGYILKTDIDSA
                     KSPELSLSVIGGPRLLNCSPLTSMNVTIHGAGTARVNGSQVSFTDCNQATIAVVQMTF
                     EANGAERTFTSAFCPGLLRPGYRALPSVPFGEERASKKQIHGIYCFIK"
     gene            complement(<221781..>221981)
                     /locus_tag="LMJF_30_0670"
                     /db_xref="GeneID:5653592"
     mRNA            complement(<221781..>221981)
                     /locus_tag="LMJF_30_0670"
                     /product="putative 40S ribosomal protein S30"
                     /transcript_id="XM_001684605.1"
                     /db_xref="GeneID:5653592"
     CDS             complement(221781..221981)
                     /locus_tag="LMJF_30_0670"
                     /codon_start=1
                     /product="putative 40S ribosomal protein S30"
                     /protein_id="XP_001684657.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0670"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0680"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653592"
                     /db_xref="GOA:Q4Q7P0"
                     /db_xref="InterPro:IPR006846"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7P0"
                     /translation="MGKIHGSLARAGKVKNQTPKVAKQEKPKQPRGRALKRLKYTRRF
                     LSKTVKPGEKVHMNKQPPGKAG"
     gene            complement(<222616..>222816)
                     /locus_tag="LMJF_30_0680"
                     /db_xref="GeneID:5653593"
     mRNA            complement(<222616..>222816)
                     /locus_tag="LMJF_30_0680"
                     /product="putative 40S ribosomal protein S30"
                     /transcript_id="XM_001684606.1"
                     /db_xref="GeneID:5653593"
     CDS             complement(222616..222816)
                     /locus_tag="LMJF_30_0680"
                     /codon_start=1
                     /product="putative 40S ribosomal protein S30"
                     /protein_id="XP_001684658.1"
                     /db_xref="GeneID:5653593"
                     /db_xref="GOA:Q4Q7P0"
                     /db_xref="InterPro:IPR006846"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7P0"
                     /translation="MGKIHGSLARAGKVKNQTPKVAKQEKPKQPRGRALKRLKYTRRF
                     LSKTVKPGEKVHMNKQPPGKAG"
     gene            complement(<223270..>223470)
                     /locus_tag="LMJF_30_0690"
                     /db_xref="GeneID:5653594"
     mRNA            complement(<223270..>223470)
                     /locus_tag="LMJF_30_0690"
                     /product="putative 40S ribosomal protein S30"
                     /transcript_id="XM_001684607.1"
                     /db_xref="GeneID:5653594"
     CDS             complement(223270..223470)
                     /locus_tag="LMJF_30_0690"
                     /codon_start=1
                     /product="putative 40S ribosomal protein S30"
                     /protein_id="XP_001684659.1"
                     /db_xref="GeneID:5653594"
                     /db_xref="GOA:Q4Q7P0"
                     /db_xref="InterPro:IPR006846"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7P0"
                     /translation="MGKIHGSLARAGKVKNQTPKVAKQEKPKQPRGRALKRLKYTRRF
                     LSKTVKPGEKVHMNKQPPGKAG"
     gene            complement(<223790..>224275)
                     /locus_tag="LMJF_30_0700"
                     /db_xref="GeneID:5653595"
     mRNA            complement(<223790..>224275)
                     /locus_tag="LMJF_30_0700"
                     /product="putative nuclear movement protein"
                     /transcript_id="XM_001684608.1"
                     /db_xref="GeneID:5653595"
     CDS             complement(223790..224275)
                     /locus_tag="LMJF_30_0700"
                     /codon_start=1
                     /product="putative nuclear movement protein"
                     /protein_id="XP_001684660.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653595"
                     /db_xref="InterPro:IPR007052"
                     /db_xref="InterPro:IPR008978"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7N8"
                     /translation="MSLVASQEGLTDLVPCNDQCGGDYTLYTFGQSEKEVTITAPLAP
                     GTRGKSLRVDIKVRHLQIEVPGKGTILAGELYKPINVDDSTWCIQDGKELVVVLTKTN
                     IEYEEWWPHVVIGERQIDLKTLKPPSIRFSDLDGGAQATVAKMMHEQHEKRTDPAFTN
                     A"
     gene            complement(<224695..>225492)
                     /locus_tag="LMJF_30_0705"
                     /db_xref="GeneID:5653596"
     mRNA            complement(<224695..>225492)
                     /locus_tag="LMJF_30_0705"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684609.1"
                     /db_xref="GeneID:5653596"
     CDS             complement(224695..225492)
                     /locus_tag="LMJF_30_0705"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684661.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0705"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0705"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653596"
                     /db_xref="GOA:Q4Q7N7"
                     /db_xref="InterPro:IPR011234"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7N7"
                     /translation="MRHSLRFLSATRAHLADYIDYLRQVDKELPSLHDIFPKSNAVED
                     VVKFHGSLCAAMEENAYPLIGFKVLPPEHEAITTLRGTQPVCFPIFSNLFQRKSVSVK
                     QDRLQYIETAICLEVKHLEDCSTVDEASLNTGAFSPSLEVSGSRFPFYAPTLTAMACD
                     LDGCVSITKGCDISMDSIKRETLKTTRFVLTHNQEPIQTGSAKLCMETPFTAVVTAAA
                     YAKAIKAPTKKSLFVFCGGVSPRTPIQVGTYAFEWGRFGRLRYSVLP"
     gene            complement(<226963..>228603)
                     /locus_tag="LMJF_30_0710"
                     /db_xref="GeneID:5653597"
     mRNA            complement(<226963..>228603)
                     /locus_tag="LMJF_30_0710"
                     /product="putative CDC16"
                     /transcript_id="XM_001684610.1"
                     /db_xref="GeneID:5653597"
     CDS             complement(226963..228603)
                     /locus_tag="LMJF_30_0710"
                     /codon_start=1
                     /product="putative CDC16"
                     /protein_id="XP_001684662.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653597"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7N6"
                     /translation="MDAIHILKENALRLVSAGQPISALHLVEVLCELQPDSDENRSLK
                     IRCLYELREFDSVLKLAKQVTFACDQNSEVFLLAVKAAFELGDLKTCVQYAMTLINAD
                     SSKVVAMCFVAKAAELSGDPAKAVRFYKMALEADPFCGEAFSALTERHLLDRWEMLKL
                     IDSLCIPAEVEVYRSTLKARIGSDYLTPGISGVPRTLVLLAGAKKEYESNNLRQALSL
                     TTEILEVEPYHRQTLCLHLCILVDSKATPLLFEKAHFLSKNKCYTELAVYAIGCFYYS
                     LSNYERAGRYFSRASELDCYFAEAWVAYGHCYAKLEEGEQALNVYRRTMNFFPGLNAC
                     CTYVGMQYSRVNQRSVARCFFEESLRKNSIDPLVLNELGVLALAEDNPKQALELFQKA
                     YDSLPNRENPSEHSDCILFNLATMYRKLGRYEAAIDYYNQYVRSRPNASHGHCALGFT
                     YHLSGNIKAAISCYHTAESIKPDSFCRDLLRRALELDFGACGRLSWDSERPHLSFSPG
                     EVSFSTVSRRFRSESTAADSVAASPPPRVGRSLDFQHQ"
     gene            <233649..>234341
                     /locus_tag="LMJF_30_0720"
                     /db_xref="GeneID:5653598"
     mRNA            <233649..>234341
                     /locus_tag="LMJF_30_0720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684611.2"
                     /db_xref="GeneID:5653598"
     CDS             233649..234341
                     /locus_tag="LMJF_30_0720"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684663.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653598"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7N5"
                     /translation="MFDVANDEDAKSICFERYGFVQKPLFLETWQEFLRELQRVELAW
                     RLMPSAGGTLQLKIHDHLEPGDGLLCELKGAANRSAPLAEFFEACGSVSQGAMSKAEI
                     EFFDGESCSVLLIESKKRLGEIPFKDNPPILPLLCQFNCRGTSVSLSVLDKKTLVRTP
                     LFSDISIQTLNYAFMTSLPLFLKRTDLGIRNADFVTKDQMRHFRYAWCFLRKESWMTP
                     VEMGELDALLPP"
     gene            <234725..>235381
                     /locus_tag="LMJF_30_0730"
                     /db_xref="GeneID:5653599"
     mRNA            <234725..>235381
                     /locus_tag="LMJF_30_0730"
                     /product="putative co-chaperone GrpE"
                     /transcript_id="XM_001684612.1"
                     /db_xref="GeneID:5653599"
     CDS             234725..235381
                     /locus_tag="LMJF_30_0730"
                     /codon_start=1
                     /product="putative co-chaperone GrpE"
                     /protein_id="XP_001684664.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653599"
                     /db_xref="GOA:Q4Q7N4"
                     /db_xref="InterPro:IPR000740"
                     /db_xref="InterPro:IPR009012"
                     /db_xref="InterPro:IPR013805"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7N4"
                     /translation="MKALSLRRGLVARASAVAYTSQCWCSTDAKSEKRAEEKEAPSTG
                     TEEVVSAAAVKQLEKELDASKAKIEELKKEILYRAADAENARRIGREDVEKAKFYGIS
                     SFGKDMLEVADTLEKGVEAFSAFSEAELNENKILCSIFTGVKLSHKVLLKNLSKHGIE
                     KMGVTVGTKFDPNLHDALVSTSATETAPADTISNVLKDGYTLKSRVLRAAQVSVSQHP
                     "
     gene            <236046..>236816
                     /locus_tag="LMJF_30_0735"
                     /db_xref="GeneID:5653600"
     mRNA            <236046..>236816
                     /locus_tag="LMJF_30_0735"
                     /product="putative co-chaperone, GrpE"
                     /transcript_id="XM_001684613.1"
                     /db_xref="GeneID:5653600"
     CDS             236046..236816
                     /locus_tag="LMJF_30_0735"
                     /codon_start=1
                     /product="putative co-chaperone, GrpE"
                     /protein_id="XP_001684665.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0735"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0735"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653600"
                     /db_xref="GOA:Q4Q7N3"
                     /db_xref="InterPro:IPR000740"
                     /db_xref="InterPro:IPR009012"
                     /db_xref="InterPro:IPR013805"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7N3"
                     /translation="MGARFDHRVLIHDILVQYSLASICTPTSTSLVCGFLFFFASEHT
                     PKDLHERMHRQVSAHVAPLLCSHRVAQRKCCTEENTAGLSVAELKGKYEALRAELCDS
                     KRQIQQLRSENLYAAASCENIRKATQEQSKQAHNDAVRSFARDMLDVCDALQVVTNKV
                     VKYTQRNSSIPKSEAAVLAGVMLTEEVALKVLKRYGVTQMHTEVGATFDKEKEEKLFT
                     APSTPSLKEGSVAEIFKNGYDMNGSVLRRAQVGLSEDP"
     gene            <237113..>237628
                     /locus_tag="LMJF_30_0740"
                     /db_xref="GeneID:5653601"
     mRNA            <237113..>237628
                     /locus_tag="LMJF_30_0740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684614.1"
                     /db_xref="GeneID:5653601"
     CDS             237113..237628
                     /locus_tag="LMJF_30_0740"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684666.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653601"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7N2"
                     /translation="MLRRCASAVAPAAHIPSPAAAVSGVQKRFLKIAKSTFGFYLARR
                     GQRKFPFHRRPHIKNTQAMNLNAPYFWSYMTAKSQSFFLPEENYITGDWTGKFFVSKR
                     QVYTLQHATSGGKVRVKSFPSVFELNSPSRWNVGKEMNTLTKPRMDLIDDQMLTKKQR
                     LDYVKAGLLPK"
     gene            <237925..>238764
                     /locus_tag="LMJF_30_0745"
                     /db_xref="GeneID:5653602"
     mRNA            <237925..>238764
                     /locus_tag="LMJF_30_0745"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684615.1"
                     /db_xref="GeneID:5653602"
     CDS             237925..238764
                     /locus_tag="LMJF_30_0745"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684667.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0745"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0745"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653602"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7N1"
                     /translation="MLLRRVRKCSSQARWVRWDGIKAPSVLNHAADHSDPLNAVFDEI
                     ENCDTSVHAEKRESPKMAESSGMPTSSFNTVPSVSDTKVRLEEAKHKRLRRQLRDATE
                     ELDALLNESSRTTAAVSSAKYVPAKAAKTFLSSAELVQEKSPQEFVALEDSKAELDRL
                     PVLRHSGCSAVVTLVGVVTEPPTSVSVALPGVSEATNCVEFAVRYDVPFFQMQTSMGI
                     VIRTVGASLSAFAKESVGVGDVVHLLGHLVPLTEPNGKGHLCCVYVLPAGGNMSVVLK
                     ATP"
     gene            <239105..>239695
                     /locus_tag="LMJF_30_0750"
                     /db_xref="GeneID:5653603"
     mRNA            <239105..>239695
                     /locus_tag="LMJF_30_0750"
                     /product="putative 4-methyl-5(beta-hydroxyethyl)-thiazole
                     monophosphate synthesis protein"
                     /transcript_id="XM_001684616.1"
                     /db_xref="GeneID:5653603"
     CDS             239105..239695
                     /locus_tag="LMJF_30_0750"
                     /codon_start=1
                     /product="putative 4-methyl-5(beta-hydroxyethyl)-thiazole
                     monophosphate synthesis protein"
                     /protein_id="XP_001684668.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653603"
                     /db_xref="InterPro:IPR002818"
                     /db_xref="InterPro:IPR006287"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7N0"
                     /translation="MHVLVVAADHSEDIELISITDVLSRAAIKVTLASVMESKSITLA
                     HGVNVMCDALIGEVSGVEYDAVLLPGGMPGAVHLGNSEALKKILQNARAGKKLYGGIC
                     AAPAVALAPMGLLEGVDTVTCYPGFEDKLPSSVKHSTKAVVKSENCLTSRGPGTAIYF
                     ALAVVSILKSPDLAERLAKAMLVDHSNEMNDVRAIK"
     gene            <240792..>243965
                     /locus_tag="LMJF_30_0760"
                     /db_xref="GeneID:5653604"
     mRNA            <240792..>243965
                     /locus_tag="LMJF_30_0760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684617.1"
                     /db_xref="GeneID:5653604"
     CDS             240792..243965
                     /locus_tag="LMJF_30_0760"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684669.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653604"
                     /db_xref="InterPro:IPR000225"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7M9"
                     /translation="MVENVVRIARQHANWPEFSRWVCALIHHYCTDDFTVSLFSEFEV
                     PKVAADALRNNPHDSRSVLAAATLLSHFNLYDIGDGITQLTNALQNHCSDATIVRIVT
                     RTLAEFTSYYKELPDRFPRVSQEFVDAKGITVLEGVLHEHIKNEEITTYVARIAANVT
                     SSGAANMVDADSPVVMYLADALARYQQSEMLCGHVLRVFSNLPRSRYIDWDCVLSLFN
                     NTKSELVVFECIHFLCSVAINVKEMKAKIYTTGCVPRVLEMMRVYQGNAAIQEEVCSL
                     LSYLSFDSETITTSITESGGLLLVLNAMRKFPDNEDLLMSACAALSGLTFNNQTGQQV
                     IVDNGGVALILDSMRRGKKARLQENGCLAIGTMCWNSDLKADVVRLGGVQVIMKALEE
                     HYTSSGLVKNACRALAQVAFNSECYRDEMSAKGVITFIIRGMAQHPNYDRAQMHGCVA
                     LSYLSWTNEDNAAQITANHGYKVVVDAMRNHPSNHEVQEHACRALANISNVSLTDSLA
                     ALEQIVAAMRRHENISEVQEEACRAIVTLSLVSPSNKDRLYQLFGADAVIAAMKRFPQ
                     IQLVQQEACNALAHLAYEHTDLNRAVTRLGGVSLLLAAMRTHKSSPKVQLNACGGLSA
                     LAFDNTVAQQQIFELGGVQCVTHAMDNFERLRMLELGCSVLGTLAWNTEIKERVAVDA
                     IPEILKAMRTHSNNALLQKSTCRAISQFAFNSESNRQLLADYGAIPLIVNAMRAHLTT
                     EKLTVHALKALTYLCWENTQVAETIINERIEEVLQRIIEHYEQTHRVYNEAVHLSKIL
                     FRKTTGSPSPNLRIVSPPIVSPMPIQQTPWLRYENPAPPSPPPQENPEDHFYSAPLDR
                     PQETPYHDYVHRRDAPADDDRGGSRSGRGGGRGRGGSRRRGGPPTRGGGGERVGERGS
                     DRGGRRGGSGGDVAVAGGNEGRGRGGGGHHEDAMEKMLDARFGRRPNYRGRDEGRSAP
                     RDATDLWDDPDPDSFHGNRHLGQMNWQQAELTASLNADIGIYDTLEPARRGGAMDHNL
                     QRGGRGGLRRYSGYRGRGRGRGAPASQ"
     gene            <245005..>245379
                     /locus_tag="LMJF_30_0770"
                     /db_xref="GeneID:5653605"
     mRNA            <245005..>245379
                     /locus_tag="LMJF_30_0770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684618.1"
                     /db_xref="GeneID:5653605"
     CDS             245005..245379
                     /locus_tag="LMJF_30_0770"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684670.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653605"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7M8"
                     /translation="MDAPEWTKDAQSIQGAKDYVRQASIVDFYEMICRNIFTHHPANL
                     TEFCLRIVKDIMNGTEITSAADFQPKRIDDNKYMRDMAMCSFLDGWILELLRERPGTH
                     LERMEFHKRYLEGLQSESDTGK"
     gene            <246139..>248109
                     /locus_tag="LMJF_30_0780"
                     /db_xref="GeneID:5653606"
     mRNA            <246139..>248109
                     /locus_tag="LMJF_30_0780"
                     /product="putative mitochondrial oligo_U binding protein
                     TBRGG1"
                     /transcript_id="XM_001684619.1"
                     /db_xref="GeneID:5653606"
     CDS             246139..248109
                     /locus_tag="LMJF_30_0780"
                     /codon_start=1
                     /product="putative mitochondrial oligo_U binding protein
                     TBRGG1"
                     /protein_id="XP_001684671.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653606"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7M7"
                     /translation="MLQRCATLTGAPLRARGYSTVLGACAVLHQRGGYEGRGGGPRFG
                     YGDGGPPPGQQHYQQQGGGYGNRDDVSRNRGGSDRGYENRNQSYENHQQRYVDRPQRR
                     DNDQQGYINRRQNYDDRNQGYDDRQSAPRRGKEQYLTQDADRLLRMKHDYKKAKDTKE
                     RFGITKEARRLLRRTRIDPSTQDERSVAIVINCAATFSVPAKMEAVEQAFQWMRSNIG
                     GVSPQNVALFANALGLISPPEAKQVMISEVMPAVQSVMREMAPVEVVMVLQALQRLGV
                     EENEKLQDDLLSHLEPCVSSMPVQQLSTLASVLHHHSMQTRDNAKWKQIAHETLARAL
                     AGVDGIHSREAIVLLCAAPFLDASQKQIGQLLARVTETVQFHTDDQVGELMSAILHIR
                     QQVSEPSVELTAAVEELHRALMARLEKVSAFVGARSATRIWNYAHASNVELPSAIQET
                     MCAALIQLMTFRTIPFRALARLMASLSTQKLPSAEILTVVANCSVGVRPPRPAKAISP
                     QESEMPEDGTDHESIRAAACEALYSRHFGTLTELRISLENAFAKNDVPPNDALAKTLP
                     EHLLKHAAEASPRQMLTAVVAIALAPADCPYRNKTHDMAVRAAVLKALEDNPNKFKPD
                     LSPELVDWFVSSIPADSDSAEIVAAVQKATAP"
     gene            <249297..>250568
                     /locus_tag="LMJF_30_0790"
                     /db_xref="GeneID:5653607"
     mRNA            <249297..>250568
                     /locus_tag="LMJF_30_0790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684620.1"
                     /db_xref="GeneID:5653607"
     CDS             249297..250568
                     /locus_tag="LMJF_30_0790"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684672.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653607"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7M6"
                     /translation="MSGFWSFRECGSGSAAAANSASGLQQLDLAVTQVLPVGMEFKRA
                     TLSTAQEGAHTRFGRKVAPHVEAAEWTGGTDCGPAKKLARQAVLSSSQSMSVEANDAA
                     VKEGWVNAYLVDREEVMDAVQRSWWETLDVDVRPGLPLSSVCIAPAKVDTPDAETLEL
                     VREFLYRASGNVPGRETARSRDSAFLRCEVRLSERKEQRTCLDRSPASEVQMKSRKNA
                     KHTDSRSFRSTVPRGPSLHTERLARLREQSTSTAALQLSEGEMSKSKAGSCYSQDHGG
                     VAKDTTVVSHVSSRPEGQGSSEHEANFGTGTVAPLETQSESFSPSAVLQDVLRTHSRR
                     VSLSSTAATRMEVIRRREELLLLRRYFALWLSAAEQRHIKQCAASYHCFLMRCINDTI
                     EHTTPQVKEEESICAYRHCVSGLAKRQGKRA"
     gene            <252591..>254123
                     /locus_tag="LMJF_30_0800"
                     /db_xref="GeneID:5653608"
     mRNA            <252591..>254123
                     /locus_tag="LMJF_30_0800"
                     /product="putative serine-threonine kinase"
                     /transcript_id="XM_001684621.1"
                     /db_xref="GeneID:5653608"
     CDS             252591..254123
                     /locus_tag="LMJF_30_0800"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative serine-threonine kinase"
                     /protein_id="XP_001684673.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653608"
                     /db_xref="GOA:Q4Q7M5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7M5"
                     /translation="MSGYLKVLSPDGRWETRYIEIDDAKLRIWRTKGDKESSAAVVKE
                     LDLKCATLREVSEPNTWAVQPEKAEATYFQADGEERKTEWMDTLRHYNSSSSGSEKVT
                     LRDFEKKFVLGKGSYGKVFMVVKKDTDKWYAMKEMSAEKMRQAEIKAPFAERIILEEI
                     DHPFIVHLHYSFQEQGNLYMILDLLAGGELFTYIEQHAPLDEEVVKFYAAEVALALGY
                     LHSRNIIYRDLKPENVVFDRDGHACLTDFGLAKANVHEPNAVTYCGTNEYLAPELLKG
                     VPHGKAVDWWSLGLMMCEMLFNDLPFYDENPMQMQMKILTEDVAFPPHIQITEETKDL
                     IRCLLNKNPERRLQTLEAFKAHKCFSNLDFCLLEARKLKAPITPDPNPAHNFAKEFTS
                     EVIVQNESPSQAVVTLAGYTYDRDLSEQEKSPSHSPTIAEELRQRRASKKRPTNGSDA
                     ASPPVTGENRTSNSSPAGVPMKQAAPGPVKKVEHHIPAKVAPQAARKKLTGNKSFDKP
                     TK"
     gene            <257822..>258418
                     /locus_tag="LMJF_30_0805"
                     /db_xref="GeneID:5653609"
     mRNA            <257822..>258418
                     /locus_tag="LMJF_30_0805"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684622.1"
                     /db_xref="GeneID:5653609"
     CDS             257822..258418
                     /locus_tag="LMJF_30_0805"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684674.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0805"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0805"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653609"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7M4"
                     /translation="MKLFSYQNRLCSTLVLALCLLSCALAASSTPAPTDFITVAGRVH
                     VRNEVAQYVVVRVVDDKTGVVVRSAPLDATRSVSFANIASSAVSLEATVELPDHLFEL
                     DASSSVLKSAVSTLSSTIPVQLTISTISRAEGAARKAPTPTAGSSGASAVLALMALVA
                     GWYSRHKIVSVLDMPSLRLPKPRKVMCSFASSKRASIR"
     gene            <259021..>259770
                     /locus_tag="LMJF_30_0808"
                     /db_xref="GeneID:5653610"
     mRNA            <259021..>259770
                     /locus_tag="LMJF_30_0808"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684623.1"
                     /db_xref="GeneID:5653610"
     CDS             259021..259770
                     /locus_tag="LMJF_30_0808"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684675.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0808"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0808"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653610"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7M3"
                     /translation="MNSHNRNIAIVSSAAYGAVLCCGMIFFLLDTREKPFYMHPSKSV
                     AVFSVFWFSFAPSILFTGATIPWLCAACGSEVAVLVFAIVPGCIFVLLGVVWLVVYFF
                     HERNSYFVGVQHNALWGGNMANLEAAIGGSAARRYLYTAADPAMVDGAKAFRVADGAL
                     PHPYGAWTASVNAFGFEDVDTAITPASQWRGYTASHENNIPRGAGGRAADCASSASWY
                     RGPLVLPTHSVGQLGPPYLVQERSLGTHYVA"
     gene            <261041..>261793
                     /locus_tag="LMJF_30_0810"
                     /db_xref="GeneID:5653611"
     mRNA            <261041..>261793
                     /locus_tag="LMJF_30_0810"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684624.1"
                     /db_xref="GeneID:5653611"
     CDS             261041..261793
                     /locus_tag="LMJF_30_0810"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684676.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653611"
                     /db_xref="GOA:Q4Q7M2"
                     /db_xref="InterPro:IPR008576"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="PDB:1XTP"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7M2"
                     /translation="MPSKEASSRNLPISGRDTNGKTYRSTDEMWKAELTGDLYDPEKG
                     WYGKALEYWRTVPATVSGVLGGMDHVHDVDIEGSRNFIASLPGHGTSRALDCGAGIGR
                     ITKNLLTKLYATTDLLEPVKHMLEEAKRELAGMPVGKFILASMETATLPPNTYDLIVI
                     QWTAIYLTDADFVKFFKHCQQALTPNGYIFFKENCSTGDRFLVDKEDSSLTRSDIHYK
                     RLFNESGVRVVKEAFQEEWPTDLFPLKMYALK"
     gene            <262766..>265066
                     /locus_tag="LMJF_30_0820"
                     /db_xref="GeneID:5653612"
     mRNA            <262766..>265066
                     /locus_tag="LMJF_30_0820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684625.1"
                     /db_xref="GeneID:5653612"
     CDS             262766..265066
                     /locus_tag="LMJF_30_0820"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684677.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653612"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7M1"
                     /translation="MSAVSTRPSPYGDRLGGAVMDENSDAERQLCSMVDTIIATSTRA
                     LQKASSDVNSTDAAFVKAASLFQANGILISHGEPGENTSNAASPAAVESDLRTQLENC
                     RNLLRTVDCERRRLRSQCIYLQKEHELRRAEIQSMHRYSTESHQRSLTLERQAAEERQ
                     HRRRLQNEVDAQTQEVMRLRRVLRALPDNVLGSLSPRHPADGAAADLVLTLAPDRRFE
                     EAFRDKMNSIVYKRRYYQASAMHQATREQVEMMLMEQQDPLQIAARWPYVGEGVSTVG
                     ATSTESVVRREWQSCGGGASSTFESPPQGIGESQPADTINATEAAKLANSALMHSALE
                     FPFQLPFTTTTPKDAYIKSLMYHSAYAEPLTQLREHVLRLSSRLKTAQDAGLRALYIT
                     FTQVLHLLGSAPARAQWRSLYEREIEKMQRAHRDMLYAVIEQANMTATRIPELERAGG
                     AATVRRELAGGAPQRQDVGCSAHESTTMEKYRASQLKEQLDHLKLHSLEVEAAAQKEK
                     EEMAKQCSTARQGALQALQSLKALAKCVVWSVRAHGAADGAVYDPFAQLFDPLTEEVL
                     DDPRLVTKTTEATDLTLSYVRLLGCSGGGGGRGKSAQRDHADLGAAPLSSSQTSGTEG
                     ALASVIDISRTACGATAPSCSSKAHSSRRKSAPSAVHALRHRTRSSSLGYSSRRLSTP
                     QLPPMSSISALSRGATGFRKRRSSGAASSHSSAEGDLSSTKASAAPSLQNTVNAQKAC
                     AKESGPKPQGTVAVIELGFREGDTQR"
     gene            <268422..>268862
                     /locus_tag="LMJF_30_0830"
                     /db_xref="GeneID:5653613"
     mRNA            <268422..>268862
                     /locus_tag="LMJF_30_0830"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684626.1"
                     /db_xref="GeneID:5653613"
     CDS             268422..268862
                     /locus_tag="LMJF_30_0830"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684678.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653613"
                     /db_xref="GOA:Q4Q7M0"
                     /db_xref="InterPro:IPR002777"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7M0"
                     /translation="MSNSSSVSVAAQAELMEKEKTVAEHQQRLASLRDTVKTMATRQV
                     TLKRTERRCQITVGELTKLKPDHVVYQGLGRAFMRAPVNKLIDSNNEEIERCEAEESR
                     LSAEKQRASELVIKEEGELRRAVEEFRAALMVVQAAQSRSQQSA"
     gene            <270009..>272765
                     /locus_tag="LMJF_30_0840"
                     /db_xref="GeneID:5653614"
     mRNA            <270009..>272765
                     /locus_tag="LMJF_30_0840"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684627.1"
                     /db_xref="GeneID:5653614"
     CDS             270009..272765
                     /locus_tag="LMJF_30_0840"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684679.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653614"
                     /db_xref="GOA:Q4Q7L9"
                     /db_xref="InterPro:IPR004130"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7L9"
                     /translation="MPPSAAKEALADAQQQPSWGGGPAAAAQANHCFGAPLLRSLDGP
                     TATGGVHDDASTALAGAAAPVASFAAPYGEDAGVPRAALPSSSPSSAGVSRLQAGTPI
                     ATIPFGKSLQLNVEEVDTYPSSEPVPLQLQGLKRRSRKAVADSILLPRHINRLFHKIM
                     GWSEELVDLEAEKDSLSQEQTGASEPRGTRLRLLRKKAENLTDKMKYGVLLDAYEKDQ
                     FAIEHQLEIAGEKMERKMLGWEGMHVLDQDAAAEMAHVLENKASIVMEAPSSFHIPVP
                     GRDCCPGCGALLQNLSDDAFGYVRPGEIEKYVAQRNAKAQLRHEYAARMAELQAHWAK
                     HGRHVGEEWLDFMTQEEFDAFYRDTPRPFTCHRCHALENLGVEGRRKVWSAPDFTDQL
                     RALKEKKCVVVLVVDITDFPGSMVYNLPGLISMNNPVIIAVNKMDCIRNRSFNYAGKD
                     RSVAACLVSESYVRRWVMDIAVQFGLPQHQIKKVVPLSAKRGWGITHLISAIEDAANL
                     NLRRPHKPLPTYFVGVANVGKSSVINAMAHALYVPQPPHPESRKVYYTKTDAQGKKAV
                     FWRWYTPPNVNQAEMLDIRGRHDKKASKLMTVSSLPGTTVAVNAVRISLGSTAHTAKQ
                     EQQRLSEGAAAPGKADDVAGIQTYIYDTPGLLPHWHQRSPLTLLQMRRTLIRKFRNPQ
                     CFLLLPGHTLLLGGLAAVDVVRGPPRGLLFLVYTSQKVRNAIVNTVQSDAFWREQLGK
                     ALDPPGSYEQLLPLDDLSTAAGPPRLSETRSYLFECYGRHRRRPKADLYVCGLGWTSF
                     CVSEPADVVLRVRTLPGVVHGVREPLRFKDLCARRAWPKLKRRFTAKGIEDMESDVDS
                     DSINTVVRLISAPVTPASAASADEPAEASVRTVERVAHPRHHSASSAPFAALKEDLHA
                     AGKL"
     gene            <273544..>274131
                     /locus_tag="LMJF_30_0850"
                     /db_xref="GeneID:5653615"
     mRNA            <273544..>274131
                     /locus_tag="LMJF_30_0850"
                     /product="putative surface protein amastin"
                     /transcript_id="XM_001684628.1"
                     /db_xref="GeneID:5653615"
     CDS             273544..274131
                     /locus_tag="LMJF_30_0850"
                     /codon_start=1
                     /product="putative surface protein amastin"
                     /protein_id="XP_001684680.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653615"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7L8"
                     /translation="MGFEALRGRMDVALSMLCSCIVFMFLVTSAPISQFRGRGMNVGG
                     ASKLSCVTVWGLKNDCTANNYDYRPTSIGCARSKQLFQVSEAFYIVAVIVSFLSCLMS
                     GLYFMGIKAKVLLVLLAVLEVGFALIPWVCMTAVWHGNYCGGSTVKINTSSGKADGVP
                     LGSVLRESFKASAGYGLTVAAWCTQVIGLVLLIAM"
     gene            <275448..>276035
                     /locus_tag="LMJF_30_0860"
                     /db_xref="GeneID:5653616"
     mRNA            <275448..>276035
                     /locus_tag="LMJF_30_0860"
                     /product="putative surface protein amastin"
                     /transcript_id="XM_001684629.1"
                     /db_xref="GeneID:5653616"
     CDS             275448..276035
                     /locus_tag="LMJF_30_0860"
                     /codon_start=1
                     /product="putative surface protein amastin"
                     /protein_id="XP_001684681.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653616"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7L7"
                     /translation="MGFEALRGRMDVALSMLCSCIVFMFLVTSAPISQFRGRGMNVGG
                     ASKLSCVTVWGLKNDCTANNYDYRPTSIGCARSKQLFQVSEAFYIVAVIVSFLSCLMS
                     GLYFMGIKAKVLLVLLAVLEVGFALIPWVCMTAVWHGNYCGGSTVKINTSSGKADGVP
                     LGSVLRESFKASAGYGLTVAAWCTQVIGLVLLIIM"
     gene            <279234..>279899
                     /locus_tag="LMJF_30_0870"
                     /db_xref="GeneID:5653617"
     mRNA            <279234..>279899
                     /locus_tag="LMJF_30_0870"
                     /product="amastin-like surface protein-like protein"
                     /transcript_id="XM_001684630.1"
                     /db_xref="GeneID:5653617"
     CDS             279234..279899
                     /locus_tag="LMJF_30_0870"
                     /codon_start=1
                     /product="amastin-like surface protein-like protein"
                     /protein_id="XP_001684682.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653617"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7L6"
                     /translation="MANKKSFYNQEYSKHVGAVILFIVSFVAMTFTVCGTPLGMLMIR
                     SWGEDLSGSSAELELNPCFTLWGLHSDCSKPDYSLRITDSPIVNCSDMHVRFEAAEAF
                     SIVAIFSLVGLFGASWYMICGSKIKKAVMLLAVFAIGSTTVPWAIVTAFYYTPFCGLD
                     FLTNTHTRFGAGYALLVTSFVLQIVGLILFVIFEPNTSKKLEENAKGAASEVWSSTAS
                     ALR"
     gene            <283090..>284127
                     /locus_tag="LMJF_30_0880"
                     /db_xref="GeneID:5653618"
     mRNA            <283090..>284127
                     /locus_tag="LMJF_30_0880"
                     /product="putative adenosine kinase"
                     /transcript_id="XM_001684631.1"
                     /db_xref="GeneID:5653618"
     CDS             283090..284127
                     /locus_tag="LMJF_30_0880"
                     /EC_number="2.7.1.20"
                     /codon_start=1
                     /product="putative adenosine kinase"
                     /protein_id="XP_001684683.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653618"
                     /db_xref="GOA:Q4Q7L5"
                     /db_xref="InterPro:IPR001805"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7L5"
                     /translation="MSALPQLYIQCNPLLDVSAPVDDAFLEKYKVQKTSACLMEEIHK
                     GIFEELEQHPDVTYVPGGSGLNTARVAQWIAQAPKGSFVNYVGCVSDDKYGKILKEAA
                     EKDGVNMHLEYTTKAPTGSCAVCISGKDRSLVANLSAANLLSADHMHSSDVVDTLKGC
                     QLCYLTGFTLTIDVNYVLQVAEAARASGGQFMMNLSAPFVLQYFTENFNKAVPYLDVI
                     FGNEVEAKALADAMKWDPASTHELAKKAVMELPYSGTRDRLVVFTQGSQPTVYATRSG
                     KTGSVTVQPIAQDSIVDLNGAGDAFVGGFLAAYAMSCSIERCCEVGNYAAGVIIQHNG
                     CTYPEKPSISP"
     gene            <287079..>287909
                     /locus_tag="LMJF_30_0890"
                     /db_xref="GeneID:5653619"
     mRNA            <287079..>287909
                     /locus_tag="LMJF_30_0890"
                     /product="adenosine kinase-like protein"
                     /transcript_id="XM_001684632.1"
                     /db_xref="GeneID:5653619"
     CDS             287079..287909
                     /locus_tag="LMJF_30_0890"
                     /EC_number="2.7.1.20"
                     /codon_start=1
                     /product="adenosine kinase-like protein"
                     /protein_id="XP_001684684.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653619"
                     /db_xref="GOA:Q4Q7L4"
                     /db_xref="InterPro:IPR001805"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7L4"
                     /translation="MYVGCVGKDKHGDQIRSAAEADGTTMELEVSSDKRSGLCVVCRD
                     GNSRTLVVHPSSASSLRDDFVSSAAAQEGQRSAKTVYTTAYASVVRVRQTLQLMTSSR
                     CHTLPDGLKQLAAMGLANQRVLDDFGEGLVDVLGKLDIIIGNPEEMYDLAMMLQWVPS
                     EMSDMVLAKKIATEMMCDRHGVRRVIMTRGAEPIIYAASAGESGEVPVVATCAHSAKL
                     LATGAGDAFAGGFLAAMAAKPDDVAFCCRLSAQAATFMINHSLVTLRTDEACLAELQT
                     "
     gene            <292312..>294384
                     /locus_tag="LMJF_30_0900"
                     /db_xref="GeneID:5653620"
     mRNA            <292312..>294384
                     /locus_tag="LMJF_30_0900"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684633.1"
                     /db_xref="GeneID:5653620"
     CDS             292312..294384
                     /locus_tag="LMJF_30_0900"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684685.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653620"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7L3"
                     /translation="MENSPPPQPREVHIDLCGIEGDAPQPPAPRFETPNGTAAEPPRE
                     KLEESCDAVKATQNSAPAAAPSPTPSHNGGNGTNDSPRQPVTTTRPLSACGDANGTSL
                     GDSRPSLEAMAASSAILVRGHDSIRHSYLLKSPHHGATNSSAAAAANGEQATAECDGG
                     GATRSRPEMVLYRSASHARRRQASTPVLARSAASNSQFPFKTALSVFPEPSEEAGTPA
                     ISTQEDVKRYVHAVMEQHTAMLAAWDKRISVAEVYRDKPLQTGGRPAPVRPQDRGFLE
                     RVEQNLDSYLRQLEFAKALLAQSHEAVPPTKSRQKSDVTAWQGYCSRLYYTLSDLAVE
                     ENLIRLRMSRVLRVGHQGFKGSMPSRTASPWGSSARGMRSYSRESASARESSRPASRG
                     SSKPATPRQKPRAASASRRGRPAQSVGSTHSAAAAGAEASCPSTPTGTNVSPSPHSWH
                     AVPSSVVRRGNGIIRPGHSSAPSPAQASAVSVDQPRHPRRYGGHSAHHTAKLHTAPSS
                     VSALALAHQRLLLRALHPDTVSPQPSCTGNTYDSQTPYGRLSPQRRTVSPAFAHSFNR
                     SVALLPELNNDDAELHSAAPSCRSLERSSVHQRAGAPPQLRTYSSPRGTDVAKAVTPS
                     TLALHPLRHRQLLERIERYEKNAAALQPSDLQLARACFYELYGEPTGLHQYCQWIDDV
                     AIKILRGA"
     gene            <297002..>301204
                     /locus_tag="LMJF_30_0910"
                     /db_xref="GeneID:5653621"
     mRNA            <297002..>301204
                     /locus_tag="LMJF_30_0910"
                     /product="putative ubiquitin-protein ligase"
                     /transcript_id="XM_001684634.1"
                     /db_xref="GeneID:5653621"
     CDS             297002..301204
                     /locus_tag="LMJF_30_0910"
                     /EC_number="6.3.2.19"
                     /codon_start=1
                     /product="putative ubiquitin-protein ligase"
                     /protein_id="XP_001684686.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653621"
                     /db_xref="GOA:Q4Q7L2"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7L2"
                     /translation="MSQFVFNGSSRMRNMKLARDHHKTRNSIIEDAQRLRLQREEEAR
                     RMRAARRLQRAIRQWLACQAMVRLALSDLDSVSSDVKQILLSTSSGGVSSAVHTPDVP
                     RQTEQLTARLHTACWCLSYVRRHQSQIPLRLDSPFRAAAKNECRAETVLGDAGSGLPG
                     ATGLGATAAAHQSVTLSSPQTSSVTPLGEQRAYRQRVFWHYSECLYTALSETTNRGAE
                     GEDTTEEDTIALAAAASVEAAAANRSVDPLSLSWPSFLASLPTKDVVLLLCVLLQQLS
                     RVTPSVPGNHASPSSSASLVKRLARYLVAVIVAHNAAFARTLNEESAPRRSHGGLEMA
                     ATGVASPSLAAAASIDQWPAVHALTVTLSFLGQETVAHPVSVRSQCSELLQPLVAAFP
                     PLSQAEAGGHSPLSPPTGSFAQVCWYCMCAPYAGEESQRLTSNSLAVLLGAADTAAEG
                     PERGGCDVVDTCFTMLVAECYRRTAMDTGLTACDGVSGLQGGKLRARVLGRLVRLLPR
                     VHQLVETTSCTAVVSPSCLAACTDVVKWYLLSVSCLSERLCREDFFIEGILADHYAYN
                     TGRRQQRRTVDGKDDVEGVAASSQSQYRLLTSYLFSAEGGLQLLQLLIAQDERCEKLR
                     LMALQKPTVEAPTDTGAPPTVEDGSNEEGDSAAAASLANTTPFMDAGAAAQWPSSASM
                     KQSPLEILCNVFAWPIFTFSKPRYSRYQQETLSLYAKLVRTPQLLRRLWSLYWQSCEG
                     LRAVLPPGEALQRLCQPPAWGAQEQEEQLALTDEEPARRRRVSAAAHPAPALMSLPRL
                     PTWETHPRYPLAFYDPHASLSIFFFTMLAYYVNVCDFADELRRGGEMAVLSTEESWAL
                     VLALKEIVHRSHMYGVVPDSNGEAVARAACLLLSRLHTVDEADPFVPAAATSLWMSVG
                     TVAAEAAVGLLFRTWDAASAAVVEEDAAEAGEAELDGASVATGERSVVGGLMSSTTAG
                     AATTSVTHVRLPGDDAAFHGSAQWKQPTRYTKLLVHTPFLFPFAARALLLSALLVETD
                     HHWTLPSERRVVVQRGRTFIGAFDLFHDKPLSNDMLNIRFIADDGTLEAGYGRGVYRE
                     CIVSLCKEGFAAEYGLFRQTPDGYVYPNSFSAVATSDPQHLLKIRFLGAMVGRALRDG
                     VLQDVPFALHFRNAILGRRNTLSNLKSFDAELYHQLMSLTQLSEEELEAVGLTFVYTV
                     NALGITREVELVPDGAQMHVTPRNCLFYVHLVADFKLNREAAEQTRAFCAGLHSVIDT
                     NRLRLFDSNEVGKLFGGDETGQIDLEDWKANTVYDKPEDVNTPQVRLFWDVVESLTRE
                     QQRQLLKFATSMTRPPLLGFRFLAPPFKVQLLAMNASGPDHLPSAATCFSTLKLPPYR
                     DYATARAKIVAAIEETDTFEFS"
     gene            <302673..>305486
                     /locus_tag="LMJF_30_0920"
                     /db_xref="GeneID:5653622"
     mRNA            <302673..>305486
                     /locus_tag="LMJF_30_0920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684635.1"
                     /db_xref="GeneID:5653622"
     CDS             302673..305486
                     /locus_tag="LMJF_30_0920"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684687.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653622"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7L1"
                     /translation="MFRRSLSAYGSYLLNQRLIADWWQAGHREEVHQAAKARLSAALE
                     EVEKRSSSAAQSSTACVDDESDPSFSPSGSCEYADAPHRSPPLSLYKANALVATFVSS
                     HNTQDLSATLQYIREQLGEELTAYHFHSLLRTFNYHHDAANALQVLEVMVQSGTTTLE
                     TYARMVDCAHCLCPPDVEARLLRLVALAQDAFGTHVMEDEAGTEGGTVAAYSFSGEGL
                     QARQAAADLTGVGSSHPSSDTATPQSARSPRSAPVLSSLLYHCSTTSHRSTVASCVVV
                     ALWIRAFGVELTDWDVMSVLSSVLTHPDTFPLFCAMFGCFDAYERGTVSVQAVVERLA
                     LLGEVERCGPPTASELVHEHVESNGTGSFGGDKGRPRGSRVPAGSSATSTLTSLVEAM
                     QASLRAAGIDAASRVVSLPFVNAQTNSMEELVAATLLPLAQTGVGPHHYNAGHLFHAL
                     SLVQSSVGDDTGAIQLLQRAACEQQRCTVAQEALNMTASSRASKGQPGEALASSAESS
                     SSLAVTSASAPASGEPYCVSVHHLVDVGTLLSRVSATTLRDVQRPFHAALRQMVEELS
                     EKPTEKPSPTSASPPSSWPTMLASCTPPVPCARDLVTVSNYETQFIRTVPEARAVLRR
                     AVDAGNATASNGRVPRSTQFMFMQLAQWCCRHPPRNPKLTPEGLEERTKWGRYLDARD
                     TSLALFGSARQSRDSMKHLFYNNNQLPELRSEAVIAKDFADVHELFFGSASPSSSLSQ
                     AELQLSLRRARTTLPHTGSCAAIVPRYLWDSAVYNPYPAAQLAINTCEFSKSPCGEGT
                     QSPFGLAEVHQTDATLGDDAEEDVGGAEFFVELWHALLDKTTSIGSNEAWYLQNTDMF
                     LLLVRCLLHRLDWEAAAHLTRKMTQHTNYTYLMDHELTTIFREIGDPAGCLAFKVATK
                     LFDGRITKDGQTKRERFHQEQFS"
     gene            <307044..>308783
                     /locus_tag="LMJF_30_0930"
                     /db_xref="GeneID:5653623"
     mRNA            <307044..>308783
                     /locus_tag="LMJF_30_0930"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684636.1"
                     /db_xref="GeneID:5653623"
     CDS             307044..308783
                     /locus_tag="LMJF_30_0930"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684688.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653623"
                     /db_xref="InterPro:IPR011935"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7L0"
                     /translation="MSRVTLAPKLEAVTVYGDCAQLTFSAPVVLKPSASIVAVVENIE
                     QWGDVDWATLQVRIGEATDPAVAAAVLLQNISPVRETVRQDVRADVQRQKDVIKRIEE
                     EQCACEDDIAALEGLCQHLERIKGFVNSAGRGDCAVPPESAGHLQAYMQDPAKWGAMA
                     SFFATRRAKAQRGLAELRTTLVDVEERLEEAQQRLSDLGGDSGVRLHTKSALEATLVV
                     GAGVVSGTKLVVELSCVVSGAGWSPLYDLRVNHAKSKLEVLYSANVHQCTSLDWEKVR
                     LRLSTATPHAGASPPPLWPRWTIWMRPPAPAICALRGGPLARRRMGANSISFSTPNMK
                     ENFAAPVAPMVEAACVEGCGSSSNATVYAIPGLATVRHNNADVKVTVARETFPARLRF
                     VCVPKVDPLVHLSATAVNATDYELIAGPSKVFYGNAFVNQSQLGHVSPGEEFEVSLGT
                     DETVKVSRTLVRRAESEKTSVFSSTKSQLRYHYAYTVECFALASAAPVTVVVKDNYPV
                     SDDADVDVVLEQPTATAAGEHLCSVKGETVTVDGDTHEVAWTFSMTRHEKRNFDMVFV
                     ARYPVKTPVFGLQ"
     gene            <311035..>313386
                     /locus_tag="LMJF_30_0940"
                     /db_xref="GeneID:5653624"
     mRNA            <311035..>313386
                     /locus_tag="LMJF_30_0940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684637.1"
                     /db_xref="GeneID:5653624"
     CDS             311035..313386
                     /locus_tag="LMJF_30_0940"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684689.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653624"
                     /db_xref="GOA:Q4Q7K9"
                     /db_xref="InterPro:IPR007259"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7K9"
                     /translation="MEEVKCSLLSFNSALLRQSLDAPSSAADARAAKDLNADSEAGAS
                     SAEALRRYCEALPFHPTEQQLLQRALPLGRSYHTLLRATQEAAVGRVEGLYPAAIANG
                     VKKILFNYVEAVKAAETPSALAALPATYALTFTLLEAIVEQQQRTEVCLPLLDSFLHN
                     QEVPAAFRRLLGESVWLALLYTTAHYIAHGVVLHARPDYFIAVRAKSTETAAATAAVG
                     SASAGFGGGAGEEHILYTDRLPLGVSSELGLLILAAGKERRVLLRDTDVQGGSDYLEQ
                     LALGTQDEAANAVFHSIFNAQLCHGGVLVAEELAARVEAAKTLWSKALWMKVGDLPSL
                     KVSLAALRSMFLCHRGDVWYAFVERVLPVLADVQPARHDSGARVAASPMTMPLLPSPS
                     PAAALEAAEGANAEGEKQVNAADALARTSHVTAARSAYLQRIASDAFLFALSVSNLRD
                     TAAYEAFTMRVKLCGVQQADAAFAADGPTRAGRHTRGGGGAAVSTEDVARHLLLIVEA
                     LYLQYIPPQGLLLIVSHKAMQYYQRLFLFHLALRFSLEALAVTRSLFSEALVTNTRPS
                     ADLRRAFSLFQLLHFMESSLGYYMQVDVISVFTAKLEEQLASAACTSVDQAKRFHDQF
                     IWHVSEATFLTEGSEPLLRACQSLNTCATTLYTLCMRYRIPYWAVDGVNETPVEVRAT
                     LSALEVRIQQEVVAVFTGYLGLGGRPWERALWSRLDFNGYFSQHLGRPAVPVPLRSVS
                     ASANTLRQPRRTRAHSTGGPSRSSSVAAKPHRHHITSRRTSAQ"
     gene            <314414..>316360
                     /locus_tag="LMJF_30_0950"
                     /db_xref="GeneID:5653625"
     mRNA            <314414..>316360
                     /locus_tag="LMJF_30_0950"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684638.1"
                     /db_xref="GeneID:5653625"
     CDS             314414..316360
                     /locus_tag="LMJF_30_0950"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684690.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653625"
                     /db_xref="GOA:Q4Q7K8"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR022052"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7K8"
                     /translation="MYHGNGSVNDAADASFCPQPSPTRPSREAPPSAPPPTGRVTRTQ
                     ALARLLRGEGSSTHTKPVRAPGNDAKELKVSETRKECVVGEVQADAPPKKSEGTSSHA
                     AVPLAASATITPDDRDDIGAALQEIGDASRRHRRHSHDAEGTSGDAVRDDASDGGAAN
                     MSDDYNGDDNSESTCSARRSGAGSAPAEGFSAHPTHARARGRAVSTRQAANALPRMLA
                     LQRSFEAEAKHLYEYCGTHVVEWPTLAVEWIPDRAFVDPERDYTLQYLAIGTQAHPLS
                     GAANAVKVMEVAVPVTAAKDVMYGLYGDDDTAGVEAVDPAREGGIDPGKRFANVKGHF
                     HCEQTLTMDAAVLKIRAMPAETNVIAVKTASGFIGVYNLLQDLTQNEAGRTVPDALLC
                     GHRRGGFGLSWNALKPGFIASAADDGYVNYYDVSHRLTIDVREASDVDPALTGPETQP
                     LERLVGHRDIVTDCCWHSSQGHLLASSSMDGDARLWDIRMSAGSSTIPSAHASGATAA
                     QFHPIGAFQLATAGAEGSISLWDIRRTADPVWELNYHGRPITGLQWSPFCETVMLSYG
                     ADGRVVLWDLAKTTLPLGYSEDQLAPPEVSFVHIGHVGRVTDASWNSSTTEEWLLASA
                     DTTNGVHVYRPLVNVVQDYRAYQH"
     gene            <320619..>321974
                     /locus_tag="LMJF_30_0960"
                     /db_xref="GeneID:5653626"
     mRNA            <320619..>321974
                     /locus_tag="LMJF_30_0960"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684639.1"
                     /db_xref="GeneID:5653626"
     CDS             320619..321974
                     /locus_tag="LMJF_30_0960"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684691.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653626"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7K7"
                     /translation="MSMNNPAPSPQAPMAAPLDASATVHPRENLAVSAPPGATGAGHN
                     KRLPEELAEFLHTQPPRMETINERKQLFCTRLYMTPPRVLATEGAERRGETLGASLTA
                     TGTTSNDSVVGAPLLRSPPPAVLPAAGAPASLKIAKTVPFSEEEHLAWLCAPASPTES
                     RTSAAVPPEAAASSRGLARTERISHAQSEGVRRHEPDRRAVGATATQQPHLSHGASDA
                     HGNDAPARLQGLVAASMATAPNPATPLALQHGEISYKSSFSVLTSWDALMVAPPLLRT
                     TPRMPSLLTQDVENIGTAAMHLNRSTTVTHACASDDVARIPSTGSRAELLIGTSPATE
                     KGEARQEEARADAVLQQPVFPSSCCTRSPTTVPSRLKYDGHGLSPEDSLHQVEEDSAR
                     TFVKHFTNGLVFVDPPWFICPVLLDNCEHPYYMTWLDELEVGSVEEAVAETKAKLLTD
                     A"
     gene            <322973..>323560
                     /locus_tag="LMJF_30_0970"
                     /db_xref="GeneID:5653627"
     mRNA            <322973..>323560
                     /locus_tag="LMJF_30_0970"
                     /product="putative p22 protein precursor"
                     /transcript_id="XM_001684640.1"
                     /db_xref="GeneID:5653627"
     CDS             322973..323560
                     /locus_tag="LMJF_30_0970"
                     /codon_start=1
                     /product="putative p22 protein precursor"
                     /protein_id="XP_001684692.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653627"
                     /db_xref="GOA:Q4Q7K6"
                     /db_xref="InterPro:IPR003428"
                     /db_xref="PDB:1YQF"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7K6"
                     /translation="MSAPTALTVPRRSASDAALADATRRELEEEMGRSDKPEQPTPPA
                     GWQVVRKPGTCTFDLTKSFEGEDLVVRYSTNQDSDKANSHNIFVYITQKNGQTMQADL
                     SIEEGELVLNNIRFYDEAALAKDTGAEAEAKRNELYTGPLVHELDYDLLNCVMTYLEK
                     RGVDEKLGEFVVLYSFWAEQQDYEAWLTTMNKFAS"
     gene            <325267..>326649
                     /gene="ATG5"
                     /locus_tag="LMJF_30_0980"
                     /db_xref="GeneID:5653628"
     mRNA            <325267..>326649
                     /gene="ATG5"
                     /locus_tag="LMJF_30_0980"
                     /product="autophagy protein 5 (ATG5)"
                     /transcript_id="XM_001684641.1"
                     /db_xref="GeneID:5653628"
     CDS             325267..326649
                     /gene="ATG5"
                     /locus_tag="LMJF_30_0980"
                     /codon_start=1
                     /product="autophagy protein 5 (ATG5)"
                     /protein_id="XP_001684693.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653628"
                     /db_xref="GOA:Q4Q7K5"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7K5"
                     /translation="MLLAIVRDLLQLFRPYAAALHPETTQVWFSVRDTPLSWLYPAGA
                     VKDYVNECVREERAAHLSASSPSSPPLSSAAALLQSHLCTILSEPLELSFHIHSLTKG
                     SSLARTVPLYINYDRLEEHIRMEVKQAHKAAYTVLYGNYAIYQREAESALQAAVGLAL
                     YRPFDAAAQEQLQQQRYRDPGSSGSGGAGVGNGGYSSSNSPGGGYSAPFAFTSPYLLV
                     EYQQLLRGLLTPRPHVAYLIRIGFPFAYRGAAGRSESGYLQYDAHRVSAAPALALSVT
                     TTEAAAAPTMEPEQLPLGLLLWRLFRAPVLRWKAQQLQQHPTDNTSPSTAAHASATVL
                     SEVERTYQQLLRTLAPYYADPPRCATDGLEQQEPLMTSTPPEPPAWAAWERAMVQAFM
                     RDYEERPEKCGLGFEFAEAAATSAASPNAVRRVRFMVQGIQPPLTTPGSFLEAHLSSS
                     DRAIFVTVQV"
     gene            <328205..>329923
                     /locus_tag="LMJF_30_0990"
                     /db_xref="GeneID:5653629"
     mRNA            <328205..>329923
                     /locus_tag="LMJF_30_0990"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684642.1"
                     /db_xref="GeneID:5653629"
     CDS             328205..329923
                     /locus_tag="LMJF_30_0990"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684694.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.0990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.0990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653629"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7K4"
                     /translation="MMTPSVLPAASPTTSSAQDLPSPTSCVPRPVPVVELSPLILRVL
                     LWWAGRPQLPLWRSGHAARVERQNTYSNRINHHGVDDDSTSELPADSRTPSHASPSDS
                     GDSGNLPSQQQDDAMGAQQLRLRIADIFALLCRRDGGVVVSDALLYGRCHDASELAAQ
                     RCHLVFSGFSDARWRAATAPAPNSPQTFATARELALIEPSASPDSKGGGASARSGTYD
                     VGQVLCALVDLHTSAASATRRSQPRPSPHLTTDANVESDVVATGVLLRALLRCPQLHK
                     RLMLLFSGDARATEPRRHRRGASVVVVTPPAAASVKSSEEVEPDSSSTVVLKAADTRR
                     QLDIFLPALTHASPIVSADSWQTLTMLLFPSSTATVSSTTRRLLLLTPACPVQRLLAA
                     ALALPGDDHDDTCASRPSTPQPVLPPSSHPMARNNALRLLHVLCSSSDLPPGLQSLFQ
                     QCPALLWRVLRLAAAVCKGVAVAHAALVRRVLVDYIMLCAPQSSCSERGGVDPHNNSS
                     VSTQVLLRENKDAVARFLASTYAAWGGGGRALEDIGGDLAGAAASAASENGYDEGHLM
                     TVLNAL"
     gene            <330535..>332373
                     /locus_tag="LMJF_30_1000"
                     /db_xref="GeneID:5653630"
     mRNA            <330535..>332373
                     /locus_tag="LMJF_30_1000"
                     /product="putative protein kinase"
                     /transcript_id="XM_001684643.1"
                     /db_xref="GeneID:5653630"
     CDS             330535..332373
                     /locus_tag="LMJF_30_1000"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001684695.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653630"
                     /db_xref="GOA:Q4Q7K3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001245"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7K3"
                     /translation="MNSQASSSPLPPAASCVQFRPEQLQLGTGIPLGSGAISQVVQCR
                     LRCAAAPLLPVVVKIVSKIQVLQQGKVQSVMNEKATLQRLAPFPYVVRLYGTAQSEDE
                     LYFVLEWLPHGDLLQHIRYVAQERVRQYNEEEAAAGSTASMSSPGTVAGGTTGSAPDG
                     PPVAEASASTGPSKRATAIPASSTALRCLDFHDIQLITAQLVLALEHTADRGVVLRDL
                     KPENVAFDEKYRACLLDFDTADLGGAENMPETNGGVACPPPVDAAAVDEAESSNGGGG
                     DAAAENGGASSSARRRRRLTVSQIHSMRRRTASFCGTAHYVSPEMVGECKWSFSSDLW
                     ALGALVYELVYGEHLFSGMTQFEVLQKVVHGTYVERQELFPRINFADDADGEAEQCCG
                     GRRFAAVKDFIQRLLLTDPQKRLGVHPDTHRFDATALRRHALFDGFQWEPVEEQLRTF
                     RMRRFDLGSSKATSTESGDASCDAREACSDASGASSAALKSLAAACVDPSSSLASRYH
                     ILPFNDPAYAEYVYRATADANPLEQFFTQEGTEPASTAAAALHEAAGSAGGSAPGAVP
                     TPAVDSRPEVASVVDDDEVDDVIDDVGMHYTGRPADKCFQDCRDTP"
     gene            <333552..>336620
                     /locus_tag="LMJF_30_1010"
                     /db_xref="GeneID:5653631"
     mRNA            <333552..>336620
                     /locus_tag="LMJF_30_1010"
                     /product="putative ubiquitin conjugation factor E4 B"
                     /transcript_id="XM_001684644.1"
                     /db_xref="GeneID:5653631"
     CDS             333552..336620
                     /locus_tag="LMJF_30_1010"
                     /codon_start=1
                     /product="putative ubiquitin conjugation factor E4 B"
                     /protein_id="XP_001684696.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653631"
                     /db_xref="GOA:Q4Q7K2"
                     /db_xref="InterPro:IPR005746"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR017937"
                     /db_xref="InterPro:IPR019474"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7K2"
                     /translation="MLEITSLGQLLSYVQRSDVVTVIDFYAEWCGPCQQIKPQFEQMA
                     RYYDPSKVIFAKCNVDRNRDCASRYGVSTIPTFIVFYANDRITTVTGGDLGMVQRSID
                     LAVAQIPETAAPSSAGQTAAIHDSMQETQDAFAEQMLRIVEAKSTKNQILEKDSCDAA
                     YALLKAKIPYGLLLLPYLASDAFSAVAIDALFSNIASRAGAERHDEGYLINQVLSHLM
                     QLSTHLSWGDMSVVKQLHRVLLSLLACPQLQRALMTSPFFTNMFITTGTQLERTTLLG
                     VLFGLGPKPMAAARAPHGDWLAMLEVFSPQKQDEHQQTVYTIQQEMNTLAKMNVRLVQ
                     GLLHIKTARDATLRYLGRALQLNEDYLKTMHHDSPISSRYFMIQLQSVLIELALPIFQ
                     ARANKEGMSSSGGYDYRQIPTHYLLDRLYGPNGVVVSFGSDVERVAHFGDDNPMPRAP
                     SSRDPYKPFIHLFFLAARAVTLCAAVFIDEHDRAERQATHPQASRQQRDYFTAEKLLL
                     EGLLGSAELSASRLEFLNHLAHWLLTVMQVDDQGVLPAQPPAEWGYLPQCLVDCVIRA
                     TSMAPLDGLYSDGMISLMLVLMGNTKYFPKPHTHALFPAYLLRLQENYTTRKVLEQHP
                     WFNTHIVRACMECYIAVEKSTYERVEVRYELSYAIKTLLKSNLLCEPVREEMESQANN
                     TMLERFSHMAVAEVNEAVDQVIDTLTRMNEMVKAGADLSENAVASGSPQNAADGSNRE
                     QQRRQTRRQRSDASRNEDADSGEDGSERDEEENADGSQTYHERGMSLRSHLMLFTASM
                     DMFIELSLQFPKGVSQNMVAGQISEMLARSLMAFAGPNSRSLKIQNADLYNFRPREVL
                     MRLVDCFTHFRRSKNFLRCLCHCSIPLSDIRSVMHTIVSRQLVSEDLIWKASEMAAAM
                     VSVSKEVDNEEAVWDDAPDYALDALLSTPLLQPVALPADVKDLNDLVYVNQETLHHLL
                     LSESKHPFTNEPLTEDKVAAFNKRPDVAAAVEGRRAAIQKWLEDAKAAQA"
     gene            <338416..>340032
                     /locus_tag="LMJF_30_1020"
                     /db_xref="GeneID:5653632"
     mRNA            <338416..>340032
                     /locus_tag="LMJF_30_1020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684645.1"
                     /db_xref="GeneID:5653632"
     CDS             338416..340032
                     /locus_tag="LMJF_30_1020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684697.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653632"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7K1"
                     /translation="MLRFTAFDLGRWGSRDFLRGRSKRAGAVHTRHTHGRKGRYKRLS
                     SITSSIRDGRRHASNHMQGGLGLKMGGGLFGLRIPRQHQLSHMSKEEFELEVYGHPNI
                     TNPYREHLDEHPDLKSVMMNATVTLRLVVLLPKAARRLVQREGGNEQVPEQWSSVVRE
                     LKVALGALAASARQALGVVEVHLATLESSVCCRCALSEAASTPVAVDGKSVEVGHDLE
                     IGVARLYRTHCLLRSRLKPVAEATPRHRRPAVFMGAALRASSPTFSSTPPGMFPWSAS
                     STSFTSSVLARLTKDTAAPSQTVLPRSCREGTRTDACLPSSAMPLSGPVTADAPGASE
                     GKGMMELVRECSATEQPLLRLCLRPGASASKRTHLAVREDCSKTTAVAAPAAVATRKV
                     LKEDIDLNSEVGVWRLARSSLPELLRWHYCARDPRAHNHDALPHHRRSLPVLLVVDYS
                     TIAGDVGHARTQSAASSRPAATLMPRHLSLELESAGFKVLAESSLLDVAKSLEAWVPA
                     RQWVDYVQSCAHAQPHDACRAAPTAQAATL"
     gene            <340847..>342097
                     /locus_tag="LMJF_30_1030"
                     /db_xref="GeneID:5653633"
     mRNA            <340847..>342097
                     /locus_tag="LMJF_30_1030"
                     /product="DNAj-like protein"
                     /transcript_id="XM_001684646.2"
                     /db_xref="GeneID:5653633"
     CDS             340847..342097
                     /locus_tag="LMJF_30_1030"
                     /codon_start=1
                     /product="DNAj-like protein"
                     /protein_id="XP_001684698.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653633"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7K0"
                     /translation="MRGAPTYATALGSACLPFALDCDAILQASRRYSSTSAHGARSSA
                     AASTSKLNYYRNLGVDTDATPQEVKTAYRQLALKYHPDVVEETHRAHAEMLFRRVSEA
                     YEVLSDPVRRRAHDAELGIQTRRKQQPSATAPAGAPSAANAKAGTRAGSPAGGARPSS
                     AFAERRKHTSSTASSTSSTTFQQQQQQQRRRYRKPFVRGDANRVFSDAFDGKTLDEIL
                     FDVQRRRRQEKAGRVAAERRHEKGGGAGHAASNGTTKSSSSPQPLMGESGPLDHDARL
                     RHVMETAAELFAQRAQRQYGHGVLRHIRGVAGPLPDGPAPPPEVYMPFRPFVGMPVPP
                     GVRTPPEPTLGKVLDSQEATVDSSSTPASRDAAWYEIPTQFHTHTYADGTPQSRSASL
                     AKATKYIHGMPHNMGQLYSYHRPY"
     gene            <343030..>343782
                     /locus_tag="LMJF_30_1040"
                     /db_xref="GeneID:5653634"
     mRNA            <343030..>343782
                     /locus_tag="LMJF_30_1040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684647.1"
                     /db_xref="GeneID:5653634"
     CDS             343030..343782
                     /locus_tag="LMJF_30_1040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684699.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653634"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7J9"
                     /translation="MRRLACLASATALSGISVAATAANPAASTTVPARFIYTTWGSVP
                     CEGWACNESWLKRITSQSEYRSFDFWHVPQADVPAGLKLNAVERYLLSSLENDAERLL
                     HVSWCEDFDSYWRDRVNSLEMLYKTIYTDDHPFYRYIFGNCTHKTAEKEHMLRKLNYL
                     KNILFWAGRTERCYTSIAKARYYVQRCVWNALERERYLCACVEAVDSFGKKVPEELRH
                     KAMPELEVALASMRHWVWDCPNGKRTFTRRLV"
     gene            <345712..>346728
                     /locus_tag="LMJF_30_1050"
                     /db_xref="GeneID:5653635"
     mRNA            <345712..>346728
                     /locus_tag="LMJF_30_1050"
                     /product="mitochondrial carrier protein-like protein"
                     /transcript_id="XM_001684648.1"
                     /db_xref="GeneID:5653635"
     CDS             345712..346728
                     /locus_tag="LMJF_30_1050"
                     /codon_start=1
                     /product="mitochondrial carrier protein-like protein"
                     /protein_id="XP_001684700.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653635"
                     /db_xref="GOA:Q4Q7J8"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7J8"
                     /translation="MSSVDMYIDGAVASMCATVISNPFEVMRTRMQLQGELCKRGEYK
                     VVYDNLGQGMIRVAREEGLRALQKGLVSSVMWQVMQNGIRVGLYPAARAEVSYACGSD
                     AIYISVLAGALCGLVGSYFSSPFQLVKTRLQSQRNTIVTMRGDVLSKATTGEQYDYAG
                     VKDAFHKIYKTGGLRALWKGSHIAAQRTLVGSAAQLTAYDVAKPIICQRMGWPASDIR
                     VHICAAIFSASCVMCVMNPLDVVMTRSFNHRAGEPMAYSSNLAVATWKIYRIEGVRGL
                     YKGSLALFSRSAPHNIATFVMLEYLRKMRERYTNRAYTSGSSVDKSIGLNRLIDGKSG
                     KNAA"
     gene            <347969..>348469
                     /locus_tag="LMJF_30_1060"
                     /db_xref="GeneID:5653636"
     mRNA            <347969..>348469
                     /locus_tag="LMJF_30_1060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684649.1"
                     /db_xref="GeneID:5653636"
     CDS             347969..348469
                     /locus_tag="LMJF_30_1060"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684701.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653636"
                     /db_xref="GOA:Q4Q7J7"
                     /db_xref="InterPro:IPR000352"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7J7"
                     /translation="MSSLTEGARASHTSSKEAGYYRLQSPKHINIDPCVYEIRTMRGS
                     GPGGQGTNSSSNKVELRADMELLSEFFDEELLAALRRHEAGGALTNDGTTIVVSCHEH
                     RSALQNKEGCLRKLQTLLHKASWVPPAEAGLVERPSFIVTEQKVRRRKKSNMNRMTRS
                     ARSGSW"
     gene            <349297..>349995
                     /locus_tag="LMJF_30_1070"
                     /db_xref="GeneID:5653637"
     mRNA            <349297..>349995
                     /locus_tag="LMJF_30_1070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684650.1"
                     /db_xref="GeneID:5653637"
     CDS             349297..349995
                     /locus_tag="LMJF_30_1070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684702.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653637"
                     /db_xref="GOA:Q4Q7J6"
                     /db_xref="InterPro:IPR005631"
                     /db_xref="InterPro:IPR028882"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7J6"
                     /translation="MLPRLALSRGAAAAAAPLTVTISTASATCVSPRWCSSVTSDKPG
                     AADSNPFTSAIAKTLREKVFSQDFAAVKAASPKETELLKKWRTVDGTPAKSPRQPATP
                     GTADSSDVEPQIAEGARNVAMSHGTTFRDSRPVDPKESVECKRRRLIYQSRYRGMVEM
                     DLIFGHFARCKLETLDASMLDEYDMLLKQLDSELFRWLVMGVDAPEGVAKLRCFGELR
                     RFIKEERTALLGSN"
     gene            <354475..>362019
                     /locus_tag="LMJF_30_1080"
                     /db_xref="GeneID:5653638"
     mRNA            <354475..>362019
                     /locus_tag="LMJF_30_1080"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684651.2"
                     /db_xref="GeneID:5653638"
     CDS             354475..362019
                     /locus_tag="LMJF_30_1080"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684703.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653638"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7J5"
                     /translation="MTCSSDNGTAIKRALAHNTTAKPLSNARTVSWTARSAAQRESAD
                     VEARMRAITAAIVSSPPPLLTHAWTSVPSAIACVSSSTPVTSAACASVGADTAASRVP
                     RTSPSSPPVASSDDAASWSMTLHTDARRASAAEAYWVPYDVYLALSAPLLRERALQDC
                     VATLCCPMTPSAEGQSQLIKIDSVVSFLLHGNAVAPPIASDAAVVAPVSMSQSPMQSS
                     SLLHWSERGSRNDKAELIAFPLFCVLGAKLCTVSRRTRSICSIHTPAAPIAARLAMHP
                     DQRGGCGSHSRHGSNRTDSTYRTAQQDLAAKPGSGAEAALPRCDGGKDHVLLLFAEQL
                     ISALPGFPVALLYTTSPTGAVVSAPPAETSAFWDSWHKTPRAVRRSVSYEHMWSVVTL
                     PRLVAMLQRWGVAPAVAMRRLCAGLLCSSTSPLEPPGMPHPYHTAMDLAHEQGEEEAA
                     TAVLDTAGALRQLQFPLGEPNSCLVESPPPLPTAASAQLARASVVRPPQHIVGSSSSD
                     GAAWDSLPSDAGVVPHRGMSTPAMRGAEAAVRAPATPLKRRGRVTAGECGITTLRSHD
                     GPLSSGEKGDASDPVHPYNAVGAPGSVNAASEDTRGLYGQAHLYDTPSPPPPPAASSV
                     TATAGSVVFVRGAVPGTPLTESSTPLFNTRRFRYPDVLRPPLRLRLHTSSFLQRANRP
                     VGATKGAAMLSSHRCPGAPKRVTAVSTDVRYSHSGALAHPYEMSASDGTRQSGSRHRR
                     RHSGRGRRLIHEGDHRRGTNVRDAPAELAHASGDVEQMGDARLISSSQSAADGLTDRG
                     GVLSHAAAPALTPTPPTRSGSGCCLGARPRTKHVNRYMQVLMSAAALRCAGPSPTAAD
                     DFPQQQQQNTAHRYGTGDHLATAAGATPLCVASSSSGTGSNAKSSLNRSRESGDSGEA
                     MPRRAPVPPPPLQQHQLHLRPSPHANILLCHQSSISTPLSFTPSSLTGGAVSVALSDH
                     AASVSAEHENKQLCDDSNTDRRAGAVAAPPTFARDSKTPSMTASSDGSLASLTDAAGA
                     LPTEQVLHHPETASLLSVKNARTHNATRNGIGDSLSTRLTSSPLRSIFTGLRALLQLA
                     TPPSPMQACRFPHRDSKPAGPLLSACSPEDRAVRPSAYAPPELSSPLLTYSSHPTLYA
                     AADSRRSGDYDNLGATASPPPSDALSPPGQQSPTLRASCERSASCLVAALSEEHLSPP
                     LRRDRGSVVSHLAVAGASARPSALTMSGFSAVKGFTANAPPLSANESDHGAESRLVAE
                     PAISVDLQLHAAAREHAADAEAVTASGTVRHDGAAAMTASTAAPPVSPGCRPSAASRL
                     SRRSADALVDSNLHEGGGWPSFLPLSLFRTTLAVATQFPGDAGGVRVAVPPPSNSESG
                     LLSGWIDTAALLMNLVACVMQAVGRGYIARRDLRRPFRRPSSSSTERAAVSMAMAAAA
                     PAVTRSPHHTLVTPDPSMPSSPTASTSASPAPPSLHHHGVATQTTTAAFSIDHFPGPH
                     RPSASTLTSSSRVLATQPLQGFPPPPLTAFSASPTFPINATVAKASTTPSDVHVSARD
                     VSLVATATSKSSLQRHNAASQTSSKSKKIPTFSSLAAAATHSSPNNLSSFSGLRLKRP
                     TCSSDEASPNKVPASSLRHLFAMRGLQSSSTSEDSGTWAPAPNVETAGDTAASSDGDD
                     AAAAANAGACTSVDAATLLLAISMYTVSTTPEVVPQRQSSAASRGHELSSPSTHGDNN
                     AGGEPSAGAVAPARPVAGEPLDFFAPPSLKVQSSTEDAASTAFRESTAERMGMVQEQL
                     AVTHSCTVPFLDQAVAKGPSASTIGSSTSQGPMSLDGARSSSCRLSSSADEYATPMIA
                     ESLLQLQRIGRGCLIRRQCKLSYRERQERPLGLLHKRVCQHMRVLSPSATSMDENGVA
                     DGFGSGSTAGGAAAVLSGITGLRSASSSYQPSDPTRLTASLPQSTPSLPEASRPLVTL
                     MAGQRCLRPVNGRHFTDLAHPASLLSQVEPNLSESEGVVCIVGDSVQLADDRSTAATL
                     RGKTNTMAVSPDSARYIASPAFVSPKRRSSVLFTDPPSHMLSSGSPSEPRGAAAGGAE
                     DGTVAAGEGAQEAGATRAHRGSLPSSAPLPAAVTVADTDSGDGDAAVASPLVPTLTVV
                     LPSSSAAVSVDTNNSTRKAQPPTGRAPSPPRPSLLSPPSLRVSFSRDSYLPSVNSATM
                     KTSVSAAAAVVPVTSAVGTSISATMSASSSRQASRSEGAYSMRSPYRSPPSPFIVQGS
                     PHADMVGAAVDSSDASCCPLPRRRFPIAVPRAELSPMEGSIVATSGRSARSLNSINSL
                     PFNCSTTANTTSFTAQIFSTSLPEGMAPELWVLGGVEEAAMSSSLLDGSDDDDAEGDN
                     EGDAFKADPILVEGGAEPACFVAAAQVLGREAAPPLMSKALRLLQRVGRGYLCRRHQH
                     FLFMVSISWAEVALIRRVALGSLTRRRTGLDYFVHREAKRQMAYWALRHRSAVLVQSV
                     VRGFNARQRVRRLQRRVFTRMELRIALEQQNTDE"
     gene            <364820..>367810
                     /locus_tag="LMJF_30_1090"
                     /db_xref="GeneID:5653639"
     mRNA            <364820..>367810
                     /locus_tag="LMJF_30_1090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684652.1"
                     /db_xref="GeneID:5653639"
     CDS             364820..367810
                     /locus_tag="LMJF_30_1090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684704.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653639"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7J4"
                     /translation="MSSSMLRSGLQLVAIDYSNPQPQYPGGPVLDAAAFNYDPLSEDS
                     AALHQCVSAVNSPPVTYGVDDLLGRITNVEFIAAEGSPEEAAAGVPIHYRLASSLEPM
                     LNATLNPAITAVVDHCLSSIVLVYGATQEMKQMGLIGTPEKCGLLPHGIRTLMERLLD
                     RKEHQLSKAASLTCTAKPTGDWAAAASDSIGSNASPSAPPRAAGSVSPPFGGKDDAVS
                     DSDHTEGVHSRCATSQTHGFVFPSIGSRHHRFVRMEATFIAFDSTSVVDLLDLSNKHA
                     ELVLKLAPPPTPSAFEEKTGDVNAAASTSPTTDSFVLNAQAMSAENTNDALSALDVGL
                     DNLTRALELPLLQSESGSSLLFSLTAFTDTCRCATMHMLCLAEDPAAQAWLVSTVQAR
                     SQAIPLGEEQSWASIQNTPMPPPLHHHAATMLVPALCFGNMFTSVLICVYNSITALSR
                     LNRDLTLAVTGYRMRTIPHVTLASSRRGLKKLPPSWEEHFTNDGRRYFIDTATQTTTW
                     KDPRFTYPHCSSRSGGLTGSNPSGSGTGAGSGRSSRSGSLHHRPRRISLGPGDKDFLM
                     SRLQHEMHGGSSSVTGSTGTTQQPAACAGRLPTLGAPASGADSLDIGIIVVDTMCRPR
                     VLIHSRNPQFALQYHEQEEVLRAKQRELEEVKVELRRKAQAAAVLGEAAGEAQDAGPA
                     IVPATATPREAVQPIVDPAALTEAVNWAHSSPTPAKGVVGLDDVDDEEVLALCHRNSV
                     KIEDFMFGDDGGEGSEDDEACGTEQISAPASACKAGGVALSQSCKASSAEARFYANAL
                     QEQAVGVDEVSASSTVSSTETSVAVSPVLKSAAAPGSSSNIAAAATDEQSSSAISDAP
                     HGGTTMAAALPEVQDLESLVDEFAAFYRKAFELQQRVVELEAALKRLKSTARSSSPLS
                     LPAATEASHVGVHELVQQMSKAVELSPSAEVRAALTPMLTNAASIAPATATASVVLQA
                     FHEALRIAAQTSRAEGRENAAPKQ"
     gene            <369863..>370774
                     /locus_tag="LMJF_30_1100"
                     /db_xref="GeneID:5653640"
     mRNA            <369863..>370774
                     /locus_tag="LMJF_30_1100"
                     /product="putative DREV methyltransferase"
                     /transcript_id="XM_001684653.2"
                     /db_xref="GeneID:5653640"
     CDS             369863..370774
                     /locus_tag="LMJF_30_1100"
                     /codon_start=1
                     /product="putative DREV methyltransferase"
                     /protein_id="XP_001684705.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653640"
                     /db_xref="GOA:Q4Q7J3"
                     /db_xref="InterPro:IPR007884"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7J3"
                     /translation="MQALSKDLQLYISGHRGRPALIYEPRTSLISHSLLQLFEACNCD
                     AETTAFLIRSRNMSLWKLMLADFLSVFLSRTTAQGIVGRGMMFVYSTEQIRRLLRPPQ
                     APLTSPLPSDFQFDSLLDIGAGDGGVTANIAPLFKKVYVTEFSVSMRWRLRRRGYEVL
                     PHDDPFHMNTAEQLLDRRYFDVIACNNVLDRADMPETLLREMRDSLKPNGLLVLAVVL
                     PWCPFVEDGPQQKRPSELLPMQGGECCRGASFEQSMSKLVENVLVPMGFEVVRWTRLP
                     YLCEGNLRIEYAVLNDAVFILRKRGDV"
     gene            <374603..>376462
                     /locus_tag="LMJF_30_1110"
                     /db_xref="GeneID:5653641"
     mRNA            <374603..>376462
                     /locus_tag="LMJF_30_1110"
                     /product="putative RNA-binding protein"
                     /transcript_id="XM_001684654.1"
                     /db_xref="GeneID:5653641"
     CDS             374603..376462
                     /locus_tag="LMJF_30_1110"
                     /codon_start=1
                     /product="putative RNA-binding protein"
                     /protein_id="XP_001684706.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653641"
                     /db_xref="GOA:Q4Q7J2"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7J2"
                     /translation="MRDPTNTVWVGSYDPAFHSRSMLCRAFWPFGRVMEISIHDGKSY
                     AFVHLRRTEEAKAAVDALIESRELGAAIFNYSKMHDYTEEEMNLPHDPNVVEEPPITD
                     PAPALAPGARRQREYDGSRDPRDERGAREAEHGRDAPLPPPRRARHEREAKEPSNVLW
                     VGNLVPYITNEKLTEVFEVFGPISSVSRLGRSNMAFLHYETVEQCTMAIETMKGRPIE
                     GVMLSLNYGHDAQHASDAAGGSGAGAEGPAGMTGHSYGNVPLTADGIPVNETPTNIIY
                     LGHLPADADAKNVEDLFAPYDGFIFSKFVASNGIGFGHFDTIESSRVARAGLSNAMIK
                     GTPIRVSFGKHNHTYTMADRRRIGEPTLDNGGGEFNLDAMMRGPGAQLDGTNGALVAG
                     GYGGGAGAGGALVLPAMGGGAAGGGIGGADTNVYARKREAPEMNMDNRLQSLLGSTYN
                     NCGARGLEISPSQIQAVCQLVDNCVSESACETLRQALMLYSPLRSVHVFNVVAKRMKE
                     FPDDPHKRLFVLYAVTHVLLGVSTEYVPFTEAVLNAYLMVLLVASEGQTSSGMDRLTF
                     IIESFQQHPFIEKKSNAGKEYEEQFRAQLDEITNRAKAEQDLRLLATRRRRRN"
     gene            <382014..>383633
                     /locus_tag="LMJF_30_1120"
                     /db_xref="GeneID:5653642"
     mRNA            <382014..>383633
                     /locus_tag="LMJF_30_1120"
                     /product="putative importin alpha"
                     /transcript_id="XM_001684655.1"
                     /db_xref="GeneID:5653642"
     CDS             382014..383633
                     /locus_tag="LMJF_30_1120"
                     /codon_start=1
                     /product="putative importin alpha"
                     /protein_id="XP_001684707.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653642"
                     /db_xref="GOA:Q4Q7J1"
                     /db_xref="InterPro:IPR000225"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024931"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7J1"
                     /translation="MFNNQEKKGAKHAVSTKAGAERRQRQLMSVRHRVHGEVMKLLRA
                     EGQDDFDMLGGNGSVAQASNPEDVWSYDARSTPASVPLQLLPTLVNMCMNGPTDREVF
                     QGTLLIRKILSVEKDPPYDVVTSSGVVPHLVNLLQREDYPELQFESAWALTNIAAGTS
                     ENTMMLVACGAIPRFVALLGSPNADCRDQSAWAIGNLSGEGAACRDEALSHGAMVALL
                     NVLSVKEQPIHVLRNATWAVSNLCRCKPLPPLERVAIALPTLVDLLNSSDDQLIVDAA
                     WGISYISDGPAERVQSVLEAGAVPRIVQLLSVPSTNVKLPAIRIIGNIAAGTDEQTQV
                     IINSGALPAMAELLRHPKRALRKETCWTISNIAAGQPYQIEALVNSNVCIPILECLSA
                     PELDVRKEAVWTIANITFCGSVAQVKYLVNIGVIPPLCETLRTYDPKIVTVALEAVQC
                     FLQVGEDEKTSGGTEENIVAKQVMDCGGVDSIEQLQTHADKNVYSIALQILETFFTTE
                     DETGPMGDAMGADMVDFAQANPTAGSGQFNF"
     gene            <385776..>386060
                     /locus_tag="LMJF_30_1130"
                     /db_xref="GeneID:5653643"
     mRNA            <385776..>386060
                     /locus_tag="LMJF_30_1130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684656.1"
                     /db_xref="GeneID:5653643"
     CDS             385776..386060
                     /locus_tag="LMJF_30_1130"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684708.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653643"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7J0"
                     /translation="MAHGILRIVRQVRTFSFTASCRSHPFAWYTCLCCALISWANYAQ
                     YKRLAPMFPKYERYLTEEGGRMLEAKRQELAEVSRYNNMVDIMRRDLSGK"
     gene            <387036..>387590
                     /locus_tag="LMJF_30_1140"
                     /db_xref="GeneID:5653644"
     mRNA            <387036..>387590
                     /locus_tag="LMJF_30_1140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684657.1"
                     /db_xref="GeneID:5653644"
     CDS             387036..387590
                     /locus_tag="LMJF_30_1140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684709.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653644"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7I9"
                     /translation="MQLSSLREPVVLFDTQLQQLTLFYLADGFFELHTVAVSIASLMV
                     CASLAVATSSGSGGSAALLTSTPLFFTSFTSFASLSVLTLMILTLFYRIIGGRFVYSP
                     RETAYVVDWILDTVSRPVVEDTVHLLLAPNKRRERGIFFTSLCLIGEAGKFLSFWSIC
                     TLASMVWCGWSVRRAWRTHLCAGD"
     gene            <388960..>391536
                     /locus_tag="LMJF_30_1150"
                     /db_xref="GeneID:5653645"
     mRNA            <388960..>391536
                     /locus_tag="LMJF_30_1150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684658.1"
                     /db_xref="GeneID:5653645"
     CDS             388960..391536
                     /locus_tag="LMJF_30_1150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684710.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653645"
                     /db_xref="GOA:Q4Q7I8"
                     /db_xref="InterPro:IPR003890"
                     /db_xref="InterPro:IPR003891"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7I8"
                     /translation="MRLHSAFSNRHDSHKQQQHGRYDHHGDGALPSRAASDADSVADR
                     QRDRKARRRQERQDKKQLRITQHKQWTQERQQARQHARDSRAAEQLQRQRKRQRAERA
                     VTSEAEKNGKRHKDEKAVKDKSEKCVRATANGCTEKARVAGLKADAAMSVTGAAAAGA
                     VAPTASSLADPAPVPAEVAEKVRRLVNKLTAANVVDLTKDLSDYMATPGVSRVSVVKG
                     LAQQIERLCRLEAGPLSTTGTLPFAGLLRGLQLLHGNQVGSELVERVSFSLHAQLAAA
                     EEAAAGNTLMVLAQLYLLYGVDVVFVMSLLRTLLRQGTRLLDHGGGDGATASDASSSS
                     SPTPASVVAVQAVCACACGLALMRACGEKLLKESPTELEASLQEARRASTKMRNITGT
                     ARFAALVEVMGDIAAGRTRKARRAITEEAAPVETMLEDLCSLLPGQNKVTSTQRRAMK
                     RLVLTTNIMSGLTWAQVTSSEKPPRWYIPGVMVPSAASARDDGDESAAATSGKHSGIA
                     PASKENGHSRHIPPSHASSSADDESEEMEEVDEVELKRERIARMRAEEKALSGQRLNT
                     EHKREIFRCIATAADGLECFTMLMYRDPGYTRFHDVCAVLLQCVYQERKYNPYYVQVL
                     MRFCSAKPACAKTLQFAIWDRFKSIRIENTDIAGYLNFACGIADLMQHGVYNLSLLRG
                     LDLENTNKTIGLFTRMLLLRLILQLPASRLTQLFFGGDGSSAHDLQVDTSVLRRLLTK
                     FMSLYFIDENASKRWLPDFYEVVAAGTDFDVSAAAKPQAAPDLCDSAASATDAGNGTA
                     EERVLRRNADRPPSTLLDNAPASSRAALSRSKSAASAEAKLGQFMTRVQVVYKALKHG
                     IL"
     gene            <392542..>397908
                     /locus_tag="LMJF_30_1160"
                     /db_xref="GeneID:5653646"
     mRNA            <392542..>397908
                     /locus_tag="LMJF_30_1160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684659.2"
                     /db_xref="GeneID:5653646"
     CDS             392542..397908
                     /locus_tag="LMJF_30_1160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684711.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653646"
                     /db_xref="GOA:Q4Q7I7"
                     /db_xref="InterPro:IPR001345"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7I7"
                     /translation="MMLAKSSDKRRHCSRGERATALMPRHGETEVNSVDAGSSPPFHQ
                     HLFSSSGTVLLEDMLEEEEEGGGGGERLVLHFDSSPPSSSPPFAPRTEAAVDDDAPPD
                     VVEGVNSTTATVATPSTLRLPAQDGTTAAPRIAAAAPESSARAPLSTAATESVGASFS
                     GAPRRLLLLRPDTGDAPCSLSTASSTAVPPAAPLSSALSSARGGRVLRISTAAAAKSD
                     TLSAEPAQGAPDTPLPACAVTTRTAATEATSSTLKVAAPALSTTPVSASETAGTPESR
                     EWQPFLLSFAYPVCSTDATTTAQKLPPLLSAPAAMKGRRAIVVHLEFVAVVVGATTSG
                     PDAASIAAHCSRGSVASCGWSSKCLSTDALSPDVAARDTTHRTSHGYSVIIGDASLAS
                     RCFMCPLVAAVLPGNSGRCYDATCKLPTNSGTGEVRAGPLLDVWVRAVSGRQLSAQQR
                     GHRNARELLSSMPEIVLKDQPRPQQGAATLEGATRDEGTCRAPAMQSSSCELSQPLST
                     TVFTASWLSQLCCVFTPCHLATSPYRHPHAGNVRRPRPARRSLWPSSRSPSLVWVATQ
                     VTQDCVVTHPRCLTGSTSSPPLRASEPKGKVRYYWLRSDPRQSDALHRHLCRVFACWA
                     SATSAPLSASSSHLCASPCAASDVVTASSLLDIVVTKANPPTLSLRGGAVGTASAVLV
                     ADETLHTAELEAEDAAEAPSAAPAAPLVAAAERRRLSPSALRARVAITAAVLQHLMWG
                     AVERSDTSCKGEASRAATLERKAMSDPERTPSTPPPPGEQCVVHLEGVTSRLVCAARA
                     LAVHWVCGSPSLLHNAPASLMGFLTEEQQLLSSILPVRRLLSGICARVAKGFDACDPV
                     RAPSTTWLDMLHHFATEYASASLAALTWLSQHAVDTQLLREEGLVSLRLHEAERALLC
                     SAPALPTSSRHGGLVRHRLSSGKGPAFRLGSYTEESHQRFSRDDGTTVVGRSVLQAPL
                     RGKVKVRVEHAAVMNAFMVHLEWTTTMSAAVYDAPPLAPFPDVHAAVELPFLLLVFVV
                     AEDVDGTAHDSADSSWTSDDKSLRGPHGVGGCAVRLYQATPFSWYVSAATCTANGFAA
                     RTTQLLTHALDLVARQPGVFEGFHLQAVTGLGSGATTTAAGSTRTRTTLKRTRGRRRG
                     TGCADGVGEGGASATAVLSKHGALGADTAAARRSRARPRAGKRRRTGVNDNDDGRSEG
                     SETSSDNEDGTIDSEVDDDDASILVLHVGSSRGFRAAAAAASPPDSAPARCRRPDSGF
                     HKSSSNASLSVFDTARVIPVVVFRQDAAAPLLEVEVSQASQLAAQLAAFGSRATRSAG
                     RNAKDEDDPQEEASRVLCALLDHWIGFSSLHAAAPHYVASLQASQRHGALTLTTQLGS
                     LSSQTGALTERCVLYAYADLLRSLWRELAHLSESSPPSTETSPSASSPLTRFVSVAAL
                     RAHVLDPVCVAAAIEAAIAEYERQDIECRKRLLAAKWYAAAQWALGEAEEEEKKKKEG
                     GAGNTGGARRSKPRKQTQQQQRQRQEAEASTEAAARATWASLTMQTNALVRAFYAEVL
                     RAFPLASPPLPTDNQPRTIHAEVESGSFCGTSGRNVLPRGVSSSWSPTASEKRATLLS
                     CLRGLLQSVEVEEEGPPPPRRGDTTVPTSPAFRLQLTGASADKVSLLQTLPSSLKSRQ
                     WRATGAGAAADLNVTVAQLAETCVAQLSCTPSHSCLRLAGATSASARSGKKRVEKVAP
                     WPVAGDDAAAQRAAELLLVSDALLLPRGKRRASAASAHGQATAAKLALPLAQLMMNAE
                     AMLH"
     gene            <399347..>401395
                     /locus_tag="LMJF_30_1170"
                     /db_xref="GeneID:5653647"
     mRNA            <399347..>401395
                     /locus_tag="LMJF_30_1170"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684660.1"
                     /db_xref="GeneID:5653647"
     CDS             399347..401395
                     /locus_tag="LMJF_30_1170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684712.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653647"
                     /db_xref="GOA:Q4Q7I6"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7I6"
                     /translation="MSQPPNTECLYSPVEGESMKRLSTATSAPRNARATPQRHAPPVT
                     PNGSAAFLYRSPLTLTGAKRPDESQPAAATSETHPQCAAASLRESAYDMDAREELPAF
                     GYRGGTSAGLRKKCHGNAAREYPMEETGDGVLNPFRCECGSDSGSSGGSGKGRDGGAM
                     GSAIAADDGQTTPLSATEYVKENGKPLFSLSHIPAPTTAEEYYARVAEIDHVRCGLGQ
                     ELEGDAKDIYGPTWPFSRRMIASRVFGTKECPAPNCDKKTNIQAVTGPRAWTLLFIYG
                     ILIVYPVFTTVAYAGEGGWQCIIVLWLLSGLTIVFVTLCAFTNPGIVPRRRLKNVTDR
                     GDILIVRVPAPNAQAVLGKLQELPERMGQPPAVKCGNGVSGAAANASAYTAEALRSAV
                     ADGDLPASVFNHKRSTRYSMERYFETDTGRIVLYNPRLSESDLAVPTLEFPILFCRTC
                     QIAKGPRTRHCKVCDNCVDEMDHHCPWTNCCIGRNNYPYFFGSLFFLHFMVLYAILYN
                     FAQGIRLSYLHPAWNVQRFLRYVYGMPIIVYISFFILGLFFFPLMLGHVYMTCRGLTT
                     AEMLKQKWKRSEYFGGINPWSQKHWYQNIYARLLQRWPAAQEDPLRWLNSRYYYGVTV
                     AAAVEDQKVDWLLALPPEERKKVEEHDAAAREAGAKIREEQEAEIVRGAMEKRGFHVA
                     "
     gene            <403802..>404302
                     /locus_tag="LMJF_30_1180"
                     /db_xref="GeneID:5653648"
     mRNA            <403802..>404302
                     /locus_tag="LMJF_30_1180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684661.1"
                     /db_xref="GeneID:5653648"
     CDS             403802..404302
                     /locus_tag="LMJF_30_1180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684713.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653648"
                     /db_xref="InterPro:IPR029248"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7I5"
                     /translation="MPIISHEVQALRRCTTPYIPLIFRNWNRLVLVPYRLAMWCVHFS
                     TLICVTRGSDRMIRVSSLARGYAEEDYVFLRQVTNLCLATSFLCLFFNLWGVLTSRTL
                     RFGVDNWFQGSCHGAAAVLLIVSWQATAHVARIWQMFCIFSIIPTGIEAITLAHSYWR
                     GMEFFW"
     gene            <405224..>407110
                     /locus_tag="LMJF_30_1190"
                     /db_xref="GeneID:5653649"
     mRNA            <405224..>407110
                     /locus_tag="LMJF_30_1190"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684662.1"
                     /db_xref="GeneID:5653649"
     CDS             405224..407110
                     /locus_tag="LMJF_30_1190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684714.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653649"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR003347"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7I4"
                     /translation="MPSSSPLLGPVFEVITPRLWVRYLQRYLDVPELLTLSETCWTFF
                     VRCNEEPLWRELCLRPPYIDVQQKLGLFTFRGSWKYTVCAYRAEGAGADRQSSRSSTV
                     VLAQSRSIADASLRFNVLLPRIVSCLQVSGEMSSDDGAAWMSQLRSPCAAGTGAASEV
                     SVGLDNGRDEGAAEATVGAEMSVGAWQENVLGKPYAPTLAVKYLSLSAGAINYFMRDG
                     TFLRPPLHALRQPQHRLVRPHTEFTDYNWYGTCLLDLVPLPQWCTNAQFFATLRWKTS
                     GNTRRLQCCGHATAALDDTGGVRGPSHLPDELRGVPGVVDRRYRLSVDAFQREYEVPN
                     MPVVLTGCIEDWPARDTWQDIHFFHCFASEALRANGRTADGRRFRMSAADYLAYEVAT
                     NAEKPMYVFDKAALQRSTALRADYAIPPYFTEDFFSYMTEEDRPDYRWLLVGPDGSGS
                     PFHTDPHGTCAWNAVLSGCKRVTLYPPHVVPPGVEEEWIHSDYYASEPCLRWYRTRGD
                     SMPSGSAVCGTFSKEHAGEAYHGSARELPPVEALVFPGDLVFIPSGWWHQVLNIGHTV
                     AVTHNLCSPLTFPRVVADMNAYADRTVRKRFQCALRRAGRDELAVQLRVPGAKRGVYA
                     GHLL"
     gene            <409236..>412256
                     /locus_tag="LMJF_30_1200"
                     /db_xref="GeneID:5653650"
     mRNA            <409236..>412256
                     /locus_tag="LMJF_30_1200"
                     /product="putative ubiquitin hydrolase"
                     /transcript_id="XM_001684663.1"
                     /db_xref="GeneID:5653650"
     CDS             409236..412256
                     /locus_tag="LMJF_30_1200"
                     /EC_number="3.1.2.15"
                     /codon_start=1
                     /product="putative ubiquitin hydrolase"
                     /protein_id="XP_001684715.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653650"
                     /db_xref="GOA:Q4Q7I3"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7I3"
                     /translation="MSCYCVEEVDLDIFRGVFIEQWLSGKKHGSCEEALFFCTTCGPP
                     AVQESIKGFSSSVSSSGANRRSAYTTKTCTPEKKSSSGKFALGSTLKKLFTSSKSSSK
                     ADLSTTSSKQHSSCHVRELSTRIMSAEEEELPITPRTDKELYLCVTCGSCYCRDHAFD
                     HHYSRQQRSTVAGGDDPDASHKGYPYHSFFIGVPSFVSTHPSHILQETSWGLLFPTVT
                     VREIEEGTVDLSKPLPFYEHFEEICDGGAACEASAFHPNSSATSNSCSFGRGKNTLGF
                     CPSGMHTRIHSAYSSSGHLDGSLRVYSKSNSYVDKREDRLPTRRSALLSPVGDHGSLS
                     LPEFHSSPPENWSYIMFCARCADRQAVRLNGKQCDNDISRHVHLRRLGQLTALLAYFL
                     LRGVRLEVPVQFLEYSAKKHAQQVERQRSQQRAHRLAEMQRVGRASELVGGLEVMATT
                     GARHTSTSGGGVHMSPTGPNVAGDFSLLSRTETDHVITRAAICGFANESYFCYMNSVL
                     QCLLRCRIFANPLLHLDPSKSPGKLTASVSRLLHHLAHQTYQDVLNGAVFAFVRSLRT
                     QICNINVLFEEDEQQDAQEFLITLLNGIEDEFDKGKSEEEKKASRRVSFESTLLSEVT
                     CSQCKHCVPRNEMFMSLSIPIEKSIEDGIASLFAPTTLRGKDRYACEGCFKKLSQKEQ
                     QGHNALAAVQAEAERRAKLDGKKLTQAQIEERVYANALYSEAEVRASLSHLGGSLAVH
                     LLRFHYDPTVQDFIKVLTPVRISLTLDLTPYVSGEVVEVYKHMEKIYLLQRRFPTASE
                     KLICKYLSHANDDVKLATQKMLDDGHGIAEAAHSRQSSSTTVSRTHTGVGAGNAVGDG
                     ASEDAAGFGSVFGDASGCTSGCTSSLAATPLNNLNGDRGTFAKMAAKSWANTNGSAGK
                     ATPSDPAAAICAITSDEFDPFGERTPPKPSLVRQLVGIVAHRGSLHGGHYIAYVRHLT
                     RPHVWFRCDDEDIDVVEEKHVLDHEAEVYLAFYE"
     gene            <413772..>414032
                     /locus_tag="LMJF_30_1205"
                     /db_xref="GeneID:5653651"
     mRNA            <413772..>414032
                     /locus_tag="LMJF_30_1205"
                     /product="putative small nuclear ribonucleoprotein
                     polypeptide e"
                     /transcript_id="XM_001684664.1"
                     /db_xref="GeneID:5653651"
     CDS             413772..414032
                     /locus_tag="LMJF_30_1205"
                     /codon_start=1
                     /product="putative small nuclear ribonucleoprotein
                     polypeptide e"
                     /protein_id="XP_001684716.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1205"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1205"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653651"
                     /db_xref="GOA:Q4Q7I2"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR027078"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7I2"
                     /translation="MSAHTRQMENPTGVVHRFMQDHQRVCVWLVHDPQIRLEGNLLGY
                     DEFMNVVLGDTTETNLRNSKSYRLGKILLRSDNVGVIYPIGV"
     gene            414992..417772
                     /locus_tag="LMJF_30_1220"
                     /pseudo
                     /db_xref="GeneID:12981169"
     misc_feature    414992..417772
                     /locus_tag="LMJF_30_1220"
                     /pseudo
                     /db_xref="GeneID:12981169"
     gene            <419978..>422149
                     /locus_tag="LMJF_30_1230"
                     /db_xref="GeneID:5653653"
     mRNA            <419978..>422149
                     /locus_tag="LMJF_30_1230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684665.1"
                     /db_xref="GeneID:5653653"
     CDS             419978..422149
                     /locus_tag="LMJF_30_1230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684717.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653653"
                     /db_xref="GOA:Q4Q7I1"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7I1"
                     /translation="MSGGGNRNLGGGGSSGNRNAIGAFSPYSEEVPVECLICADPCRA
                     LCVFPCGHYTCYSCGLRIHSLNKGSCPVCRKEATQMPIITQQVSREEEQFSAEEMASM
                     RRVVTTNRYLRCVIDSPQLAYEVAKLYEYTCPIESCWCQGYQDPFLEVNMLKDHLWVD
                     HELVYCDVCLQHRPAFLCEQVAYSITALQYHMEGRCRHDRSSFTGHPPCRFCKRANRF
                     YDGESLLKHMQQQHYTCDVCNRGQFTFTFYASRQKLDQHFQTCHKICDHPDCASLDLM
                     MRVFGNEIDLMVHKQRVHGVKAKVTLSPAMFGEASGSSAGSGPAGSTPATASNANVIQ
                     ITFDHVFRVETVEMMPTKENNHRGGRRGGGGGDRGVDRVHAPEENGIPLYYLGSGAFP
                     VLTRSVASDAGAASTSARAGGARSNNRSSASSSFAFAVAEDMSNYNVKNKLPTDKQQL
                     EQRLNDMLSKHVRSPVTYAHFRSYTRDFIDSAMLTSEYYDVLAKECFPDPQVFHKVFP
                     LIVATVPVAAKQAALQEVYKMRMAPETQRVARAREEDARKEAEAKAAAARAEEMRNCK
                     AGKSTSSNNGVSNSTPVGAPSPFGRKNAKGKGAKQNAWLTMDTRSKFGCSSSAPAQHQ
                     DPSASAPATAPTASAPPAAASLKPQSNNGPRGWGSVATASSGTFVTTPAAASVPVSSP
                     AHLGPGLVINEETFPSLPNNGILREPIGKAQRPKANAWFKR"
     gene            <423493..>425115
                     /locus_tag="LMJF_30_1240"
                     /db_xref="GeneID:5653654"
     mRNA            <423493..>425115
                     /locus_tag="LMJF_30_1240"
                     /product="putative calcium-binding protein"
                     /transcript_id="XM_001684666.1"
                     /db_xref="GeneID:5653654"
     CDS             423493..425115
                     /locus_tag="LMJF_30_1240"
                     /codon_start=1
                     /product="putative calcium-binding protein"
                     /protein_id="XP_001684718.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653654"
                     /db_xref="GOA:Q4Q7I0"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7I0"
                     /translation="MHINVEKQQASPPLIAHAMREKSKIGSEEEEALTAMVPQRRSQR
                     CCCCRFHFAYLQPCSLSRLFSMLPFLLCKQHRFNVFVCCLCLRFLLEEVASLDTHTHT
                     ERERERERDASVHQGGRPARGDTTKMSVRMDASLYSDVVRIERGDYLRFHCEQLSADG
                     RDTQRYFFGCYYPRWHGFYLEEVRSIIGNMGYCELKHFPAYPFDVYLKPADVTAAADS
                     SQNYDVDSANVTTYITDDFQVNNILVLGPPQNQRDDAVKRFKIVSVDVSHLKTKTFSL
                     APVANLNSSSIQNPNTMLSTLRAPGGERVPVQLESSVLDILTQLRDAYIDHAGGGIPE
                     IGIKAMGRPFRKVSDDGRRWMTRDGVRQLVRGSRAFGAHAGCLSDTRHALQTIEAVAG
                     TIFRAFPHEEATHPVAPGEEACEERIDYDVFMDYVRGHMNSTRKKAVLEVFQRLDYDS
                     DGNITIKDIQATFNAQEHPVVVSDAIFTAEKLLKGFLAIWDENQRHFGLVPYTEFMDY
                     YNGLSAVIEDDAVFLGILKTTWKVPNWTIHFV"
     gene            <426692..>427600
                     /locus_tag="LMJF_30_1250"
                     /db_xref="GeneID:5653655"
     mRNA            <426692..>427600
                     /locus_tag="LMJF_30_1250"
                     /product="putative Pyridoxal kinase"
                     /transcript_id="XM_001684667.1"
                     /db_xref="GeneID:5653655"
     CDS             426692..427600
                     /locus_tag="LMJF_30_1250"
                     /EC_number="2.7.1.35"
                     /codon_start=1
                     /product="putative Pyridoxal kinase"
                     /protein_id="XP_001684719.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653655"
                     /db_xref="GOA:Q4Q7H9"
                     /db_xref="InterPro:IPR004625"
                     /db_xref="InterPro:IPR013749"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7H9"
                     /translation="MSDDKHVLSIQSHVTHGYVGNKAATFPLQLHGFDVDAINTVSLS
                     NHSGYPVIKGHRMDLEEFNTIMEGLRANDFLSDYAYVLTGYINNRDIVQQVAATVTEI
                     REARQKQGKKDVVFFCDPVMGDDGRLYCKEEVVEAYRELLSHADVATPNYFEASILST
                     VEVKDLASAIEAANWFHTQGTPTVVIKSFAMADDPTHLRFLLSYRDKATGSTKRYTGV
                     VPYHEGRYTGTGDVFAASLVVFAHSDPMDLAVGKAMGVLQDLIKATIERGGSGNATLS
                     SRELRVTSYPDQLQHPSSVALVTPLP"
     gene            <428533..>429588
                     /locus_tag="LMJF_30_1255"
                     /db_xref="GeneID:5653656"
     mRNA            <428533..>429588
                     /locus_tag="LMJF_30_1255"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684668.1"
                     /db_xref="GeneID:5653656"
     CDS             428533..429588
                     /locus_tag="LMJF_30_1255"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684720.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1255"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1255"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653656"
                     /db_xref="GOA:Q4Q7H8"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7H8"
                     /translation="MRDGHLAPTATATLAAQFSVYCLEKPKQDVSDGYAAAPACESAP
                     TSLPSKADLAAPLSYLDVVQQLDGDSEWSFAPYPRCSRAQLLQVHAYWVAIRNSAAPE
                     TWKPSRSKASDGASEVHKSEESAWIRGVEEATTTPRCLCDRDDGCLAGSCPSADALWL
                     ACVVGVVWVRLSARTPSTHSLVNRRTPHNGQVSAGSATTGSPSVSLCRPSVEGYIQVV
                     VTHPHYRRRGLASWLLTQCLACTEAPAGVFASDQRDGVTYAIERWHLHTLAATRRAAK
                     RSRDDEATWACRQDRTRPDQHRQDANHGRSEGECSEAVVAATLAMYRRLGFHERRYLA
                     RYYAGKNDAVELMKICF"
     gene            <431050..>437022
                     /locus_tag="LMJF_30_1260"
                     /db_xref="GeneID:5653657"
     mRNA            <431050..>437022
                     /locus_tag="LMJF_30_1260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684669.1"
                     /db_xref="GeneID:5653657"
     CDS             431050..437022
                     /locus_tag="LMJF_30_1260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684721.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653657"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7H7"
                     /translation="MPLPSAVSFTQAKWLAFFAELTAKLTHHNALVVMEGAELLKRLL
                     LSRVSIAAVLQQGDLLVRLLDTWRGCVLAEHPSKFLHHDDRNSSAFPAPPPPPPSAAV
                     ALNDELSFVLAESISQCIDLMVSLYADGDPYYSLLVLARAGPMLEVLVDVIRMAPSQI
                     YGITASLLQQLLALPLGRDSIGSACVGDVADGARGEGAQLGFDRATLAQLRKSIPLQK
                     HVRSLVEAIQGHGVLLQYAADTLVELLAGQQGPRRFAAIALFNQASKRLRKHQLRRGG
                     ASSAAASAPGGDATPGIPPQSRCDARESTVNDSDLNVTITGAAPAHRPSPSPSPSPGA
                     VAPCALDDLERGLQSPAKHRHGGAAVPLGEAEEAGGAAAARGGVSLARDAAQFPSLPA
                     ANPAADSDKPPAPPSQPNDISAMVDAEPQRLVCAVPLTVAEEALRHLASSRSHDEFFA
                     AFDWLWCLTVADAPVVGAALTPEMLRRSLGRYLTAAPQTRRDRILFTLLLLWIGHVHS
                     VSALREETHSCVLEVAASALLPMLRTELAKDGERASPGQACGSSNKQGISSLTVSAIT
                     PTNTNIAATTSATMLSTQETAGPLGYGDIGSDPTVAGLSLDPSLFRRGERRDNGSYPS
                     AIGSALLPYAAARKAQEAAVLLRPSIGVILLSFLLNIHAGAAVHAQRVWVSQGRVLEV
                     AQMAIRRAQGCRSALLDTPTTIDGALSDEVYLEYALRSVRTDATTVAVLGCRLVAAVL
                     GDELRWGAAARDSSTAKPAPTEKVRGEGNTAAALMQAELAVSAQSLIPLLVDMAANNP
                     DVTAAQESGAASPVHHVPLNLRCSRYTSLGECSLVALDACLQYHAQAGHLRSRGDVPM
                     SVSGFAIEDLVRVLPSLTCVSQCSVHPPVRAVPYRLLLYVSQRLEEVLVVLRHMPSLA
                     SAAVSCVLDYGPRAAQWEAAAAAEWLTVLVDLLIGAETAKQTAAPSCEGKPPSPSQQR
                     RRLPTAAELLNEYFHFDDTPLSRKLLLTIASGRRNTSTGSAYAVNALLQLATHLQTYL
                     QARSRKPQQSSPAVLSSVTREAAAVKEAVTLPLCPPGAPSLAQWVLLLQSITADNRRL
                     TRICSAFKHPIGGGHSVLRRGSGGVTKDACTRAVTAAEQIALQYNFTGTVFRALESLL
                     CDAASGVSAASLSSWLLCDAAAAALMLPTPSDVVALVSTRFQAARAPEAGDGDAAYLP
                     PSWIPSPALVFSYQAAIQWASRVGASWLTGSYGAAAHAEVGASNRTRGHGGLPLKHGC
                     TGLVEDICTGALRAMQEMTPSVSQRTRCLAATLVSAVVDACPVEQLGVLEAHGAALFA
                     TSVTLRRLPCVSGLQCRLLRRVRSAAVHAATSSDGWLEESLTSLRRVVDRLQENAQLP
                     PSSAKNGGHSSHRRLSYQPHDAAQAVRELQNFQVLVSLLTSLVSCTGATRADGAARAS
                     SPTTEDEMSSPTQRQLLLTDAQRQTLCAALCDALRVHQLQPTVVLAVRSMADTHEGRR
                     CILTEIASTGDPLGRTLFGRLMALTLHMPSRWVGADSAAGTRSSSRAFSPTSTPQDRH
                     RGLKSSPSQQRLPSITGAAATAASSASPPLRSPPHGETPQPADRDIVCVVGCDVCTML
                     CGSRSQEGVGGAKPLADAGPSSAPTSTVFLSAFVKHRGVEFLARAVVESDRELRRHGR
                     DLTVPLHWLRLVAALSLHLSIAKPFVQHSDFFSVLMELAGTPASALHARAATLALLAI
                     RNVCFADGLKSTLCQDARVLLTLKAAGMGITAVSQLIEWRPPPLPPPNSKRSRTAARP
                     TVMGGAPPLTSRGGARLEVMLREDVIDMENKTEVDWAKQACVYARGMTRLGEEPLPTI
                     DDPASCDATGDVVAAEGKPPSAAPGGASGADHVVAAPLPRRLFGDITNHSRAADAGGS
                     LLEIDATVSGGSPAKQVEDTMLPVLVAATDSEAHLRRYLAATAIASLWFDNQRGRSAI
                     ARVLAATPCWSMEDVQAAIKASVAPTMGAQVS"
     gene            <438145..>440262
                     /locus_tag="LMJF_30_1270"
                     /db_xref="GeneID:5653658"
     mRNA            <438145..>440262
                     /locus_tag="LMJF_30_1270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684670.1"
                     /db_xref="GeneID:5653658"
     CDS             438145..440262
                     /locus_tag="LMJF_30_1270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684722.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653658"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7H6"
                     /translation="MTSQERQAAVLALVRRLLPLAQPGLPVHSPTHFTQLCDGIALFA
                     MLRLVAPNSFPSTCSESTEGGAVASLTGPMPEEDVQQRKDNMCALLRDIGAYAQEAMH
                     TTSSTPVTQGLDPAVLAGLPGDEDAGSAAAEAAQRQQLMQLVGVAVALVVLSGVPAVL
                     SEVKSLPRQEQVVLSDWVKEIMRAYQLKPRHHAAAVSEPGPSGVSAHLRQTVSPQLAS
                     SGFAAGSPSVIRGATGLSPSPLSYRGASSNAAAAAGEEDEGYYRNATYQLRRELAGVK
                     AQLAALQDAYKVSKEDKEMAAGKYRLLLGDQAKMSATLAVTSAAAATEGGDSEAEGGG
                     SSDILSVWQRRCAQKDETIAALTARVEQQSTQVTALKEATAAHEMALQALRRRLKTAE
                     EGVMVKSEERREALQKLAVAEDKLAAQMKARVELETQVEELQSRLVVLELEQDRLRGL
                     GSDDAAQLNISFASNGSVDRVLALENELDEARQQRDSLQRQVGILQRQVVAMVAPVAD
                     VSTANDTWRAQLRQVEREREDLRQQLTTALERVGGLQQQLMASGAAAAVMDASGGGAG
                     QAGPASGTANVDVSMMSAEEGSELDMGLFDEGTDSPCGRDRGLTPCSKTREPACREQV
                     ILSSLLLQYSYRNLLLQQHQTLLHKDAMEAEAARRRQAEEHLEIMRQTPMSLLTKQRR
                     DVEQGLLETVLLGAKLRMMQVES"
     gene            <441224..>445567
                     /locus_tag="LMJF_30_1280"
                     /db_xref="GeneID:5653659"
     mRNA            <441224..>445567
                     /locus_tag="LMJF_30_1280"
                     /product="putative vacuolar assembly protein vps41"
                     /transcript_id="XM_001684671.2"
                     /db_xref="GeneID:5653659"
     CDS             441224..445567
                     /locus_tag="LMJF_30_1280"
                     /codon_start=1
                     /product="putative vacuolar assembly protein vps41"
                     /protein_id="XP_001684723.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653659"
                     /db_xref="GOA:Q4Q7H5"
                     /db_xref="InterPro:IPR000547"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7H5"
                     /translation="MKRHDSAGDASASPSPLAPLPAPVQEADHAHDGSRTSSSSSTPA
                     SHHTLEKRETASCGRTRHSFPGGGENAGDDGVDGTENDSYTSYYEYDSSYDEENSNFV
                     HSDKCRGSDSVDDDRFSTAASLLPQEDLLRFLSYTLAGAALKDHRLMAMEAFRHILVL
                     GTNQGTVAVVEPSSGKLKEVYTNHHEPICDVDCTINELYIAACDKAGYVTIQSRRDVK
                     DVWMAELSGPIESVALHPLYHKMDSCPMVCGGATKVLLLTKGVLWSNSRRVTTLQEGR
                     GRIHKVRWCHTAAVDVVAWLSDAEITLYNMKSGAVARRVSLPGLPAQNALYPPTLRWE
                     HNLSRDPTAAATSAATLLCGWGDVVQEVQLHADPHVRRLSGGGLFSVDRSPRSTLLQG
                     GWRGTSSSPFPLRASFGSAAPASSPSPTTVAEAAGRAPCVVELRTSQPLRPSTTLFPY
                     RVCGIAPYGPQRYVVLAGIVEGGTEGVLKDLEVRVVDRDSLTDVYRGRMPIRFIHPLQ
                     LRLTYLEFLPSLAAKPAPAASLPQLALPTDPLAPSPMMQYFILSVDTIVKAVPSDIDD
                     HVEFLLCTSQFECAYRYAAAHARQLRRHVLEHVGQQWLMHLFHNRSTEEGALLKIVEL
                     LPELIPRDNSAAWEQWIYRLDTCGESWRLIALLPASTGASAEYKVTSTQDMQEEQDAY
                     AEHADAAARSLPRPVATLQTPIQREYYDLVLLRCLRHDPSLFFAALHKFYTLFSVPVV
                     LKATEVVYREQCAAAAWWEGDSSDEEKNDNDDKHVQTRDVTASNASPTLNTASADQSG
                     VPPGAPASPPPTTPQGTSEETSAPRAASDPSQLTTAGAGAASAPSMSRTSRWSLVASY
                     GFLLRCARRHEEALQVLLHLPASPRSDREVFGLIRDQQLFHKARELLPELLHRREDAT
                     LQLLMEHVAEATGRNGVTDGGDAALVSQVVAAEADGTAPSSPSLDALQYGSAQDPLCT
                     ESVISCLEKSDRLHLLRYLNLVQRRYPEVFAQAAKRHAQLVATLYIDYDRPSLLPFLK
                     QMSMYVERIRELHALCHKHHFLEEEIFLLFRMGREDEALRILLERMHDLRRALKFVVT
                     VPDLEEQAALFTRLVDYTVAYNASLPTGSLDSANTATGGAGARMRYVMHHTKPNETYA
                     SIAEQYHVALEDVCKANGVAGASGSAVSPPLSAAVEASKRCTSCSSPLQGQGEAQRRA
                     SCDADASKDLPAPPPQCVVPLNLFGDLLRILAEPPFMEHPALDVRLVLPKLPSREPIL
                     HAGPSIAAIAHAMAEEIAFFSTVCKVGENDLMGYYGQLLKRRTAAIAMGRPRHPAESG
                     TTAINEAATTPRHAAAELAEGSSVVHRCAACRQLLAQRVVVFACQHMYHPACVLQYLR
                     KSPTDAFTGGGGAAFGGRAGGAVPVMRDGAALALPVTSTAAAGAETMEAQLRKLPVYC
                     RACRQHSGEQS"
     gene            <446283..>447149
                     /locus_tag="LMJF_30_1290"
                     /db_xref="GeneID:5653660"
     mRNA            <446283..>447149
                     /locus_tag="LMJF_30_1290"
                     /product="putative U3 small nuclear ribonucleoprotein
                     (snRNP)"
                     /transcript_id="XM_001684672.1"
                     /db_xref="GeneID:5653660"
     CDS             446283..447149
                     /locus_tag="LMJF_30_1290"
                     /codon_start=1
                     /product="putative U3 small nuclear ribonucleoprotein
                     (snRNP)"
                     /protein_id="XP_001684724.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653660"
                     /db_xref="GOA:Q4Q7H4"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR007109"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7H4"
                     /translation="MRRSVIRTRKEFLERKQHERVHEAIHARKEQFRSAVETATPLPG
                     HLKKDALALKKFTELDDAQTRNLTTTVDDEYANAGQEDPHVLVTTSRNASQKLLEFAK
                     EVRLIVPNAVRMNRGNLSVHQLMDAARKENYTDVLVLQESQGVPDSLIVSHLPLGPTV
                     TFTIHNLVARHDIDGVGTMSEQYPHLVFENFSTKLGIRIKDVLRYLFPVPKADASRVL
                     TFDNENDFISFRHHTFKKEKGKKQVELTEVGPRFELTPYRIVLGTLEMDDAETEWVLQ
                     PYMNTAKKRRLL"
     gene            <449477..>453184
                     /locus_tag="LMJF_30_1300"
                     /db_xref="GeneID:5653661"
     mRNA            <449477..>453184
                     /locus_tag="LMJF_30_1300"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684673.1"
                     /db_xref="GeneID:5653661"
     CDS             449477..453184
                     /locus_tag="LMJF_30_1300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684725.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653661"
                     /db_xref="GOA:Q4Q7H3"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7H3"
                     /translation="MTTSARQAALRRRMEAFTSAVVHQESILDAVAAACRARLNTVGG
                     ATAAPTPCFFFSALPQISVRQWAGSHLYKHWLVRCGTPRASLPSTATNPQKSGPHGAP
                     MLTSPSAPRAPATALVLPLDVEAELRKYWKLHDEAAARARLEALRCNDAQAFAEHVSL
                     LKVSALLEIMEKTEGFMRRIGLRLQFHATQAAANRGGDGARAVPTTRAAPAALAEPGI
                     ADRPGGAAGCHGSEYERFRSYVASTKNEFKLMHRVDVFVAAQPAGLDATLLPHQMDGL
                     RFLASLDANHINGILADEMGVGKTIQTLAFLLYLKNRRGETGETGEGSGGRVAPPRVG
                     SRLPHLVLAPLSVVREWREACEQFVPSALHVAMYQELADPVHEAAAYDLVLLPVHAIR
                     YVGAEAARIQWHYIVVDEAHKAVANLSTITAQRILGLSCLRRLVLTGTPLSSDLQELW
                     SLLHFLNPEVFTDNDAFEEVFRRPFRVYGAHEMELTEEERGLLILRLHQVLRPFLLRR
                     TKADVDSTLRMTFHHMWCPLSAMQQRLLCMLREQRRIPTVLGMAGGYSGKSSSSSEAD
                     NEEEEEAAGAADAAAHTSTFPAAEIGADESTGCTPYIAVAALAADALHGKASPDLDPL
                     QARNETAMPRDRLAELVWRHLPALASTESSDILRCAVQQDRALGLTSAGVSESSARLV
                     CNHAFLLPFFSQVLHRHGLDEVTQEGCNDADAAAVATSESSVVGAEAAERCGAAGLTL
                     ACSGKFLVLHLLLSRLYVAQRKVVLFTHWLNCVDLLVDYLYSRGWADHAEVLTGGSSE
                     AERLTSVRRFREDPGCLFFLLSIKAGGCGINLQAAHMVVLVDRDYTVTNEDQALARVY
                     RIGQRYTVRAVYLATTDSSEQHVAQRATAKNKPRQAIINDGVYQVTTASEGERVGETG
                     EAVTAAKFADPPSHAYNELDTSELWRSISGATTPPSPTTAMQEARRPECDGTASGAAR
                     PAPFSLPPPEAFWVALSCLVESMDELVLTEEDRAAATVRSAEEERRSMGCTPANSAAA
                     RLLATRPPRSTAELHLRLQGGRDEMFSGPQRERGVAPSLSGTAASDAYLGVWKQSAEA
                     PTTGDRTRSHTPSEPQAAALAAAPQPTPRSAPVTDPLQNSALFWLEYSHLLRIAGRGP
                     YLLSDSLRVAVTNDTRKNDPEERVRRRQRRDRRVAKRLRLASVDVPDDFREACWAKEG
                     IDDDAEVAERYLRFLDANAGKRRQRRRKDAG"
     gene            <455157..>460304
                     /locus_tag="LMJF_30_1310"
                     /db_xref="GeneID:5653662"
     mRNA            <455157..>460304
                     /locus_tag="LMJF_30_1310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684674.1"
                     /db_xref="GeneID:5653662"
     CDS             455157..460304
                     /locus_tag="LMJF_30_1310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684726.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653662"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7H2"
                     /translation="MVTERQVLKGGDGGGGDAARCTGVTLCGAMTPAEAASHATEWQN
                     HRLPQVQAPSSSASVPATVEEVVVSPVRLSDTVTPQKPPQHYTAASTADSKVLFAEDE
                     DEEGEDEGRQPWRPNHLCAASGDPQRSARAEEVEHVLGELSECSSITSARPQAPRRSP
                     DTRSGRDDRVLHHGCAPTDSNKEVQGGPLDVSYTDTTVARGAKAVLGGEDGEKARRQT
                     CVACTTPSLKPACPGLSEGSVTPVLEGQVWGAASAAATFTETLAVQDLSLLPDESGGG
                     ATLDVGGVAKGDGCVYAPLLSSSTGQRTPYSAIANAGASARLRGDKLGVTAAEEVLLG
                     EGLISPPVKRTTAIPQQATHAVEVAAEDGTETRSRAGETGAGPSRVHGKILAMGDSSS
                     STTFLSTPSSATLCAVTGGGEASGFGQNMNTPTSPSSADGAVLMTEEQPPPPPRVSLT
                     PSSPSPPPNSLPSTLDDGLWKGSARSAQADVVDTDAVAPGRCTPKRQGVSDDAPAPLA
                     PSVAVAQHQTVPIDPFLSTPPQFKGESPAIEKDDSGGGVRVRRSPERSGREDAGKGGH
                     SPAVFGFPTRTPPRSAKKSAMAFTSTITGADVDVQALRVGTRVEGRWGRQWFPAVISE
                     APRNGFVQVEWEEDGSRLHLRLREVRLLPGAAAAKRAGAVPAIHEADRCAASVGGGAA
                     ATEGAHDVLTATQLVALMEEEDAEDSRHQPVPPHVRPSASQREMSPPMTTSVCKQVNR
                     SGGEGGEGAEEDVVVRPLGVGHACGTAGRGVYAVNADGDAHPDRASSAASSAGVANTR
                     SPSRSPVPTYAAPGVPPCEVHPSFLCIFLPQTVRRDLLQGEGPPPASAFSSSSSFHYH
                     AGPATELQRRTELQRILHFLTSAGTVVIDSVAQADNMAAQLGDSGDGKGTAFTSHLSS
                     LAAGQHHSADSSPMQGAKTTKAVAGGGRKRGTVGRASLPRRSMASAVAVASHAQRSAP
                     RYFVFLVSSATALMGGSAEASEKLGQQQDVLPVVCLAHALGVSAIHASWLWGIAPGTA
                     RVKLPTPADQVELLPSAAPETWGAWKATRAGAPSTKAAPLPLRFAPFAVKDRWLSAKD
                     VAFVARDDRMEMWLNAAGATVTAESAPSLPSHVARQSLPRGSSRPSASVTGALVGRSL
                     GSALPRCHSESPSRSLPLKQLRAERTPDFVYVPDDVTVPLDLDRLGSVPVLQVSWLAD
                     GIEQHYRHCCDPTSSAEPVLPTPPSLTSVWRTILHAKPPKESYTRRSNTPSQPGCAQS
                     SPSSPPLRPAVSDEEKRCGSEGARSRKAAAATTLGSERDRLSHHGSDAVHPESVPPLA
                     NNRDESGDDAGPSAFPPSAKGGNMDEGVGDTVGAIGGRLNEEEEEALTMRIGGGDAHE
                     PLPREADDFASASGPDGAAAERCSAEAGKDIMSRLAGATGATAAALSDAVGSTESSAC
                     TSHAAIVIGEDYYFTLSAPQPPPPPSLSPHGLSLPHVPPPALPTATIVLGQVVGLQVD
                     APPSPLLRQHLCVDGTASSLTFSQPQCRCRVTLRLYEPKYISMHVDPRSGDVVHQTTV
                     YLAQRWATVPGTSLLFDTPVYVITTAARPHVYFLEEVESEVTAQGVSDSAYHSRLRQQ
                     SVLGAVATPPVSDLFHGAAREPDGTLSPHFHGRRSLSQVAMSSSAPVPTCPITRGCLP
                     TPPAPFSLTQSIANGRPRRDALAPSRTSEGAARDGSGDGVDERRGPD"
     gene            <461518..>462843
                     /gene="ABCH3"
                     /locus_tag="LMJF_30_1330"
                     /db_xref="GeneID:5653663"
     mRNA            <461518..>462843
                     /gene="ABCH3"
                     /locus_tag="LMJF_30_1330"
                     /product="putative ATP-binding cassette protein subfamily
                     H,member 3"
                     /transcript_id="XM_001684675.1"
                     /db_xref="GeneID:5653663"
     CDS             461518..462843
                     /gene="ABCH3"
                     /locus_tag="LMJF_30_1330"
                     /codon_start=1
                     /product="putative ATP-binding cassette protein subfamily
                     H,member 3"
                     /protein_id="XP_001684727.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653663"
                     /db_xref="GOA:Q4Q7H1"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7H1"
                     /translation="MIGAPWPPEAVFGNTVDRVASPAPVPERKISIADQLHLPLSRFV
                     EKMSWGEKRRVQILHGMLYPATVYLLDECSTDIDVAERRTVLELVRQECEAKDGCCVY
                     ATHIFDGIEGWATHLLLMEGGRVVDFKAVEKLTLPLEDYALQFMSKRAHAARGVDGVA
                     AASLSHGSSAAISTTSPACPTTAAAACPTSATTDAPVTYWPRGHADEKRSEIVINCAQ
                     LNYKDVFKNLSFQVFRGERVLLCGGNGTGKSTLLNMLGGKQFFDNRQGSLSVLGKRCY
                     DDMLLNALVSYGGDWWTAVPGGEVHVREMLQLRTSRAERLCEMLAVDMDWDVRHISAG
                     EQKRVQLLLHLLDDKPVVLLDEATTDLDVYQRHSLLQFLYEESVQRGVTVVYSTHIFG
                     GVEGWANVVVLLDRTVRGVHAVWRASEGQPIVLQRVVDAIVSLKAREVF"
     gene            <463623..>464579
                     /locus_tag="LMJF_30_1340"
                     /db_xref="GeneID:5653664"
     mRNA            <463623..>464579
                     /locus_tag="LMJF_30_1340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684676.1"
                     /db_xref="GeneID:5653664"
     CDS             463623..464579
                     /locus_tag="LMJF_30_1340"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684728.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653664"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7H0"
                     /translation="MPSSFAAQQQGSCNPHQNPVRSHKGGYLRCPFNISSSYAELAER
                     RVHEDLACGRSRAAVADKDGVKAFPSTGPQVDSDGIDGDFAGRPWSRAGVGANRLSGK
                     EKRTQQEQAEHIYGRGTLAEDDGAVAATGAVSVTSDLLQENMFAVDVRERAALQKVVP
                     RAVREQVKRRKLEDVKKERLSPGNHCRHGCAPLHTDRAAGEEAGEDDDVESRSEDHMA
                     GPPRERTRFSSPAAGSSRVGAPPLPHSAGSKDHPSGGSSSANVGAERSPRSGPSDASA
                     QRPPLREPTPAPVSAKSNCPKNRMQMLDGLRASALMNKKGRR"
     gene            <465529..>467352
                     /locus_tag="LMJF_30_1350"
                     /db_xref="GeneID:5653665"
     mRNA            <465529..>467352
                     /locus_tag="LMJF_30_1350"
                     /product="putative GTPase activating protein"
                     /transcript_id="XM_001684677.1"
                     /db_xref="GeneID:5653665"
     CDS             465529..467352
                     /locus_tag="LMJF_30_1350"
                     /EC_number="3.6.5.1"
                     /codon_start=1
                     /product="putative GTPase activating protein"
                     /protein_id="XP_001684729.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653665"
                     /db_xref="GOA:Q4Q7G9"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7G9"
                     /translation="MGTRQSSASAAPAPQASNGALHLNKLNVPTPPRIAATESPFGSN
                     TPLAKTPTPTAATATATAAVSGEHAKRFQEALRVDSVDMALLRELSWQGCPVALRYEA
                     WMFLTGCWTAQAATRQATVLRRRVEYAAYIHSSYGIVDWDAVCAMVDSGVDTAVHRST
                     LKLLEHTADAPQVAPPSGTSHSLLRVAPLTTGDSTAMAAKEAAAALPPSLSQRPDGRQ
                     SASLPLEDVRSRLPQNTSGSDAPQPSQLSPPQSADIRSASPSLGIVPAPSDSSFRASA
                     SAGFTDTAGTGPASHPSIFAPPLPGFATLGLSNVVAATAAPPAASGGAGGATGHQLSA
                     STMLGSKELQTLKQIRKDIPRMSGGHCYLRHPRVQGSIERILFIWSLRHPACGYVQGM
                     NDLVVPFMGVVLGYRFCPTHSVTELHAYTEDIFDDLWSVSAVSVTQWINEVEADVYWM
                     TSYLLNTMQDNYTSSHAGITSMMRHLAAVVQVADPPLYHRLVNVLQLHFEQFSFRWMN
                     CLLIRELTETQSLRLLDAYLSDEERRWSVTHVYVCAALLLRWGSQLMAFCEDYISVMK
                     LLQEPPTEQLSLRDMQDVLSEGFVLQNLYEASLKRLSTTAE"
     gene            <468317..>469777
                     /locus_tag="LMJF_30_1360"
                     /db_xref="GeneID:5653666"
     mRNA            <468317..>469777
                     /locus_tag="LMJF_30_1360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684678.1"
                     /db_xref="GeneID:5653666"
     CDS             468317..469777
                     /locus_tag="LMJF_30_1360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684730.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653666"
                     /db_xref="GOA:Q4Q7G8"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR015285"
                     /db_xref="InterPro:IPR018934"
                     /db_xref="InterPro:IPR018935"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7G8"
                     /translation="MVKLDVTLLRFMEDEDFRVLTALEMAMRNHDVAPTALVERIAQL
                     PHGGCRKRLNNLLKHKMIHHENTMYDGYAMKYGAYDYLALRTLSKRGTCTGVGHRIGC
                     GKESDIILVRDEAGHECVLKLQRLGRCSFRSVARNRDYKGNGRARHGESWFYLSRLAS
                     QKEYSFMKMLYDEGFPVPKPIDQNRHALLMELVPGTLLNNITELGDASKVYRRALELM
                     VKLAESGLIHGDFNEFNLMITDDQRVIMIDFPQMISINHPNASELFDRDVQNLANFFH
                     RRFKVDTTWFPSLEKDVVRKNELDKQVYASGHFTRKQQEDLERLMLEGFQRGEKSDDE
                     AGSQARDSDASDDDGDENALQRSDIGNADVDAGVAGKFMTIPGFARGGESDEEREDSS
                     DDDASEGRLLDEAMGAARERRQGEFYAHNADRNANFFPDGKINEDHVKHQIRKSIRRK
                     DNHDFNRHLHRNVQKGRQKQKIQRQLKSSNGGGFFD"
     gene            <472455..>475157
                     /locus_tag="LMJF_30_1370"
                     /db_xref="GeneID:5653667"
     mRNA            <472455..>475157
                     /locus_tag="LMJF_30_1370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684679.1"
                     /db_xref="GeneID:5653667"
     CDS             472455..475157
                     /locus_tag="LMJF_30_1370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684731.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653667"
                     /db_xref="InterPro:IPR007557"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7G7"
                     /translation="MTPKVRALSGCPATAGSPSEDSGLLGVSRTPGHNAVHHPAHSNG
                     SAACRSTQHRQRGLSTPHSNDTSVVEATPNAGRQRPSRVARATLLASPLYAPSNGVGA
                     AADTRTSGVQDDNGSGSQLPSQSSLLCTPNGACRSAAVAAAAASGTRSRLDTPTRLDE
                     IPLFFNNSFESGFESPPGDAAAGGGYSATQMTPYRTYDLQMAVEEVLRSCLDSFTPAK
                     CSDTSGATPHGSRRRAQAAPFNAYAALESLLPPSAMGSAGQDGSEVWAPAMMGAAMPG
                     STPERVTAPQGAFAESDDEGALTTPQSDRASCGMPYAGVRRDPMAYLSTAAVMAADSS
                     EGRCGVTHHGEGGVESIGSLSAGCGACGGATESLPPHSSDARSGLEFNCRNGHCGGPD
                     MLAMLAAAVQQQHPQHPHSYPHTETRPQSARSTTGSMELDSRAFSERDVAAAAEQQST
                     SPPPSYEVAACHQKPPHHGSYAHPDLSSAPSCAAATHAQPPTRRGHHLPHVKAAAGSL
                     IAVGGRRVPVDKLHLLSIGDEPSLSAPSSMAGQAVTAASSRGGSKARSQQSSSSAPYH
                     VEGPSMRRVPKANLVTVTHAAAAGLVEAGAPAPPGRHASAPVHERDAALPTSSSSATL
                     SEAAPARAAAAGPSARRVPPAMATQQRHSSGSIVPAVVALNSAVDREGVQQSSEADVV
                     AVLQFPKGQTMRFLTNLSSAALATAKDAVARDLTNSKRSTGGTATSVLASRSLLRCVE
                     VGKTYLAHVYAEGSPHEGVSYEDAGVCVQLITPSSSLYAALLGCVNGVLLRKVDVLVN
                     DEDRKQHERLLLQQTTAYIECERHFKFSGLPFQLESIYCTFDGSVCVVFYRLLPVADG
                     SASSFASHRHPSTSRMVRELKFHLNCRVFLKRCLHRTHTYTQKK"
     gene            <479893..>480864
                     /locus_tag="LMJF_30_1380"
                     /db_xref="GeneID:5653668"
     mRNA            <479893..>480864
                     /locus_tag="LMJF_30_1380"
                     /product="putative N-acyl-L-amino acid amidohydrolase"
                     /transcript_id="XM_001684680.1"
                     /db_xref="GeneID:5653668"
     CDS             479893..480864
                     /locus_tag="LMJF_30_1380"
                     /EC_number="3.5.1.14"
                     /codon_start=1
                     /product="putative N-acyl-L-amino acid amidohydrolase"
                     /protein_id="XP_001684732.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653668"
                     /db_xref="GOA:Q4Q7G6"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="InterPro:IPR017439"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7G6"
                     /translation="MVALRADMDALPEDEETDLPFKSQNKGAMHARGHEAHTAMLRSA
                     AKVICARQADIEGSVRFIFQHAEELLPGGAKDLVAAGVMEGVKNIFGMHCSPRCEAGT
                     VGLIPGINTSYADSFKLIIRGRGDHASTPQLLVDPVPITAEIVMAIQTITARKIDPRV
                     VPVVSITTMTTGSSESHNVIPNEVKLMGTEWARDKAVREQVLRDIERIASNIAAAHGA
                     AATSDFTFGHDCCDNDPEVTAQVRCIGERILGSANIIDPKAPLYGGEDFSAYQLEKPG
                     CFLWLGTADKSQGICEMCHSTKFRVDETALPVGVSFHVGYVYDNVMA"
     gene            <483750..>484247
                     /locus_tag="LMJF_30_1390"
                     /db_xref="GeneID:5653669"
     mRNA            <483750..>484247
                     /locus_tag="LMJF_30_1390"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684681.1"
                     /db_xref="GeneID:5653669"
     CDS             483750..484247
                     /locus_tag="LMJF_30_1390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684733.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653669"
                     /db_xref="InterPro:IPR006461"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7G5"
                     /translation="MYNSSKSEYSVVGQQEQLDVVDVAVSETTHVVGSATRPWHYSLC
                     VTCTEMNSCLECCFCTVCQLSRQFNMLYNNKPELHLPVCLLVTGLSVSGVPSVFVLEY
                     ILRSDIRRRYGIAGNVWKDCCVSWLCEACAVQQQFLEMTSLSMCPGMSMCGVAPVAPG
                     APVML"
     gene            <486172..>487833
                     /locus_tag="LMJF_30_1400"
                     /db_xref="GeneID:5653670"
     mRNA            <486172..>487833
                     /locus_tag="LMJF_30_1400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684682.1"
                     /db_xref="GeneID:5653670"
     CDS             486172..487833
                     /locus_tag="LMJF_30_1400"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684734.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653670"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7G4"
                     /translation="MHPQRGNATFGPPGGNRSNPATTNPAATTRTRSISRSPGAAHGS
                     VAGGPRSSVGRLRASSPSHTAAVGRGGRPLGRGHAPTQPTLFGTRGRSPATMSGAGAG
                     LPSAQDAIQAEMDVLADEFYGSVPSRAPGDGTPILRGASARTVSADSPYYRADAGNGL
                     TADTLRSTTSWYEGPTDPAGRTFDASDSHLLCMDVLVPRAASSGAVGRTPAARTFSAA
                     PPSASSSLCVVGSADHGLKVFNLCTMRELKTLYTKTCGHTEWVTACRFLSDRRVISGG
                     MDSKLCLWNDVTRGGPGRCVDLLGHTGSISQVEVNERHGRSIAMSSSYDRTIRVWELD
                     GIAGGREMGCLSGHKGPVTQFSWLETEVLSGDRQGTVKLWDVETAQCHLTASSKRGQI
                     GSLAHLVHPGVGHLALFGDQGGALTVVDARGPSSAKPLFQDVLHPGGMVTFIRAPSPT
                     AVSAPLIVTCGADKRIIVRDARHNFAEVCAITDHDDFVYSMEVIGNILLSGAGNGRLL
                     VHDVETGELLYELKANAAAVREMFASPSVLVAAGDDGNAKVFDFM"
     gene            <490610..>491137
                     /locus_tag="LMJF_30_1410"
                     /db_xref="GeneID:5653671"
     mRNA            <490610..>491137
                     /locus_tag="LMJF_30_1410"
                     /product="putative ama1 protein"
                     /transcript_id="XM_001684683.1"
                     /db_xref="GeneID:5653671"
     CDS             490610..491137
                     /locus_tag="LMJF_30_1410"
                     /codon_start=1
                     /product="putative ama1 protein"
                     /protein_id="XP_001684735.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653671"
                     /db_xref="InterPro:IPR006461"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7G3"
                     /translation="MLQGQYDQKPNGGPQYNQPQGPGQNVYTGNPMNAPGSRPAVHSR
                     LGNWHYSLCVCCNDMDSCCEACCCFPCQVSRQCNMLVSNRREIHWPYCLLMTLCDVSL
                     LFFSVTCVFASETRRLARERYGISGSGCDDCCIGYWCRTCSAQQVLLEMTAMSEFPGA
                     TCYEAAPQPAANRMV"
     gene            <496983..>497507
                     /locus_tag="LMJF_30_1420"
                     /db_xref="GeneID:5653672"
     mRNA            <496983..>497507
                     /locus_tag="LMJF_30_1420"
                     /product="putative ama1 protein"
                     /transcript_id="XM_001684684.1"
                     /db_xref="GeneID:5653672"
     CDS             496983..497507
                     /locus_tag="LMJF_30_1420"
                     /codon_start=1
                     /product="putative ama1 protein"
                     /protein_id="XP_001684736.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653672"
                     /db_xref="InterPro:IPR006461"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7G2"
                     /translation="MLQGQYDQKPNGGPQYNQPQGPGQNVYTGNPSNPPGSQSAVYYR
                     EGPWHYSLCVCCEDMDSCCEACCCFSCQVSRQCNMFMYNRREIHWPYCLLMTFLDLYL
                     PFTISWVFVGETRRLARERYGISGSSCEDFCIGYWCRTCSAQQVLLEMIVMNEFPGAT
                     CYEAAPQPAANRMV"
     gene            <503336..>503863
                     /locus_tag="LMJF_30_1430"
                     /db_xref="GeneID:5653673"
     mRNA            <503336..>503863
                     /locus_tag="LMJF_30_1430"
                     /product="putative ama1 protein"
                     /transcript_id="XM_001684685.1"
                     /db_xref="GeneID:5653673"
     CDS             503336..503863
                     /locus_tag="LMJF_30_1430"
                     /codon_start=1
                     /product="putative ama1 protein"
                     /protein_id="XP_001684737.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653673"
                     /db_xref="InterPro:IPR006461"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7G1"
                     /translation="MLQGQYDQKPNGGPQYNQPQGPGQNVYTGNPRSAPGSRRVVRNR
                     NGDWRFPLCVCCEDMDSCCEACCCFSCQVSRQCNMLVNNRREIHWPYCLLMTLCDVSL
                     LFFSVTCVFASETRRLARERYGISGSGCDDCCIGYWCRTCSAQQVLLEMTAMSEFPGA
                     TCYEAAPQPAANRMV"
     gene            <511268..>515683
                     /locus_tag="LMJF_30_1440"
                     /db_xref="GeneID:5653674"
     mRNA            <511268..>515683
                     /locus_tag="LMJF_30_1440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684686.1"
                     /db_xref="GeneID:5653674"
     CDS             511268..515683
                     /locus_tag="LMJF_30_1440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684738.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653674"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7G0"
                     /translation="MRVRVALMRRLVCVPSSYGLTASGRALMRLSHSLLAYADSGACR
                     TPREVQHHDSACDPSSASHRDHVTAHLSHTSCQQRIGSFDRRPLLRPPLMPCSIGGTP
                     FAHLLQRIIVDRTEKLSHIRREALEFLCNVAVGDSTTRSHGNATEEAKTRERRMRGAL
                     LKVAQPALHSSLQRKENLRLTVCLQRPEGHVCVPAVVGETYLFLRSQDVDVTAWWERY
                     YNAFIRPSMVEHPGNEGMIVTVAADIRGVERAAASPATADRSPNSEWNGATRPPPFYW
                     KLDWGLRHVSSTHATASHSRDVFAVPLPSLEEPAHWPVTPAKTRADASERGLDGVPTS
                     TGAAAAALASPPARQSVWIPVWLICHLPFFPIPFPSAEAEGEEQQGRSAEMQYNDALL
                     ASADSPLMSHDPDSCMAEENKRVLLQRDSEPESTEADCLLSTQGAVSRTNASYDIPLE
                     VHRAGIEACTSGHTPQTFTSTPRLHTHAQQDQLDKEWGHPFFDGLHSVSGIGGWSPRH
                     ATLMTSSGDHGTVAHGIIAEQALRHQRVRESSTFALGLEFSTGCSPTTATGALSAAVT
                     AEWPSPLSSWKLRSTHWKTLSSFWATKADPASSLAADYSFPLQAYPLLRYRSFPRARA
                     GDTAMSACKPHLHSFSEGRTLHRLEKDTTSQKWVWYPFKHCGAAQQRPHLSAQPPAHS
                     WIGEEGPLNRVSPTAAAGDAPHNSKVSVAAQRASVFHVLLRNACVERVTFFGVHYVSV
                     DATALSCLFDSTVCVRHAVPLGVTGTVFKAGLRSTRYRQQHSCLPAGQQRMFTVEDGE
                     RGAYAATHGFANRRTELRLPLFTTAMKKLEAAEAAAAAPVSSQDKATATPGGGELGST
                     AGAAPWLARLRAIRNECQKGRCEPEVSLIERVVRMRRSHRSVFFLFQSPYWVEVAELY
                     ERWGVRVAPGTVPLLIRGKPYVNAEQTTDASRFSPNTCVPHLLQEVLFSRGLGACTWA
                     GSQCLLSLIAPDAAPRRRPGGACAWTYRTLCERAAAVQRVSNLWIAESVIEKFKWTLR
                     TAPAPPRPDMSDGGGSGRPEGDCNEVLRAFLPLHDIESSQFREALSDELHSEVLHRHP
                     HQRGNSLQHADSCGNTATPPTPRSTSQNTPTQVAFSTPSRPPPPPCEPPVIEDVSSPI
                     LSRRPAQPHVCVVHSSCVAEQAELAFVAAFSPVVLLLRVPDLKSRDWGFDKWEAAKRS
                     AATASRAVETRVTAAVKEGDGVEGITGARADKPLSSYNDLEGEFGDEDDQAFEDGLAD
                     DGTAAAGSESLLEERARLMYMKAMRRKRLLCLAPWRGARLSFESRLDLSRLALRNGYS
                     AENANRWVSLDFLRDEPRVRTARTDMVAPEVDTQGAGEPQIPRPNFASDPAVAESSAG
                     RQARTSSRSRSITGIRVDVLFYSPDEPGGSSRLSGNGGYIEYDHGMCSHDNGATDDCS
                     TVTRVMKITLINSEELEWPESVVSSSKQQWVWKNL"
     gene            <518836..>522474
                     /locus_tag="LMJF_30_1450"
                     /db_xref="GeneID:5653675"
     mRNA            <518836..>522474
                     /locus_tag="LMJF_30_1450"
                     /product="putative kinesin"
                     /transcript_id="XM_001684687.1"
                     /db_xref="GeneID:5653675"
     CDS             518836..522474
                     /locus_tag="LMJF_30_1450"
                     /EC_number="3.6.4.4"
                     /codon_start=1
                     /product="putative kinesin"
                     /protein_id="XP_001684739.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653675"
                     /db_xref="GOA:Q4Q7F9"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7F9"
                     /translation="MSEKRITVAVRIRPPIGCERYEPVCARKADDDQTITINAEETSA
                     SVGGVSAFQFDYVFDETDDQVAVYEESVQEMVDHALSGFNATVFTYGQTGSGKTYTIL
                     GSKSADGKVTEGSGAFMRVFDDLFTYKESVKDRIHIVIALSALELYVEDVMDLLMDKK
                     KLKLRETPEETITVGINTVEVHTMADVERNFDVANSFRSVTATKMNDTSSRSHALFFI
                     DIFQIPVEKSPQSPKVSQLIDETGMSLSKGVPGVIKSRIALVDLAGSERVKRSGATGQ
                     ALVEAQAINKSLSTLGTVINAMYLQNPHIPFRESKLTKLLKPCFVDTTSRLLLIGQVA
                     PPSNSASESLGTLRFCDRVKGLKAGQVMGFTDPDAEQAFLQSRRANEELLAEMHILQA
                     QYYYEAVNVRRLAAAKSAPVDQERQRIVAELQASAADVVARKEREMLEKAEREAIAQR
                     DAAVESFVLHMNSLIEEYEQVAHTVKREKKAQKKLREEQEAEHEVRLHEAKKAKKHRL
                     KLQEAVAETRQSFEALDRELEALDGQIEVVRKESAAGVIDSVDDDAASPNKAMDRAVE
                     EATHGLVESFYNHATEQSRLYSMFVSRLAATRRERSRVRRMKLMSSTLVTDGTLLYDL
                     IAFLIDRAVDVSEGDLPLRAKWGWHDVDGLSQRLLCADEMYPPLLPSVLEPLHEEAKP
                     CLEQPHSITFLSSDESDGEHSHHAAESRRIRQIRDAAAAAKAESLHALQADSEDDRQH
                     EASSGGRSDGDGHDGKESSEESACTPAPHAHQSDWMNGQLLGQTPPQDAALAVANTVE
                     DAPPLARKAHTRRKRKDGAAAATATSPSNGNDDASTSGAAAASAARSPENRPGRHGKS
                     TGVPAAVTAASEGSSSDESGDESSGTESSSSPSESDSGDESPEEPATATGAAHKAQEK
                     EAHEAACEGRDVEEDALPVDAPNPSYQEKDSRALMKVYDSPTLVQDLIRFLRSGSRML
                     KHCRRGKPHQRIFWVSTQRGKKELFWKEPDSRSVDYSCIQLSDVSFIQLGCFGKVFSR
                     HRIPPTDPAFFRAFTIGLKHGGRTVDIVAETLPDYEAWVVGLSHLVGVDPVWGGKIDL
                     TMEVGTDRLTYFESSVCEANYIHPLEYLELKKCVQHVATRTIQVLKECGEDTARAQAI
                     LGGIHPPAVNSNCAVYMTKGELRFLLPDTFDIIRVSRLWMLFQQMNLVYDDNFAPATA
                     FGITVRES"
     gene            <525690..>526232
                     /locus_tag="LMJF_30_1460"
                     /db_xref="GeneID:5653676"
     mRNA            <525690..>526232
                     /locus_tag="LMJF_30_1460"
                     /product="class i nuclease-like protein"
                     /transcript_id="XM_001684688.1"
                     /db_xref="GeneID:5653676"
     CDS             525690..526232
                     /locus_tag="LMJF_30_1460"
                     /codon_start=1
                     /product="class i nuclease-like protein"
                     /protein_id="XP_001684740.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653676"
                     /db_xref="GOA:Q4Q7F8"
                     /db_xref="InterPro:IPR003154"
                     /db_xref="InterPro:IPR008947"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7F8"
                     /translation="MGRGERCLLPLALHSAYVLFRALCRFMRICVAIVFIPTYIYIYV
                     CIYIYISCFYFHICFSAYDFVCLRCGGLFRHLFALAATADRLLETYTFPEALRTLVDV
                     VAIHEESHMFAVNTSYPGVTPGATLSDAYLARCKRVAEARLTLGGYRLGYLLNELLPS
                     IPVDEATLEAYRAARWKRSA"
     gene            <527010..>527552
                     /locus_tag="LMJF_30_1470"
                     /db_xref="GeneID:5653677"
     mRNA            <527010..>527552
                     /locus_tag="LMJF_30_1470"
                     /product="class i nuclease-like protein"
                     /transcript_id="XM_001684689.1"
                     /db_xref="GeneID:5653677"
     CDS             527010..527552
                     /locus_tag="LMJF_30_1470"
                     /codon_start=1
                     /product="class i nuclease-like protein"
                     /protein_id="XP_001684741.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653677"
                     /db_xref="GOA:Q4Q7F7"
                     /db_xref="InterPro:IPR003154"
                     /db_xref="InterPro:IPR008947"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7F7"
                     /translation="MGRGERCLLPLALHSAYVLFRALCRFMRICVAIVFIPTYIYIYM
                     YVYIYISCFYFHICFSAYDFVCLRCGGLFRHLFALAATADRLLETYTFPEALRTLVDV
                     VAIHEESHMFAVNTSYPGVTPGATLSDAYLARCKRVAEARLTLGGYRLGYLLNELLPS
                     IPVDEATLEAYRAARWKRSA"
     gene            <528347..>528874
                     /locus_tag="LMJF_30_1480"
                     /db_xref="GeneID:5653678"
     mRNA            <528347..>528874
                     /locus_tag="LMJF_30_1480"
                     /product="class i nuclease-like protein"
                     /transcript_id="XM_001684690.1"
                     /db_xref="GeneID:5653678"
     CDS             528347..528874
                     /locus_tag="LMJF_30_1480"
                     /codon_start=1
                     /product="class i nuclease-like protein"
                     /protein_id="XP_001684742.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653678"
                     /db_xref="GOA:Q4Q7F6"
                     /db_xref="InterPro:IPR003154"
                     /db_xref="InterPro:IPR008947"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7F6"
                     /translation="MPTSVGTALGVCAVSGSVPFYAHLCRHRIYTHIYIYICMYIYIY
                     ISCFYFHICFSAYDFVCLRCGGLFRHLFALAATADRLLETYTFPEALRTLVDVVAIHE
                     ESHMFAVNTSYPGVTPGATLSDAYLARCKRVAEARLTLGGYRLGYLLNELLPSIPVDE
                     ATLEAYRAARWKRSA"
     gene            <529701..>530192
                     /locus_tag="LMJF_30_1490"
                     /db_xref="GeneID:5653679"
     mRNA            <529701..>530192
                     /locus_tag="LMJF_30_1490"
                     /product="class i nuclease-like protein"
                     /transcript_id="XM_001684691.1"
                     /db_xref="GeneID:5653679"
     CDS             529701..530192
                     /locus_tag="LMJF_30_1490"
                     /codon_start=1
                     /product="class i nuclease-like protein"
                     /protein_id="XP_001684743.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653679"
                     /db_xref="GOA:Q4Q7F5"
                     /db_xref="InterPro:IPR003154"
                     /db_xref="InterPro:IPR008947"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7F5"
                     /translation="MCCFGLCAVLCAFVSPSYLYPHIYIYMYVYIYISCFYFHICFSA
                     YDFVCLRCGGLFRHLFALAATADRLLETYTFPEALRTLVDVVAIHEESHMFAVNTSYP
                     GVTPGATLSDAYLARCKRVAEARLTLGGYRLGYLLNELLPSIPVDEATLEAYRAARWK
                     RSA"
     gene            <531729..>532679
                     /locus_tag="LMJF_30_1500"
                     /db_xref="GeneID:5653680"
     mRNA            <531729..>532679
                     /locus_tag="LMJF_30_1500"
                     /product="p1/s1 nuclease"
                     /transcript_id="XM_001684692.1"
                     /db_xref="GeneID:5653680"
     CDS             531729..532679
                     /locus_tag="LMJF_30_1500"
                     /codon_start=1
                     /product="p1/s1 nuclease"
                     /protein_id="XP_001684744.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653680"
                     /db_xref="GOA:Q4Q7F4"
                     /db_xref="InterPro:IPR003154"
                     /db_xref="InterPro:IPR008947"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7F4"
                     /translation="MPAFVGLRLPLTVLCLLVLSSALCVTEVLGWGCVGHMLLAEIAH
                     RQLNDENKEKLDAMAHAFAQSGPFESSPDMVQAACWADDVKRWGQYAMATWHFFATPY
                     NPEDINITDPVATVNAVTVSRNMVTSLRRTNAPLYLLNFAWVNLVHILGDLHQPLHTI
                     SRYSSKYPHGDKGGNEVEVQVGKRKVNLHAVWDNICSGTPPRYKRPLSYTDLFALAAT
                     ADRLLETYTFPEALRTLVDVVAIHEESHMFAVNTSYPGVTPGATLSDAYLARCKRVAE
                     ARLTLGGYRLGYLLNELLPSIPVDEATLEAYRAARWKRSA"
     gene            <534216..>535166
                     /locus_tag="LMJF_30_1510"
                     /db_xref="GeneID:5653681"
     mRNA            <534216..>535166
                     /locus_tag="LMJF_30_1510"
                     /product="p1/s1 nuclease"
                     /transcript_id="XM_001684693.1"
                     /db_xref="GeneID:5653681"
     CDS             534216..535166
                     /locus_tag="LMJF_30_1510"
                     /codon_start=1
                     /product="p1/s1 nuclease"
                     /protein_id="XP_001684745.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653681"
                     /db_xref="GOA:Q4Q7F3"
                     /db_xref="InterPro:IPR003154"
                     /db_xref="InterPro:IPR008947"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7F3"
                     /translation="MPAFVGLRLPLTVLCLLVLSSALCVTEVLGWGCVGHMLLAEIAH
                     RQLNDENKEKLDAMAHAFAQSGPFESSPDMVQAACWADDVKRWGQYAMATWHFFDKPY
                     NPEDINITDPVATVNAVTVSRNMVTSLRRTNAPLYLLNFAWVNLVHILGDLHQPLHTT
                     SRYSSEYPHGDKGGNEVEVQVGKRKVNLHAVWDNICSGTPPRYKRPLSYTDLFALAAT
                     ADRLLETYTFPEALRTLVDVVAIHEESHMFAVNTSYPGVTPGATLSDAYLARCKRVAE
                     ARLTLGGYRLGYLLNELLPSIPVDEATLEAYRAARWKRSA"
     gene            <537043..>538404
                     /locus_tag="LMJF_30_1520"
                     /db_xref="GeneID:5653682"
     mRNA            <537043..>538404
                     /locus_tag="LMJF_30_1520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684694.1"
                     /db_xref="GeneID:5653682"
     CDS             537043..538404
                     /locus_tag="LMJF_30_1520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684746.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653682"
                     /db_xref="GOA:Q4Q7F2"
                     /db_xref="InterPro:IPR006145"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7F2"
                     /translation="MLVVNKPPGILMDGDESIYGRTVESLVCEHMKARGIFDETHEQL
                     QKEKKRKKQLKFVHQLDFGTSGVLCLAFTKDMAARLAHCFEMRLVRKYYVALLHGHLP
                     SDTALLEDAASSDQPGSAFSSDTKARRASFAAWANACNKAWEGLGCVRAGCSASASGG
                     SSANSAGGDEVAGFRHLLQRPDKTAWEAVGLANSKDAEEGEPVTVVHRYRSHRSPASS
                     LITVAPENSAPVPADAVEDLIYRTLLESTTTCSVVFVDLPVGYDLTDPEHLRMAVTAE
                     QSRDAKTSLLVLKRTYLAAPPPAGGEVPQRGAIAKDSPSVTSYPVTLVLLAPHTGRRH
                     QLRVHCRAIGFPIVGDTSYCADLPWCTALPLGSSPSTWVTAGARRMYLHAWRLLLPGT
                     ATPCLDEVERVVLKKKRRREVLGLSEQRGVSLSASRCEWTEFVASVDFTGLDLKELED
                     RKM"
     gene            <539199..>542354
                     /locus_tag="LMJF_30_1530"
                     /db_xref="GeneID:5653683"
     mRNA            <539199..>542354
                     /locus_tag="LMJF_30_1530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684695.1"
                     /db_xref="GeneID:5653683"
     CDS             539199..542354
                     /locus_tag="LMJF_30_1530"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684747.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653683"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7F1"
                     /translation="MLHEVYAPRTVADVAWSRQKTVALSAVIQQARGRDKALSSAAPH
                     IVLLYGPPGCGKLETLKVLLREDALVDAPVPMTHNTSRVSPGATLQLAQCHNTSFHIF
                     HTCEATVPAYAQYLHSVVSYCRGQLGGGELQLPSLTESPASCMSSGVCGSSADSRAGT
                     MAGSAGSTELPTNHAHIIKFYGEPASHALHRCTLLFLREYEELRAMAQHEEQEQGLLL
                     SSDTRVSRRVCLMQHLRRNLIFFLHTTHDTHNDKLDLSTSFPSTLLQSPAVELFHCTP
                     ITEINLRKRLQSILDVELRRRAQKRRWAASTAGMGCFENSLSSSYTALPSASLTSARL
                     TTKAKRKVSTPTSATATACTASPSIDLMDPETLNAIVAGSQGDIRQALLQVQWSCLMP
                     ASNSLAPAAHQSGESVEGAWAHSAQAAAAIWMRLEKQRLAARQSVAAASAAVADTRVL
                     SLSGTADVGMSVYALHSTLCVSPTTPASKASGVAHCEGKDGDGEIDSERESDIVEEVS
                     SKDSGETGHIFSSSECTSFPAPQTSRNGDGQTRANVGGAASRKRPRQSSSPPAMNMLS
                     LLDSQMERMQAMAHVDGQTRRGLKSRAGRVAHRGAAPPAAAAESQQRRVLPMTRDEYL
                     GLSHAIGRLLTQKYCIDEVLDTLNVPPRKILDYLTNNQIRYFGDDQLPQYARCIDAAS
                     DADALRASELSGSFAGVPNATALRERRQLADRTTAGENLGNTGRLLEFIALQLFHLTY
                     RAIQTEVRPPPGFVAQEPPPYLRLAYPRLRDISYSAMSYSMRRGEDRTEADPAAYLSE
                     REWVQQALARLESVPAVSARGSSASYGSDSNRRRRFDAGAGGGSSHATLTPRIQTDEV
                     DVLREGLPDLLYRCGSTEAVLLDYYALAPYILLTVTPPLPLQPSHAERVPASAALASR
                     SQACEEANTTAQSRGVHIAPDAPSLPSCSPGASTTPTTAPRRTVFRFTSSPLSALVPA
                     MASPSAHSVPTRPCLRPCTPLQVAILQRGRNPATAQLRSDLFVLSTDGVGDRTAGAAT
                     ESSAERPLIPHGDEIEDIDED"
     gene            <543736..>544707
                     /locus_tag="LMJF_30_1540"
                     /db_xref="GeneID:5653684"
     mRNA            <543736..>544707
                     /locus_tag="LMJF_30_1540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684696.1"
                     /db_xref="GeneID:5653684"
     CDS             543736..544707
                     /locus_tag="LMJF_30_1540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684748.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653684"
                     /db_xref="GOA:Q4Q7F0"
                     /db_xref="InterPro:IPR003382"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7F0"
                     /translation="MDSPESPQTSLPSEEKYPSVHLLLLITGSVAAIKTGLLLDQLST
                     ERCNIRIAATKAAFHFLRRAQPSKTGIPFQSIITDEQEWSEWQAMNDAVVHIELRRWA
                     DLVVIAPLDANTLAKVATGLCDNLVSSVMRAWEVKQKPVILCPAMNTAMWTHPITAKQ
                     LNQLAEWYCDPDARSCTLCTNMIKTSFPVSDSCASPSRAVVKENEETSGRTAEDSATA
                     AINASSSSAVVTAGSVAAATARGPPLPVTLRESMCQVVGPESKRLACGDIGIGGMASV
                     EEIALYIRHTMKLIRDEKRRCFQEAPERREAEAGGTQSVAHPPQETH"
     gene            546114..546692
                     /locus_tag="LMJF_30_1545"
                     /pseudo
                     /db_xref="GeneID:12981175"
     misc_feature    546114..546692
                     /locus_tag="LMJF_30_1545"
                     /pseudo
                     /db_xref="GeneID:12981175"
     gene            <548003..>549499
                     /locus_tag="LMJF_30_1550"
                     /db_xref="GeneID:5653686"
     mRNA            <548003..>549499
                     /locus_tag="LMJF_30_1550"
                     /product="putative pseudouridine synthase A-like protein"
                     /transcript_id="XM_001684697.1"
                     /db_xref="GeneID:5653686"
     CDS             548003..549499
                     /locus_tag="LMJF_30_1550"
                     /EC_number="4.2.1.70"
                     /codon_start=1
                     /product="putative pseudouridine synthase A-like protein"
                     /protein_id="XP_001684749.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653686"
                     /db_xref="GOA:Q4Q7E9"
                     /db_xref="InterPro:IPR001406"
                     /db_xref="InterPro:IPR020094"
                     /db_xref="InterPro:IPR020095"
                     /db_xref="InterPro:IPR020097"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7E9"
                     /translation="MASSSTADDHSAVAGIVASSASVCGSRDAAASPPTALPKLGSAK
                     QQRTERAFLFDRYPSRKIALRLAYHGHVHDGLAKQKETDNTVEGLVCDALRRLRLIPE
                     DGPHNFGRCGRTDKGVSALGNAFSLTARASCTGDAEPQLPPLDYCSMLNNVLPSTIRI
                     VGCALVDDAFDARFSCVHRTYRYYFFHRGLNLAAMQEAAAFFLGTHNFRNFCKMDVVN
                     VSNFVRTVFSVGLHPSEALPELISYLEIRANSFLYHQIRCIMEVLFLVGRGLEVPSVV
                     QTLLELGDRKPTYPLADGTPLILWDCGFDNVQWQMSHCAFHAMEQELQDIGTALLIRA
                     TSATAMRSQLFRWYTGTADVFRKDTSEKDASGEDRSRAVVRRDPELRRLDGWSITGCD
                     WTDPGTAGQMKARKRDLLYYLRTEAKNGQPLPTTTSCEEKTSQTAETIASGALAPVNY
                     VPLLQRETERTYEEEVRELSGKKRARYEVNEAKKAAAAAAHKEVVSED"
     gene            <551897..>555790
                     /locus_tag="LMJF_30_1560"
                     /db_xref="GeneID:5653687"
     mRNA            <551897..>555790
                     /locus_tag="LMJF_30_1560"
                     /product="putative protein kinase"
                     /transcript_id="XM_001684698.1"
                     /db_xref="GeneID:5653687"
     CDS             551897..555790
                     /locus_tag="LMJF_30_1560"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001684750.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653687"
                     /db_xref="GOA:Q4Q7E8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7E8"
                     /translation="MSLPEAVRHWNAVCCHHHQLLLLRHMEERYIELDLFTGAPLDSI
                     HLKADMTAAVSAEMLDSTSSLDISAHSIYSSLSDGSGTDVTRDSCTSISDANGDGLPR
                     AVLSLTTQRYATLIMQATVSRSLATITKKRKTRKEAMAAPTRKAAHTCLAKLAAPVIQ
                     LGLTWHTPRQRVHNDLSFSDADDEAVVERQQGKAELLAASQGSAARSFSSISSENTLH
                     HGSTSASDIDMDVMAGRKQLPPQYHFLRAVSPTPSSSAISATSPRGIRNKPTKWSREK
                     PARHKYAGTDKSADSSVGREAVPHEIPVRCGPGGCVYRAVSATLDSFTAAGNGEAAPP
                     QFLLLLQLPLPLVEAFWVRLPSSSTSGSSQSGVDGAGRRRAGEQSMSAVELRRVPWLP
                     RDACSLRAAELAVDAPIGASSASEARTTLRGFVLEASEVPSARIAMSTGFPRVLRALS
                     AYDVLSARSTAVRSAWLAHDRRGNRSPFSASFDAGERERAAGAAAAPEHRSGTRAVHT
                     KSFSTPFPYESNKKSSSITHVISPPTRRYIPEASFFDENFEPLMLLGRGVGGAVLLAR
                     HRVTGVFYAIKVLVARDYESERDILQEVRIHAMLENRHLVRYHTCWSEVISATRAQQL
                     AFIGVCHPYKANLGRCKRLNSASSSLPMTARQNARDGTSHSPTNSDTDILDRSQSRSA
                     PSGWHHLIHPSLSSMMLLGSDSTSGAVTPEKTPMRSHPRLRGDDRRRLIVDEFADDLT
                     DDDGDAVPAGQAEKRQGEAGDCLRHSGTGISPPTKIGSQPSRRPLTFSSTSSPSARGT
                     RAFLTAHRLRKQLPNTSVLSPGPSSAASDGVSGTTVQDVADSEGKDFETIWDDAQGCD
                     SDRSEGSGDGYGSSQRPEENTIIGTRVVFLQMELCQGTLAQYLASRTSIDRVENLIMA
                     IQVVAGLRYLHHRGVLHRDVKPTNVFMNYRCQYDKEVHQTNLSSTSDVDDGSEDEDDT
                     RSFWGFPGSAASRSGASAAWHGDRSNEACVPSPSSTLTLCRHHSSSCPLKLASSGCGP
                     SVSCAPRRSSIVPPIMQELFRAASSLTSGWKAETTMTSLDNLPSWDGEQAAVDFVMHP
                     PHRMATEMLQERLLRRPPPPAARQRSSSKCEVEEEETAAAGATMPLVQSDGGRHFLRR
                     LASWLLHRFVHVQLGDLGLAKFLYQQEVRVDDFVSMNAINTIGVGSPLYASPEQLKGN
                     RCTPASDAFSVGVVLAEMYLQPKTIAERLTVLREVREGVYRDKVLLAQFPELKLVRRL
                     TETQPERRMTLAAVHRALRSFLEQALQDELYRHYE"
     gene            <556643..>557890
                     /locus_tag="LMJF_30_1570"
                     /db_xref="GeneID:5653688"
     mRNA            <556643..>557890
                     /locus_tag="LMJF_30_1570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684699.1"
                     /db_xref="GeneID:5653688"
     CDS             556643..557890
                     /locus_tag="LMJF_30_1570"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684751.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653688"
                     /db_xref="InterPro:IPR014903"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7E7"
                     /translation="MWRWVSLGGWCGPSLMLSKLGLRPTEESLPFDMVRCTFDGLVEL
                     TANGFSSSLRPTPLIPLANPAASLSATTGVGRYNFSPKQEDGYFPRASRIPSASSPSD
                     AACTAAHSCFVPDPVNVWLLFRSQHACFTHYDLNNTDVQAEFRRRIRAWEALLSAESA
                     GAAGQERVRPVTFIRTVIAENPAEELEMLPQFHQTVRERTRGRLPFRTVLVVHDQADT
                     TQPLCAMPQESKDHDSPCIVWNLRRQRPPRTSSSSLAVDATGATSAAAEAPSLLDECH
                     DGYQTILTTMSKNVKWRSLDASLPAYETYVHSRKAPFTPYTELSRVDGVPAVRGTCTG
                     FGSTFSAALGRCVHCGCTDGHAVSAERYDKHQEWEEEDVNELLLNYALHHCDEVAAVE
                     ATARRQKRGAHETWQKLRVLLSD"
     gene            <558798..>561338
                     /locus_tag="LMJF_30_1580"
                     /db_xref="GeneID:5653689"
     mRNA            <558798..>561338
                     /locus_tag="LMJF_30_1580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684700.1"
                     /db_xref="GeneID:5653689"
     CDS             558798..561338
                     /locus_tag="LMJF_30_1580"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684752.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653689"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011043"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7E6"
                     /translation="MTATPAPRVFLASWLEKKMEWRFTYEQRYFILDGTRLSYRLEEH
                     GAEKKFGTIISFDPWRESLRDDTSKGYCFTVWLLEGGSWELRAATREIYDSWLHALLT
                     VLVPSDSTSAVQSESGGMPSSHDTSVNADVAATPGGPSSGHLESESLGCSRKAGGAGE
                     RGDTISSASPTQTESADTSRKATGASPAAEGATLTATSIAAAMNASNTVSLSNVVLLF
                     SMVEKETAWRGRWKPRYMELLEGCHLVIRSSATSKTERQHYVIEAVDPSPLVGQEVWL
                     LFTTSSGDRFWVRYGSVEECQRWYTVCRRLLHAKCSWHWLPLAENDAGRSLRLRQATS
                     GDYRDLQLQYHSATVVPSFQKGTWCPSLYIFGGSHRWCKQQFNPQARAFLPHAESAHT
                     TNQLCTLELTGPHVMQLWKPAPYEEGPHALVRPLSRYGATLTCIPVEAPPSSARSDSP
                     QQLIGARVVLFGGLSGGGYQPPATELWSVWRSPAACAEDVEMQWNRHDIPPYDLPMLA
                     FHDAVCVPWRCAAVKGSADPYKRRHTDGGFLLVTGGLDVEYRCRAECYAVVWNDADLT
                     EVGEQLRSTDSTTEDDFEERARLAKPVAFAFGQLPEPRAFHRMAVIEDGTVVLVGGRG
                     VENAAAGHPVLTLAPEAWRRASKAWRDVATAATAPPESDLDGAEPKSENHCRLTSGED
                     EADAGAADDTDASSSQWLEASFDCSMTPTSSTALRAVTALPKEMGDVAVAATEHGNRV
                     VVMGQVSQPHQDVKLYLLDLEPVVTPTSNGRRRGSRGINAGQQLPAGTRRVRCQEVVL
                     FVGAVPNRVVGITLHAYNDYLFVIGGCMADNSKSEPYNLCGPLRILLE"
     gene            563455..563547
                     /gene="LM30Cs2C1.1"
                     /locus_tag="LMJF_30_snoRNA0007"
                     /old_locus_tag="LMJF_30_snoRNA0020"
                     /db_xref="GeneID:12981176"
     ncRNA           563455..563547
                     /ncRNA_class="snoRNA"
                     /gene="LM30Cs2C1.1"
                     /locus_tag="LMJF_30_snoRNA0007"
                     /old_locus_tag="LMJF_30_snoRNA0020"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460980.1"
                     /db_xref="GeneID:12981176"
     ncRNA           563458..563547
                     /ncRNA_class="snoRNA"
                     /gene="LM30Cs2C1.1"
                     /locus_tag="LMJF_30_snoRNA0007"
                     /old_locus_tag="LMJF_30_snoRNA0020"
                     /transcript_id="XR_002460981.1"
                     /db_xref="GeneID:12981176"
     gene            563733..563824
                     /gene="LM30Cs2C2.1"
                     /locus_tag="LMJF_30_snoRNA0008"
                     /old_locus_tag="LMJF_30_snoRNA0024"
                     /db_xref="GeneID:12981416"
     ncRNA           563733..563824
                     /ncRNA_class="snoRNA"
                     /gene="LM30Cs2C2.1"
                     /locus_tag="LMJF_30_snoRNA0008"
                     /old_locus_tag="LMJF_30_snoRNA0024"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460982.1"
                     /db_xref="GeneID:12981416"
     ncRNA           563736..563823
                     /ncRNA_class="snoRNA"
                     /gene="LM30Cs2C2.1"
                     /locus_tag="LMJF_30_snoRNA0008"
                     /old_locus_tag="LMJF_30_snoRNA0024"
                     /transcript_id="XR_002460983.1"
                     /db_xref="GeneID:12981416"
     gene            <565065..>566213
                     /locus_tag="LMJF_30_1590"
                     /db_xref="GeneID:5653692"
     mRNA            <565065..>566213
                     /locus_tag="LMJF_30_1590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684701.1"
                     /db_xref="GeneID:5653692"
     CDS             565065..566213
                     /locus_tag="LMJF_30_1590"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684753.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653692"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7E5"
                     /translation="MFCRSTGRAAAVAILAAVLCVSALSAPPAAAEAAVPNSAARTVP
                     PFEKFFAQSFQVSVMTQSSGVFNATLRMRASPNFPERVQGELIPIGEAKLNSRRQTLL
                     PHFQRARSLEDDKLSALSFVMATGFGRPNRKKKGGTDESGSGQFAVAGKEERPSLLMV
                     DLHLRHSDAMQGTASVYYLPADLMALRAQREGIKEGSAPPSATVEFEFRSESDHMTGN
                     PLSDVQALAHVSGAVVAIRGRNGASKSSSVVGEKADDGSAAATRQGGIIFRWITEHEF
                     SAHVTLPITDKTGATSTHMEQIWVYGYATPSKGVFDRKQREVPLHNRYMMIGVGLLGF
                     FVQVVSGITEGKRRAREAADLEATAQRREKAKLEAPLLEQERNRTKKK"
     gene            <567104..>568702
                     /locus_tag="LMJF_30_1600"
                     /db_xref="GeneID:5653693"
     mRNA            <567104..>568702
                     /locus_tag="LMJF_30_1600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684702.1"
                     /db_xref="GeneID:5653693"
     CDS             567104..568702
                     /locus_tag="LMJF_30_1600"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684754.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653693"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7E4"
                     /translation="MSSDPLALVVYAGQMATYVCEGGDVQPTYPILHPITEEVLRLLR
                     QAQCQATAPDQSAPASASSAMHTSGDRAWPLKQQVQELRYHFLPLLQGRFVLLVVPLS
                     SAPSYREEWTRLCFDSHVLARRLVMLTDTVASAFACGMDNGVVVHASLSTVSMCRVEE
                     GCSTRYSNSHMGSLQMLCGMKLSLQLAEEWPKVANTAATSNSTLVPAFGPVKGAEVDT
                     AGEGGAHKHLWGSGVGAVVDLTSPAHRDALVRAFGFKAYRDVIVRAQMEAQQHQAAMT
                     TPSKGKGKGGTRQRAPSFLDDLRQKYPRAVRRAPGQLEKLLARVVQGGPTTPASAAFV
                     EGGEPCVLAGEALAIPYVYALFDYLVKRCGDDVWAVVERERRARKRSLTTSRSQHLSS
                     PSHHDHRDTMSKAESGAAHLGANGGSDEAATGTRRHSSSTSRSTSSGKDLSDEEEEEE
                     EESSLSSSSSYSSSGTLLSDSSDEDTWLQSQPTPLPAAPWWLPLLGGSIVSRLSDKDV
                     QRAVITAEEARETNGTMVHWRMLL"
     gene            <576456..>579698
                     /locus_tag="LMJF_30_1610"
                     /db_xref="GeneID:5653694"
     mRNA            <576456..>579698
                     /locus_tag="LMJF_30_1610"
                     /product="putative ferric reductase"
                     /transcript_id="XM_001684703.1"
                     /db_xref="GeneID:5653694"
     CDS             576456..579698
                     /locus_tag="LMJF_30_1610"
                     /codon_start=1
                     /product="putative ferric reductase"
                     /protein_id="XP_001684755.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653694"
                     /db_xref="GOA:Q4Q7E3"
                     /db_xref="InterPro:IPR013112"
                     /db_xref="InterPro:IPR013121"
                     /db_xref="InterPro:IPR013130"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7E3"
                     /translation="MHIAPLTLTAQLCYRIGGTVVCVFFTVFGYLVWRTQGYYELTPE
                     GQQRSAGFTPNGIAGVTGFFTFAGLAVVLLIETTLFYVRYAFHPSHKGRYWTMHRYAS
                     VILQAALGILYVGTGVTLLVKWSGNSAQCAFIFCLGVDKYPKTPRTRGADFESFLSVI
                     IFFVLVPAGLVLLYRVFTIAMLQWAEKVARECDAASVAADAQASSSASSQSTGEGTSS
                     PGRGGGVVAAVATEANPMAKPVSIRPFQPKSRVKQVCRLVGVLIGILVCAILSFWLPN
                     DSRRWNPNCIASFARNGVSRERRTTNMTVPEMPDAWFRTGQIRFSDDLTLKLFPGNVF
                     FYVYLLMTAIVVLVLRLTQRGRYWVQRRIPLCACFTCGEAAFVAATALLSVMFFIYWL
                     HDHNYKQTWTVTANESAQIEAPERWARGLGQLAILFLSLLLLPVSRQSVVVSVLGVSR
                     DGMLWFHRAVGYAMLAATVGHIVAFYVSYASFGYLMQNLNTVTNFVCKKGVYDDYTVL
                     VVTWTTWFLLISMGIFALNLMRRRHYELFYYTHLAATYMTLPAMLFHASAGWMYLLPG
                     MTVLLSDQLVRLWQRSAVVRVVRARVIGDDTTELAFTVPGRWDMRRVHPGQYVLVCVP
                     ELTALQWHPFTLINVVDEESAVVGSSKVSAKETVFYVHVKSMGPKTWTGRLYDLVSRG
                     EEITMAVEGPCGTPVVYRHYGNIVLVAGGIGATPCVSILGSLLRQCHALGHSGASPRV
                     TFIWSTRSARHVKAVADMLQLPMRCGDVVRQPATRAALVKKIDTCVAPEDVTNDVRLN
                     TEIIQPANSLEQDEPLNEEFSAVNEGVRIADDAVQNFFLDVYVTRTTELQHFSNGDAC
                     LGEQCSSTPFTPSPKKGFVELDSKTLSCAGAMGTVQNAVDSASPWKQKTATATTTGPH
                     GKADDAEEAKAFSNASMGRESKGLDLTGADGCEDRINGSSESTAHRMGWKVFGDAASA
                     MDEEGAFMLNGLSRWSSSSVTKSSERLHDNSDSSGSGCVALKVHSWRPDVDRLIREAL
                     KQPGSGVQESSKLDKARTLLFVCGPNSLVRQVTASGAQLGVAVHKEEFLF"
     gene            <582749..>584824
                     /locus_tag="LMJF_30_1620"
                     /db_xref="GeneID:5653695"
     mRNA            <582749..>584824
                     /locus_tag="LMJF_30_1620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684704.1"
                     /db_xref="GeneID:5653695"
     CDS             582749..584824
                     /locus_tag="LMJF_30_1620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684756.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653695"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7E2"
                     /translation="MRTTHPLRWLRRCHLVFARRGHGGTAQMQRELKRLALLEEFMTQ
                     PAETRAQQVPATTAACTAAYLRELPQRVERMRGIAATANGDQALPEHGVAGTSASATL
                     PTEHEETRRPSGEVSAPQVSTLSQFLTACKEHRVRYSSSADPALRKQGRDVFRSFWSR
                     HASSAVSCCYESVRDLGFVADIGLADTGLHLGMRDMRGMLRVLQTNHTAASSLDTTRV
                     LGYLARELQYWESRKDSESDENAAPASASLIAFRTALTDVALGRLASIFVQQRQCSES
                     FTQPRVKAAANVPASGDAAVPPEQASGADAVWGLEALSVLHARDATESVLEDVWTGRQ
                     LRLLRQQREPVHLRSTSAFPDVSSATVPMSALATEVQHLLVSELFRVVAARRRDLRMT
                     DIVHAYALLRVHLRLLWPPYGRQQPPQPSHAARHHNRGCASVERYRSHAASTSAPATA
                     QRRPLWYEKDTLFRVTWGLAVALASKDRVFISGYHFVKIVAVLAKLPAFVLSQEPHVK
                     TELRRFELPHRAVAFRGGADEDDAESRFVCATIAAEVIRQEMAVEAGSKPATAVALHP
                     SDFWRFIVAKACVFVPSLPPEQRRIVCRSLHLAITEKRAHLLPLQAAATARSARVPQS
                     ARRARSDSIRGQFGSRTVSPDGSDAASASEILRPLMEEMEDYPEPYEACVKDLRPRSL
                     PPRVAPWQR"
     gene            <585931..>586317
                     /locus_tag="LMJF_30_1622"
                     /db_xref="GeneID:5653696"
     mRNA            <585931..>586317
                     /locus_tag="LMJF_30_1622"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684705.1"
                     /db_xref="GeneID:5653696"
     CDS             585931..586317
                     /locus_tag="LMJF_30_1622"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684757.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1622"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1627"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1632"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1637"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1642"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1647"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1655"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1622"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1627"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1632"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1637"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1642"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1647"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1655"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653696"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7D9"
                     /translation="MLRCLNGSMLRPTRGAASLAAATAPAAIALPARQFHSVYGVIGS
                     CLMCGACMLCFGSWANNYCNVKKYGRWRFRNSIDDVIMVSDFRGARYFGAFLGFLFWW
                     FVVGPQKYRWNSNLADIPGNTRIGPF"
     gene            <587636..>588088
                     /locus_tag="LMJF_30_1625"
                     /db_xref="GeneID:5653697"
     mRNA            <587636..>588088
                     /locus_tag="LMJF_30_1625"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684706.1"
                     /db_xref="GeneID:5653697"
     CDS             587636..588088
                     /locus_tag="LMJF_30_1625"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684758.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1625"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1630"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1635"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1640"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1645"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1650"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1625"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1635"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1645"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653697"
                     /db_xref="InterPro:IPR009445"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7D8"
                     /translation="MASAVANVNASAKPMTDKEITRHRVMARLSEIRTQPLKQLPMTV
                     FMMWMVGNEVSIFSIMFVGMAVVNPLQSILSAGKLFADFEEDSKADRQIRSAVNQARW
                     IYIGCCLVAFLVALVKLNWMELLPVSSMDWMDNTPPTYQELSSGVFYH"
     gene            <589380..>589766
                     /locus_tag="LMJF_30_1627"
                     /db_xref="GeneID:5653698"
     mRNA            <589380..>589766
                     /locus_tag="LMJF_30_1627"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684707.1"
                     /db_xref="GeneID:5653698"
     CDS             589380..589766
                     /locus_tag="LMJF_30_1627"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684759.1"
                     /db_xref="GeneID:5653698"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7D9"
                     /translation="MLRCLNGSMLRPTRGAASLAAATAPAAIALPARQFHSVYGVIGS
                     CLMCGACMLCFGSWANNYCNVKKYGRWRFRNSIDDVIMVSDFRGARYFGAFLGFLFWW
                     FVVGPQKYRWNSNLADIPGNTRIGPF"
     gene            <591080..>591532
                     /locus_tag="LMJF_30_1630"
                     /db_xref="GeneID:5653699"
     mRNA            <591080..>591532
                     /locus_tag="LMJF_30_1630"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684708.1"
                     /db_xref="GeneID:5653699"
     CDS             591080..591532
                     /locus_tag="LMJF_30_1630"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684760.1"
                     /db_xref="GeneID:5653699"
                     /db_xref="InterPro:IPR009445"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7D8"
                     /translation="MASAVANVNASAKPMTDKEITRHRVMARLSEIRTQPLKQLPMTV
                     FMMWMVGNEVSIFSIMFVGMAVVNPLQSILSAGKLFADFEEDSKADRQIRSAVNQARW
                     IYIGCCLVAFLVALVKLNWMELLPVSSMDWMDNTPPTYQELSSGVFYH"
     gene            <592824..>593210
                     /locus_tag="LMJF_30_1632"
                     /db_xref="GeneID:5653700"
     mRNA            <592824..>593210
                     /locus_tag="LMJF_30_1632"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684709.1"
                     /db_xref="GeneID:5653700"
     CDS             592824..593210
                     /locus_tag="LMJF_30_1632"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684761.1"
                     /db_xref="GeneID:5653700"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7D9"
                     /translation="MLRCLNGSMLRPTRGAASLAAATAPAAIALPARQFHSVYGVIGS
                     CLMCGACMLCFGSWANNYCNVKKYGRWRFRNSIDDVIMVSDFRGARYFGAFLGFLFWW
                     FVVGPQKYRWNSNLADIPGNTRIGPF"
     gene            <594527..>594979
                     /locus_tag="LMJF_30_1635"
                     /db_xref="GeneID:5653701"
     mRNA            <594527..>594979
                     /locus_tag="LMJF_30_1635"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684710.1"
                     /db_xref="GeneID:5653701"
     CDS             594527..594979
                     /locus_tag="LMJF_30_1635"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684762.1"
                     /db_xref="GeneID:5653701"
                     /db_xref="InterPro:IPR009445"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7D8"
                     /translation="MASAVANVNASAKPMTDKEITRHRVMARLSEIRTQPLKQLPMTV
                     FMMWMVGNEVSIFSIMFVGMAVVNPLQSILSAGKLFADFEEDSKADRQIRSAVNQARW
                     IYIGCCLVAFLVALVKLNWMELLPVSSMDWMDNTPPTYQELSSGVFYH"
     gene            <596271..>596657
                     /locus_tag="LMJF_30_1637"
                     /db_xref="GeneID:5653702"
     mRNA            <596271..>596657
                     /locus_tag="LMJF_30_1637"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684711.1"
                     /db_xref="GeneID:5653702"
     CDS             596271..596657
                     /locus_tag="LMJF_30_1637"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684763.1"
                     /db_xref="GeneID:5653702"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7D9"
                     /translation="MLRCLNGSMLRPTRGAASLAAATAPAAIALPARQFHSVYGVIGS
                     CLMCGACMLCFGSWANNYCNVKKYGRWRFRNSIDDVIMVSDFRGARYFGAFLGFLFWW
                     FVVGPQKYRWNSNLADIPGNTRIGPF"
     gene            <597976..>598428
                     /locus_tag="LMJF_30_1640"
                     /db_xref="GeneID:5653703"
     mRNA            <597976..>598428
                     /locus_tag="LMJF_30_1640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684712.1"
                     /db_xref="GeneID:5653703"
     CDS             597976..598428
                     /locus_tag="LMJF_30_1640"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684764.1"
                     /db_xref="GeneID:5653703"
                     /db_xref="InterPro:IPR009445"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7D8"
                     /translation="MASAVANVNASAKPMTDKEITRHRVMARLSEIRTQPLKQLPMTV
                     FMMWMVGNEVSIFSIMFVGMAVVNPLQSILSAGKLFADFEEDSKADRQIRSAVNQARW
                     IYIGCCLVAFLVALVKLNWMELLPVSSMDWMDNTPPTYQELSSGVFYH"
     gene            <599720..>600106
                     /locus_tag="LMJF_30_1642"
                     /db_xref="GeneID:5653704"
     mRNA            <599720..>600106
                     /locus_tag="LMJF_30_1642"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684713.1"
                     /db_xref="GeneID:5653704"
     CDS             599720..600106
                     /locus_tag="LMJF_30_1642"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684765.1"
                     /db_xref="GeneID:5653704"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7D9"
                     /translation="MLRCLNGSMLRPTRGAASLAAATAPAAIALPARQFHSVYGVIGS
                     CLMCGACMLCFGSWANNYCNVKKYGRWRFRNSIDDVIMVSDFRGARYFGAFLGFLFWW
                     FVVGPQKYRWNSNLADIPGNTRIGPF"
     gene            <601422..>601874
                     /locus_tag="LMJF_30_1645"
                     /db_xref="GeneID:5653705"
     mRNA            <601422..>601874
                     /locus_tag="LMJF_30_1645"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684714.1"
                     /db_xref="GeneID:5653705"
     CDS             601422..601874
                     /locus_tag="LMJF_30_1645"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684766.1"
                     /db_xref="GeneID:5653705"
                     /db_xref="InterPro:IPR009445"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7D8"
                     /translation="MASAVANVNASAKPMTDKEITRHRVMARLSEIRTQPLKQLPMTV
                     FMMWMVGNEVSIFSIMFVGMAVVNPLQSILSAGKLFADFEEDSKADRQIRSAVNQARW
                     IYIGCCLVAFLVALVKLNWMELLPVSSMDWMDNTPPTYQELSSGVFYH"
     gene            <603166..>603552
                     /locus_tag="LMJF_30_1647"
                     /db_xref="GeneID:5653706"
     mRNA            <603166..>603552
                     /locus_tag="LMJF_30_1647"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684715.1"
                     /db_xref="GeneID:5653706"
     CDS             603166..603552
                     /locus_tag="LMJF_30_1647"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684767.1"
                     /db_xref="GeneID:5653706"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7D9"
                     /translation="MLRCLNGSMLRPTRGAASLAAATAPAAIALPARQFHSVYGVIGS
                     CLMCGACMLCFGSWANNYCNVKKYGRWRFRNSIDDVIMVSDFRGARYFGAFLGFLFWW
                     FVVGPQKYRWNSNLADIPGNTRIGPF"
     gene            <604868..>605320
                     /locus_tag="LMJF_30_1650"
                     /db_xref="GeneID:5653707"
     mRNA            <604868..>605320
                     /locus_tag="LMJF_30_1650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684716.1"
                     /db_xref="GeneID:5653707"
     CDS             604868..605320
                     /locus_tag="LMJF_30_1650"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684768.1"
                     /db_xref="GeneID:5653707"
                     /db_xref="InterPro:IPR009445"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7D8"
                     /translation="MASAVANVNASAKPMTDKEITRHRVMARLSEIRTQPLKQLPMTV
                     FMMWMVGNEVSIFSIMFVGMAVVNPLQSILSAGKLFADFEEDSKADRQIRSAVNQARW
                     IYIGCCLVAFLVALVKLNWMELLPVSSMDWMDNTPPTYQELSSGVFYH"
     gene            <606612..>606998
                     /locus_tag="LMJF_30_1655"
                     /db_xref="GeneID:5653708"
     mRNA            <606612..>606998
                     /locus_tag="LMJF_30_1655"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684717.1"
                     /db_xref="GeneID:5653708"
     CDS             606612..606998
                     /locus_tag="LMJF_30_1655"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684769.1"
                     /db_xref="GeneID:5653708"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7D9"
                     /translation="MLRCLNGSMLRPTRGAASLAAATAPAAIALPARQFHSVYGVIGS
                     CLMCGACMLCFGSWANNYCNVKKYGRWRFRNSIDDVIMVSDFRGARYFGAFLGFLFWW
                     FVVGPQKYRWNSNLADIPGNTRIGPF"
     gene            <608316..>608768
                     /locus_tag="LMJF_30_1660"
                     /db_xref="GeneID:5653709"
     mRNA            <608316..>608768
                     /locus_tag="LMJF_30_1660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684718.1"
                     /db_xref="GeneID:5653709"
     CDS             608316..608768
                     /locus_tag="LMJF_30_1660"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684770.1"
                     /db_xref="GeneID:5653709"
                     /db_xref="InterPro:IPR009445"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7D8"
                     /translation="MASAVANVNASAKPMTDKEITRHRVMARLSEIRTQPLKQLPMTV
                     FMMWMVGNEVSIFSIMFVGMAVVNPLQSILSAGKLFADFEEDSKADRQIRSAVNQARW
                     IYIGCCLVAFLVALVKLNWMELLPVSSMDWMDNTPPTYQELSSGVFYH"
     gene            <609986..>611335
                     /locus_tag="LMJF_30_1670"
                     /db_xref="GeneID:5653710"
     mRNA            <609986..>611335
                     /locus_tag="LMJF_30_1670"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684719.1"
                     /db_xref="GeneID:5653710"
     CDS             609986..611335
                     /locus_tag="LMJF_30_1670"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684771.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653710"
                     /db_xref="GOA:Q4Q7C7"
                     /db_xref="InterPro:IPR000397"
                     /db_xref="InterPro:IPR016153"
                     /db_xref="InterPro:IPR016154"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7C7"
                     /translation="MHAFRTRDITLRVPSKDKLLRFSFCSSRHLLAETIRRHDLLRST
                     GAHVDFLQLLGTQITFTSLLASALEGEERVEARFTAEEATILTEALALGECRCYLRPE
                     YNAQLAECGLPTFPLRVNRILYRQEKPFSSVVHADLAELLQPPCDVASSFAAASSGAN
                     EASGAPFSLYLPDMERRVPLEAWKSFFSYNSSLHAYNYLRRSDGSVPAVWLQSRIDAV
                     RLVDHGFLNVDSTAAAAAWQRGEACSDEDDEKAQDIRRALLHAIPFSFGVVVTPLAAG
                     VAVDQRVNQLNRVVMEAAALLSAPSGGGATVTSALQPLLDRCAEKHTACQHILSLVSG
                     DHDGAYQAAVAARQYNDDPAQVAAVVDPIRRALGVQDFVVPLAATEAARSGLDFFCRC
                     SKQNVLESLVSAPPRALESLKGSDNTVHCSFCGRRYKLAGAEWQELEMARSASTPPQ"
     gene            <614380..>615114
                     /locus_tag="LMJF_30_1680"
                     /db_xref="GeneID:5653711"
     mRNA            <614380..>615114
                     /locus_tag="LMJF_30_1680"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684720.1"
                     /db_xref="GeneID:5653711"
     CDS             614380..615114
                     /locus_tag="LMJF_30_1680"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684772.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653711"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR011074"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7C6"
                     /translation="MPTAKVTEKEAACVTALKGEYPASKADPADAGFLSDSTYLRFAR
                     AHDGNVKKASELLGATLRWRKQTKPYAITMEEVQNAMKQTTMYCGGRCNIGCPVIAMV
                     PGMQNDCTVEERTKQLVYIMEETHRKGYERITWIIDFGAMGSHRDERSKEARKETMKI
                     LQDYYPERMARILLYRTPWYIRMLLGAAKMFMDARTAAKVYNAGRTIEALEKFVDRDQ
                     VPPVCGGTMKGSALSHLEELPSLNSE"
     gene            <619312..>620376
                     /locus_tag="LMJF_30_1690"
                     /db_xref="GeneID:5653712"
     mRNA            <619312..>620376
                     /locus_tag="LMJF_30_1690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684721.1"
                     /db_xref="GeneID:5653712"
     CDS             619312..620376
                     /locus_tag="LMJF_30_1690"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684773.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653712"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7C5"
                     /translation="MRPNVLCRRLVRTLFSIRYFLFKERIMGEKPPSKKGSVGDIAMP
                     QPVEETAATAAVSTLSPHTIRQRTWAKRVDDAVIEMRHVQQLLQKHTVEVNTVKRELE
                     ELTYTAATLWAANPDELPAQYKDKQHSSLQRANSPASAAGRSSDNTPTKRRGGPDTTS
                     PSTSLGADALRGISEVALESVEQTLLQLSPAQRAKVSAALQSLFYAPPAALSAEVVMD
                     GAGVDFAGDPPSAAVDGTAQQKLAPPAKSGKAAAAVEVSSATAATSDGKPSTAATVRR
                     HCIPLSLLLAMKELQARRINLEERLTTATNATAQQLQRFQLLQEELMVSQYGLDAARH
                     DLQKQSELQQAPFEGVPGPS"
     gene            <621607..>624180
                     /locus_tag="LMJF_30_1700"
                     /db_xref="GeneID:5653713"
     mRNA            <621607..>624180
                     /locus_tag="LMJF_30_1700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684722.1"
                     /db_xref="GeneID:5653713"
     CDS             621607..624180
                     /locus_tag="LMJF_30_1700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684774.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653713"
                     /db_xref="GOA:Q4Q7C4"
                     /db_xref="InterPro:IPR001270"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7C4"
                     /translation="MVHLCVWWRGAISAGVLGERVEQLARLVADVKHPSEHNTVSTCL
                     SSGAGPGAGGHDVDDVGQGSEDTPSSRRARLARFVKQRIVERSKRGSSPSAAAATAQD
                     EEELSLDTFADMVGLTQQLLEQEGVLTAGTTGVAETSSTQGMRTFELYDEKINNTEAL
                     KQRPILAVVMVLVLAVYASKIVARPELAARSVAHLEALEKMMVLGSSDGNRSGAATVA
                     LPHPTSSSSSTLAALWPLTGELEVALVHRQHEADAARCSSSEGEELRSTLQHMHEKRM
                     LLQQDSSAAKAATPSERWAAGASQYIGQRPIWAALRSHFLSAGVFDADKPTVLVFFGP
                     SGYGKSELAKRVASVLHGIPMPELEASGKMVYIHMPSFCTKDSIYSLVDPPAAHVGSG
                     ILLSALQKHPDAVVVLDEFEKSTAEAINNLWLSAFQKNGVLRSLKEANRSVSTVRTTF
                     ILTCNIAAEGIAARERLYLSASPADQERIRALFQLQCRNVCQETMGDPFVNRVDHFFP
                     FMPYTRAERRQFVCLLLERLLTSQAEKGRTIYATPGFVDVMAERLHTFHAATLEEAVR
                     TQVVRMAHEGWKSGVLTAERRVAGGTVAVLLPATRSELMKHAATSSSCPASTTGGCSA
                     ARLSSDDLVDVGDRSLLVEAWESLPGGPQSLTQWEVAGGRDGCAPGTADEDDILSPPK
                     LTPTPSTCRRDTSLFSATPSTTTLPTPTPGGAEPPAVSAPALEKEYEYECLTDKVRIL
                     ELEKELDTTRDLLKQRDLEIDTLKDKILLLQKALALVLLSLLSCLFLIALIIGLKLTL
                     LFALAIAACLVFVLGVPLSFLLDAVRGLFHLLGPYKTGGLLLLLSGWLARASRSAASC
                     S"
     gene            <624835..>625542
                     /locus_tag="LMJF_30_1710"
                     /db_xref="GeneID:5653714"
     mRNA            <624835..>625542
                     /locus_tag="LMJF_30_1710"
                     /product="putative small GTP-binding protein Rab28"
                     /transcript_id="XM_001684723.1"
                     /db_xref="GeneID:5653714"
     CDS             624835..625542
                     /locus_tag="LMJF_30_1710"
                     /codon_start=1
                     /product="putative small GTP-binding protein Rab28"
                     /protein_id="XP_001684775.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653714"
                     /db_xref="GOA:Q4Q7C3"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7C3"
                     /translation="MESGSDSSEDGAMQFKVVVLGNGAVGKTSLIRHFCDSGFTKSYK
                     QTIGVDFYSRKVQLPHSHPPVTLQLWDIGGQQIGGKMLANYIYGSHAVCLVYDITDLN
                     SFKDLSDWKECVDNVFADAPAVDKPKMLLVGNKVDLPNRQVTDQNQAAFSKNFSMPHC
                     TVSAQSGERVNAMFTRIAATLAGVEMKQQDLDLADRVAANVVSRPEERQAAPRALVLQ
                     ATSNSQGKRKNGDCAVM"
     gene            <627444..>627815
                     /locus_tag="LMJF_30_1720"
                     /db_xref="GeneID:5653715"
     mRNA            <627444..>627815
                     /locus_tag="LMJF_30_1720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684724.1"
                     /db_xref="GeneID:5653715"
     CDS             627444..627815
                     /locus_tag="LMJF_30_1720"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684776.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653715"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7C2"
                     /translation="MQDFNGDSAYEAVEVMVVDRGTQTVSTVGTQTDPLPMPYGAYYP
                     GPFAPSPYTGASSYARWMPPSLPLRSYGAGVDEQPFRHHYHDYEQREAAEAAKLRGEL
                     EMIQNSIDMLIARYNLPPPPT"
     gene            <628424..>629596
                     /locus_tag="LMJF_30_1730"
                     /db_xref="GeneID:5653716"
     mRNA            <628424..>629596
                     /locus_tag="LMJF_30_1730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684725.1"
                     /db_xref="GeneID:5653716"
     CDS             628424..629596
                     /locus_tag="LMJF_30_1730"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684777.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653716"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7C1"
                     /translation="MFSAKYYDDPFDDDDNDICYAEVVSDGDDGGAAADARPRCTFAP
                     STVAFTSALRRTSETAKSGCGASTEIPPSTVYGSRSGSGQAENLEYEAHIELLRAELK
                     TANAENSRLTAFQSKLESSVRSLSFGKENAERQLQQEKERNRVLADKVSALEEELKLM
                     MTHASSAAHHRGATSLETSSLHASGSPEGPRPAAPRAQRRDPNTPMGQFMASDTPLEL
                     SRSLELSRSTARYAPPVDGSRSSYALEQLHHAQAAYAASRGGPHERQDGSMMTTALPP
                     TGHTSNEPQGAAPPPSRQTLRSQRGATAVHETIAAQEQTRNQQAAAVRQLEAQLLQHS
                     QQRDELTKQLERLERIRTRTVADRKKKAVVERQLEDEEKVIGQIRLELRSRSALMR"
     gene            <630436..>631377
                     /locus_tag="LMJF_30_1740"
                     /db_xref="GeneID:5653717"
     mRNA            <630436..>631377
                     /locus_tag="LMJF_30_1740"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684726.1"
                     /db_xref="GeneID:5653717"
     CDS             630436..631377
                     /locus_tag="LMJF_30_1740"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684778.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653717"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7C0"
                     /translation="MSFAKGTTPRKSPESKPRNGDEKTTDVTKEAVKRSSSRVLHVSV
                     TDDTQIVSIPRDQEDAFDVWAVYSHAVYATKKEQRFLKRSLQSRIHENIAQCSNLFPL
                     IGNDQEGKQSTPTGNSGRRMDGSFVSTLQAQGYGKNIAACAMCVLSVWPSLPINNRPP
                     MSTKVQRSFEDLQAGTHLYVFNEKPNSPLLCDTALRLLHSIDGDEVSVTIFNATERSV
                     IDGYIPLSFVVSLSFGLEPVERVRHLKKTGTITCSNGNQTTEETSKRAFTLHCSAPEL
                     FYVTFIAETQEDFDKWTCVIDYFALLNSCYRTYLQSR"
     gene            <632106..>632603
                     /locus_tag="LMJF_30_1750"
                     /db_xref="GeneID:5653718"
     mRNA            <632106..>632603
                     /locus_tag="LMJF_30_1750"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684727.1"
                     /db_xref="GeneID:5653718"
     CDS             632106..632603
                     /locus_tag="LMJF_30_1750"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684779.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653718"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7B9"
                     /translation="MSLYSEIVSDQLPAAISAVRSHLAKWSPSQLARIVFTEFIAFLR
                     KYWAWAMYFIILRKLYRILSRTNKRSSKPNRIKRSSASVPDSNNTIADLVSTPCTVDV
                     ASLTDTAEYVPSKNQMIVGDGVIVINRNDRYVEVYERKNVAKVGSVEAEVKALLKEFA
                     ARNDK"
     gene            <633401..>639205
                     /locus_tag="LMJF_30_1760"
                     /db_xref="GeneID:5653719"
     mRNA            <633401..>639205
                     /locus_tag="LMJF_30_1760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684728.1"
                     /db_xref="GeneID:5653719"
     CDS             633401..639205
                     /locus_tag="LMJF_30_1760"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684780.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653719"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024395"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7B8"
                     /translation="MSEVLWHSHWKARKNGYERVQKDPIKYKKLLLDSLKYIANEGNA
                     TVQEAAIEALVIVLSECNDAERSQLAEGTLPIVVEKGITGRPKAVQLSQQFIFALVEA
                     GSGAAVFAALLPALAHKAPKNRLAAAQTATSLVSDYGVQHFPLKEILKAMQPLFNDAN
                     AQVRKEAIALCCQCYRYIGANIRGFLTDLREVQLQELQKQFESLKVGERPPKMIKGAE
                     GSSSDGKDGKNSLAVAKPIGSLTGEDTAAVVDDAGFELLEESLIIPRLPKKFFRVVLD
                     KETTWQDRVEYVNEHLVPLLAAPRFRAKDNYHELASMIKEYLVDPQAPLMLLGFKMVQ
                     DCARGLRSNFGPHARLFVAPLLGKMKDKKVSVQLHVMKTLEDLICFNCISMDQCNDDF
                     DQALQSKNPTQRTVLLNYLIRMVDTLGDRSRYVKLGRSIAMLMRAVNDEKASIRDVAY
                     VLLDRLIRAFGEAQYKSVLERLDENQRHNMAAAVARGAPTVGPRSVASRQASDLSISQ
                     SGGTSGTTPFNSPAKKIPRVEDLSAATVALAPPPQTSITSAPCATVVARRISAFVRED
                     GADADAEPRGTLALEPPRTSSLLRKSAPSHASGTEQLSVAGSCVAATHGSGADQSSTR
                     TTADDSIALESLLPSKMESLTMILGMLNGDNTVLDMVRSREWARRQEGMNKLLLMVQQ
                     WSPAQTTRAMDYLVVYIRAHPSFREPTFQVFTLITQVFQVALAKAVTLTMAAGYAIVS
                     GFTSRFAEPKNKPLVREVCGLAARKLGQRFVVRHILDTAAMIKTPKLLQEVCEYVREA
                     VQHQPDSEEAERDAVDARGALHFVKTVCSDFNNAGVRQEAALLLVALRRSPQASVAAV
                     ERCVASLQPPLPALYERELNRSVGVATIAGPLAPARASVALPAGAPAPGAAVPTPPSP
                     TQKRARAVSQLSVPGTRASVLAPSSPSRPSVHRRSLSDTEASPNFPHRTSSPGGTGVA
                     TRLTSERTSSLRPLPRNSCSASAATPGGLRPILHEITSGKDWRDRLNGVRRAEAFVAE
                     AARPLPGHCAVALLKALQGRFEEANKNIIVDVLRFIPVVVNAAEPEECRAALRQLTPG
                     VLAMLGDQKAALREEARNVAFFAMNVVGLESLLPLLQRPLSSDSNVCRQNVLEMMISG
                     FEQLPADATLPRVGMQLLTPAVIASIMDRLLDVRLVAEQVLGWMLGVVGEDVVMHSVQ
                     QLKPAEQQAVMPAVERQIEHRRRQAQEGRPEGQQDQLPSTAKSGEPFSKVTNDLLDNE
                     ESRRTTPRRATPRASSPATPRVANGGTTTPRRLSAAHIPYDARSAISATRQNGNRAGT
                     PTLELAPKTRPVHKEAASVTAAPSAPSTAACEGGEAMPAPASSNGPAARASAHPSPPS
                     AASKAAAAAKASQPSNASRTPTTSTDISPVADGNEELYTIREILVGLRSATSDVALAM
                     CKDFCRHLRAGVDCGTPEVVQVMVERLYENTQTFDRDLAQALIDCLAAMFMIPRCAMR
                     CHSQLLFRMMGAFFDCLLSEKFSLHEPVIKALNVMTLKLLEGCPANDVFTALLSRLTT
                     YSTIYLSTGQKADLKFLQVTVKCAMRVDLTKVSADTVILCCHEYLLQHPPSAFRNLDD
                     LPIRTVKTVLQTTTKRLGASLLTTAETLVGPQNLVTHFIRACLELRNKAAKERGQNEQ
                     QAIEVSRHEQRASQSPAPLPAKEKTCSPPTPPNNTVASTTVTSTAAAAAARAAAPGTT
                     ATAATASVTPSRGTVTPSWRKKRVSHHADPNATPASSLDATTVASPGASCGGSFSPSA
                     PACSVRAPLKAHSGLQVAAAAGQSAPESATANSSIVVASSKVTPRGELNGPVSSSQAN
                     APTASPRDIKKDLTEVFAHIRNHVTSSSGIDELYSFLKDVPPSSFEEAFRVQFNRCSE
                     AFRLYIKRKLERKVEEDTTKPASFKLPAVIQHLS"
     gene            <644320..>645408
                     /locus_tag="LMJF_30_1770"
                     /db_xref="GeneID:5653720"
     mRNA            <644320..>645408
                     /locus_tag="LMJF_30_1770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684729.1"
                     /db_xref="GeneID:5653720"
     CDS             644320..645408
                     /locus_tag="LMJF_30_1770"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684781.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653720"
                     /db_xref="GOA:Q4Q7B7"
                     /db_xref="InterPro:IPR022088"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7B7"
                     /translation="MEDTAASAVLGGQLMVNNPNDERIEVRNAENVKTPRASLGPSYT
                     PGADAGRGGGGMGQPIENAPHDEAIPVSPSASQVATPTAMRTGQTMRPDDDDDEREDE
                     GEEDEEETEIDESREYRAEGYAGQKPTELAEAAPAMQVGDPQLGYNPAKYARINATAS
                     REMQELFKQIMEYEPFAAELPAKLRPFVPDYIPTVGDLDPFVKVPRPDGIPDGLGLEM
                     VDEPAIPQSNPAVVLLELNATNAHGVAADIVDSLENAANRPEVIDRWISDIKKVHYKK
                     ALPTVNYQRPMPDIETLMQVWPQQFEEVLNSDVAFPPSHINLDLDQYVRTLCTILDIP
                     TYSSLIDSLYVMFTLYEEFRSNQHFQHV"
     gene            <647103..>648983
                     /locus_tag="LMJF_30_1780"
                     /db_xref="GeneID:5653721"
     mRNA            <647103..>648983
                     /locus_tag="LMJF_30_1780"
                     /product="putative protein kinase"
                     /transcript_id="XM_001684730.1"
                     /db_xref="GeneID:5653721"
     CDS             647103..648983
                     /locus_tag="LMJF_30_1780"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001684782.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653721"
                     /db_xref="GOA:Q4Q7B6"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7B6"
                     /translation="MAHLFFTGACAAAAALPISDREEVSPVWSIYDDYCCGASQHAEV
                     DDPQVEGEGVGNCGGTTPPRLPFISGPVSSMTLKGAQLKKEAPIRRGAQGAVYSALDV
                     ATSAPAEDEKAKGLFSPEACRGHEGEAQVADGGQRPARRGRRVAVKRIFIQASDFGAR
                     DISATVLREVTLHRFVSEKQAACLAAAGAFYPTGSTSDATALAEADQGQTLCNLIDDS
                     ARVIHLYRVVEAPHKEMCLVMELAATNLEQVVFPHGARGASRGDGAGGYKRKPGVVSL
                     FGSSASIGVGGGLGLSSASPSTAPDAATAEVGPQASSPSPPPSRMPLVRYVMRRLLRL
                     VCFLHETCCVVHRDLKLSNVLVSKDAGLRLGDFGSARFIPPLRSATKTGVENSPSVPE
                     PPAAPAGQREHLLCTPPSIRTTLHYRPPEALLGDQVCRTAADVWALGVIFAQLLLQKG
                     LFHSESELDLLGAIQKLLGMPTYSAPPSWLAAPSVPGPPRERESAAHVPAPQASLPYK
                     FHTGVVPADGLDLLSRMLHQQPECRVTAREALQHPFLNLEGLSAAATHDDDERGRVLW
                     EERVATVLREQATGHIYGMGGGERRPMLISLADNEDEEDQEDDEVGVAPFCVNLGGCT
                     SY"
     gene            <652794..>654164
                     /locus_tag="LMJF_30_1790"
                     /db_xref="GeneID:5653722"
     mRNA            <652794..>654164
                     /locus_tag="LMJF_30_1790"
                     /product="putative DNAJ domain protein"
                     /transcript_id="XM_001684731.1"
                     /db_xref="GeneID:5653722"
     CDS             652794..654164
                     /locus_tag="LMJF_30_1790"
                     /codon_start=1
                     /product="putative DNAJ domain protein"
                     /protein_id="XP_001684783.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653722"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7B5"
                     /translation="MGAGTASATPKSTGGPEASPGSVRRSTLYAVLNVSHTATLEEIT
                     AAYRKLALVYHPDRPNGLQWKFQEIQRAYEVLSQKDARAKYDILLRGKLAVKNFKRPP
                     PLESVLQPVYALLADGAFYEFEAASSKLKCSFHYGDGIQFNGDCGSFIGLAGDGFIYW
                     TISGRGFASRLCKAGSTFALSSVRVMYRSNMGLAKMPLKRSSLHSSHTCRPAGSSGDK
                     RAVRGSTGDAGCSERAKSTTGARAAKMSEADRIKKALLNKERSRNLKRRMETLKEEEI
                     EARNSLQQDLWGQFSSLHTTAEVAFRCTLQGVAVPVEMALWMGYKSPEEVMLRSSGAC
                     SSLFIAEQVSLQTSSLWVDPLQSDYFNDDEMLREGCDGNKEDRKHCTSNGRDVTARHK
                     PDSADSSPCSSQSSPASDGAPDGDACRGRSATASGTHSPILHRLNNGATAVTGASDGA
                     EVAKKE"
     gene            <658099..>659508
                     /locus_tag="LMJF_30_1800"
                     /db_xref="GeneID:5653723"
     mRNA            <658099..>659508
                     /locus_tag="LMJF_30_1800"
                     /product="putative queuine tRNA-ribosyltransferase"
                     /transcript_id="XM_001684732.1"
                     /db_xref="GeneID:5653723"
     CDS             658099..659508
                     /locus_tag="LMJF_30_1800"
                     /EC_number="2.4.2.29"
                     /codon_start=1
                     /product="putative queuine tRNA-ribosyltransferase"
                     /protein_id="XP_001684784.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653723"
                     /db_xref="GOA:Q4Q7B4"
                     /db_xref="InterPro:IPR002616"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7B4"
                     /translation="MPPSSIFTFDEYRGPDGKQPVAARSGVFHLPHGPLRTPIFMPVA
                     TQGALKGVTVEQLEELDVEIILGNTYHLGLRPGEEVLRALTARKNAREAATGTRTSAD
                     GIRDNMDGIHFMENWKKNILTDSGGFQMVSLLKLAQITEEGVRFQSTHGSGTAGAVAS
                     VAKTEASSSASGATAAASAVTAPTDAANGHDNKGEAEGTYSLLLRPEDSIRIQNAIGG
                     DIMMQLDDVVHTLTVGPRVEEAAKRSIRWLDRCLAANQNREKQCIFGIVQGALNAELR
                     RYCVKEIVQRAECMGYAIGGLSGGEAKDDFWRMVRLCTKEGLPANKPRYCMGVGYPED
                     ILVCIALGVDMFDCVYACRTARFGSALTSSGKLQLSRKEYATDFGPLDPNCSCMTCRT
                     YTRSYLNMIAAKEGTAATLLSYHNIAYLIGLTRGARSAIEEGRFTEYVQHFFLAYYPA
                     KDYPAWVVEALNSVEITLL"
     gene            <661454..>678139
                     /locus_tag="LMJF_30_1810"
                     /db_xref="GeneID:5653724"
     mRNA            <661454..>678139
                     /locus_tag="LMJF_30_1810"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684733.1"
                     /db_xref="GeneID:5653724"
     CDS             661454..678139
                     /locus_tag="LMJF_30_1810"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684785.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653724"
                     /db_xref="GOA:Q4Q7B3"
                     /db_xref="InterPro:IPR008962"
                     /db_xref="InterPro:IPR010488"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7B3"
                     /translation="MRSSSPETNARKAAVATFSGPSSAPLTRLQKRFSSHAASAGREK
                     AAALPAGIAAAVVGASAPFAATGSSSRKRSASKVGLALHQPANAKGDSAARVPPTHRQ
                     ANKWNADTAPLDALSTRQSPHAAPARSPSFPFDVYPTQIFFDSFEANRTYTATLELRN
                     HTAANTHVRVDRPSSCSGFELSAPHGAESSSKVAPGLSVIYTVVFSPTSNVKDYETKL
                     VVRAESGEAITVPVLAYASRGQLQLPAALTLREAPVKGTSCTPLFLRNTSKQSCAWRA
                     MAFDVSSVAPEAMVKDASYPPSSHFSITPSHGVVEPLCGGGDGTAVAVAPVTLHFHPH
                     PNMAAAGTCGGVLRFFLGPEGDVVQDVRLSAQAVELTGIALEQTEVMLADTYVTAERQ
                     AVVRLRNDSDNTVHFAWKSSYRGCRVSDGDDDGSVAGDDAEFGGDGAASGGMTGSCTE
                     KRKSDLTATAGGSVYSGSSGGDGRQHQPHQRFHDHSTMRDDYTGDEAFRIEPLSGILY
                     GHGVREFTITFNPSVAVLYESMAFLDVTGLENRLPLTLRGHGLGPQCTLEYSRLEIGD
                     VYLNALHEYEVSMENISSIECQYVIMPPLPVLSASAAAATSAEPAASTSLTDFSSKFR
                     FTPSHGTLGPGEIVKLRIELQSDRIGCFSEVFRVHMQGAVEEVPLLLKGRVLGPHFQC
                     SVEELVFGNVSYNMTHQRTMQITNTSPIPMHYTLRMPDECTYADDLSISPATGVIAPM
                     ATQTVTVTLHSCTVGDYDTALLVEVADVGDVLEAIPLRATCMVPPLFTNATELSFGGV
                     FVGYPSTLNVAVLNNSALTGMFELVLVGGGALSDVVSVELPVSTEHEDGVHWISPHQT
                     MQMPVTMTALRPGKLHFSIALRVLGMDSAAAPSQTILVSAVASGKHVEMQPSTFQFGT
                     VDVLRAEVKELTLKNTSPVPAPFSLVFDRYGGLPATASSAAAARVAAEATLPFPRVPV
                     FTVEPADGVLEPHSTLTVRIRAKPDEAMVFSDTLRLCHSPASHSATAAEETAVAAGNK
                     PTVTVKVTGKGIPVVPERPVADVKLGDVLTTALVAETITLHNYGRREQEVQWQNTHSA
                     KMKERDLPPAFSYKPERAFIPAGGALTFSLSGGSDEPGVRTETFTLKQSGTFKEILRS
                     AVSATFTVPTLSCSTRAIHFDFANTEQLQALDAPSAASLVKSLTIKNITSKTLVVSLR
                     IRHAATASSSSPSPPPLGASSAAASGVPFELEGPSTITFAPGDSYVVGVRCNPLYRRD
                     FTSHTTKGMVQFSLAHHARKEHVSLSATLRFPALVMNPPARLEFGSVLRNTQKRRAMV
                     LSNPSADLPARFEWVLQPQPANSATAAPKTPAEAQYTGDKSAPLIIKAGDEAATAAVR
                     CFDIVPYTGMLLPGESRSIDVTYQGAECGTALATAVCRVHGGPTYTVEMHATSSVVQA
                     RCDRTEINFGRLPFYESATQSVMLSNSTLVPVTWDVDLRSMRHPECVHVSPVSGELRD
                     KARLLITFTPTVPDAFEETLWVRIGHLDPQPIRLCGSGYMNRLMIATTSPTASAVENE
                     VVVYRAPFSAFTEALQYVESRLGSSQLGSSQLRSVYASRSVTPLTTTLATAASASASA
                     SNAPALPTLVQREWPTLEAERLAFCRAVCEAQASEHSCSVSPNGAIDPPLFLAPHALR
                     RKSVTAVGSSDGTGAGTHKLVLARYIVDFGHLTRHDMRKMTLRLTNPSATEVVSAMLD
                     SKELEHLPVSAVPMKGIKVGPLETTTLTLVMDATKPESLVRHGQNRYEFAIDVKHGPA
                     IVVECRCYVATPTLRTAEKEVRFGPVLLGKVKVLPLVLTNPEAVSCPWRVTCKEGASS
                     DITASAASRGHWLRDGQSYTPAGLVAGEPRGSIRSRRAAPASQFWVKKDHGVVEASGT
                     TTIAVYFAPNRIAAEDGMGASEDRGSAPATATLRFRCGKGPAESVLTVKLIGSAFQYK
                     VSLSTTQLQLPVVRPHQVVHEAVTLTNNEEHPVEVYSLDLDTQHTHEIKLLRRAMEVN
                     PDHEIFLPHLEAGSRLPDALLESIFARLHAASDSLKEALPAVDLEAAEGVLAGAPAAA
                     CKGAKTSRGQSVSAVSRTSSSNSKGGRREKGKSGHRSTAVASGGIEKGLDSDPAAADG
                     IADQNQGAIDGCTAVSVAKPNVVLLVGPPCSGKTTLARQMTEWADAGSVIRVDVDEVI
                     RREADRDETANGAVARFLLSQLADRPQKSVPVTADGAAATGDAVAASYIACAPKLVRD
                     ALEGHLSRCITNHATSSAAGAASLAESRDSAASRPEKLLLLFDGLGCAVLQNPWRLFE
                     LLKEACDALCIPLQIVSLAVSTPMSGVRRAEALEAHHAARATAASLTLLSEAAFEALD
                     KEAREDYTRRLKHFNDCRRDLRAAQQLKRNYMAQLPHKTVQQEAEEAFTQAQMDLQQA
                     LALESTMRSARKGKAVAGAGRGAALAADGAKKLQEPKWADLDAATQFREWYTRFLTKY
                     GTPPKPEGGDDSVIGAAPVRAGAVGPPLKGAAAVAAAAAAEERANCWAAVLRVSAETE
                     TPSEVARVVELQLAQGDTETSSDTGAAAIMLAVPTLSPPSTTVALAPSSSVASGEGQL
                     SVSARETDTPPAASSTAAAVESSNSPATAAAAAATSMIGEWFYLNKRRLRFWGNEAIG
                     GSRGVASVVGRPSSGEEVLAAKARTAVASVAGAAETHAPLEAAGSPSAMDAFHAESAA
                     ATKAARYVHFFSTLEREVIPAKKSCGRGKTVPGVVQQEEELTRWWLPPKSSVTLTLEF
                     CGDHVGPYTEKCLFGVVGTLQQLGLTVSTTVALSDISRDPKDIFPVIKARGMSISGGV
                     ESGQRVSKVYIPSRKLFDFGPLLIPPPPVPRSRRRSIEKAGTGSSSSTAGSGRGGNAG
                     GGNYAHTSKAPLQYDNTLGEETLTFVNREASEAEVTLSFLNEKEKTFVVTPTSFVLKP
                     GTSQLVSLRATPEKVGDFTNTLLACIKDNPLPWRTEVTCTGARPTLTVNGCKDLEVNF
                     GRLVLNRSVTKSFSLVNEGPLPLQWRLVPVLDGATTRGPGGGGSGVGSAPSGAAAAAA
                     AQLPAELQCSALEGVIEEGGAYTLNMTFAPTHPCLYTRSMLFTVSYPGHPHQVLYESL
                     PMIIKAEGYDVVLEWTREIQLGVLHVGEEKHDTIRILNKSPYEVGYQLKLPKRLQKSV
                     TLSSPSGTLRGMVGFKDAAVVNIDVVARLEKEGELPAKLSLIEVAFFDVEKKELLYPV
                     QSIPVTGEAWYTKYAVQPPSVSFGSCLIGQPRESTFELRNTGVFPLEYVLFNYRDAAA
                     EGSVNENVADASTAGGAAVAAAPALHAPSAGAKNQIKAAKGSEMDIIVGAFKCCPCRG
                     IIPVGSAQIITVSTVPRKQSRTQETIGVRVVQSGPELEHYGTPVEVSAYPALPSIAAD
                     LTSSADVETIFEEQRVVYRLDQLAKGVCAYSKEERVFSFGTTLVGRRSEERFRIANSS
                     PLPCTVVAHLEGASVTGASGNSGGGNAARGNASAASSGNKLVTGGGGGGASAAAGGAG
                     KMEGFDLSLDGSGASPAQTRMMTVKMVLPPYESRFLTIGFTPGSLRRFQAQIVAVAEN
                     AAISSDDMAEVGQELRFGLCGEGTLPSVEVEVPPRLSSSAVPWGSSGGRKSSGACAGS
                     VERVHRRTESGGSSSSNERKRGLRRSGGGSGGSTSPSVYGSTDGYTTSSGVAEVLELP
                     LARVGAVASRSFTLRNIGCVTAKVQLELMTPGGDGYGTPNSALKITTRGGTGGTAVKK
                     QRGALAQHRVELFVPAGQSEVVELTYAPTQVETTMTRMRVLLRDNPFEEKEVHILAYS
                     FDSPISFEGIDPSSPDHYDIGDCWIGVDKSCTFTVRNNTNSLVRYDWQYPDAVVRMVP
                     SVGHLSAGATRTITVVVRSESQNLNQVARCTIQVQSIQLLSNALGGGLVHSSIGDGGA
                     ASRGAGSGATPVSGATNAVITEWDNSMQSPKWVLREDDTAASAIAAGAHSAAATAAFL
                     STAASMVGRRNLKQVLEALPEPPYAVVDAVNVMQPLTLRYRCSVPAYQCQLVDAATGA
                     VTDLKAISFEQTYLMQKRVAIVRVINTGSVGLPLTYDIVTSGEEDEALSRIASQQDLK
                     SPHARRGDSGASAAIVVSGASFLTPSVEGDAGALHESPGYTSPTADFAVVPAPTSRAA
                     STIPVGTHLDLHVEFTPRAVGLIMAELILLMRHSDPAEMRVPLQGVAECPLVHFNIPP
                     TTYSDTRSMAGISGAAYRGQDTVVVEFLARGLHTKATVKFPVMNPTATTYSYEWVEEG
                     MGRGANTNGGASGGSVSPFRCLTPMGTIAAGRQTEATFEFFADTLGVRESAWSFQIPG
                     RAAIPFVLVGTATEPNVYFHASKVLFGHVQVGTQVEQTVVLESCDDVPFSFSWDKLSM
                     EGTSSFLSVRPLRGTIAPHERLLVTVTFAPQDEVEYNVPLRCTVKRSSVPLSINVKGV
                     GVSVHESLQMEPIEDGAEPTRMVRGQPLFLNLDRVQVNSTVERRFALRNTGAYPFQYS
                     VEAPENSSVSVEGMEGKIAAKQTGLIVFRYHPTCEETLKQCRLLFRIEGKVAYKVGIK
                     ATAYMPRLQLSFDHYDFGPRFILAYNNGSATAASGVAMTVLQLTNLESEVVSVDCSLS
                     AHNVWCRLDSTTLVVRPKESARLRLTFVPPEARQYNDNLRLCFNALHTVLFPITGEGA
                     VPRVEVVNPFAKLGIVRIGETRQMEVKLMCLSRIPTPISFAQSIDDDLLQKGFSVSLP
                     ERTPAATAAATPLSMMLRPKESTTVVLSFAPTQRMGEFSREVKMLVCGVEVPFLSVSG
                     SCADAEVHLDTSALSFRDVVVGASASRRVSILNSGNISQKFSWLSSLQKLRPQGEWSI
                     FPSSGYVRAHTELSCELRYTPSLPSRGNAKAAAAPASSAPMEQILTLELDSSPGISLT
                     IESNCVTRPAATETVHFACRARETDVKMIEVHNPTEETWTTEPVLDNSLWTCPTQLTL
                     KPKAKSMLAVTYQPVRPTASVAAANAAAAAAAKFYSASNDLATAVLSSTDKATLFIPL
                     PNGTGQCVALEGIAEAAGSAGPMQEYDGVVQISLPLYFQIRNWSTTEIARFRREVEWN
                     SVTRTGDNESRQLSERISTLIRVEGDEVGDGSRKGTPSARSGRSGNRIGTASKAPPAQ
                     NAIEVPPGASRESVLTVTPLCEGVYKGTVRFVPVDRPSDSAAADVAQFYDFVIRVRPV
                     EVSVPTTVDLHAALRELASFAIPLTNPLSKPAVFKLEVGAADGTASPTTTAASAAPET
                     FTFPPSVTVPAHTHAEALVHFFPLIPKPPATVRCTVTSAELGSTTIYDFRLLSTCDVA
                     APERMTRLVCPLGQHTNFVLRFKHYSKTNTEFSIRVSGETLGKGTAAFTRVGASGGGS
                     QVAVVKVNACPPPPATSASLVSKGQDVAVEFSYEPSELGEAAETIEFVSPVAGTYTFP
                     IVANCTLPERQGPFVARLGQNVQLPFKNVFSDPVAVTVTSDSPFFVPSRKTETIAAHK
                     TANVTVHCKPEDGVEVIRGRVTITCVPPGKPAQNQTQQPIQWVYYVEAVNASDRGSSV
                     KQSKAKK"
     gene            <680123..>681991
                     /locus_tag="LMJF_30_1830"
                     /db_xref="GeneID:5653725"
     mRNA            <680123..>681991
                     /locus_tag="LMJF_30_1830"
                     /product="putative splicing factor 3a"
                     /transcript_id="XM_001684734.1"
                     /db_xref="GeneID:5653725"
     CDS             680123..681991
                     /locus_tag="LMJF_30_1830"
                     /codon_start=1
                     /product="putative splicing factor 3a"
                     /protein_id="XP_001684786.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653725"
                     /db_xref="GOA:Q4Q7B2"
                     /db_xref="InterPro:IPR000690"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR024598"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7B2"
                     /translation="MQTNVLERIRALEADIERCIDSIVQQDLFAASIENERHRILLDH
                     FTLQQVGIVRSTAEKLLDVYLDEDDIVQVQNAPAESPDNIAAAVKEFEAKIADIREYH
                     HIYRDLPPVKDELAVPSPRLLDDIFTVHERYGACFDMDAHYNRYSAFMVHTKTLAEGC
                     VSASAEVKKELAPLSPSSVLKWSSMWPGRLDFFSFTKALPQLLLHEVEAHRKIVGFAL
                     YKPFVAELLAYLEGFYRRIHPLKPAALERLMAEVESDAEKYWASLVEVKAEVTSVAAT
                     TAAASTEDEQADVQDVEDERVEEREAGGAAGSSSKGQTAAPVRIAVGNKVACGLAIPP
                     SLRQHVKKFSLWPLPLIEKLIEDVGQASGTSDGAVASTSKLPTSVADVKMVCLMEAKA
                     AALLQSFLYTTLETTNTSLLRDYSRTLEELENDREVAEQEFLDSLEEVRKNSADTMEG
                     TVAHAAEYNLKLALEDSKGSRRGRHGKASAPAPVAAAPAAPELPLEEEEEQLIGENGE
                     PIPRWLAQLHQLDKMFRCDVCGGTIYKGPKVFREHFGAERHAEGLRRLGVMHHLKSYE
                     GITSIRQVVEMREQLTGGESGFRKRLRDNTDNEEIQDARGHVVTAKEYLRLQQRRR"
     gene            <682963..>685425
                     /locus_tag="LMJF_30_1840"
                     /db_xref="GeneID:5653726"
     mRNA            <682963..>685425
                     /locus_tag="LMJF_30_1840"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684735.1"
                     /db_xref="GeneID:5653726"
     CDS             682963..685425
                     /locus_tag="LMJF_30_1840"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684787.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653726"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7B1"
                     /translation="MSQSSLASSTASGCASAPSSSGSAAVLAAWPLSSATDIEDTTAT
                     TSVTTSASACSLTDGDADASAPPVLHDGLWSLTAPLSDPSTVTTTIAAAADAPYQAPE
                     ALPSLQPLPSIDVVQLRGFISNAIGTVSASCAMLPQTVLPTSISPSHDDPGDTLAAPR
                     SSPLRVPSSVASPSVASDASTSQQGVASSLPTVALAPSPESPVPFAPVVAADQEHHSD
                     IPGSSPAGTPSTTSASSPLSQPRATAEATRIVACDYTAPATREERFRLGLSPSIEGAV
                     TSPPICGAAASPGGQSATHSLPATPMALDAKPASTSEEDTVAVPLPRAGNGDHCVSGG
                     GVLLGTTEARVALDDAAIAEPALSLSSVAVNVNAGAGPQAEGGASFEAPKRTTPLLTR
                     PAAAPGKLTIPTVSINSEIDGARQDGNDDCRWLMVSVEPPVIQEPEKVPPASRKRRRA
                     ALAVPNRQPRRPAQGAGSEVKVVEEVEPALSLSAPPESGLRHATAAAGREICHAPTLI
                     KTHAPAAVSAAVRGSGGEGASDKQRLDVLPPPVVAHERDAGDMDVCALTISNTPEELP
                     GDVQYGLRRVPADYGAQAETTEDSCQTEAPVVACSGKKASVTSPPSPVAIGASAAVAR
                     TTVTPLPGSNPTTETSTTTAAVHNGKPKRGRRGAQGTAAASRKDSGPGALTKEAGAPA
                     SFLPASSRPVLNLAGVNVQALLAEGTDPPPLYTRRQRRTRWRSTLAEDHPLFAEHRDL
                     WEHDTAGRILPRAPFASDADVLNSLTEWTDSPALVYAHLLWRYAPALFVNLAMHDSDA
                     TLYVKVEPKVEADTRVKQEKME"
     gene            <688915..>693039
                     /locus_tag="LMJF_30_1850"
                     /db_xref="GeneID:5653727"
     mRNA            <688915..>693039
                     /locus_tag="LMJF_30_1850"
                     /product="putative phosphatidylinositol kinase"
                     /transcript_id="XM_001684736.1"
                     /db_xref="GeneID:5653727"
     CDS             688915..693039
                     /locus_tag="LMJF_30_1850"
                     /EC_number="2.7.1.137"
                     /codon_start=1
                     /product="putative phosphatidylinositol kinase"
                     /protein_id="XP_001684788.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653727"
                     /db_xref="GOA:Q4Q7B0"
                     /db_xref="InterPro:IPR000306"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR015433"
                     /db_xref="InterPro:IPR017455"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7B0"
                     /translation="MSDAPAATAAAEAATTARTENPVAVCPATPPPTNCIGSVWLGVY
                     DRVSHTRFRIHIEDPVFLCIVSNTVVPAAESDGSLPFEMQEFVECLDAYERERLRQAY
                     AARRGTNTSGGGVGIGRCGVHGDPAAAAATAGSCGAGGAVSGSGAIHSGVFGIPPMCC
                     LNSCSPAGGPVPRKLEETLRETLSENSDFFFRVSSVAYHLDPNPQGASACTPASASVG
                     SGVMGNAGVGACSPRRGEGLASAAAGGVASLLSNTIAAASATGPPPRRKYSVHSGYSA
                     AFHLCGRLFADVYRDHCRALAQKIASGFSGLRVEDCVKFRKAVWSGFHLKALEPYRSG
                     ARSESNLELRWVSEKIKDDQHLFPSRGVAPQQESSHVSRLVDATLSYVANARLRGRPS
                     SSIGGNANSSTGGNGAAGAGGAGAAGKGGGSAAARATVGGVAEENELNTFGLTKLLHN
                     PSWQKDDESSDSCPSCGRAFISLSRPLGTRAHHCRSCGIRLCVFCITRRAHYSFAKLA
                     KPGSSDEAEERLVCDTCYKEYETVSQLHYLGALFAFAGLGFSDLVLCRTVNEQWREAA
                     ELCISEYRLLLHNCDANLHSVKTPVGILLQNSLFLLLGDGPTSSIPVVHHPEAALLLL
                     KFIATENLWVPDASYYFIWRLSSSVLNRADTVLTSLPSLSSSAASAVESKHHSFQLPV
                     VPNFSHWHLFCTAFCSKIGSSYFFVKCAELLCAAPAKVYDAYVASALERMTRVYLSTT
                     PLWKRLAEANQATAAAFAARTSSPPTTAPLPLPMLSDVTEGQVVTVWLLDMLHKDALV
                     PAQRRRFQQLLEHVIPTVAGSSLSLVFIMLLSLQSTYSYYGYDEDLFGLWRTRIVAEV
                     GRKDPVARDRVVATLDFFHELDGFCAQSSVVSQTSVVGWIVAYCRRGAPKAPASATGA
                     PGEATMPSARRVYHHSYIDLPHPILNPFKPYIVLKSIRLSGVKVAPNAASKPTWLAFS
                     TWSAAEHLERDTTTAAENFGRHTLPTGESHAERSGEGREKGTGAASTYLSTKTSAPVT
                     RPVTAVNGVSPEALHESLPQEYMFLYKRENVERDQLMCISSRLLQMLLSSEIGNAEML
                     DYSVLPLSCDSGLIEKAEGRELSNLDNMDIASYVLHRGTRSCINFLASAKLFLLLNYI
                     FSIGDRHKGNVLIGTNGALLHIDFRFIFSEKTFVEKLARSTVRIDDAFLAAVEQCQQR
                     QCSCFAGSSPAATSSHAQGWASPPASSGSGGRGSCASPTKAPEPSSAEIREAFFSSAA
                     EWFVHVRPFAAVFYELWLYAVHRHTVPYNDAEMLNMLNTLFDRHASQTSSASKFSTTM
                     KESVNVCRLKDVTHSSAEVLRTFADQVSRRVSESSVDAMKMMGSMWSSWWSRGG"
     gene            <694758..>696215
                     /locus_tag="LMJF_30_1860"
                     /db_xref="GeneID:5653728"
     mRNA            <694758..>696215
                     /locus_tag="LMJF_30_1860"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684737.1"
                     /db_xref="GeneID:5653728"
     CDS             694758..696215
                     /locus_tag="LMJF_30_1860"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684789.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653728"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7A9"
                     /translation="MTVRELAKGAMMRYMLSLRRTAKEADAVVRQLCRSGIAVTDVYV
                     LVPSDAARSTTLEDDETGNGGGTGEPPFHMVELLSDDCVVQVVQVMKETVHMRFCAGN
                     GASAKKRASSSVQAAAATEAQSAEETFNSISIAAPPAVVAVGGAACDGPALPSRDEPI
                     KNAAAFGCVSDAVSDTAQESSSPPVAARQRSKKTAHKVNSTGADSSLEEEEENEAWQG
                     TARSIVTLREREAQCIRWGPAAHKHFAANYVSSPQKIMIDRFKCGRRPPPVVQLHPTQ
                     TPSSVSSQSSVSEVPSPRSSGDSRGTTETGGGRRPPRPVIAQEGSTKEHLRYQRHEPR
                     QSPQLPSKHHRCDTYSYAHSESSSVQRAHEVLTPSAATRFQYLQVTAAPSVPAVEEML
                     VATEVTTAERQLVSPSHARQDAFLCSAETPVDAAARLGTSPWAPRTVAKPAVAVVARQ
                     LSFDEDGDTAPKRSLAVTDYSGVTPLGGVRRMVQG"
     gene            <697648..>701466
                     /locus_tag="LMJF_30_1870"
                     /db_xref="GeneID:5653729"
     mRNA            <697648..>701466
                     /locus_tag="LMJF_30_1870"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684738.1"
                     /db_xref="GeneID:5653729"
     CDS             697648..701466
                     /locus_tag="LMJF_30_1870"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684790.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653729"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7A8"
                     /translation="MAVSRQCVRISLFQCAPLSDTSVHQAHRASQADGRPEARHPLFR
                     SRSADYRGDVLIPLVSIASSSLQSVHHKTGTVKLHQLRDGLEGRLSTYCVLHVPASRT
                     RSFVEEHRLSPSSLSLTPPAAGLSAPEDVQLILSADEEESRSRCEGAPVCLPCKAQFR
                     CCARCSSSVVAEAAAISSKAPAVLGASSAPREAASNITSNAPWICINQLQRMTARSSD
                     TTSQTPSSSSLQSCFAPSASTPPMRSVEEWMQQQHDSTDMFLTSSEAESVGAVNAEDD
                     GAEGEVEGGACYAAFFSLTMLPAAERAKRLMSSLARSSAPAAGATASKSPTVFTVRTH
                     HHTLRMGLPLPTSLDKADSFRTLQSPLTLREAIIDRLRLQRRLRVERLLDTKSGAAVL
                     PCESAPTLLAAQVVSLEAECRAPLSVRSKQEEGLAQRLAPRSPLEAQQQSSSTPTNAR
                     AGGPSTETASDLSDHLVSLRAHHHGDQYYYDGADAYGWAEWRTLISVSELASESELRL
                     SFTGSRGSSQMPRYSSTPPSTASSDAASSVVLLFAESSSSHRAPRPQDDDVCAVQTGP
                     LDGVGVAGSSAGMELPMSTENGTDDHEQYHDQGSKVSGDQGGSTAFFSMNGEEATTPL
                     SPMQGNLEGLRDSLCDMNDVFIYEDEETVVDVDVVGTGDRGDGSSGNQRQERRSSLVW
                     STPVARGSGAGRMLTDTGFSATPLTYRTSTQLSLSPPASPVAVPCKAAMTAINEQPTQ
                     RMIFATSPSSTASLFRSAHSGTSVEDEEVIAFGSGDDGAVTSAGEVHDGDVADQGAGD
                     ATREFLMSVARASVAPPASTSSAMSSTDSSIASASHSSNMSSSSCARSDHPSTPSCEA
                     TSSVRREGAAASSSEMPVAPLSLVDSAPAFALSSPSPHKPRHAVAPAHPDEQTTLIAP
                     CSAPPPSRRCTSEHELRSHLHSLNPVATQHSSERASQGAPVVASQRSTDGWDAKNGEK
                     AVLHGDDGGSSSERKRARGQEMIALDSTDARPMAVLRGEGARAAMVLSSSTSAGGIDD
                     DHSTNSSVSTPSTTVATRSLRMRSPIILSPGELSRMALNMAASDAIQTRSSSTRHPLA
                     RTVELDLDDASEVSEDTLGHYGYGGYVASYTVPGRDDREDLVRDDEWGHGSRHSSTHR
                     SHMARPTQHCQSTVSQPVSQSSCQQGSAPLVVATTTEEAAATMDPAHHLDGTKRCRSL
                     SFPAPALETWICFTDDDSGGTESDPDHHMLVTQQGIPVYTTRSDSSAESDGGGSASDE
                     DSNERDTDHT"
     gene            <702680..>703036
                     /locus_tag="LMJF_30_1880"
                     /db_xref="GeneID:5653730"
     mRNA            <702680..>703036
                     /locus_tag="LMJF_30_1880"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684739.1"
                     /db_xref="GeneID:5653730"
     CDS             702680..703036
                     /locus_tag="LMJF_30_1880"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684791.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653730"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7A7"
                     /translation="MKKYIGRQLRPSQLAAELLPPDQMWCTVCHQAVERRRFREHAAM
                     LGHRLGRKKLNKLKYVSLSMWERHRGASLDNESAHEGSIEQEFACYQADQRRREQVSV
                     AAAWGPLRPPSRGDLF"
     gene            <703789..>704331
                     /locus_tag="LMJF_30_1890"
                     /db_xref="GeneID:5653731"
     mRNA            <703789..>704331
                     /locus_tag="LMJF_30_1890"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684740.1"
                     /db_xref="GeneID:5653731"
     CDS             703789..704331
                     /locus_tag="LMJF_30_1890"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684792.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653731"
                     /db_xref="GOA:Q4Q7A6"
                     /db_xref="InterPro:IPR020618"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PDB:1Y63"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7A6"
                     /translation="MEQPKGINILITGTPGTGKTSMAEMIAAELDGFQHLEVGKLVKE
                     NHFYTEYDTELDTHIIEEKDEDRLLDFMEPIMVSRGNHVVDYHSSELFPERWFHMVVV
                     LHTSTEVLFERLTKRQYSEAKRAENMEAEIQCICEEEARDAYEDDIVLVRENDTLEQM
                     AATVEEIRERVEVLKVERGL"
     gene            <705800..>708874
                     /locus_tag="LMJF_30_1900"
                     /db_xref="GeneID:5653732"
     mRNA            <705800..>708874
                     /locus_tag="LMJF_30_1900"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684741.1"
                     /db_xref="GeneID:5653732"
     CDS             705800..708874
                     /locus_tag="LMJF_30_1900"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684793.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653732"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7A5"
                     /translation="MPHAGNKLVPIGCNMNDAAYPFRGEHRLANCINHGHSGVVKRIP
                     TSIAMRISGSNLVIEEVKTPKGVELECELGVDGGIARPVSLQQASAFMVPSDGHNYNL
                     IAAVKASGNPMKHYCKLTFNGSEGITVLRMRAPEGCSPDAVYIVADGRRLRPTAGWFR
                     IPIHTKECALVANLPLDDAPPPPPPPPPPPPPPPSFSFTATPPLPPAPSGGLAEKTLE
                     ATTGAPWTAENVPELETRIHPPLIPNAGAVTLTEPVPAAMPSFVATAPGFSLQLTGEN
                     GSSVFGVGVAALPLSHRRAQTVQIVVSDAQGRVLLRQRSHVPSLEPAAVSLAVKDDGK
                     GGLALSANPGSKITVGGVPQADPSATAVLPRVVPQRAVVEQPNADGSVSKATLDVAPT
                     SEPAPVSAAVSKQLPQQPQAPALPEAWVKELSDALQNSNPEEQRHLLQRIYPSSIPGV
                     TIVNFVRDQLTRQPPAISFTVSSNGLEAVQCPGCSVTAAVGNDPARQIPAFGSVALAS
                     GKSALLTATSTVRHSAVSACRVQIGVPSAVAFTSPTVSAYPPHAAAGPPMQAGPSADE
                     RADSDVVSRLVDCLLRHNLSAPLVARELDSMSTAPFSAQGRRMLSLLTSCLRSATASG
                     AAAAMQAASTQAAAITHAAPEEIFFTCGPGYVDNIYTTQPQYQLFGAVDNQAPQVVPQ
                     RGRIPAQGTLEGEHKPFFICITARDPITGAVKVEKTVTVLGVRHEAKPTPAAVEVPPP
                     TQVSYTAAPTAAEALPEAFAEEPLHRLGAAAAGSPAFMPEQQPPPSSAGAAIPYMDVS
                     LQAVGQDVQARILCHPHLRIVCDVDGVGGNTGRSDFVAKMPATRFHQVNFSLIDLYGR
                     VVFQQKLGVPAMISPLWGLALQHNGLAVDPEVGALVTASIDRALERTLQGNFVSFDAS
                     APHFVHLRKYHDSIHGGAAGEVSLRLPGLALPEELEEVTRIMRRRANGEASDPQTKTE
                     LEQLRARCTTTSVVELITSILDAWPATLSADARTSGGDSPSSRVFFRLTGTD"
     gene            <710692..>712509
                     /locus_tag="LMJF_30_1920"
                     /db_xref="GeneID:5653733"
     mRNA            <710692..>712509
                     /locus_tag="LMJF_30_1920"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684742.1"
                     /db_xref="GeneID:5653733"
     CDS             710692..712509
                     /locus_tag="LMJF_30_1920"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684794.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653733"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7A4"
                     /translation="MVSATATLHRSGSAGVFERLGGESRIGVTMLGKRVRQWAEGAGL
                     VLHPSSSAWHALLAYSTEPLRHERLWRQTCAKGRYRLSLLARARVGDTTHSANTVQEH
                     KAAHRPSHADPRQEATTHGQRGPARRRSLPSATPGGLSAYRRQQEYTRRCRWQLWHFF
                     EQGRRYLTSVWRVSPLLDCQRRHAVRYCGNIECRTTSPASSMSRIFDGRYVVPSAASI
                     DAAQEEHRALEKRVNVLLRLLRQESGPSAPTSAVRSRSHEGAVNGAGMAACGAGDMAG
                     STVWDPDGEGAEDEEEANVYHSVSQLRGISEAVAATQPYLDVRVDETTGLMHLSLYVN
                     GDAGGNGAEFADSSVAGCIDNHRWVILKGLWALQVLVFCFHREEELPSSTEKHVDAHL
                     KRQGGYDEQTEQNVSRRSRIVDGLVVKGVAFAKVKTGHTLATAQDTFACTRCGQTRRR
                     HNEVYISKKTGRIVCGMYYCVVCLARTHHVRLPPMKNMPPGLLGERGASVANVSWLHT
                     LRDVSSARSGASPSQFSNTGLSDLLPSAYAHQCSMSSACAADALQLPDEAAATAMREW
                     TRAAAAAPPPEWHPGGKVDSDELFGGTRGLGCPPPRPRM"
     gene            <715194..>716690
                     /locus_tag="LMJF_30_1930"
                     /db_xref="GeneID:5653734"
     mRNA            <715194..>716690
                     /locus_tag="LMJF_30_1930"
                     /product="succinyl-coa:3-ketoacid-coenzyme a
                     transferase-like protein"
                     /transcript_id="XM_001684743.1"
                     /db_xref="GeneID:5653734"
     CDS             715194..716690
                     /locus_tag="LMJF_30_1930"
                     /codon_start=1
                     /product="succinyl-coa:3-ketoacid-coenzyme a
                     transferase-like protein"
                     /protein_id="XP_001684795.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653734"
                     /db_xref="GOA:Q4Q7A3"
                     /db_xref="InterPro:IPR004163"
                     /db_xref="InterPro:IPR004165"
                     /db_xref="InterPro:IPR012791"
                     /db_xref="InterPro:IPR014388"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7A3"
                     /translation="MLRRTLLRFKPTILTAAEALQDVKDGATIALGGFGLCGFPFELL
                     EALNQKGTKQLTLIAGTTSGPENGTGPLARDRQLKKIITSYVGENSVLSDRLMNGEFA
                     IEFCPMGTLVDRLRAAGAGLPAFYTPTGYGTAVAEGRLPVRFAPGKPVRVAEYSQPRE
                     TRQFNGRWCTLEMALPADFALVRAWKADRRGNLVFRGTTQNFNLASAKAAKVCIAEVE
                     EIVECGELDPKTVHLPGVYVHRLVCPPNIRRAAEFVVERKPGFSTGTGKNAHASRNLI
                     ARRAALEIKDGMTLNLGIGIPNMVASYIPPEMDVVLQGENGLLGIGPYPLPEEVDPDI
                     TNAGKQTVTMSKSGASLFDSAESFSMIRGGHLDLTMLGALEVSGTGDIASWWIPGKLL
                     KGMGGAMDLVMSGCRTVVLMEHTDREGKPRVVESCRVPLTGTGVVDLLITELCTFRFV
                     KQKGGINEMWLSELSEGVTLEEVRAKTSAAFKVDPHLKMMPRADPLPT"
     gene            <719484..>720983
                     /locus_tag="LMJF_30_1940"
                     /db_xref="GeneID:5653735"
     mRNA            <719484..>720983
                     /locus_tag="LMJF_30_1940"
                     /product="succinyl-coa:3-ketoacid-coenzyme a
                     transferase-like protein"
                     /transcript_id="XM_001684744.1"
                     /db_xref="GeneID:5653735"
     CDS             719484..720983
                     /locus_tag="LMJF_30_1940"
                     /codon_start=1
                     /product="succinyl-coa:3-ketoacid-coenzyme a
                     transferase-like protein"
                     /protein_id="XP_001684796.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653735"
                     /db_xref="GOA:Q4Q7A2"
                     /db_xref="InterPro:IPR004165"
                     /db_xref="InterPro:IPR012791"
                     /db_xref="InterPro:IPR014388"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7A2"
                     /translation="MLRHTRRAFRPRVMSAAESVQDIHDGATIAGGGFGFCGFPFELF
                     DAVNATKAKNLTVIGATMGGVDSGFGPLARDGQLKKAITTYVGENPLFTQHLFHGEFE
                     VEFCPMGTLVDRLRAAGAGLPAFYTPTGYGTAVAEGRLPVRFAPGKPVRVAEYSQPRE
                     TRQFNGRWCTLEMALPADFALVRAWKADRRGNLVFRGTTQNFNLASAKAAKVCIAEVE
                     EIVECGELDPKTVHLPGVYVHRLVCPPNIRRAAEFVVERKPGFSTGTGKNAHASRNLI
                     ARRAALEIKDGMTLNLGIGIPNMVASYIPPEMDVVLQGENGLLGIGPYPLPEEVDPDI
                     TNAGKQTITMSKSGASLFDSAESFSMIRGGHLDLTMLGALEVSGTGDIASWWIPGKLL
                     KGMGGAMDLVVCGCKTIVLMEHTDREGKSRIVENCRAPVTGRDCVEMIITDLAVFVVK
                     KAAGGVRSLVLTEIAEGLTVEEVKLKTEAPFAVSADLKTMPLAPVPSQV"
     gene            <723031..>726594
                     /locus_tag="LMJF_30_1950"
                     /db_xref="GeneID:5653736"
     mRNA            <723031..>726594
                     /locus_tag="LMJF_30_1950"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684745.1"
                     /db_xref="GeneID:5653736"
     CDS             723031..726594
                     /locus_tag="LMJF_30_1950"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684797.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653736"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7A1"
                     /translation="MQAERSLGEPKRRARFSPLPMSTPLLSFDVLEWIPNSSESLARL
                     PVGRAASVYPPDSRASVAPSEGRVHPRDCTAFESSCGSWTCFRTLSRCGDALVLEDAQ
                     LVDVGAARRHGFTWQQGPDRLPSGGVRTGYIGASAGCRRTLASVSENAMDIGADIVPR
                     DSLLADRRYERPAPPAQCRKRGIPMQDIHSVCRHCFQKPVTLVFDARGHSISARDSAD
                     TTARGDRAKRVLAQSRHHRSSGLEMALALQWRYELWGPVGVIFTLRGGRRIFLAFAST
                     QHAEQIVELLASFATGAELGRRQPSDSSPHRSSTGASASFSQVPAWSAGDDIPFAASA
                     SGPHAAPLSSGGLQRCASPSCASVHIASCEASLRGAPATPCSPQAGSAFSSAWASGAP
                     WLVSSTPAGPQTGKRWRKTGSFTDENSPSPLSDTVPASQEVGGALAARARRDSSRVPG
                     GGYLYCRPWGEASRYLRYYLRVCTTAGRSHVVHLSRHRLRLWQRLRQVFGNERRTVSL
                     DLRRASVCPSAAHENLLRVTYQAESFAQYKSLQPLGGGVVFVGPVSDFAASRAARRRE
                     LELCADYSVVFEALAKSPEERTSWLAFFCSRGAAVQAPVDAAQLGDYADVLLTPEKPV
                     AFQQLGGESLLATSPASGPGQEMLLSSTADQCMPTWETPTFSAEAVSSLKPLSNGSPH
                     LPLKEQSEGRRGGCRAAAETAAALRLSTLYRTYPSNVSPSLPERHPAADEHASTLTSP
                     SPLSAVAAGTGDRQEEEEELTIVVEDDELDRTTPCPEAAEPHSPGYMMQSDPSTMDHT
                     ATPPRRTSASPVLDEGGRWLRSGTGRAVEAPNIMAAANESSKAHQRLANTRLTMAGTI
                     VAPMYLEDTTSSEVSSHERLNALPPQLPAKYETSKIRRGAGETLLDHTAAAQGALGTP
                     LFTVEVNSAGRHTPVATANGSATPVPLKAPSTVVASASVLAEEHLRRSRSSNGVNTPP
                     RTSELETAAFTTTTLGSLVVGLSQRMWQTPNRSLSLDAPLDATPPAALRNGAEKPAPT
                     GTKSSSAPQAPPASLPGMMTGHRLRHQDAINGLVDENHTMHDTLASCSPAPSSGGRPG
                     KGDGDTDDARGSDASSSSFSTRDRDSLSSSSSAVDPRLSQFLEPYVNETSLDQVGGRH
                     RGDGVSIGVPVTPFDLHLIPPREYRGNRFTALRVPGEASAM"
     gene            <727846..>729369
                     /locus_tag="LMJF_30_1960"
                     /db_xref="GeneID:5653737"
     mRNA            <727846..>729369
                     /locus_tag="LMJF_30_1960"
                     /product="RNA pseudouridylate synthase-like protein"
                     /transcript_id="XM_001684746.2"
                     /db_xref="GeneID:5653737"
     CDS             727846..729369
                     /locus_tag="LMJF_30_1960"
                     /codon_start=1
                     /product="RNA pseudouridylate synthase-like protein"
                     /protein_id="XP_001684798.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653737"
                     /db_xref="GOA:Q4Q7A0"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR006145"
                     /db_xref="InterPro:IPR006224"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:Q4Q7A0"
                     /translation="MPRALRYCRPRRDPDESLLAYLSTKFTYLADAQWRQHIAAGDIS
                     VNGETLTDGSYVLRQGDMLRFAPPRSLEPPVDSEHIEVLYEDSTLLVVTKNGNLPVAE
                     GGRYCENTLVEVLRRRGTAAFYTASTRTSFGTTHEDTEKVSDSPTHAGEIVETAARAE
                     GSTAMDASGKGAEIPTSPPSRRRLEDGSHGIFAVGSAPCASVPSPKASTVQQRSSLDL
                     FTVQRLDKETSGVVVLAKNSVSARTLASQLEAQTKGCADAVESRLRERGHAVALSSDA
                     FDELLRLKAQSVHKTYTAVLRGAAPEDHTFVVVNCMDCMAKHPTHSWEAQHTQLKKLK
                     MCCEPVKEMLFSHAAAALPQSPKEQQTRWGRLAVTRIRVLASNKKLGLTCVQVELLTG
                     RSHQIRLHCAAVGYPVLGDKLYTTMTPGREGGATAVSDAVYLERVRREDDPYLPIDDD
                     VSGAGGSSRSGKMWCRRHLLHATRIIFAHPDVSPARLMTFMASPAPFFTADVRFECE"
     gene            <730204..>731526
                     /locus_tag="LMJF_30_1970"
                     /db_xref="GeneID:5653738"
     mRNA            <730204..>731526
                     /locus_tag="LMJF_30_1970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684747.1"
                     /db_xref="GeneID:5653738"
     CDS             730204..731526
                     /locus_tag="LMJF_30_1970"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684799.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653738"
                     /db_xref="UniProtKB/TrEMBL:Q4Q799"
                     /translation="MSTMSSPRSEISGSTALPETDESRLMFYAEVLMANVPSLIADLS
                     SAKYAFLSFSEKTRNEVKQKSALIQSIGRTFTLLQNASKSLIAARQSLQEYETRLVRA
                     APPTFVTSAEALHLSSARAHGDTTDAEQNGNASAEATAAALRRLSTASLDNLVILDEE
                     DIRPVREAEEAYEKESTASAEIARACNKVEDAFDHAHDQCRMMTEHVQDLKWKFDEVY
                     NGWKSVERERLVVRVMRDELEDRRAIMTEALHGIKAVEEECRAQELRIIEVSIAHAQA
                     ETVAIKAELQAKRSRYELELATYQIAYKEQQAEVEALREHCKLLRSHQRDLEILAKKQ
                     QIEEMNRNCLRKLMMATLTLTPSKCGKAEDRTLTSEQQMEVRNDHLLVSVLAARISIL
                     EEQRRTVGVLLASARGMGKSDDDSATVEQIRTLLEPEVQLDEDALTGD"
     gene            <734016..>734708
                     /locus_tag="LMJF_30_1975"
                     /db_xref="GeneID:5653739"
     mRNA            <734016..>734708
                     /locus_tag="LMJF_30_1975"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684748.1"
                     /db_xref="GeneID:5653739"
     CDS             734016..734708
                     /locus_tag="LMJF_30_1975"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684800.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1975"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1975"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653739"
                     /db_xref="UniProtKB/TrEMBL:Q4Q798"
                     /translation="MEFPVFVASDVHGEKVNLALRYNPRTTTVDCFLSAASRCFDDVA
                     HLMRQGSLQPFSAAYIYRDVQCQWDVLEDRTQLSPFCQVYVFRQLFNEVVAAIPDPLD
                     ASQLLSVHDRKADRATSCTGAPFLPGSPPLNSSTSTSPIRVADNHWALSQSRQHPETA
                     RPRFGVPSLLCKSDSPVVHATHPTRSDRATHIGDEANGFHHVRSADRVAAFHCMKSRR
                     FRLQIVSPPVDT"
     gene            <735966..>736991
                     /locus_tag="LMJF_30_1980"
                     /db_xref="GeneID:5653740"
     mRNA            <735966..>736991
                     /locus_tag="LMJF_30_1980"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684749.1"
                     /db_xref="GeneID:5653740"
     CDS             735966..736991
                     /locus_tag="LMJF_30_1980"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684801.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653740"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q4Q797"
                     /translation="MAEGLKESCKKILQRLQQQDVEEFGCILCSQHVRGQDALMQHLI
                     TEHQVHCLHFDNVVDLPGLLEHLSTLLHSHVTSPAQWFCPVCGEDTASDSAETLVRHM
                     RLAGHQHWNPHTIPSMAPWCVTGISAPTGPSDKVLAATAMPATCAPSSPAPQGLGRGD
                     ADEETTDSEWKDIEDEEVDEDEDWNLECVCLYCDYSGEDVLQHLRTHHNFDFRASVLR
                     RPDLHDEYDLIRVVNMVRRAVCSDRCPYGDECDVDGKQNNRAALEAHLALHKEHRLPR
                     RVSTSDADLIPVLPGDAFISMLVTSGEGFLQTEEEDPDFPMVPTVQELAAAASRAPQT
                     AKSLAST"
     gene            <737918..>738901
                     /locus_tag="LMJF_30_1985"
                     /db_xref="GeneID:5653741"
     mRNA            <737918..>738901
                     /locus_tag="LMJF_30_1985"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684750.1"
                     /db_xref="GeneID:5653741"
     CDS             737918..738901
                     /locus_tag="LMJF_30_1985"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684802.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1985"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1985"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653741"
                     /db_xref="UniProtKB/TrEMBL:Q4Q796"
                     /translation="MQRGHRCTDQLLLTRRLRRLFARVNERQPLLHHHQGDESLSWFH
                     AASRPLEALHHLRSPQTNPSKLAWAPASFAAEADGAPPQTKPEDRLRERAPPHLAAPP
                     GDPPPSAHPAAPQLSFLMNASFLHETCLFLLLLRHPLPSSSLSRLSSLSEREPLQVHG
                     HGTVAEETTHYILQNGLWRSCLPCSVEATWLRAATPAVDVQLELGASTDPTAGDDQAP
                     NDSLGERGDAREPALARLCSHDYLEHLIWPTQAAGAVRPDLTADCVWVDASSVRARAL
                     HSYNDAFWAPFSTSHSFAAWHRASLCATLDNQRAAASLEALRWTGDLYICG"
     gene            <739803..>746291
                     /locus_tag="LMJF_30_1990"
                     /db_xref="GeneID:5653742"
     mRNA            <739803..>746291
                     /locus_tag="LMJF_30_1990"
                     /product="cyclosome subunit-like protein"
                     /transcript_id="XM_001684751.1"
                     /db_xref="GeneID:5653742"
     CDS             739803..746291
                     /locus_tag="LMJF_30_1990"
                     /codon_start=1
                     /product="cyclosome subunit-like protein"
                     /protein_id="XP_001684803.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.1990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.1990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653742"
                     /db_xref="GOA:Q4Q795"
                     /db_xref="InterPro:IPR024990"
                     /db_xref="UniProtKB/TrEMBL:Q4Q795"
                     /translation="MSLSPYTIDVGPCKADGRRDVFLQCHQRPCFSTTHRGITRVCLA
                     KWPARSRTDMALETNDVDESEALRAQRTEQVYQTLLEFGDPQGPPTSPQLMCSDHDAA
                     GNDTDVRSPLEQYLCVFHREELADQYGRYTFVQPHTICTAYRIADSTVLELVLHNITP
                     TDISAAATGVFVRGHRQSSKGLPSSTPLEYQGIQYKPASNLWWMGAPLSLKPVYVAVP
                     LGPQVGATGGAPKGSVDKASGSHADGIAAADSDHGDKAAGDTVSRPVASPTSVGADDA
                     ATQRETVDNTSSPLLVELGGRTAQGQFQFRHSRSSSPNMCCPSQSAVLPAEGQVPPVA
                     AAASSPSLPRASLPLVSNAQARYVAVEATVLAQLELFDLTAGSCTCASSLAVVRTGDA
                     ELGLATTTPQYALDCMLWQWWPHRVRLPRLASGNAALSAVASLHAALDRYAVFVYDAH
                     HSHVFVLRTPYLHSGTGAFELLFSFPCGSLPFVLPCLRAPHPAPIAVCNYPRPNCISV
                     YDVMALLDAPAAATVAMELDLETYQANHSAFFGKVCTSSSDDDSALFGGADILSTNGN
                     SARGVMPAPPLPTGAADNAMTRSVTAASWRADAINGVPHPIRSILYHYENRLVVQYAW
                     PSGSAQPAAMESADDAGAVFASSCGSGEYEADDDQGVRSRHRRRRRCEGTVSFTVEFP
                     AITLDQDPLLVFVLEALSAALGARAVATLEYILFAELWDCKCRAAVAVDAFDLCARLL
                     RKIFRCECGDCDPALACTSARAHLQQAAEDPETTGCGGETMTEAAAPHVFVDPSTVTL
                     QQIRRTIARRRTGDAPARWRRGAVEEESGTTSVVKTTVPVRWGAINGCAWTRQERGLA
                     LVALHLLFEACRAQEHLWSLLPRLASVNRDLSNALQWPSYVEYYDAMCPRLFAAPSPP
                     SQISPTQSFTDSLPASVLQCHFDTLERPDNAAALRASCAASVAPSATEFATGDAPSLF
                     SALSLAAMRSSILTCVAVPYGTWPLLKHLPDAHPIALVNRVVLLYRDIFGASAGSLTV
                     TSASSVGTSRGDVLVDSHVDATWWQRICSLVLQRRISSRVVWHTLNAAAAYPLLEALT
                     KGRECADSTWPAALLELVGRRDRCPPTSRTAQISSAGQHVVETAEENAVSRQFRVALT
                     DDDGVSVRPDFRKTWRDSRLDMVQNLFNTVAPISLSGFEDRPEELTGALELLSCRTRA
                     TPLGRGMLTMCTQSFKVQDSIPIAPLNLNGRTNDGINVASKPVDDLMWPLFHNGCAAG
                     LRFLPLPPAFCAGAGDAPFATQDALGDMVAKEAAALSLRNVAQSITKQWVMYQTKNIG
                     DPASRAGLLLATGILGHLTVLQRTDIFYLLISRQEQYVWREATTMAVMLGLSCSFCGT
                     GNEAVFRCLSVHVQSLNPSAEDIEVSLDVQTAALVSMGLLCQQSPSNSFLVEVFLVEL
                     SRMPTDEHCTKREGYVLGAGFGLGQLLLGVGQSHGVQRVEDRLLAIMRGGPRSAAVST
                     RDGVEHFEETMGRGEAGHFLTRALLSQDEREATYNACASVYEGDCYNVFVSGPAAAVA
                     LGMMYLRTDNAFIASRMAPPNRRAAMQKLTPLMCHLRSTMASLIGWTSIEPTRLWLYN
                     QVPSSLLELTQASLPRLATQQINYLLMNLAHCIAGHVMAIGLRFAGTMDSTARDLIFA
                     ELQGFLAGQVGSTKAAIPAVQRSTGAYEACLLACANALSLVMAGTGDLRALALLQQLH
                     RRTNVPYGSHMAISMSIGLLFLGSGRLTLCNNITAVAALLMAFYPVWPKDAEDNTGHL
                     QALRHLYGLAVVPRIMEAVDAVSHQPVPVPVRIVLRKKKSVEMEADVRAQQRTSRAAA
                     SAAVEHAEDTEQAIHTVTPCLYPPVEMIERVEVRGTQYYPLVFYAFSKELTQSAGMLF
                     RVMAKESASSPVHGRGGGRALSTRTSIESRLLGWLHRLFRQSSTTMTEALTIIDSVKL
                     VLRVQRPLLSRTTGGGELLLSGDFGEAVAEAMERRYAFIFLHGGVPAVEGVSSDPHHP
                     LRQLILEGKSRAEVFQSIVRHPQGTVAFPCDFTALAFGGTFPANWGGETTVTPMLPAE
                     RNMCPIIDTDAVARWMTEALHYYGIGQREIALLRQATTTLSTPAAGSPMGTSREGASS
                     VQRLTALLRLQATTLLPLATLEKIWACCVD"
     gene            <747221..>747610
                     /locus_tag="LMJF_30_2000"
                     /db_xref="GeneID:5653743"
     mRNA            <747221..>747610
                     /locus_tag="LMJF_30_2000"
                     /product="putative intraflagellar transport (IFT) protein"
                     /transcript_id="XM_001684752.1"
                     /db_xref="GeneID:5653743"
     CDS             747221..747610
                     /locus_tag="LMJF_30_2000"
                     /codon_start=1
                     /product="putative intraflagellar transport (IFT) protein"
                     /protein_id="XP_001684804.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653743"
                     /db_xref="GOA:Q4Q794"
                     /db_xref="InterPro:IPR028172"
                     /db_xref="UniProtKB/TrEMBL:Q4Q794"
                     /translation="MDEDRLIMFDSNGAIRMYDPEKYDELVKTVEVERRYVEKMDEFR
                     ALVQRTMAIVQRLGEAIEAEKLKAIGFRNIVESEAEERFRAVQEAQIRLREKQTELDR
                     YVAEYESLKLVEQEQQTFFQHLSQAKD"
     gene            <749973..>754469
                     /locus_tag="LMJF_30_2010"
                     /db_xref="GeneID:5653744"
     mRNA            <749973..>754469
                     /locus_tag="LMJF_30_2010"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684753.1"
                     /db_xref="GeneID:5653744"
     CDS             749973..754469
                     /locus_tag="LMJF_30_2010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684805.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653744"
                     /db_xref="UniProtKB/TrEMBL:Q4Q793"
                     /translation="MAASGLNHAAPRRRPGSCPPSTQQLHCNETLYATHRHVPSPYYS
                     FDPDALLAKSIQQQLERLYRGPSVDASPRQHLSSASQPHRGRSTNGKHHGSCSRLRLS
                     LAQAIPGAKQDESSFSLSRRTTPCSKGLVASLSSPQSQRPHGVTAAAMSLLTSTLPAP
                     SQPSACCRQRRKEELIESELEPVPNLIGLGDYFMKRPHFVYRPRSTGGGEASTSTEDL
                     YNGGHDLDGTSCHSRTRGTPQLPRSFSSTTPVLLHRSSIRGPTLPLGVPPSSAVRRRA
                     AGFSGQSKPSQRTDTGAPAADHNRGVNGAPSSPGEAAGGVHAGEPSSSSRHSASTFSL
                     DSEDVFFDEDPLAAQLLHGPEAAKCPATMHTPASEQAAREHERVDDQAASGTRAAPAL
                     EPLVVESLSSSAAQHALVPRAPETPSDPVASFSSFPTDPTSSAAAGQSAAPATLQPPS
                     RSTLFLRQRSPSPWDRRRTIDNLLHKLLRLRVQYERARHQGHGPCGVCDKNFREQPLY
                     ARSRGAAAQGERFSSPAIFAATVRPHSRRGCTQQQRQQSHARPASRASQRSGLCSGCG
                     HCAPHIRSALDVCSADQDVSLPLFRGYRRCECCEVLLPHNAAVPMPPTVPRDGASLAP
                     RQGRRRPSSATPPAAPPRQRSSRMPDPFAAPRPTPSYWRPYHSETASHRWPSARRSEG
                     GDSCRGDVRDEARAQRELDLNADDYSFLIKLVRGIGKDIRAEQKGSEASTAEDTACRA
                     TSGATDRGVEALLRALREEARMYDATYAELLRVLHGSGQSRVSGSSAASASELTSTAV
                     VFPYNIPHSPFVAPPRHAAERCDAAVATMASPPSPPEMNVENHHARGGIRGTPLQAFE
                     ETLPSAPAAILEPLHAGEGVPCSQRFSSISSNKLSSDSCASGLAAPAVTPQGETDASA
                     PGPVTELHPTTATTPAALDAVFDNLVHESVQQSQLRLIDELEGALRARLGKDEEDARW
                     EVCRRGVDEEELQRRRVLALDEAVKGADLVRQWRYLRARIFVAETALNEWTATLKTEE
                     HAHERLTENAGLAAAAEGPQRGIHELCILEESDRCANVWAELLIRQTLQVSLCSDAEE
                     CARVEIEFEEQLKRTKWIQIFIVCCLAQTRAARDATPIKVDRTEWGGGNIGDMSSTPP
                     LTGEQLSAPTEDAPTKTSVAGDAPECVAAPPLDTGLSVEKDAVEAAAPPAEDESVADE
                     HARGKDGRHLRPFPAFSVNSNVPGIIPPRSKSPSICASSASLVLLGNGAGVPTELHEG
                     DEEQQRQSVAGHSGAVLTVPEHVSGIPICMEGELESDNSSEAIASRADVASLPMETSS
                     PAAKGRAADAMSDVQRHSAASPMLSASEPKSTHNVQKPAMTPPENGELSPSANTPSAS
                     EVENGPATPLEERAEVELAAAVENAAGGTFVSEGEATEELTVLQSTATITGALDATQR
                     LSATLCSAAGAAVTETSLLSNPLRERASPRTPLEACANGASAPARTACASQEQGLSTP
                     RMPQ"
     gene            <754798..>756096
                     /locus_tag="LMJF_30_2020"
                     /db_xref="GeneID:5653745"
     mRNA            <754798..>756096
                     /locus_tag="LMJF_30_2020"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684754.1"
                     /db_xref="GeneID:5653745"
     CDS             754798..756096
                     /locus_tag="LMJF_30_2020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684806.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653745"
                     /db_xref="UniProtKB/TrEMBL:Q4Q792"
                     /translation="MKHIERQPSIDVHAAYGKVQGEGEELQAPFMMEGEADGALQRLP
                     PPQLSVGNAADAEIRQPIQQSHSRVASAEDSHASTPASAHLQQTSAQTERSVSMLGED
                     HVTNFVEIPTDNRHFTSLLATQSESDSPNVVHAEANLEVEEDEGDGRVDSGAFGTQKL
                     RKYVVSSPALHHCSMTAIFLSALSTHLLEPTIEEDGKAPDVDGVRDDHSRARDEDASY
                     EHGGDRDVVEEGAPRKRVEGGGGSAKTPRMFCSWTVCTHPNAEVGHAGDGVSEELLCS
                     VVHTARFTDTDCGGTDSGRDDEASASSEGRLHRSLASPCTECESSAQTSSSTTGKGQL
                     KYDRSLDSDVLKPVARGLRQHSARRKTVRLRGCTRKGRRRSTSSRDPAFLSLCGVSWI
                     TSCSSGTSMPRQPGSPPAPRGPLAEVPRRRALRGLLPGSQ"
     gene            <757520..>758818
                     /gene="GPI14"
                     /locus_tag="LMJF_30_2030"
                     /db_xref="GeneID:5653746"
     mRNA            <757520..>758818
                     /gene="GPI14"
                     /locus_tag="LMJF_30_2030"
                     /product="putative mannosyltransferase"
                     /transcript_id="XM_001684755.1"
                     /db_xref="GeneID:5653746"
     CDS             757520..758818
                     /gene="GPI14"
                     /locus_tag="LMJF_30_2030"
                     /EC_number="2.4.1.130"
                     /codon_start=1
                     /product="putative mannosyltransferase"
                     /protein_id="XP_001684807.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653746"
                     /db_xref="GOA:Q4Q791"
                     /db_xref="InterPro:IPR007704"
                     /db_xref="UniProtKB/TrEMBL:Q4Q791"
                     /translation="MRNKTWLDRQSIGTLLLYGGLARVVLLIYAAFHDYYFRVKYTDI
                     DYMIVVDGARELLHGGTPFDRTTYRYTPLLAVLVIPAVLIANPLGKVVFALSDLGAAY
                     YCFHMLLRFSTERSAKWMVVILILFNPVVLNVSTRGNSDMLISCMSMGVLAKFAEGRY
                     FTAASILGFAVHFKIYPIIYALPLVLGVWERAKQERFFGRLAHTASVVVGCGLCFTVA
                     FAVPTYVCYLVYGQQYLDEGFIYHIHREDHRHNFSPYWLLMYLNMGRRDLGVGVDYSA
                     GLFAFLPQFAVLCYASWKLRKNIAHACCVETILFVAFNKVCTVQYFVWFLPFLAFVFC
                     EPAQPKWLTGVTNAPKSERPSMLSAVAAILMWSLMIPLWVWTAYGLEFEGRNHYGRLW
                     IVSCVFYLATVSLAAWLGRLCYRSRITVSIKDHRPASKRA"
     gene            <761055..>765119
                     /locus_tag="LMJF_30_2040"
                     /db_xref="GeneID:5653747"
     mRNA            <761055..>765119
                     /locus_tag="LMJF_30_2040"
                     /product="putative calpain-like cysteine peptidase"
                     /transcript_id="XM_001684756.1"
                     /db_xref="GeneID:5653747"
     CDS             761055..765119
                     /locus_tag="LMJF_30_2040"
                     /codon_start=1
                     /product="putative calpain-like cysteine peptidase"
                     /protein_id="XP_001684808.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653747"
                     /db_xref="GOA:Q4Q790"
                     /db_xref="InterPro:IPR001300"
                     /db_xref="InterPro:IPR022682"
                     /db_xref="UniProtKB/TrEMBL:Q4Q790"
                     /translation="MSYYIGYSQREIYKKRCNELGCACNSAVVRLLSDVPGEVTGLTS
                     LDLSRNFLGRKGIIPLLDVIESAVQLRSLDLRDQQLSNDTVEVICARLRRHPSLLKLN
                     LSNNPITLAISSALLELANQNSVLQYIYLENTLVRPSMVTAIEVQLEKNRTLARAASA
                     VSQVTDGKSRRIFVIASSVAGTCAVGSKPGSPRAEQAVLSTPVGSGKSAAAMLLRDAH
                     AALTAAGSTGWRQRIPAHELQHVFRSYTHAVADFLFDVNPTKDAWAWCEERHYVFDDD
                     QFNSHNDHLHRTARHTYGIAGWRRVGELYPDATLFGWEGATAHANDTARQAAPSINGT
                     GAQDTCEDPVEDIMGAERAAAGNGHRRSDAAYSHADSVFWQLPTDVPEGFTWTFTALM
                     ASVKEIQSLHALFCASAAGLPDGGTRVQRGTACPGIYTMRMFVEGQWRYLLVDDFLPV
                     DKYGRLIFTKPSMDDKAFWPCIFEKMLAKLHGGYHVLDAHFDKHHVGIDSPNMRKPIA
                     WLFLGKENLQRANDGAGGGGDTDWGTVPDDTLICAEVAKNCGRVMSRLTRGIYESYQL
                     HPVEQASTTLFEGLHKVLGVPLCNADAREGCGNPPCDRRTASVKRSFLDSRSVSVDSP
                     AGASGVSSYLTAAIAFSRDASRTFGGIHPRCGYQIVRVCHAGGVRLLELRNPWCGMEK
                     WTGDWADDSPLWKKHLEVAGLLLTGARSARRTQKGGNNLLELPDSASTLTNTPLKRSL
                     LTALGEMGGSLAEASSTTPVCSVTSPSGRAAATRPHAQKSTFWISYTDFLQNFEWVHT
                     CCVFGDEIYRQDVHGAWTRDSAGGNAREPSWYRNPHYRLSFPYRTTVHVQLTRRDPRL
                     RRTRGAVRGQEAGVGGIGLQLLRDTHYPLHCPTMSRRQAETSTAASLPMSSVEDIVTG
                     NQEDDGSIKEALGSRDLGASDRGCGCAFSSVLSSEERQRSDCLSLGILLDAGAQYWIV
                     PTTYTPRVLDEFDLVVTSTSPFILQEAQESQYWDQRTVPSELLCCASASAQEVERNEG
                     EVAIVFDSQSRVSRDANLLLEKQTQRSSRRLVRNSISHFMETKLTTVSSATCRVVVAA
                     TMHLAAAGEDVINFGVDEAYKQRSVPAEDMYGTPTLQLAIVPGEVDGEGRPSRIVGEI
                     DPHAAHTYVFDRHTVLETTITPVPHSSVEYYTVICSIHPAGTRVHVDYRVWCAAPLLE
                     VMSVPAWSEQEVALCWDHEKGSGNYYEGTGHPQVELSKLRPFQRFAISLRMVDYDTIE
                     PAIMFSVICNDRQRGEPVEGRLGNQAMLSQSAYVNGTYVQASFDLDEHPPESLIIVSC
                     LQPTGSKGRCVMTISSDSADYRVHPLRVATAYPL"
     gene            <766799..>767482
                     /locus_tag="LMJF_30_2050"
                     /db_xref="GeneID:5653748"
     mRNA            <766799..>767482
                     /locus_tag="LMJF_30_2050"
                     /product="ferric reductase transmembrane protein-like
                     protein"
                     /transcript_id="XM_001684757.1"
                     /db_xref="GeneID:5653748"
     CDS             766799..767482
                     /locus_tag="LMJF_30_2050"
                     /codon_start=1
                     /product="ferric reductase transmembrane protein-like
                     protein"
                     /protein_id="XP_001684809.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653748"
                     /db_xref="GOA:Q4Q789"
                     /db_xref="InterPro:IPR004877"
                     /db_xref="InterPro:IPR006593"
                     /db_xref="UniProtKB/TrEMBL:Q4Q789"
                     /translation="MTTTIKDDASLPSIDDIPAPSVWLKSLCRRLAAVGIIVPVSLQL
                     FRKSGTYTDIFQYHPICMMLAFVMVLPDVVRDIKQLRQAHRRSPLKDRLPRHEIIMRH
                     QLASFVMELAAAGGFAAVEYTKLKNHYPHLESLHGIVGTLCGLTIVCQMVLGSILRYV
                     LAPANPKRLIVRTVHKCVSVTIAVTAMMAMAGGFLATEYAERMIPASLIRTAIVLTSV
                     ATTVAGFLM"
     gene            <770834..>773662
                     /locus_tag="LMJF_30_2060"
                     /db_xref="GeneID:5653749"
     mRNA            <770834..>773662
                     /locus_tag="LMJF_30_2060"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684758.1"
                     /db_xref="GeneID:5653749"
     CDS             770834..773662
                     /locus_tag="LMJF_30_2060"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684810.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653749"
                     /db_xref="UniProtKB/TrEMBL:Q4Q788"
                     /translation="MDSASSAVQVGVAAAAGAQTPDQEAPFPYFITPFFVPELVKECV
                     VKQHGAALQLSEIDVTSVTAVRLAVPEVEVQCQHHTTGFGFNFRVHPSFKTTEGVEVD
                     LTVPHWADVGGRPNSTLSFLANTARLGETVLQDLRRLSTVMSKVVLELSSAAHQAYVR
                     RNKGFHMYAVHVWSLVRAQCVVARDALLPHLERSRLLENIMGDLVVYQLQQTASHASP
                     PQKHVVRDNCVAFMKAEVQLCRQLDQVMEGIDAVCRGIHTLLTRMYTVMKELAQPKVH
                     RGGEHRRSGRSRLQFSVQMFRARQQEHQDSCVHDSHDPASTSADGTTQSPRTRAGVIR
                     SLSRRFPRAGAVSVEAEAPPSPLPRNVVDTVRDSTLSDSPREPDCSFHGQVAEHGAMT
                     RTLTDSMLSIIRCFMQARMWEWSLSNTCIRECGLGEGDRRTLLAAEEELQLITDKLLH
                     SMWSHSRMTYILEVEQDAAGPASSLDILMDVETLELLNSALECPVYDHSEVFESLKAL
                     SQLRAQLVASSSAVTIVARNPETQQELLSMMSSVLSTTMAHQTTVLRLVVEAAASLDE
                     HYAAYLRTRQMNPTVCERPSPSEDTLLAVDVLKLLQRHSGEKLANYLAVMSKTTDHHG
                     DGSRRGAHARHGFPRADILAMTQGSCLSDTSNASAGEGAAPPLHCPFLADFSLRDTAL
                     FSCQVFGEALVRAAHGEHLQAGSAPEGQHQEQRSEEQASNAEVVAEAAAEVPSSPPVA
                     ADCSRMPTEGTVSGRIEATASRALRSSTTSLQTVAIDAQRNASPLNTEAAVAATFAHE
                     EEEDSSARDDDAPHREPLFSADTDASVVALMRVSPSAADADGVRKAAKLFGAAFQLPA
                     TTTSVGRRRHVLLPFYRGECVYKGVSTPFYVDGQTGTVLMDPRTLSAAGKRQYALQVL
                     SSPLFFILFNSTLSVFLHRRYKLDIMYK"
     gene            <774987..>775928
                     /locus_tag="LMJF_30_2065"
                     /db_xref="GeneID:5653750"
     mRNA            <774987..>775928
                     /locus_tag="LMJF_30_2065"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684759.1"
                     /db_xref="GeneID:5653750"
     CDS             774987..775928
                     /locus_tag="LMJF_30_2065"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684811.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2065"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2065"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653750"
                     /db_xref="UniProtKB/TrEMBL:Q4Q787"
                     /translation="MKFTHREIEDDRRKPVGSLFMHLIDRDSMPSRSHRNLAAQKLNA
                     HSLPNTELSLYAQDAPQFSSTPLRGRRHFPKQDRHVDCNKAEEVRPSRGVRRGTTPNG
                     NIDHIGDDMTPRASTEVPMPRQRRYVTPPARSSTRRPFWLGDDEIVASARCRRGAGNT
                     ARSVSVGSQSFSRNSNTADQLTVGSLVPLPEKPVEKPVPPPLTVKPRRKGVRMFPGQR
                     SCSADNARRGIRMVQPQPHWRSAADRQWDFLELGVGHRETPAPLYRNESHIDVGGPII
                     VREGPSTPIQRWRGGRRYGGTPVRRTFDIITGRPLVY"
     gene            <777013..>777639
                     /locus_tag="LMJF_30_2070"
                     /db_xref="GeneID:5653751"
     mRNA            <777013..>777639
                     /locus_tag="LMJF_30_2070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684760.1"
                     /db_xref="GeneID:5653751"
     CDS             777013..777639
                     /locus_tag="LMJF_30_2070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684812.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653751"
                     /db_xref="InterPro:IPR008532"
                     /db_xref="UniProtKB/TrEMBL:Q4Q786"
                     /translation="MVFYFTLTSDPSVMCYMGRDKYENEELIKFGWPEDLWFHVDKHS
                     SAHVYVRLPPGKGMNDLTPEIIEECCQLVKENSIEGCKLNDVRIVYTPWSNLKKTGDM
                     AVGQVGFHKEELRRYHTISSKNRPMLKALEKTRVEKNDVDFRKLREDRDMEERRKQRA
                     EKAAQEQQDKLEREEKKRQEDLRAYKDVMDENSMRLNTGEVPDEDDFM"
     gene            <778407..>780062
                     /gene="YCF45"
                     /locus_tag="LMJF_30_2080"
                     /db_xref="GeneID:5653752"
     mRNA            <778407..>780062
                     /gene="YCF45"
                     /locus_tag="LMJF_30_2080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684761.1"
                     /db_xref="GeneID:5653752"
     CDS             778407..780062
                     /gene="YCF45"
                     /locus_tag="LMJF_30_2080"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684813.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653752"
                     /db_xref="GOA:Q4Q785"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q785"
                     /translation="MLASSSLVSVKRTLRIKVGTSTSERLRAAELDEPTTSSARPPPS
                     AMDLSYITGKMPDTLPAYQTERAVWSATTFRSAWNKLHKAYASFLETDPERAAELRAK
                     DWQGLALYNSYAETLHLMSLLPATLRTAITQHSSFDYTEVEELFVHLGQDVEVRGSGG
                     WVIQLPPPTTADLQYLVKHIGRFGADGRGCVANTAHRASVWRGRHGEALGVTLRVGRY
                     VPGAARALLPLAQRGSLLILSKAGMGKTTLLRDLAAALAQEPGTPRVTVVDTSNEIGG
                     DGPIPLPYLGRCRRIQVAQRQDQGRVMMEVIQNHTPEYLIVDEIATEEEAEAAWSISQ
                     RGVHLIGTCHGEHLEGLLQNRALNLLVGGAAQAFLSNEERRLRNKMKKTVLERPYSSP
                     FSFVVELHARNLGHLYVDVNKAVDLVLDEQPAQLNGAVGAAVELSALLPSRVEKLLRL
                     HDERKRKLKYVAGTGTNDAEVGEEDDETATFSSAARGTVDEDGYTLLADDGGDPESKR
                     SIAPSTYAAPNHASGRRPHWQAEKQRRHRKTDDELYGELKGSF"
     gene            <783798..>784997
                     /locus_tag="LMJF_30_2090"
                     /db_xref="GeneID:5653753"
     mRNA            <783798..>784997
                     /locus_tag="LMJF_30_2090"
                     /product="putative alcohol dehydrogenase"
                     /transcript_id="XM_001684762.1"
                     /db_xref="GeneID:5653753"
     CDS             783798..784997
                     /locus_tag="LMJF_30_2090"
                     /EC_number="1.1.1.1"
                     /codon_start=1
                     /product="putative alcohol dehydrogenase"
                     /protein_id="XP_001684814.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653753"
                     /db_xref="GOA:Q4Q784"
                     /db_xref="InterPro:IPR001670"
                     /db_xref="UniProtKB/TrEMBL:Q4Q784"
                     /translation="MACRSYQFTICATSYLLRWRAPAVTQGSGALVKLPHLVRGARLQ
                     RGLLVTDAMIMKLGLVDDFIDEMKKQGTELAIYKDVLPNPTIDMVEEASVLYRKNRCD
                     YLVAVGGGSVMDCAKLIGVRQARPRTPLPYMRGLLRVLWPLPPLIAVPTTAGTGSECT
                     IAAVVSDPAKKDKLVVMDPFLTPSHCVLDPALTLTLPKFVTATAGMDALTHVVEAYTN
                     VFHYRTVDKAALRAMELLAKYLPCAYKDGSNLEAREKMLHASYLAGLSFTRAGVGNVH
                     AAAHAVGGLYNAPHGYVNAVILPHVLDMYGSAAHKSLARLAEAANIVGANDAEKAVNF
                     ISWVREMNAQMQIPTTLGAGDSRWAPQEEDIPFLVKHAVTEANPFYAVPVIFGEEEMT
                     ELFRRVM"
     gene            complement(785495..785566)
                     /locus_tag="LMJF_30_TRNATHR_01"
                     /db_xref="GeneID:12981363"
     tRNA            complement(785495..785566)
                     /locus_tag="LMJF_30_TRNATHR_01"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:12981363"
     gene            complement(<785935..>787857)
                     /locus_tag="LMJF_30_2100"
                     /db_xref="GeneID:5653755"
     mRNA            complement(<785935..>787857)
                     /locus_tag="LMJF_30_2100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684763.1"
                     /db_xref="GeneID:5653755"
     CDS             complement(785935..787857)
                     /locus_tag="LMJF_30_2100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684815.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653755"
                     /db_xref="UniProtKB/TrEMBL:Q4Q783"
                     /translation="MSALWARFTEKLKGSGYTLSDLVYCSEDTFLTLVANMNAFTPLQ
                     IASLAKEWQRSLSAAATPTATVSGSALPISRRHAESTRLSSSPVRSSALNRATLPATG
                     AAETPPNHSTLSTALRKNSFVPPRRSPAKVKEEAEYLLTKLGAQSGAEYQVSLTEGIV
                     AVEASPEAWGPLLDRVSRMHVTSHRDSAAAATPLATELQLLWKLCSPATLRKMEKACV
                     SGAPFGLSNQDDADGLCSSAVVLYGKDATRLAAPAEELEQLFREGWGLVAFDVAVGKA
                     RTVTKEEAQDLNANLYRFSMEQCLEMLEEAGFDAFHIPSRNAVAVCHMHQLMPRFVVF
                     VSTLEPVVVTRRLGDAVPAVGNGRPSRAPPAPAASPSPSAVAAAAAALPAARRSINGG
                     DDVLVPASRSSRNSEDLQCAVHSKKTVEFWSPTEKRLLCSHCLYYDGYSQENCIPIEQ
                     AAREEAPRLERWVQNAITFSQEIKSVFDLFEAAQTDVSQTHKQVRSDIAHSFTRLRAR
                     LDALEANLQQQCQQKAQQNLQVLQDTLSRITATVQFVSEVVQDADEPVAAYRGGVADT
                     NTCVALLRSAQRAFGAWEPVTISAYEDVRIVDGSALLQPVEEALKAVQSISSEAGKVQ
                     LPEAIDVNYLKSDCDV"
     gene            complement(<789128..>790738)
                     /locus_tag="LMJF_30_2110"
                     /db_xref="GeneID:5653756"
     mRNA            complement(<789128..>790738)
                     /locus_tag="LMJF_30_2110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684764.1"
                     /db_xref="GeneID:5653756"
     CDS             complement(789128..790738)
                     /locus_tag="LMJF_30_2110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684816.1"
                     /db_xref="GeneID:5653756"
                     /db_xref="UniProtKB/TrEMBL:Q9NE60"
                     /translation="MPSMDSLRTAVDNAPLLVNLLRLIRNARSPNYKDHEKGPVTFHF
                     GGLSMRDTGSYEAAEELWRQSSWSSGALAPNAAGPFRGPLHLVVYLNHSPVEVWTLQD
                     YREPATDHSVPRDFEQLEALNTLVRVLFAHLRCQDIYGVVLQSCVTATDDANNHFPAS
                     PNGNVSSPPHFPPPRNASLSRARTPHSPANHVSLRLFRSAEDCPTMPVHARRQYLWSS
                     DDFVRVDVTMDRTWRHHSWVQPGTQAASPVLAAGDRERDTAVCAAGERSSPIRTASPG
                     LRHFGSEGDTRSQSISPEAMGSLDKSSLPTPYLAPAATLALSSHLSRSPRTNLSPLMP
                     GSRLSPAQGVSEFALPPADVSSPFDCDRSRQSRSSPPIMHSCVFASSHPAGGGGATYT
                     AAVGAVNQVEDAVWLSNAEHVRRMGTLVCSRKQSPSASSSPVMGKKPRNSFISQKHEM
                     GSLVPSISIGALSGIGFDRRLLSSDVDLEDLAAETASSGSSASVPNSAAMEQLVSLLG
                     LCSKVKLQHVPSAPFGDLVLSLNLREVP"
     gene            complement(<792131..>792739)
                     /locus_tag="LMJF_30_2120"
                     /db_xref="GeneID:5653757"
     mRNA            complement(<792131..>792739)
                     /locus_tag="LMJF_30_2120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684765.1"
                     /db_xref="GeneID:5653757"
     CDS             complement(792131..792739)
                     /locus_tag="LMJF_30_2120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684817.1"
                     /db_xref="GeneID:5653757"
                     /db_xref="InterPro:IPR004394"
                     /db_xref="InterPro:IPR025656"
                     /db_xref="UniProtKB/TrEMBL:Q9NE59"
                     /translation="MIARDPPQEGRLPDPSRLPYDDERFAEMLLEMEVNGVIDETWQD
                     AKKARMEDVKEIANILSSLKVRDLCCVDVSEKTSNFDYMMFGTCEGARHIHLAAWAVQ
                     DADKVHRISKIKRQQTDELWEVVPVGRIVVNLMVESFREEMTLERKWAVTRSMDPLAA
                     ANAPISEGRQVKAHGLWTLTLNLQDLEDFEVDYCKDILMRQM"
     gene            complement(<794865..>797816)
                     /locus_tag="LMJF_30_2130"
                     /db_xref="GeneID:5653758"
     mRNA            complement(<794865..>797816)
                     /locus_tag="LMJF_30_2130"
                     /product="putative protein kinase"
                     /transcript_id="XM_001684766.1"
                     /db_xref="GeneID:5653758"
     CDS             complement(794865..797816)
                     /locus_tag="LMJF_30_2130"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001684818.1"
                     /db_xref="GeneID:5653758"
                     /db_xref="GOA:Q9NE58"
                     /db_xref="InterPro:IPR000315"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR006626"
                     /db_xref="InterPro:IPR006633"
                     /db_xref="InterPro:IPR007742"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011050"
                     /db_xref="InterPro:IPR012334"
                     /db_xref="UniProtKB/TrEMBL:Q9NE58"
                     /translation="MEEYTIKRKIGDGAQGVVYEVEHRTSKTSYAMKVICCTDQEQVN
                     MALKEIKVLLQLRHPSIVSYVDFFLVFNSVKLRREFAAQSEGACGSGGCGNGQQREQD
                     SLFLCSLSNSELDHGCAADSGWKPAAAEASSNAPTGKPQSGATRVVPTSLLSKHRQQA
                     GAHWLGEEEIAVCLVMELCSNGDMQGLVRETRQEFMKTGSHSIAEAQAVSWLEQAAAA
                     LQFIHNKGFLHRDLKPTNIFFDEYKNIKVGDFGLAATVGLGRNSAVGTPYYLAPERML
                     QQRYDGKVDIWGLGVVLLELLTLREQPINSMLLENPKVVDTVIPQITKMGYSTKLATL
                     LRDMLQRQPQDRPTPSSILHRLASITATSPHPGMSATLFAGMSCPKLTEALCDVCEVE
                     VAGVMCSSCKAAFCAGCDRARHRHHSRQSHDRTNMSSIVNSMNGASSLPLSATPMQQQ
                     QQQQKTLSFSRGPSPANTSDQTRASMQNIVVFPSSNSSHSRTLPREREMNSRTFTRFQ
                     LALPGRSVSMSDFSMTQGLQGPRDGSGINAAVAETVLRVPDDVPSLAQALRVVESMPH
                     IRKILVAGNTTHTVPLVLTSRLPDSIKLVGESPPPMLEVADSPFALHCHSGRGSVENF
                     ILRHVGRFCFKLLKLDTNLHQTDANAMTSAPAKKPSRPTAVSITGGEWRLHKCRISCV
                     EGSGVTVGGSKHTPSSATNGQNPSATGARSSRPPQSPSLVARSSLVNGADEGAEDADV
                     MSMEPIITKCSFIDVTAAGIVVMEKSRGLYEGNTFSGCGFAAFLLRKDATPRIRANHI
                     TDGAEAGIFCQDASGLMEYNVIAQNAGCGIVVKGASAVPVIRKNRVLSNVQAGVFCCD
                     KAAPFVSDNEIRQNGKAGVLVKTTAAPKITRNVIESGKEAGIYIFEKGAGIIEENRIR
                     GNQNAGLLVTTGGNPHVIHNTITKNAYEGIWVCKHGGGTFCDNDLRGNTKGAKDIEAD
                     SRVTWVGNVEQ"
     gene            complement(<799377..>801815)
                     /locus_tag="LMJF_30_2140"
                     /db_xref="GeneID:5653759"
     mRNA            complement(<799377..>801815)
                     /locus_tag="LMJF_30_2140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684767.1"
                     /db_xref="GeneID:5653759"
     CDS             complement(799377..801815)
                     /locus_tag="LMJF_30_2140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684819.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653759"
                     /db_xref="GOA:Q4Q779"
                     /db_xref="InterPro:IPR002641"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="InterPro:IPR021771"
                     /db_xref="UniProtKB/TrEMBL:Q4Q779"
                     /translation="MRQVLSLSVLLDLAQGVLGRLFALLRWLNDYPARVQFRRTTQRF
                     LSVMNTTESYKTFVEAAASLDHYCGVAKWAQDAPPLDRCNAVGLLVDATAAQHLVRTN
                     NLYAMETFLCSLLKRNAHGLMDASIYRYYNSAPHCLEDYTDSIECLITAYAAGTWHGE
                     SAGSDSSSAAADRTLPPVSPAPVLRDLRPCWVRLEASAGAEVRPPLLAGTSPSVSSAT
                     HSLPSAALPAVDVTAKIQQVWQAQLRKTIPTIQAPWATATAALSRQHSTPASGHCLVS
                     SAASAAMPLTDTSTGTMPTCASTMAGDKSILFAGDDAALVPAPVSPAFANPQTNNDAK
                     AAGDFSSVSLLLSPLLRTEDTTAGNATASLSFGAHISVASPLSANPMAAARPSPEVAL
                     ARQLRSSCASLCRFLDGCASPSASPQQYHAHQRRCSAYHPAVATVGHRLKVLQKVLHS
                     YGRTALVLSGGSSMGTYHAGVARALHEAGVLPDILCGSSAGSIIAAMICTKSPDELHA
                     FMQSHVLSTEAMHMSPFGEDSDLPGKLKRFFKTGFLMDVRSLMGCMRGQCGDMTFLEA
                     YQLSGKVLNVSVTRSQQEGMPSDRHVLLNYVTAPDVVIWSAVSASCALPGLFTAVQLI
                     EKSSLGGGTFAPYLPGELWCDGSIAQDIPRRLLIQLFGVNYLIVSQVNPYVIPFLRPP
                     DSHHITATSGSWLARLWFAWVDVCGWVLTVLFSVHLLPRFGRFEMLFMLFAQFYSGDL
                     TIQPIDSVMKAVPDYLNLVNNPSADYISYVASRAQSRTWPLVTRIRLATCIERCLQRE
                     IRVLEAMEFREQTT"
     gene            complement(<803226..>805781)
                     /locus_tag="LMJF_30_2150"
                     /db_xref="GeneID:5653760"
     mRNA            complement(<803226..>805781)
                     /locus_tag="LMJF_30_2150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684768.1"
                     /db_xref="GeneID:5653760"
     CDS             complement(803226..805781)
                     /locus_tag="LMJF_30_2150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684820.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653760"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4Q778"
                     /translation="MVVSSDASLIAVVSSTFMALLEIEHTPSPTFLRMGDADALGDAS
                     RDEVVITAEEMRRIACTVGDVRGVVFNSDASIAAVCTDSALLLLSNIFGDASNDDEDG
                     AEPHLASFDCTHLGASTQGCSVTCFTGARQLLVVDDVNHLVLLRCVNREESSDVSEDA
                     HMRVACPPNASPMAVKLQLMVDGHICARTARVTSLACSHSGVYGESLVVLGLSNGTVQ
                     LLNGHQLQALRTWNVRDAITAAFIRSSDEAALASLRRRSGLSQAAMRDRLGIPDAAAS
                     TAAPPVVTIFDVCVGAHLITVCTSHGVVYYSRFTFQLESAYTQLLTTPLVQAGAAAAA
                     GTSALGDVAMRGGSNGRWAYINVFDGVLYFSRRDVDTQHTLKVRSAEGKAASNDIVHA
                     RTPLPATWLDNVASARLAQRPFLSSDARRRQPTKGSGYTDAPWSVQQERKRKARAAAA
                     RDRKAQAFGAVSASAVASTNELRFQYDFASIFGVGRATLTRMEASSSALRGLHTRAVV
                     ATAFATAGDALITAGADSRIRQLHFPIARTRGTDGVAGRILAGHAAAVTAIDANLSRQ
                     HPLILSAGAEGCLRLWSPGARDTPLAECTVGCSGAKLARPAPGKPIVAAQFFYLDKLL
                     LSCAADALELRRNVGGICSSLATAAPSSTSEADKVLSQAPLYRFSVGTGHSITSATAV
                     NHFASNLIFLATSEKEVQVLDVAANTVLWREGTTHTRGIYRVATGRTSRYAAADVDSG
                     AAHLFMSASLDSTAALWDVRIAKPVQLFTQHSNTGIPSLALEVAPGIGVVAVASQDNA
                     VYMYDLRGGCGGVALDVLRGFDSYVTSLAWHPLRPFLVAGLASGDVHVLQHAT"
     gene            complement(<806735..>808684)
                     /locus_tag="LMJF_30_2160"
                     /db_xref="GeneID:5653761"
     mRNA            complement(<806735..>808684)
                     /locus_tag="LMJF_30_2160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684769.1"
                     /db_xref="GeneID:5653761"
     CDS             complement(806735..808684)
                     /locus_tag="LMJF_30_2160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684821.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653761"
                     /db_xref="UniProtKB/TrEMBL:Q4Q777"
                     /translation="MELCVAWPNAIAAHMEVCRVCRGELSPAHASSPLAATLGEGETD
                     EPSWQLEHFTREEALLVLLSDEIEATAATQDDFLTRWGVHNAWDHHRALQGRSWWVSG
                     GIVAVLPSEAATRLVEPFLMLELSRMENGCPQLSRHPASCRDSSQTLEEALTHAILER
                     ELSHSVRAYLRNEVEGRIESRRLHRMTTVVPPAMALFLRGAPSSVLHECLLYHTVDCP
                     LFPVEGGGCDAAQSSTDRATGLVAPAASPTAFLRPVKSGLSSTDLLERQRLVARDETS
                     RLTELFCEYDLLLSGDGYVRVPLAPVSRYVFTQLLCQSELPSALMLALMRRHSDVTRR
                     AGDMGHRIDPAAVSSRLPPPTEEEVVLGIKVTWAVTRWTAALQRGAAAAPPVGLPMWN
                     EEQSLRKDKLCGWIRERMRKAKREAAELYSLEDAADTRATGREEDGVASTVSALPVAS
                     GDTADPLRRCRGAALEQLERRLFAPFPSSYRGSSTEWLGQALRDVAREQRHAASNMAQ
                     RDDVRASYAGPAPAARRAASPNVLDNSSSASDSDGTSDDGSEGAGGVGTPTRQETESL
                     LAQLTELEVVLQNELASRTAIPLACGGDSRTTDSRLGVGDAVTGDQEMDVTSWLTAAD
                     MQQVTRNELFLHHVQLLESEMEQDQ"
     gene            complement(<811476..>813056)
                     /locus_tag="LMJF_30_2170"
                     /db_xref="GeneID:5653762"
     mRNA            complement(<811476..>813056)
                     /locus_tag="LMJF_30_2170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684770.1"
                     /db_xref="GeneID:5653762"
     CDS             complement(811476..813056)
                     /locus_tag="LMJF_30_2170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684822.1"
                     /db_xref="GeneID:5653762"
                     /db_xref="GOA:Q9NE54"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR002867"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="UniProtKB/TrEMBL:Q9NE54"
                     /translation="MGTKDKEVMYDPGYDKEYYGEDEDEYAYEEQEAAATVVPSASVA
                     AEQKYVQCEERTMDVSEVLAMQSAVVREVVNLTCLSTSAATLLLRRYRWSRDVAVERY
                     FENSTAVLSDLGITEEASLHEATLLHGEAGGPIVCGICTMEYNPQQVACLSTCQHYFC
                     VECWRDHIKSRILENLIGTQCPDQGCCQVVGLSVMCELFSKCDDEAQNEASKNILEQI
                     HRKYLTSFVETCPTLHWCPNPQGCAAVIYAPVPPLQGQGVRCLLCNRSYCLRCSYEPH
                     RPATCENIRQWKSYCSKEGANLAYILSRTKQCPECKKTIEKSGGCNHMTCKCGHEFCW
                     VCLGPWKQHSGDYYSCRNVERHGSAASEEAVGASRRFTYHYERYTLHLDSAERDEKLL
                     RTMVHNPTMRERLIKAQRRIDENRAPGVASGALKQEDMPLVDLTCATLEAVSRVTDTL
                     FTARDILAHSYVAMFYLPENVSEGQLMAHRVGKLEEATEAMSGSLIKLFTTTRSQLGT
                     FFDAADVLVAWMKALCDV"
     gene            complement(<822279..>823781)
                     /locus_tag="LMJF_30_2180"
                     /db_xref="GeneID:5653763"
     mRNA            complement(<822279..>823781)
                     /locus_tag="LMJF_30_2180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684771.1"
                     /db_xref="GeneID:5653763"
     CDS             complement(822279..823781)
                     /locus_tag="LMJF_30_2180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684823.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653763"
                     /db_xref="GOA:Q4Q775"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4Q775"
                     /translation="MTSLQNLFVAKLPRNLTDADLHQIFVQYNPTSAKVMLDATTGKS
                     KGFGFVLFASEDAGRTAYEKLNKTHVTLHGHNFNLCIFPSKHDGKVAMEESNALYVRN
                     IPLKLSQAEVEQFLRGFGPLTYCAMREDNFGGSVWVVYAEFDSVESAKRALMSLHGNR
                     TYFNTSVAILAKYADSEETKRERRRRREQQQAEQQHLDTVHNFGSPTTGLDSNKGFAV
                     QSQNTPLPPPPPPPMRTSPGHSSTGSTLASSYSTSDMHKEGTGASLHPPTFASISHHF
                     APGRHGGGGPPPAMGQPAAPPASSMLASSTLQPTQPVSGQPQQSPTPNSGSFLNVIFN
                     PTSANNFGNSFTHYSVLDQTPSRSSPGTPLNFSFGPEMENSGALANGLGTGSHAMLSA
                     SGHAPMTPVRRSSNLSTSGSYRHNPYAPVTPVSSTHNSTGPSTPLVSSIAYPTAPLAI
                     MHFGASHHLQGSPVALHPLGPGIGVANNHFASRGNNAYLAAPASFNDLSH"
     gene            complement(<828962..>830452)
                     /locus_tag="LMJF_30_2190"
                     /db_xref="GeneID:5653764"
     mRNA            complement(<828962..>830452)
                     /locus_tag="LMJF_30_2190"
                     /product="putative RNA-binding protein"
                     /transcript_id="XM_001684772.1"
                     /db_xref="GeneID:5653764"
     CDS             complement(828962..830452)
                     /locus_tag="LMJF_30_2190"
                     /codon_start=1
                     /product="putative RNA-binding protein"
                     /protein_id="XP_001684824.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653764"
                     /db_xref="GOA:Q4Q774"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4Q774"
                     /translation="MSLQNLFVAKLPRNISDADLLHIFSDFEPSSAKIMLDAATGKSK
                     GFGFVLFDEEEKGAKAYKALNRKMTRACGHSFTLVIYPSNHNGKIFTEESNALYIRNI
                     PISIGQEKMERFLRTFGNLIYFAMREDHYGNPVWVVYAEYETVDDAKNALAKLHGNNT
                     YFHGSVPILAKFEDSDDAKKERRRRRDGMQTHAPNSGCIFPPPHSHHENSGSLHTAST
                     TLSSESIVSSGHGGSSNRTVESKTSSKSTAGPRRSGTGGIAAAVPLLTPASAPPPFLP
                     AMTDVAQNTPTAAFSMPQQLLQSTPGYFYTLGESGQQIFVPASSFSSSMPPYNFAPAT
                     QSAPLLLLNPPMQTTDAVAKPNFSLLNPAANATVVLMENGLHYMLTPEAMNINCEPFS
                     SPTSAYGPMLAGSQPKSLLGMSSSQATYTNGSACSINSFGPCLDALYTDPLHVVPLRC
                     DAEDEVLGEASIAGPNTEDTARVHALQRASTEGSVITGQRGLGVGW"
     gene            complement(<843114..>843623)
                     /locus_tag="LMJF_30_2200"
                     /db_xref="GeneID:5653765"
     mRNA            complement(<843114..>843623)
                     /locus_tag="LMJF_30_2200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684773.1"
                     /db_xref="GeneID:5653765"
     CDS             complement(843114..843623)
                     /locus_tag="LMJF_30_2200"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684825.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653765"
                     /db_xref="GOA:Q4Q773"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:Q4Q773"
                     /translation="MQLSRIPSYEEASVAGAEYSLSPMSPLAHLSKKIDVTKLKTKAC
                     RYFLLGVTCPFGDSCAFSHSEPVSPAAYAPARMAAKSSASLTFEDLSKSGSAQLSDTQ
                     SNDAAGDVSERVVFGQPPPAYEVALKESETLAAAAAAAEELTTPPAYPKRFRFDPYSV
                     NWIAYEKTA"
     gene            complement(<844914..>852290)
                     /locus_tag="LMJF_30_2210"
                     /db_xref="GeneID:5653766"
     mRNA            complement(<844914..>852290)
                     /locus_tag="LMJF_30_2210"
                     /product="putative endosomal trafficking protein RME-8"
                     /transcript_id="XM_001684774.2"
                     /db_xref="GeneID:5653766"
     CDS             complement(844914..852290)
                     /locus_tag="LMJF_30_2210"
                     /codon_start=1
                     /product="putative endosomal trafficking protein RME-8"
                     /protein_id="XP_001684826.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653766"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR025640"
                     /db_xref="UniProtKB/TrEMBL:Q4Q772"
                     /translation="MSTTISSVVSSASAASSAPLDHRSFTSCYTVTKHSWRGKYTRIF
                     CVGPQGIATCDVRSLTKLTNYWPYTSSVRSIVAEGVGNGHFLLITQSNGSRAEELRFS
                     CGTDAERAQLLTDVNRYRLCFDCNYRASLTVQVYWAMKYTINETLRPCTLRVTATGVE
                     QLCRIRGDTGANAPADGGASASSQVSASPTAAKYGTGAPPEYEKVGEYLFCSIRGITT
                     IADRPGSIVIAYGTEMKMHLYDVANVKLLIESIYRNATEYIGLPRYREMNVLQQSVFD
                     SERLGIRRDSLEAVEEFSVLKHSPKQRDGAVRRLLSTTPIAIVERDPVTYNPISAHFL
                     HSIFALVRCEDDDQRFLILFKDSPVMKSYQSPARDTILAHVLTACYSAGDGNVCVMAR
                     PLLRRNRLSSLDTPVTEEVESLLLKGLVEGRLAGAPVAVDTAGSTEDSVRAGLMASLE
                     LFNANVPRTGLTWSENRDGLFSENREKLIFNAVEAVLKHFTWVKPSGGDASEGSRGSS
                     GVTLDAVNQHFIVEQFQALGRLSVSRVGFSSIALVPSLFKSVGVYSVQALRLNNLAVS
                     FAVIEFLNTLMTPFHNHYEIEHESMNKNRLLSAEGFIRSLMEVLRDHIPNESASLLVL
                     ELLFFFEFALCPPYSSTTDPAHFKRILGDLVDILGRHLFKLLGRTCDIIRYTAGQLIR
                     VVMEEGDKAQFERMQQLALSEGGILTQFNTALFSSNRKLRDLARRLIAYWAHGHVPTQ
                     DILRRMVPLTLLNFLQSQEQAPPNEQELEERKKVTQMTAAFRESKTGWFKKSFNPRDV
                     TLEANRGVGNGSTAAAGSYAVDPASPDGGRVRYRVRNVNVMPMINWSMFFYQAKLDHL
                     RPDLIWNHTTRAELKTAVQAELDAFRQYIDMRREKLIAWNYAEFEVVYHSLDSELKIG
                     QHYPRLLFEDAHPMIARPREFFNDMYHRFLLVQDTKSKLECLHGLALLYTHYAEEIGE
                     FHDVPFLLQMLEKTMDPMMRDRLLLLLAHLLKARHNIKLFLDHDGLAPLMELVTVAHL
                     HIDRPQLKSVPNTIEYAGSLEEMQGREKEWHYTQNGAKAGPVSFSELKELYKKGEVTA
                     TSKVWAQGMPGWRELGAVAQLRWGVLSADLPSILTLTEVTCTVLDVFLLLCEHYPSLN
                     DEGAIMQPQPKVKRILSSPPVLPHLVQLLLTFDSGVCSRVHTLLLSLMEANPFVGRFF
                     LTGVFFFSCLYTASDVLPMCRLLAATHHRQSFQYTAGTNDLVRDSILAPLLPPAMVCY
                     LTHHGPEAFADVLLGEYDNPEAIWSPSMRQYLATKVAAHVADFTPRLLGNNTVVYQYC
                     PIVGVQYESLQRELFCCQYYLRHFCDELRFPNWPVRDAVRFLTDVLQRWREELNKQPS
                     SLTREKCYEILELQPQPSKQEMRKAYYQLAARYHPDKNPNGREAFEQVQRAYEFLAAD
                     SVESSEPSPYNISLLLKAQTILYKRCGATLRQYKYAGFGLLLRLIETEFRAPDALHKD
                     IVLLDPATELCYFTIRNAPLNADELQEENGIHLLADIATYCFDLITPNSHDTEVHVRI
                     ATHCMLTFSISARFPDCRLKMLREEQIPYLTAKGISYYQAPELSRACTQACASESRSE
                     KMQSELIRYGCVWHLLQPLFSYDASLDKAGVGLDEEHHKQLFANRAAIFALHAIYALS
                     GISRLRSIAVDNAVGTAALDGEDVAASDGGAAEGTADDNTQSKRHAGVYELLQRLLTP
                     YILYKMERQQDSEAEVLMLLNSNSDTPYFLWNNSCRAELGELLQTNSKQFCEAAFGAT
                     DLPSLSTSVEGFAYSLHTGEVVVGGVFLRLFIAQPNYPIQNPVGFFMALLLFLLNKEA
                     DTTSAKANDAAARPAPPSSSSRITLREAPLLAAQSLRLLSSGYTETLSATASKQMKSL
                     VALLTPSFAVETAGVAAAENEEDMRSAIFVEIAQALSKFLSSDACLQALSTVETAMTA
                     VVLLLERMLGRHDEAHGTSALSSEEPDAVLTLIRLMLTHRTLVQQSLDRGLYIFLLSV
                     YATWPREKVREECCRCLAKGYEDRLVGPQLFIRSSKYLPPAFLEMMKDNVKQACRMLD
                     AWQENPELLWTKSQREELVEQLQASRRQIVAALSTDGLACWKPSDTAGSSRGAMHSSF
                     DGGGGDAGSADRRLRRLQVGGVYVALYVQQPGWAVRHPKEFLVSLLERFVEEASKATS
                     PTAAVSGDAAAAPDTDMLELLTKAGEILLSNSPGLRDYMTSLGYGSKVDRLLSPATAD
                     HATNEAVVRYSLRWLREMSRSAACVESTSSSADVLPSLVNVIEQYPALTMEALQTLEG
                     FLSNATRRSRVLEYALRDHIPERLLKYLEEGLPDSVSAAADVSAATIRAALVKVIKAL
                     LAVPDDVHTPHIQALLDKSLVWTKYKNQSHDMFLVQTHFGGYLTAGSNTHPGAAAAAL
                     SLTAPATTEANTRSEPPPLEDISGAPPPFSTAQALT"
     gene            complement(<854098..>855717)
                     /locus_tag="LMJF_30_2220"
                     /db_xref="GeneID:5653767"
     mRNA            complement(<854098..>855717)
                     /locus_tag="LMJF_30_2220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684775.1"
                     /db_xref="GeneID:5653767"
     CDS             complement(854098..855717)
                     /locus_tag="LMJF_30_2220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684827.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653767"
                     /db_xref="InterPro:IPR003734"
                     /db_xref="UniProtKB/TrEMBL:Q4Q771"
                     /translation="MDMMSGLGAGMVEAEGVAEDELLVSTWSQSRHFPEDRILQTADL
                     RTENVRSGDGGLQHIEDDSISVTPFTSAPSTAPRFAATTGAPPLAPRPLTDTSPLLLG
                     LRMQKTEMPADPRTRLLDLVITNTTASITLAEMEQEMKWNAQYAATYGPLKEYLQSYQ
                     SIFVVSPVDDRVRLRRLFSIRTNALAREVRRATPHSPSLSSRQRHGRRTGRDAAHRSQ
                     SAADRRTGKPSLPSAEALAAHIGSVSYSCIAERLDLDALETVYHRRGYKTEIAHAVLH
                     VSSENCFDLFLFSNGAVVWWGMDRTNHWMVDDDFLSASNHLFEGVVHRYPQAEIDALF
                     PIWCSYELDEQCEVVQTPSALGFQPLAVEPALDRLAKVLCFDHYLVPASEPARSLVML
                     TFSHSLGRSAGVDYFEYITKWSHRHILSTPAEFTSLLDYYSTKRRIARLEGEIAVAQL
                     AIQSAHDIPDVLWEAPWLQGYYDLAEQQNTTESRLSWFTSRSDTLLEQLSHIKGRRYR
                     LFMLGSDVFLIVLLILDVIFMTSRLVAKMYF"
     gene            complement(<857418..>858173)
                     /locus_tag="LMJF_30_2230"
                     /db_xref="GeneID:5653768"
     mRNA            complement(<857418..>858173)
                     /locus_tag="LMJF_30_2230"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684776.1"
                     /db_xref="GeneID:5653768"
     CDS             complement(857418..858173)
                     /locus_tag="LMJF_30_2230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684828.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653768"
                     /db_xref="UniProtKB/TrEMBL:Q4Q770"
                     /translation="MRRRCLLVDTIRLSDFADMEAVLLRCPKFYAKENLVTVFPAAER
                     RVRFIQAAQAGGESSEANYYLLYTFQSSDLVPSEEPARLGSGELQKLASEDDGAATVE
                     TSAAPSPLCSPLKKEENGFSELIQCSPASVEWKDRSRERFFSFMAAAQTRLEKRLGSA
                     NKSSSLFFMDWPDPATGLPLCTERGSTIFCDADAILQFFSFNSVLIAGPGGGCRMIEH
                     PRFGLNVYPAAGVLVLPRDAEETLRETIRSFAA"
     gene            complement(<860582..>861502)
                     /locus_tag="LMJF_30_2240"
                     /db_xref="GeneID:5653769"
     mRNA            complement(<860582..>861502)
                     /locus_tag="LMJF_30_2240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684777.1"
                     /db_xref="GeneID:5653769"
     CDS             complement(860582..861502)
                     /locus_tag="LMJF_30_2240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684829.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653769"
                     /db_xref="GOA:Q4Q769"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q4Q769"
                     /translation="MFELVTYAYNGVLAAVNRGFKIQKETPKTLTDPGSFLAGAVAGG
                     LGRVAALPCDQGGPKGIKQTVGRRMPQFGFLMMFYCPIAHKLLPGLEEDPLSKMLTTF
                     MIGAFAGLNMRLVCNPISRVMDESRRTGKSSIDTARILKNKTILQFWYTTPNLIANAM
                     YFGTLFTVFEGLRRFNERNFAPIVPNEPTEDAFVMGEEMQVQLVGQRPRHRRPAVVDH
                     NWSWENYTTTVASNFVLGGAAATVASTVCYPLSAHQYMQTVIHDSAICRGLTPTLLKE
                     VPMVAVMFGTFSAIQPLLAPRHGVRCGFGY"
     gene            complement(<862945..>864060)
                     /locus_tag="LMJF_30_2250"
                     /db_xref="GeneID:5653770"
     mRNA            complement(<862945..>864060)
                     /locus_tag="LMJF_30_2250"
                     /product="conserved zinc-finger protein"
                     /transcript_id="XM_001684778.1"
                     /db_xref="GeneID:5653770"
     CDS             complement(862945..864060)
                     /locus_tag="LMJF_30_2250"
                     /codon_start=1
                     /product="conserved zinc-finger protein"
                     /protein_id="XP_001684830.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653770"
                     /db_xref="GOA:Q4Q768"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR022755"
                     /db_xref="UniProtKB/TrEMBL:Q4Q768"
                     /translation="MSRCGTCNVVLENGEILRAHYGSEFHLTNVRRRVDGLRPLSQQD
                     HRLSSNEMEGAVLDEKGTPVYSCTLCKKTFHSVQTLQTHIRSTAHLMRKEKRIIARDS
                     ETASMLTSTSLGSAAMGLHRRHNAKKGAAARGDAKPKTAPKVDAEEREEDASELRCMF
                     CGFLSTDVVSNAHHLECVHSFTVPLAAHCTNQAALLAYLARKINGLMCIVCNERTRSF
                     SSLEALRDHMREMNHERLILSPEYQEFYDVALEDPEAARPVQLEGVRGDELVLAHDKG
                     PGKKRVVLKRENDVPRARPRETEEQNEKRMAILAEEQETRALARQEQKELVMVQNKEA
                     AWVAKRSGGNRQDLQLDVSMRTNKLHPKGYDGNMMFS"
     gene            complement(<866025..>869864)
                     /locus_tag="LMJF_30_2260"
                     /db_xref="GeneID:5653771"
     mRNA            complement(<866025..>869864)
                     /locus_tag="LMJF_30_2260"
                     /product="putative phospholipid-translocating P-type
                     ATPase (flippase)"
                     /transcript_id="XM_001684779.1"
                     /db_xref="GeneID:5653771"
     CDS             complement(866025..869864)
                     /locus_tag="LMJF_30_2260"
                     /EC_number="3.6.3.1"
                     /codon_start=1
                     /product="putative phospholipid-translocating P-type
                     ATPase (flippase)"
                     /protein_id="XP_001684831.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653771"
                     /db_xref="GOA:Q4Q767"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006539"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:Q4Q767"
                     /translation="MRRIRLLDEAVANQYCTNLVVNSRYTVQNFIFKNLYEQFSRPLN
                     LYFLVVTALQFVSVIAPVNPLSTLLPLLFTLTLTAAKEGYDDVKRHRQDHKYNHTLRR
                     VLDAEKVAWVSRINADIRVGDVLLLREDEEIPCDVVVLGATSGVYIRTDNLDGEIDLK
                     PKETLQFTTVDPGNLSRRTRAVCEVSSEAEPPPAVNVISSLTGVCLECPPASAIIDSF
                     EGCADLQPTAQATVSCAGVPSERVPLTHHHLLPQSCVLKNVAQAVCVAVYTGDDTKCG
                     MNKRKAPAKWAQIDKAVSRYSACIFVCQILNALVFGVIGFAKNGSMHDMVWYLPLPVS
                     EASGSAVIYPLRFFLLTTVMIPVSFKFVVDVCKYYMARAVEWDVSMMHTAPATARSRR
                     PDRSQQIGCKVKNSSILEDLGQIDYVLSDKTGTLTQNVMRLDAVTVCPGHHISVSKIA
                     DTCATLPEELKKQDTATLATVRRFAQMVALCNTVEVVHPQASSAAGPNGAAIAYHAAS
                     PDEVALCVGMRKLGVSLVYRNEHRAVLRMRRGEGSSRTEAAAALGACRHGNSGVRVAR
                     ADDDAEDDLTWTVHHTLPFSSERRTMGVVVEEPDSGRIWFIVKGADDRVIGMASRGPS
                     SSVASGHPENLPLHPECAARLSLYARRGFRTLLVACKELTRADLSVFLRNIAEASCLV
                     EGRQARLDALRAQMESGVTIVGITAIEDKLQDDVGETISDMLVAGIKVWMLTGDKTET
                     AEQIGLSCGLYRASDMVIRISETQPSADLGRDTCERGGAATHARSWREELLTFPMEQL
                     PPPPSWQSRQSSAASAFVSASAAQMCGKALETRVLGFDASDSSQLSNGPLRTMAQAAD
                     SVAEATGGGAGGGAFVSGGPERIAVLVVEGGRVLETILQDPALRARFREMSSRCGSVI
                     CARSTPSQKAAIVRFVRGGGFMTLSVGDGGNDVAMLQEAHVGMGIAGKEGQQAARAAD
                     VSITQFSDLRALLFVHGQQAYIRSAYVIKYSFYKSMLISFIQLAYNVIGTHMSGGTFW
                     NSFSLTMWNGFYTLPQTIFYCFDRCASRVVLERNPYLYKMTRHAVDLRPGEFFGSFVV
                     RGMLQSVGLLWLSTRLYGPGFAYADSGGTASNDVTFSVSYTALMLSQVYTMWWESHAV
                     TPLNLLMLLGMPLFYVYSTSVYSDSPTLQYFGVFRKSLDTAGILSALGVSVALVVPSI
                     IYLTVTVFQTPNPRDVLRQAEIRRQRLLLTRRDYKRMQPLWVRWFGATPEDCSMLCRR
                     CYSAPSMDIDDAGDDMI"
     gene            complement(<871669..>876759)
                     /locus_tag="LMJF_30_2270"
                     /db_xref="GeneID:5653772"
     mRNA            complement(<871669..>876759)
                     /locus_tag="LMJF_30_2270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684780.1"
                     /db_xref="GeneID:5653772"
     CDS             complement(871669..876759)
                     /locus_tag="LMJF_30_2270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684832.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653772"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="UniProtKB/TrEMBL:Q4Q766"
                     /translation="MNVGSGGETNGEAGQAAAAVASFPQLTLEEEAELLTKYGAEGPC
                     DDGLEWAAPSQFKSQMGDGHVFLTGAASDDDDVGDSAAAADSCRHRGATAPRRGREHA
                     HKDPLRLYLHEKFPSLMLLDRTTPASLMETVTDALDALEHLSNADGLQRERTEGHVST
                     LSLTGFTRSPAVERHAAVLRSGKEWARRASLAVQGASITSMASKLFVPDTHDAPLACR
                     GDRSPLKAAGASACTEDMEFHRLVESTEQLLAKAAEILKACSTEACDKEADDIAHAVR
                     KQEEREALLSEDALDVYFDRMEVLNGDEDDEEAVQLLRRAREGRVRLRAALALRTVDT
                     PASDIRAGYDEMETAPRAEDVDADAPSLFALTPDLPYLCAFEMELPLPQPVAVQPLPG
                     SNGAVARASEARSRVRSAAHAVPEAAGPPTDFTAEEEKSVSLSQLLTRSTEVLSLIAD
                     AELRDAQAQVDAAASREAHVRVRRPGSPARRGMAQTTLQSDDRSALGLATLPSFVQQL
                     DILLSPTREEQHYRGAAPTRSLQPDTQVGLDDGPNAALEQQGRGSGGAAESVSLVNTS
                     LERIRWQAALESFLVDREATEGHRMRIEDELVEREIRACADRLTWYAEQRTTLAQSAV
                     QAAGHLCETEKAAYAELLAAANKDRALAQQSQELRRLQEAEKLVYTLILEYEVQREKL
                     LQEEALSLRLLRRDAVEEEQRARIATRKRVDGEMAAAKKAIEQLRAVFEQQRVWPDPR
                     TRQGEDDAPAADTAVSLEENPLRKSQWYVWQIAPLLRERATLLRWTSTQQKALESVRS
                     LLVEAEGHYRAHVKGAAQSFNIETPASVVVLPENPPVVEKRGMPAGHAAAEARVLDAD
                     AFVRLLWPSLHAVVRNPRRAPQHLAKLVLSLEDLQQVDWGQLRQLSLSAAQSARTQRE
                     PEAAVSVARVVKELDLSGNPLQQFDVVEAVRTFSSLQSLSVSHAQLRTLDASGATATS
                     GKVHAAGSPDQRRLSDASAASSRSSHLRHVAAARNHALAAQVHLLSLSVSSNDLASLT
                     PLGTLASSSLVRCTATENKLTTLESLNGCVQLRELSAAHNRLTDVRAASTMPLLRELD
                     VGNNELATVTARADGGGDDATSYSPMLLSKLCASHNPLRALPTSQYVYPCLTQLFVNH
                     TKLTSLGAAALGWFPMLTVLQAEANEISDISGVQHCPRLRSLRLSHNRLASLSELEPL
                     RCCTRLQVLDLTGNPCLVEDSNDVQIAAAVTRALYELVPSLEVLNNRPREHARELRRM
                     PESHSPSTHAPTTGAEVGDNGDGGWHADAALAVCVTSSSRYLPATPKLYREVFAALCW
                     DAQLQHVLEEKELREAYAQRPLNRAKGWELTASDAAAAVAAVCAECDGDQPPSNRGAA
                     AVADLNAVTAAQIHVRTAEHERHVEHYRVDAAAVSEWISLSPRPSSAALTVSAEGDPL
                     ANAHVRNFSYKQQQQDHVALLARAYLTEWLHGRVLVRRARLELARLRLAHRQSRARQE
                     ELAVQRIQPVWRGAALRSRLRRFLHPERAGKGEEIDVDDFPKVDVDDWLIGNADALAP
                     VEVLFHDVVESARGLAPVPFDISEMTASHAVAAISGVSPPPVSTSLTPALSRDASSHN
                     GVVSGHAAPLRIAGEPPGGDVAVVGKLRSSGSTLAEQWGPLAAAQIRKRRQKLARSHQ
                     QHMREEFLQDPLRVKREAREDRAQQRPK"
     gene            complement(<878288..>880402)
                     /locus_tag="LMJF_30_2280"
                     /db_xref="GeneID:5653773"
     mRNA            complement(<878288..>880402)
                     /locus_tag="LMJF_30_2280"
                     /product="tubulin-tyrosine ligase-like protein"
                     /transcript_id="XM_001684781.1"
                     /db_xref="GeneID:5653773"
     CDS             complement(878288..880402)
                     /locus_tag="LMJF_30_2280"
                     /codon_start=1
                     /product="tubulin-tyrosine ligase-like protein"
                     /protein_id="XP_001684833.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653773"
                     /db_xref="GOA:Q4Q765"
                     /db_xref="InterPro:IPR004344"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR027748"
                     /db_xref="UniProtKB/TrEMBL:Q4Q765"
                     /translation="MFRHHGRLCAAAAAAAAAKAGELASSCSSKSPSLIHAVESVSPM
                     PVYLKPSSSPQRKASFYFPRMREKCPPGYAFQPSSLGTALPLFSITSSSCEYYALRLP
                     LLKAGFRRVPAEARDVASNLVWGRSMRFCEMLRDGQPTPLLDLPAADSSEQAAYMDKL
                     RMVNSHQRYNHFPLSHANLGCKRGMAVNVRRAFKDAMQRTTTPGERKAVQSRYSYMPR
                     TWFYPQERESLVTVMKAAPSNRHFIWKPSRGSCGRGILISQGGTAQAASWERIMEVID
                     CKAASRETRRLFSSYVVQEYIENPLLVEGRKVDLRLYVAVTSYNPLTVYWHEEGLVRF
                     AAEPYSDATSSSSPGIDGGGMEVGDGVGLPGALIDGARPESAASRNRGDHNSDSAAPS
                     DHCAKHMHDRFRHLTNYSVGRRYVAMHGHGRSVLSLPTETNAVDGDAAAPALKWSIQR
                     LWDYIDARGDSTVTSRTGVAPARRPSDAVREEIAQLITRTLMAVRPVVDDAVRRVPMP
                     GSYFELYGFDVMLDASLNPFLIEVNTLPSLESSSAFDYATKTNVVADLLNLAMLEPFE
                     RKMAPGSTLWNSSQLREDLHGPLAAKDRGLFHAAETGDVDVVACGNADGAREDVELRM
                     RDELAYARGFHRIFPAKTLSGTSSQRIKMESSASFSGLSAPPTLHQPLDSLAMCPSYL
                     ADLHAYESQGLLSEEDTWALAA"
     gene            complement(<882276..>885287)
                     /locus_tag="LMJF_30_2290"
                     /db_xref="GeneID:5653774"
     mRNA            complement(<882276..>885287)
                     /locus_tag="LMJF_30_2290"
                     /product="ATP-dependent DEAD/H DNA helicase recQ
                     family-like protein"
                     /transcript_id="XM_001684782.1"
                     /db_xref="GeneID:5653774"
     CDS             complement(882276..885287)
                     /locus_tag="LMJF_30_2290"
                     /codon_start=1
                     /product="ATP-dependent DEAD/H DNA helicase recQ
                     family-like protein"
                     /protein_id="XP_001684834.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653774"
                     /db_xref="GOA:Q4Q764"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q764"
                     /translation="MSMNQVGFLHARKCTRRDLLGTSLGNCPASENVLANGASHGIEA
                     TPLPGSRSATSTSFTSPTSAPLAPMAESECDVSYLEQMLMQIMDAAKAFANTSQAPSC
                     DTAPQSADTLPACEYLLRKCFHFDTGAFKPRQQEVCLSVLAGVNTLAVCPTGWGKSLC
                     FQFPMLVHRLLFQCRYTRWCRQAATAPAAAQQSSETAVKEGQTGASRFAGALPSAGLP
                     AHLFSRFCVVVSPLLALMEDQAEKINAVDHLSAFVLSAKVGADREARVLAQLESPVCP
                     LDILFVSPEKLIASVPLRRLLQAQAHRLALVCVDEVHCVSGWAYDFRPTFMYVSRVLQ
                     SPLLGDPAAHPCQERQATCAREALAAVPYLCLTATATKAVMHDIQASFGIVRTVACGD
                     QWRANLRLQVTDLVERHTSFHHLPSASGDDAEAREPSARVTQDALLEAVQQLPKPMIV
                     YVQSRADADALSGLLSTKCGQSHSPSPSAASGTRSGVFHAAHYPLPREQGSPAYDAEG
                     ESTAENPNDGQAEAPHAPEAAMVIRPYHAALTQTMRSATQRQFLQGKIDVLVATIAFG
                     MGVDKVNIRSIIHASAPSSMECYVQEIGRAGRDGAPSICRLLYNPFDFYTLRCRLWGT
                     LLSPSEMHSIVRAILSCSTTHVGQRLMLVSVSALSAELGFTEEIIETVLFLLLTATHV
                     KAPVAEDFSSCASSSPLPAPFKSVFGAYPLSYKVLRVQEEAGKADDSGLSSSASNATL
                     HGRATPLKRRRTGATAALGGSSSPVAGVSLLLRQLGATDAVLELCRVTPNMSNQIEMA
                     NKLSMPLDEFQQRMQDLVESGVVTLAKYGRSSALLLELADSFDEAASPAAQQALASHL
                     LALHRGRLDSQVAGLRRMFSVLQRPTHEAVAAELSREPGWHGTGLDNGPLSWRPPGRG
                     LGKMKAVSLVNAFVEENRLRIHSTYEALRALLGIRPRSLIQHGKYAGQLPLAQSWYVN
                     SPYFGALRTFELSWVLQVLAPHHLDAPTLDA"
     gene            complement(<886260..>890177)
                     /locus_tag="LMJF_30_2300"
                     /db_xref="GeneID:5653775"
     mRNA            complement(<886260..>890177)
                     /locus_tag="LMJF_30_2300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684783.1"
                     /db_xref="GeneID:5653775"
     CDS             complement(886260..890177)
                     /locus_tag="LMJF_30_2300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684835.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653775"
                     /db_xref="UniProtKB/TrEMBL:Q4Q763"
                     /translation="MTDWRAEASRVIKAFDDALGRPPFPVDAPDDLVSKAEAVQATLG
                     TVAAAGKLESLEGVSEVTTTLPILCASLKEGTPNRTPCLRLYRPLLLAAAHASSLSTY
                     PISYLLCDAEQVLAPQEVSSPTSSSVTCTLASASTAASREVDSDDAEVEKEVTLFAFM
                     ALTHTLTPTHMRRFLRLGALEPPTAGTAANGKAGKGQGGALHADDTDTKPHPSSPSTT
                     AAGANRAGEVGGSYSAVSRALLHSMIEAPLSEECRAVFESFVDSTPKFLACVAGDGDL
                     ARRILDVYAGHLVPKLKPSSLLPCLDAPLLDYYVDVVAASQCAGHTTLLSSRELRDVA
                     LHAWDAARLRRLGCAAVSRSIGTEDAMASLLVYVFVYLIYCDFRTDEAPTTPPPSPPD
                     TAETEPRLSATESDLIAAVCKASRAVFLANRAPASCASASLAYTQSESGILLVEGSAV
                     PMALAPLQVFGDRLLARPAAVALWRRGLVPQLEWGTEDATLMMATVSASAALVETNVV
                     SVLEGVLRGVPRPDPGARPSTKREQESAKGGAAKSKRTQKKAAGRSGKGSRIDAASSS
                     STGGQPSAAAAAVPAPIPLSELLSGCCTCLLLTALLRAGTEASRGEGGSSVESVCYQD
                     GHVLDCVVRAYSYLLQYQSQRLSAALWHNFSIFTCFVWQWAMTALCRDTEGGGVTYLP
                     SMRTLLSAPSTVVVLTALTQDTGCILWLSPLLLPSYFSPPSTSNAAAEMLSQVLWDFP
                     CRALWIAIVRAAASGEIVRAGGKTARQAAKTTSSLLKQQLHPIPPAFLLGLLCSQWSD
                     AVVADVAECVAATTVGSGDGTALVASLIRMRTSNACAGEVALPPRCGLAFERAPASAS
                     QHGLQRLLDEVGRLQAKYLAAAKSVRQEAHEENRQRMQEQLQSIHALADAHRAFCNAA
                     EAKRAARTAEQQRVQEELQRRRAAHAARLRDDAAALERKRQVALETLQRKATQSRADA
                     EAARQRRFDSYRRRLESEYRVSTFLEHLQLSSARVMEVREALRTVMDSITPDDLLEYL
                     VSGKAKVPADMLDGDDGVNAADKVEARGANVDQRTASSCQRATERQAPMSAPPRPPAT
                     GERRDFWADVMDGASTDRGTVSRGDEESSYHRISEAAPAPAMTTADVNVAPARHNRSF
                     HARIAPLMDLFCYDDGDEFGRVPHMLPNLCLRMASRVWPAPRVQSLGFTDVRDAFERM
                     RDRGLVRIQDDVSQLTLLGFRYHYPFHDPDGMLEVHLREARERVRALVETQKGWRRDN
                     AADDESSEGDESVVAKEDEANEEDETSGHLREDRLLSDVEFGI"
     gene            complement(<890854..>892248)
                     /locus_tag="LMJF_30_2310"
                     /db_xref="GeneID:5653776"
     mRNA            complement(<890854..>892248)
                     /locus_tag="LMJF_30_2310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684784.1"
                     /db_xref="GeneID:5653776"
     CDS             complement(890854..892248)
                     /locus_tag="LMJF_30_2310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684836.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653776"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4Q762"
                     /translation="MHTKVLAPLAGNRIQAAHKFPQVRLQPTLHRLMTRRRQCNLPLR
                     LFHPSSVDFAKHELEAGRIVEVRRDDNSLVALGFYEPHLERVDVFDMTANLAAMLPAI
                     SEDFFMARVHEAWERRRRILPQTQSNTYRVVNGYADSLPSLFVDVFSESFVRVVATSF
                     GAERLVTPLLDFLSRRGAEDVLLDTPTLGDAARVSIVTPTISLPQMYVESGVSHLWLR
                     PDMRMPSTDNLFLINPAHRRTRRMMRDVGKGKRVLTIYDRSGSAAMNAVMTAKHVTVV
                     HREETSLEWARTNLICNHSASVFKTCETVCCDPAELRVRHQQDVVYVECHPKFLSTSN
                     QWAELVRSLANNKVIGVGTMLIVAQEEAPLGVHDLLPRRKVFYEGDESKANQDCPMKR
                     RPLADVLRNALEKCHLRLKFLRAFSVACDHPLLPEAESASFSLVYLVEGPALEQVFRV
                     SASSHRTECTDEAA"
     gene            complement(<893123..>894187)
                     /locus_tag="LMJF_30_2320"
                     /db_xref="GeneID:5653777"
     mRNA            complement(<893123..>894187)
                     /locus_tag="LMJF_30_2320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684785.1"
                     /db_xref="GeneID:5653777"
     CDS             complement(893123..894187)
                     /locus_tag="LMJF_30_2320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684837.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653777"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:Q4Q761"
                     /translation="MSLLHRLHGARWCALRQQRRQRNGVRGVFAAAALDRGELVLSVP
                     LRYCFITQLDLPHADDRSSSPLLDTVREVRHLRRCNRGVALFPEAWVWLQRFSADASA
                     DRVSLSSAISCEAAPGSIAAAPAVMALTLSPVEAALATCVALRYFYAHALHLSAATRV
                     AHSVGPAPHDLSDRFTANLPFEDYLQWGLESIYSDASSAEAHLCLEQLSSNLRDAIMT
                     HANNMEFRFLDEAPSLFDTVLLTSLYLVRSRVLRMPLLSSTSNKPDSNCSVFGPGLDA
                     LNHCSTSPAAVVVVSAARRSVVVRARRRINRGEEITLDYRLTGSGRGVSRGHPSHNGS
                     LLRGDVICMNDDWAARYLMN"
     gene            complement(<897450..>898472)
                     /locus_tag="LMJF_30_2330"
                     /db_xref="GeneID:5653778"
     mRNA            complement(<897450..>898472)
                     /locus_tag="LMJF_30_2330"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684786.1"
                     /db_xref="GeneID:5653778"
     CDS             complement(897450..898472)
                     /locus_tag="LMJF_30_2330"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684838.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653778"
                     /db_xref="UniProtKB/TrEMBL:Q4Q760"
                     /translation="MPAPAVHTVFGVEDFKIDARFLSHMAFLCSPDKPVETSTLIGSY
                     AMCEICVSETETADIMMYLDTLRSPGQQAYVGKVTSEMRLSAKASRNTAVAEAADAMD
                     AEFARLKSVFFLRVRSFVVINTETNETVGRVVTFPGQISDDYGTNLDEHSEHGANQIK
                     VVRAHSAEELITVYIGHGQGAAMAQLCAVASGSQAIVFDGTTLSELLVRNAVVHKCVM
                     TEPIDKSVERAWHILHYRSEAWAKKQDATVRATVAAARKIDAEEKAANDAKMKGESTG
                     WVTENKDCSAEEWLKKCEWITMSGIIPVVAQCRFARTGRYNAKALSDMITDYTASMQA
                     AEDPYA"
     gene            complement(<899981..>903574)
                     /locus_tag="LMJF_30_2340"
                     /db_xref="GeneID:5653779"
     mRNA            complement(<899981..>903574)
                     /locus_tag="LMJF_30_2340"
                     /product="conserved zinc-finger protein"
                     /transcript_id="XM_001684787.1"
                     /db_xref="GeneID:5653779"
     CDS             complement(899981..903574)
                     /locus_tag="LMJF_30_2340"
                     /codon_start=1
                     /product="conserved zinc-finger protein"
                     /protein_id="XP_001684839.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653779"
                     /db_xref="GOA:Q4Q759"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q4Q759"
                     /translation="MPFRFRLRDPPSDVAFVSLVDGEALYNADGASTRDVKEATIRQM
                     GWHRVELPQDWFLSRHALDTARQLVEAMQCTIQYLRYCCKNEERRAQKATAQLRRCEE
                     GRASAFEELVELRECVAGYKQQLRELRQERQRARSSPSRAPLAREGQASHSRGAVDTV
                     CQLACSFCGNVYPSRHALESHIRKRHKRLEGCAVMAAGSAAVSLKQPKHLKQFEAAPQ
                     APPSAPQTSSGGFFVDHVPTVVQETADRCGDHGLRKEISELRLAVAKLMEQQAALQRG
                     MSPSYVAAAPQQTAGEAVTAGGPVPSLGPLSGTQQCGSRSDEEDTLLRIHRELLRTGA
                     ELQQLQSAVGRESEQHGRSAVDDRGSCNLRTDLPQKQVQQQHRDPLAAPRGTRAALTL
                     NPQNVLHCPSRTEGSDGGEAARRRGSVGESLVVVSPITPPAAARAWTQHALANREDTT
                     AALKQKDVEELPLMASESPCGSLSGPSASLETKPTAGAVGKISPSPSSALGLPFGGSS
                     VVEAAGAAHSHDILTPQSAPYDPPRDFSGITGDRSPNGLGATTRGGDGEQTASREPGT
                     TQLVLPNSASQSYLPWMRPELATAHFGRADPASANRYGSAPIDEATSWTSGCHLLAAE
                     EKVPAQRNLIPTFTRGDATPTLALAAAEVMTSSKSELIPATSAGAPHYRGFLESSEAA
                     FAEEACRRSNGATQGEQVGVGAVHMVSNPHQVARDEERGRTQLPFCEQPLPGTRIAPM
                     PVLNVPGSAPFPGSAAAGAKWPQCSTSPLTDRSTQGSHEAAPGAEVWKGISGGDVRES
                     LTSRPHVPGVRAQHSLAATGQAEHGSTSKMIPVVHLVPAAASESCDSSLQDPQKRKEE
                     PVQGERPSSSAVLLQATRGLDESRQYSAVPQPQLRRSGDEDSSESKASAEDANSYSVE
                     MPPFDSSEQGDADDVPFSVPLDATVGDGRNVNEDGFGHLVMEDVSSDKLVDPTPSAAG
                     DARSTRLPVFGARDDDVEEYASRFMSYNLARPTDGGERTPSEADRPAAESIPADCSYY
                     TYSYSYSDDEEEEEAVGTAQEGIPVELRVDDGDQETHRAFAIHDSAAAGFPESTFHAD
                     LTPVAHAAGARTSGEVAAQREDVAKAGAEKFKKSHQGGKSDARLSAARQGAPSPKHHP
                     AAGGGHGGKPASDELAIVPRRHSSQLSDPAPQQVVKKRKSFLATLFSKKRK"
     gene            complement(<906736..>908349)
                     /gene="SPL"
                     /locus_tag="LMJF_30_2350"
                     /db_xref="GeneID:5653780"
     mRNA            complement(<906736..>908349)
                     /gene="SPL"
                     /locus_tag="LMJF_30_2350"
                     /product="sphingosine 1-phosphate lyase"
                     /transcript_id="XM_001684788.1"
                     /db_xref="GeneID:5653780"
     CDS             complement(906736..908349)
                     /gene="SPL"
                     /locus_tag="LMJF_30_2350"
                     /EC_number="4.1.2.27"
                     /codon_start=1
                     /product="sphingosine 1-phosphate lyase"
                     /protein_id="XP_001684840.1"
                     /db_xref="GeneID:5653780"
                     /db_xref="GOA:Q4Q758"
                     /db_xref="InterPro:IPR002129"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q4Q758"
                     /translation="MTTICQYLNERLKDKSPTQIIVITLSSVVAARIAVNCFRDGRLA
                     KRSYQAAWRGIRTLAAPIIRKEVKKVVSVVKMPSKKGEFKALALPEKSRSEAEVLQLV
                     TQLHHDLDLSYEKGFFSGAVYHGGRSHTAFINDVMAIFQWSNPLHSDIFGATRKMEAE
                     IVSMVLHMYNGHLLPDAGGVVTSGGTESILMALKAYRDWGRMTRGIEHPSVVAPITIH
                     PAFDKGAEYFGIDLIKVPVLVTTGCVDPKEMEKYIRYDTIAVAASAPNFPHGVIDPIE
                     EISEMAYKHNIGMHVDCCLGGFIMPFLEKTGRPAPVVDFRNRGVTSISCDTHKYGYAP
                     KGTSTVMYRSKELRSFQFSCVAEWPGGMYCSPAVSGSKPGNVIAGAWAAMVRMGMEGY
                     VDCCHKIVTTRETMTRELSKLPYIRIIGEPAASVFAFTSNVIDIFRLGDDLKLRGWVL
                     NTLQFPPGLQFSVTLLQTPPAVTARFLSDVKEIGDILFAESEKLIADGKKPVLGESSG
                     TLYGTAQRVPDRTIMQDVLREFLNTYYQG"
     gene            complement(<910681..>912321)
                     /locus_tag="LMJF_30_2360"
                     /db_xref="GeneID:5653781"
     mRNA            complement(<910681..>912321)
                     /locus_tag="LMJF_30_2360"
                     /product="conserved zinc-finger protein"
                     /transcript_id="XM_001684789.1"
                     /db_xref="GeneID:5653781"
     CDS             complement(910681..912321)
                     /locus_tag="LMJF_30_2360"
                     /codon_start=1
                     /product="conserved zinc-finger protein"
                     /protein_id="XP_001684841.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653781"
                     /db_xref="GOA:Q4Q757"
                     /db_xref="InterPro:IPR000315"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR018957"
                     /db_xref="UniProtKB/TrEMBL:Q4Q757"
                     /translation="MPARVITCGICFNVLDHPLTFDCHHSFCTGCVRRQLTENGSNGF
                     QCPLCATSRTEVHLHNLAQYADHETEVYVEVLARGTSNPPKCQWCETTSAKVQCGECM
                     CVYCEDCCIAVHRNSAKRDHAVGKLSESSRNFMPRCPLRGHEEYRAEFFCSQCRQVCC
                     AYCLQVGPHRDHLHVTVAVAAAEARQQLSRDMESLLEVKHRLEQQAAEMNRVSVLYSD
                     TYDAVENMVTERFEAFKQQLMQRELEVRRTLTNLRDSGDAALTASRRQYLDKLNSVNE
                     TLLQFHAIRNGGTDDEVLKRHSQFGKCLNADLPTVTGNGFKVVSLGEMTLTSLDIGLD
                     LQTIEHNHTTSPRLNRSGRLSAGSNMSMNGGGSLSLFAGNTLSTPLRLTFPVDDDVEA
                     TVLAEGVRLRCVASGGGDTQIGVRSKEMFEALLAQFPEDRGVVSWQVRLDSISDTFIG
                     VVEKTSQASQIPEGFYWKAACADVIDGRIGRYTPAVRRLPVCRNGDRIRFLYDGVQRA
                     LRIVVNDSDDRGVVVADLHPRIAACFIFYPGESLTILF"
     gene            complement(<913482..>914021)
                     /locus_tag="LMJF_30_2370"
                     /db_xref="GeneID:5653782"
     mRNA            complement(<913482..>914021)
                     /locus_tag="LMJF_30_2370"
                     /product="ADP-ribosylation factor-like protein"
                     /transcript_id="XM_001684790.1"
                     /db_xref="GeneID:5653782"
     CDS             complement(913482..914021)
                     /locus_tag="LMJF_30_2370"
                     /codon_start=1
                     /product="ADP-ribosylation factor-like protein"
                     /protein_id="XP_001684842.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653782"
                     /db_xref="GOA:Q4Q756"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q756"
                     /translation="MLRGLRNRMKRENEPRVLILGLDNAGKTTILNKLGVAEERSVEA
                     PEGPTQGFNVMNVNRDGKRAKLCDLGGQRALREFWEDYYANTDCIMYVVDSSDQRRLH
                     EAHEAFVDVVKGVPKVPVLVLANKQDLATAKDPQKVAEALELSDYRDRSWHIQGCSAK
                     SGDGLEEGVAWIFEACNVK"
     gene            complement(<915183..>916085)
                     /locus_tag="LMJF_30_2380"
                     /db_xref="GeneID:5653783"
     mRNA            complement(<915183..>916085)
                     /locus_tag="LMJF_30_2380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684791.1"
                     /db_xref="GeneID:5653783"
     CDS             complement(915183..916085)
                     /locus_tag="LMJF_30_2380"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684843.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653783"
                     /db_xref="UniProtKB/TrEMBL:Q4Q755"
                     /translation="MSAHDSSAMALIAHMNDIEQQRRVLSMSQREQEAKIAFTTAEKE
                     QLVQAAKAAEAEEAQLKDDLEVLATEQQQLELQKMEATDRLRRTQAEEALHTAAVEAD
                     LQALAKEKVLWHERAQDLESLRRSWEEDAATSSCIAALRQESEMLAPLKAEKTAVEDA
                     LAETMAAIEKVRAEQQARLTCLGSVGAPADAVQRSGLARALASMHGSALSDGNTATVD
                     DDDTAAALEEEIKRADYEAAQVTARHGRTIAVLQREVDALSTRAGELQQLLSSIGASW
                     QEVLSRTRDLQHCKETGLCRRCLT"
     gene            complement(<916786..>928173)
                     /locus_tag="LMJF_30_2390"
                     /db_xref="GeneID:5653784"
     mRNA            complement(<916786..>928173)
                     /locus_tag="LMJF_30_2390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684792.1"
                     /db_xref="GeneID:5653784"
     CDS             complement(916786..928173)
                     /locus_tag="LMJF_30_2390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684844.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653784"
                     /db_xref="InterPro:IPR000585"
                     /db_xref="UniProtKB/TrEMBL:Q4Q754"
                     /translation="MTSSITPVALPSSALLNPKEAAAFYESVCRSEGVFIQSTFLKQL
                     LLGSVIIQFENGYLGESGVGPIIRTLQCAPLRALLLAKCALSTEDMKIVCAGLAQHPQ
                     LEKIDIRGVPLTICGTKELLHLVTHNTRITEVLMDESLPKYVAIQQQCNRNAETTHQI
                     SECMICGSAVSSEAVTSCETLVTRLLLEYLMPASKSVSVAGLRVLCGAWQECLNRNKG
                     ILAVCAGLCAESLAEDLCHCVSSVTKALVTHKPYNAPNLVFLRTYLTREHMRLQAEAE
                     QAQQPEHGSAPSPSLLVPGPVDAVVEERWRTKRARIDIDAFFQDDNSLCLPRCTVCGC
                     PAECSQDGPTWLLRVLQKDITEHGAVVTPVALVRLWRLFELYADLQPCSRRCVRHLVR
                     YGLYGYGGVNCSYASGYPSLSSAVGGHAALQRLPLVNFSVVDVEREVVEDVCGGELNC
                     ALTVTSALSDEEAAPMDPYLLFAIGRQLRQQPVRAIGMDLASACEAVRLVGCLPVSEA
                     PFKYYGRNNTAEAPPRDLVADWATWSSSSGEAAVQRWLHRAFAHRRQRVCVVDGPHRD
                     LFDNIRAALWTLRRQARSILVTVKFAMAWLSLPNGVIAPDTSAHTHGFYTTAKVIGQS
                     TLHSTVYIILQFPFGIRVGYKGFFYLPKTVFLQIVRGLAFVFLDAVGIEYRSAGRAGH
                     VYGYELVGRPLGDTSPDALALLRRLLMCLTVLGLEQRQAAATVWGAALRSCDVTEMRR
                     LLSHEHLPAPLQFLRSLLEARQVAKATSDLSDCRPGMGRRRQGHATASRTYWERVLLF
                     SRFPSQLLFFFSELIGTRESFDWLQEALRAASAVLTTAKDGGTSDQAALGLNAAQQGA
                     DLMSHPPIATAERQWIMTLPSPSQVVTTVRFPESSLRLDSTPTGVPSRRSPSASQQRR
                     SVRREQMISMAPRHASAKTPKPPSALPLGEKRRKTLRQSSAASSAPKRSLRAKSAESQ
                     ASEEAMSTTNAASTALQTESRPSYSFDTNLLLHQLHRKWAGERATRQKILQAASSVGI
                     LEFLRALHQPRSAVKQLRRGSNSASQTVHADDMHALDASNCGDAPAAIPGRLLGKPWL
                     VLPFPEGTGNSNNTATSSSSPVSDILLLFIGDTVSAYSQRESRLLFGPVTMCDDPLLV
                     DFPFRTGVDAAVAHPTEPHLAFFFSGREWLLFDFYLAECVDGPYAMCSHGQFRRLPSI
                     FHDRLDGVVHIPHTQLLVFFRDYCYVVFDTCTQRCVGGMGFLDPPSRDTVGPNGPPVL
                     AGHTSSSMPPALEDLIQTLQQTSVGSQNAKSAQVRRDKPSDVDSDADDDAARATAGPS
                     GIGTTALPLLLSAQLQGLLRTAPMTAFCVRSADSEKSAEACYVVSRTGAVIPVCWQPL
                     EDVAAAAETQESGASVPSEPQRRWLLNVQEQASPTTETPLRNLPLLFRQFTTAALTGL
                     CKLAVETECAFTQPCTVLAASSPQLCVFDPERQARTSNVSPLAAETPRDADAEGDSVT
                     ANTSSGAPYSPGDSCGKPLSTSASTRITSSLIATGLGERVPLALSRCWSAQESDVEFT
                     GNSTWHDEVLFYGDAEEPQRPRACEISDSLAAEGQSSPPPPEQEVSSGTADVDGAQRV
                     SFIEYDLGASAPPRIFTALLLVLDTSALPSSLLQLSSLVASVESSTDGTMYFSQALVR
                     ITSPVVAARWGSGAGSVASSTARFWRLRFRTPVPACLGVVRLFWMETAPGSFAETQLP
                     APTVLSPCLPLTLTVPPLPREPTASDGDIADAQPSSRGGRAATGDPLIIEAEELFQAS
                     RRLISSDNFHSVFADDPSRSGAGWFVPHAVMPELVSSSLSTCVFVCASSILQLAWAHQ
                     GASIAATHAEAQPMGRRTGFRDIPYPFVLGWDAAFYVAPREHPGRVALLRGDWMLLWD
                     LHEQRPVSDVLLWRTSALLGKLGSLPIATVVAVINCWSSEEGDAVIGIFHVASSLEER
                     EVKYVEFDLETGAVLDLPVLLAACLTNRFRAPPPPPGSTLHTVLCTPCSPSTWYMFWD
                     RSVQRVSRTELMAENGDGGDDGVAAADPLSESRLFYSVPLYLSEWGQPQHHCSVLLDV
                     PQLLKAVQGESGEDLLITGMQLYSAGGRGGEKTCWQVQCSENGGGEWRDVAMHYQAAG
                     GRVCGETLWTPSEACALSKCPYWRLSRVASSQDPYAAFAAIPSSAASETAVAQSYSQL
                     RLLTLPRRRCRQLPTHISGDAATTTVADINSFFSQRAPGAVTLSLQPCASAAATPMGP
                     SSDSVMYELMWDYGSSPVALCSVAFEPRDTSPFTVQRTWTMWHSDTAVGPGICSATTT
                     KLIRGSDTCGRCALSWLPDGPYRYWRLQCEWKTVAGAAYGDCPPSSLTISSFSAHEYD
                     GPLITVYNADGGCLRATPLLWPMADRATTSSYQLQCVANSVILLMNVPLGLTLWETEF
                     FGERGSCTARIAVESTNDARTWSIAAEATISTAMATASRPQLCSLSWPSCGTHVLWRL
                     RVLESSADVTLHLTRVRLGHRPTASHISMFVPQSMTSSLSSAATAAATAGALRRSLPM
                     KTVLEAPVEHAPVSMLRLTRPQRMVRVRATLPSSAARYHVEYLGLDGTSWLFAAVMDS
                     GRADALCSAYSSKRSSAVVASVSWDGTLVSPSTHWRLRPVDETSLDQPQGVEWFEHSS
                     EYAELVDTAEIPGMVVSTTGFTEVQFPSMLSGRAAHRRTTEASTARIAPPMPVLQCAA
                     QSPQSADTVQDSTPTAVTWSFLSPVMFDQVLLFVQSTVDEPVAPTVVETPGEESSASG
                     YVDAEAPPPPPPPPPPPPAPPLPANQPLQQVLVETSNNGQDYVTVAETVLHLCDQTVS
                     LRWVEVPTAAFWRLRFARRVVPPEAVPGKTPLSVDEPLTFTLSLYAARWLIRRGGHAL
                     LAQVAKPTPGHYTNTIYRSWISDAFNREGAFMQSCLYAFEEHMRTVNQRRQTDAISRL
                     GQVAGTVQKMKQMYQTFLQRAAKEAGSYMRLGGEEAAQEADGRSSRAVAPLLPPSIPA
                     EVSEWLSREYLSSDIIHLLVVSSTTTSIGGPHVLHLAELLHHPLAFRQALQFTKRTTS
                     WFYPCLEAVGSLAEDWYGFPASSACASLSVFWSLSTVLQRQLGALLSTPDTITPLDEH
                     VASPLVVVRITESNWVPTHHFPTVAPFLYAVGFHERPFTMAFAINDIVFTPPYAMGVP
                     SARDSQPLVSPYPYKIAAGVNFVQQCPLACCPTPVMDVLRYILPASAFTVDARGNAVV
                     LTTLVLTVGSLRAGSGVGGEECSAVLRFTVSGNGVNFGLAGLVMESIEFEVLMLSADG
                     VCADREAPAGQRFHQMNFVSHGARFVGGAGALAGGLPASQPANDGPTPEMELPLSLMG
                     AVDSDGLPLVSLRGDFGNARFATVAELPGAVVTHLQFTTICHVEGSVPVGDASSTEGG
                     ERDSNVAHWVFAPLEGEGQVLLPGVLCSCNCACTVEITWGESEWPVRLSSFHIAVDRC
                     SVDDLEAIFRACRGDERDLGQELFLSARRDATAYDVGGLRIEVAASLRVLTGRVVDDR
                     VRISLKGMAVLSLENTAIPDATLEMDCEAGFIALTARCVHSLTVGAILVEGCAEKPIL
                     MQLLHPVGVSRSIGERTDQCSAPASALRFLVSGYSRLFSVHHMAQVTLELSQSTERFN
                     SVTLVAASLRHAGLVVTLQDCAVSEVWRFAQMTINERALRGIIERDMSSVPMIAVMQA
                     HQIPLALSITSITPEPYDLVAQRLSCRVKGLLYGASFDVVTSVVAPDDSDDVWSLLGA
                     QCIPAMLEQCEANLWASYANVIGLRETSSGCRPDMDATV"
     gene            complement(<931277..>932098)
                     /locus_tag="LMJF_30_2400"
                     /db_xref="GeneID:5653785"
     mRNA            complement(<931277..>932098)
                     /locus_tag="LMJF_30_2400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684793.1"
                     /db_xref="GeneID:5653785"
     CDS             complement(931277..932098)
                     /locus_tag="LMJF_30_2400"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684845.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653785"
                     /db_xref="UniProtKB/TrEMBL:Q4Q753"
                     /translation="MSGFHQANAGTSSTHYLPKISSNLETVRLTYGAFLRLCLHATVY
                     YGSQGFAAEKVFGNKGAMITSEREAMRYVLSMGAEVGISVLLMPVRYLAASTTPRFML
                     DYMFTRWSDVLALLDRFNPSTYASYAVYAFASSDDEWNFDFFTWQIPSVLMTIGKLIA
                     RRRLVGSARCRTKRVFGVLLSQLFLRAYMSTFSVMIPEQGSEAVVALLVTVLEGMATS
                     YLARHTWPFPWDDVAHTASTNTTSSSTAMVSEGADTPPRDHSRSTEKPGYDAEWK"
     gene            complement(<932852..>934129)
                     /locus_tag="LMJF_30_2410"
                     /db_xref="GeneID:5653786"
     mRNA            complement(<932852..>934129)
                     /locus_tag="LMJF_30_2410"
                     /product="pre-mRNA cleavage complex II Clp1-like protein"
                     /transcript_id="XM_001684794.1"
                     /db_xref="GeneID:5653786"
     CDS             complement(932852..934129)
                     /locus_tag="LMJF_30_2410"
                     /codon_start=1
                     /product="pre-mRNA cleavage complex II Clp1-like protein"
                     /protein_id="XP_001684846.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653786"
                     /db_xref="InterPro:IPR010655"
                     /db_xref="UniProtKB/TrEMBL:Q4Q752"
                     /translation="MQPRKTHTSLHLSQEAVTIQWNAMQEGGSVLLLSGKVELFRSSL
                     TRNLRYAFPAGACIVLEAFGDAVVQIDGDAITLQTLISSALDEIHALLDTARVDAMLA
                     IEERSKKALSSSEELKDSWQGPRVLVVGENQWEREAVSRALLNLAVRHGSPYGICYVD
                     LDVAMPMVGCPGTVSAAFVEEPVTAPEDFGVMMPLTFFHGTASVTSATRKRYLDLCVC
                     AAQAATSLGFANSKFEAGGFLIHSLSPSTEIQHDVLSDVLSIFAVTHVVVTGADRELE
                     KFLYNAVLGRTVHFVRLPKLAGVQSPSSAGAEQRRRAQLERYFFGTPRTPLVPVRGVA
                     RMSELVLLHAETFEPLSWREVPDLGLAAVVWADTAASAAEANVAGFVALLEVGKQFVS
                     FLAPSGGELPKPFLVVSPSLHLPRELVMPLPVT"
     gene            complement(<935059..>935559)
                     /locus_tag="LMJF_30_2420"
                     /db_xref="GeneID:5653787"
     mRNA            complement(<935059..>935559)
                     /locus_tag="LMJF_30_2420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684795.1"
                     /db_xref="GeneID:5653787"
     CDS             complement(935059..935559)
                     /locus_tag="LMJF_30_2420"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684847.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653787"
                     /db_xref="GOA:Q4Q751"
                     /db_xref="InterPro:IPR002833"
                     /db_xref="InterPro:IPR023476"
                     /db_xref="UniProtKB/TrEMBL:Q4Q751"
                     /translation="MDSDSEYEQMEALRLKMVFVVSSRVQPKITAQEVAVLTASAGVQ
                     LVELLQQETKLSAAVSAPSSESLCAADSGDHQRWRHWYLWWNRIGCGKITLKCPDKET
                     MELVVATARKHQLPMAMARRSEMAVTGGAQAKMVAKPSDVVVVALGPAPSDVLEPITG
                     SLKLFS"
     gene            complement(<937038..>940694)
                     /locus_tag="LMJF_30_2430"
                     /db_xref="GeneID:5653788"
     mRNA            complement(<937038..>940694)
                     /locus_tag="LMJF_30_2430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684796.1"
                     /db_xref="GeneID:5653788"
     CDS             complement(937038..940694)
                     /locus_tag="LMJF_30_2430"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684848.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653788"
                     /db_xref="UniProtKB/TrEMBL:Q4Q750"
                     /translation="MFKSSLATHSSIDHDLFPLLTVRSCVSEADESKNGPRFCAEDKM
                     TGGAYEIRSRKLDLEAEQLVDGAGCRDTHRNLSPNDLRTIRRQQERIDALLTATAHCA
                     VPPCVALPIDVYIQEQPSTAYTYVASVDAFSGLSLGDIIRSGWGMMEESVFLEILNAV
                     EAFGYASARLPPHGNLSSDAIKQLLIVRDGASEARQPSRWVVSDWLLLSDDSVTSFDP
                     QAFVADLEWVLHSSFAQLHISTTTAQGSTLMPAARVEELVGETVDRIRAHLLRQGAEA
                     HHITSSDGLTQLSDGGLQTDTKAFHAHLDASSSGVTDVDGASAKQTSASNEDGVPTFF
                     DSAHGNTANWASAATGSAREFQATAQPSSPPRSFPDPSAATASTAAASSLNTLPATSL
                     TNESQGSRGAADKCDSEKEAFRVARQMSLKDKVAYHQAALRSEQLLVNRHRRKNAPLP
                     PRPQPVSAHIHNARPILSPSASEEDEEFFYDPPAVTSPIDVKPSAYLMQGHRSSPNGR
                     GAGSARKLQSPRSARTLNGEARTPCERSRSATTPPPSQQSRATLHASASCDQLRERLL
                     DDVVSIAVLNQRRRAEDHLLQQEAERRRREERQQVLSLSTPPRSVAGERLSTPNLLDN
                     RGASISYPTAPSSPSVEAKAAKAADNHRRACRRGTVPCGSAANVSHGGSASPSGYCLV
                     LMASPHDAAMNRFDDASKSPEPTPPSPRWSRIVRPTFCQRKPAGKAAAGTRVAPPRAS
                     ARGAATTAVASRLPQTAGKTMVPSQTFLYGVRTGTAATIVRSDTAKMSVNARAAAAMG
                     GVATEAIPGNGSNLSRQLAASAMPRSGRSTTAAGNRAAWIVGQQQRSARARAAAPLVQ
                     RNTRASTASPLSSPRQKTAQQSAAAPFVKPLTFASVLGRLASPRKAPAVGGASSPPPA
                     SRVALGQLVPARRAAATSSGSFSYFSNGSTRKSITDAKFQALRCPSTARPPPTQLRLA
                     ASPRVYQRMSSTGVLRSPRNGVPVTPLRRSSAETPTTALQLSSSIGEVSRSVLQKPAE
                     LEAPTPIALRTTQPRLPVAADSASAKGRASVSPKPLRRLLLQKDSPGLSARHAVTLDT
                     QNTDLPPTSATEDSLTSPRTPPPPPPPPLAFTNGAAATGAVRRFTCADPPAQSGVAEV
                     ENRAPRGRNVGGPSLSPGSRPMAASALATQREKKGKAHAALPCAEPLTLGSVRPVKKA
                     SPGIPLLRHRSSTM"
     gene            complement(<944900..>947233)
                     /locus_tag="LMJF_30_2440"
                     /db_xref="GeneID:5653789"
     mRNA            complement(<944900..>947233)
                     /locus_tag="LMJF_30_2440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684797.1"
                     /db_xref="GeneID:5653789"
     CDS             complement(944900..947233)
                     /locus_tag="LMJF_30_2440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684849.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653789"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="UniProtKB/TrEMBL:Q4Q749"
                     /translation="MWGTFNGAEAKLPLCDDDDHEASSSGEDDVLFVPDPVFDLTSLQ
                     QRAAMPCLTQDQLPLGVTVWVMDEDDVATQLTCNFSASYPPVCNGRLSGEVVRHTGHM
                     TLVRFRSKASDLYFTLCLPTSCLSLQRIEPYDSVPHHDDSYGLGSGAYGMLGPRAACR
                     GGTETCGNDGFVGHCLFEAMPAYDFEKLRGTTLEKAQAAFFGGVFEKALASVNEYIDA
                     QPTSPTASASTDTDASAILATSGDAPPKAAALVDALILRSRIFVFLERYHEALVDAQR
                     CVQLEPRWVRGYLSVARAHCGLGQFSEAATATAHACIILPYSLELERIRELNNHMYYL
                     QSQLRAEKASCYLVLDCYYRKRLCVNASVAAETLLCTEATPIVATHSVFVAKDPPHRC
                     PVCFRVFTTAEQPGSVAGDPSPAALTPEPASTPPINDISPPLSSPGGTDMDDDVEYCS
                     TECTQRASLYRPLELKHRAPLAQVRSLILSKGAVTLDVLPLEMAAMAVRLFLMVVTIH
                     RRLSAKRRIEDSSRRNLDGEAPCSCHDKMRTWPDVDAHVSSALASSQCSSPSPPLRVE
                     TSLRRLGVYPLCTEPIAHNKLDELKILYDALTADFKAEDRAIFSYEVLSQLYAYVSAY
                     FTPVDLNSFQPPDSPGGTASHQTVFYLPHYVGCIETAKVISYTAASRRRRLNEESAHS
                     EDDLLASRVTERPTMSEMAMSSSRQSSSTHSHASSTSTATGDAKDLAVASSSDANCIV
                     RMAPPPALLELVTVAPVNRERKLRCVPVTIALDLDVA"
     gene            complement(<950570..>951580)
                     /locus_tag="LMJF_30_2450"
                     /db_xref="GeneID:5653790"
     mRNA            complement(<950570..>951580)
                     /locus_tag="LMJF_30_2450"
                     /product="DnaJ domain protein-like protein"
                     /transcript_id="XM_001684798.1"
                     /db_xref="GeneID:5653790"
     CDS             complement(950570..951580)
                     /locus_tag="LMJF_30_2450"
                     /codon_start=1
                     /product="DnaJ domain protein-like protein"
                     /protein_id="XP_001684850.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653790"
                     /db_xref="GOA:Q4Q748"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR027137"
                     /db_xref="UniProtKB/TrEMBL:Q4Q748"
                     /translation="MLSLVHSRRLLPQRDPFKILGLTRAATKAEVKMKYRELARIYHP
                     DAGSGDSAKMEEVNHAYKLLLKEGGYERLHLPGPSRARAHGACGRVGVTSESRRQPLR
                     ETAAAPFTVDQQSSGTTGSSSGASAVPAWSLLTDEEVEKVSALDPATERRTPEGKYLY
                     QSRDDQSWVELDRPLLRAQQPHYASFSAQADMKAELRRRALLKEKEQNEKSRFQRTAD
                     RLADSAELPTRNPHLLRIYALVVVCVFYLMYKRTFERTHHQRKRAQFYQALEENREDL
                     MATYEKHKEGLQVTAVAAALVFLAAAEHKMAGDPVVPSPPEVFYRSVKPPSDHYTVVA
                     GG"
     gene            complement(<952317..>954224)
                     /locus_tag="LMJF_30_2460"
                     /db_xref="GeneID:5653791"
     mRNA            complement(<952317..>954224)
                     /locus_tag="LMJF_30_2460"
                     /product="putative heat shock 70-related protein
                     1,mitochondrial precursor"
                     /transcript_id="XM_001684799.1"
                     /db_xref="GeneID:5653791"
     CDS             complement(952317..954224)
                     /locus_tag="LMJF_30_2460"
                     /codon_start=1
                     /product="putative heat shock 70-related protein
                     1,mitochondrial precursor"
                     /protein_id="XP_001684851.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653791"
                     /db_xref="GOA:Q4Q747"
                     /db_xref="InterPro:IPR012725"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:Q4Q747"
                     /translation="MFARRVCGSAAASAACLARHESQKVQGDVIGVDLGTTYSCVATM
                     DGDKARVLENSEGFRTTPSVVAFKGSEKLVGLAAKRQAITNPQSTFYAVKRLIGRRFE
                     DEHIQKDIKNVPYKIVRAGNGDAWVQDGNGKQYSPSQIGAFVLEKMKETAENFLGHKV
                     SNAVVTCPAYFNDAQRQATKDAGTIAGLNVIRVVNEPTAAALAYGMDKTKDSLIAVYD
                     LGGGTFDISVLEIAGGVFEVKATNGDTHLGGEDFDLALSDYILEEFRKTSGIDLSKER
                     MALQRVREAAEKAKCELSSAMETEVNLPFITANADGAQHIQMHISRSKFEGITQRLIE
                     RSIAPCKQCMKDAGVELKEINDVVLVGGMTRMPKVVEEVKKFFQKDPFRGVNPDEAVA
                     LGAATLGGVLRGKASDLILVDVTPLSLGTSVVGDVFTRMIPKNTTIPCMRSHIFTTVD
                     DGQTAIKFKVFQGEREIASENQIRGEFDLSGIPPAPRGVPQIEVTFDIDANGICHVTA
                     KDKATGKTQNITITANGGLSKEQIEQMIRDSEQHAEADRVKRELVEVRNNAETQLTTA
                     ERQLGEWKYVSDAEKENVKTLVAELRKAMENPNVAKDDLAAATDKLQKAVMECGRTEY
                     QQAAAANSGQC"
     gene            complement(<955837..>957825)
                     /locus_tag="LMJF_30_2470"
                     /db_xref="GeneID:5653792"
     mRNA            complement(<955837..>957825)
                     /locus_tag="LMJF_30_2470"
                     /product="putative heat shock 70-related protein
                     1,mitochondrial precursor"
                     /transcript_id="XM_001684800.1"
                     /db_xref="GeneID:5653792"
     CDS             complement(955837..957825)
                     /locus_tag="LMJF_30_2470"
                     /codon_start=1
                     /product="putative heat shock 70-related protein
                     1,mitochondrial precursor"
                     /protein_id="XP_001684852.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2470"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653792"
                     /db_xref="GOA:Q4Q745"
                     /db_xref="InterPro:IPR012725"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:Q4Q745"
                     /translation="MFARRVCGSAAASAACLARHESQKVQGDVIGVDLGTTYSCVATM
                     DGDKARVLENSEGFRTTPSVVAFKGSEKLVGLAAKRQAITNPQSTFYAVKRLIGRRFE
                     DEHIQKDIKNVPYKIVRAGNGDAWVQDGNGKQYSPSQIGAFVLEKMKETAENFLGHKV
                     SNAVVTCPAYFNDAQRQATKDAGTIAGLNVIRVVNEPTAAALAYGMDKTKDSLIAVYD
                     LGGGTFDISVLEIAGGVFEVKATNGDTHLGGEDFDLALSDYILEEFRKTSGIDLSKER
                     MALQRVREAAEKAKCELSSAMETEVNLPFITANADGAQHIQMHISRSKFEGITQRLIE
                     RSIAPCKQCMKDAGVELKEINDVVLVGGMTRMPKVVEEVKKFFQKDPFRGVNPDEAVA
                     LGAATLGGVLRGDVKGLVLLDVTPLSLGIETLGGVFTRMIPKNTTIPTKKSQTFSTAA
                     DNQTQVGIKVFQGEREMAADNQMMGQFDLVGIPPAPRGVPQVEVTFDIDANGICHVTA
                     KDKATGKTQNITITANGGLSKEQIEQMIRDSEQHAEADRVKRELVEVRNNAETQLTTA
                     ERQLGEWKYVSDAEKENVKTLVAELRKAMENPNVAKDDLAAATDKLQKAVMECGRTEY
                     QQAAAANSGSTSNSGEQQQQQSQGEQQQQQQQNSEEKK"
     gene            complement(<959440..>961428)
                     /locus_tag="LMJF_30_2480"
                     /db_xref="GeneID:5653793"
     mRNA            complement(<959440..>961428)
                     /locus_tag="LMJF_30_2480"
                     /product="putative heat shock 70-related protein
                     1,mitochondrial precursor"
                     /transcript_id="XM_001684801.1"
                     /db_xref="GeneID:5653793"
     CDS             complement(959440..961428)
                     /locus_tag="LMJF_30_2480"
                     /codon_start=1
                     /product="putative heat shock 70-related protein
                     1,mitochondrial precursor"
                     /protein_id="XP_001684853.1"
                     /db_xref="GeneID:5653793"
                     /db_xref="GOA:Q4Q745"
                     /db_xref="InterPro:IPR012725"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:Q4Q745"
                     /translation="MFARRVCGSAAASAACLARHESQKVQGDVIGVDLGTTYSCVATM
                     DGDKARVLENSEGFRTTPSVVAFKGSEKLVGLAAKRQAITNPQSTFYAVKRLIGRRFE
                     DEHIQKDIKNVPYKIVRAGNGDAWVQDGNGKQYSPSQIGAFVLEKMKETAENFLGHKV
                     SNAVVTCPAYFNDAQRQATKDAGTIAGLNVIRVVNEPTAAALAYGMDKTKDSLIAVYD
                     LGGGTFDISVLEIAGGVFEVKATNGDTHLGGEDFDLALSDYILEEFRKTSGIDLSKER
                     MALQRVREAAEKAKCELSSAMETEVNLPFITANADGAQHIQMHISRSKFEGITQRLIE
                     RSIAPCKQCMKDAGVELKEINDVVLVGGMTRMPKVVEEVKKFFQKDPFRGVNPDEAVA
                     LGAATLGGVLRGDVKGLVLLDVTPLSLGIETLGGVFTRMIPKNTTIPTKKSQTFSTAA
                     DNQTQVGIKVFQGEREMAADNQMMGQFDLVGIPPAPRGVPQVEVTFDIDANGICHVTA
                     KDKATGKTQNITITANGGLSKEQIEQMIRDSEQHAEADRVKRELVEVRNNAETQLTTA
                     ERQLGEWKYVSDAEKENVKTLVAELRKAMENPNVAKDDLAAATDKLQKAVMECGRTEY
                     QQAAAANSGSTSNSGEQQQQQSQGEQQQQQQQNSEEKK"
     gene            complement(<965777..>967759)
                     /locus_tag="LMJF_30_2490"
                     /db_xref="GeneID:5653794"
     mRNA            complement(<965777..>967759)
                     /locus_tag="LMJF_30_2490"
                     /product="putative heat shock 70-related protein
                     1,mitochondrial precursor"
                     /transcript_id="XM_001684802.1"
                     /db_xref="GeneID:5653794"
     CDS             complement(965777..967759)
                     /locus_tag="LMJF_30_2490"
                     /codon_start=1
                     /product="putative heat shock 70-related protein
                     1,mitochondrial precursor"
                     /protein_id="XP_001684854.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653794"
                     /db_xref="GOA:Q4Q744"
                     /db_xref="InterPro:IPR012725"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:Q4Q744"
                     /translation="MFARRVCGSAAASAACLARHESQKVQGDVIGVDLGTTYSCVATM
                     DGDKARVLENSEGFRTTPSVVAFKGSEKLVGLAAKRQAITNPQSTFYAVKRLIGRRFE
                     DEHIQKDIKNVPYKIVRAGNGDAWVQDGNGKQYSPSQIGAFVLEKMKETAENFLGHKV
                     SNAVVTCPAYFNDAQRQATKDAGTIAGLNVIRVVNEPTAAALAYGMDKTKDSLIAVYD
                     LGGGTFDISVLEIAGGVFEVKATNGDTHLGGEDFDLALSDYILEEFRKTSGIDLSKER
                     MALQRVREAAEKAKCELSSAMETEVNLPFITANADGAQHIQMHISRSKFEGITQRLIE
                     RSIAPCKQCMKDAGVELKEINDVVLVGGMTRMPKVVEEVKKFFQKDPFRGVNPDEAVA
                     LGAATLGGVLRGDVKGLVLLDVTPLSLGIETLGGVFTRMIPKNTTIPTKKSQTFSTAA
                     DNQTQVGIKVFQGEREMAADNQMMGQFDLVGIPPAPRGVPQVEVTFDIDANGICHVTA
                     KDKATGKTQNITITANGGLSKEQIEQMIRDSEQHAEADRVKRELVEVRNNAETQLTTA
                     ERQLGEWKYVSDAEKENVKTLVAELRKAMENPNVAKDDLAAATDKLQKAVMECGRTEY
                     QQAAAANSGSTSNSGEQQQQQSQGEQQQQQNSEEKK"
     gene            complement(969305..970334)
                     /locus_tag="LMJF_30_2500"
                     /pseudo
                     /db_xref="GeneID:12981364"
     misc_feature    complement(969305..970334)
                     /locus_tag="LMJF_30_2500"
                     /pseudo
                     /db_xref="GeneID:12981364"
     gene            complement(<971624..>972673)
                     /locus_tag="LMJF_30_2520"
                     /db_xref="GeneID:5653796"
     mRNA            complement(<971624..>972673)
                     /locus_tag="LMJF_30_2520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684803.1"
                     /db_xref="GeneID:5653796"
     CDS             complement(971624..972673)
                     /locus_tag="LMJF_30_2520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684855.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653796"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4Q743"
                     /translation="MGSTYEPPTKTACRLEVVGTVSSMCYDCATSSSLVTTILNGMHV
                     FNLDERFYGANLAAGLSASNVESYPYHTIGEEPLMSSCFFNAGQLFAVGSSCGSVTVV
                     SRRSRALTSCYATPDSFPIRSLSEIPAQPNCLLTCTEQGAAIVDVERSQLRMSLANPA
                     AGRAVAAVPLQLHTFVVANYDGKVLLYDTRYRSSPSSVLSLPDQITCLAVSRDTPEVC
                     VGTVGGRVFTLRCAEGPQREQAFGMSNRRSPVRCVAMDNGRIAAGDLAGRLALIDTAD
                     VPDPTVYWSAETLLRLPRPSGRAGTLDVPAGTAGASAAFSGTEVTAVALAQGTAWMSF
                     CSPKNATSQVVAVPA"
     gene            complement(<973189..>973797)
                     /locus_tag="LMJF_30_2530"
                     /db_xref="GeneID:5653797"
     mRNA            complement(<973189..>973797)
                     /locus_tag="LMJF_30_2530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684804.1"
                     /db_xref="GeneID:5653797"
     CDS             complement(973189..973797)
                     /locus_tag="LMJF_30_2530"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684856.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653797"
                     /db_xref="UniProtKB/TrEMBL:Q4Q742"
                     /translation="MSYIPYPSAVSRYTTTQSSGVTRGDAFGEYATYRRVIRTVLCGI
                     LFAIPLCAAAPMSPLLKLSQTQENKKSIIPRMMSDFFYVNFLASTAAYWVLVEPFISN
                     PRAKEGFMPYLGPVTAEVPAVSCLFASHLFYPGLWAIVNEPTWKLRRHEFVRLNVKCF
                     VAFGPVHVPAAVGVGAAVGVALYPFKYMKLRAQRRDERQHAS"
     gene            complement(<974605..>977028)
                     /locus_tag="LMJF_30_2540"
                     /db_xref="GeneID:5653798"
     mRNA            complement(<974605..>977028)
                     /locus_tag="LMJF_30_2540"
                     /product="AAA family ATPase-like protein"
                     /transcript_id="XM_001684805.1"
                     /db_xref="GeneID:5653798"
     CDS             complement(974605..977028)
                     /locus_tag="LMJF_30_2540"
                     /codon_start=1
                     /product="AAA family ATPase-like protein"
                     /protein_id="XP_001684857.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653798"
                     /db_xref="GOA:Q4Q741"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q741"
                     /translation="MKSLPAASPETGSPKSEGKQRMSPILAAALSSVPHGDSNVPAGK
                     GRDVAPIMLAMGVDGALGPSECLLATRVMHRLGLQSGHVVHLCTSYGDVYAGVRPMRG
                     SAVAPDKIFVNDDAAAVLVDVSSVAICPVLLPLNGMPTLRSVTLAMVVPENARDADMA
                     DAIVPSIASTVEWQALFRRTLHHKIGYVHLRITQRVLTHRIALEVVDLSVACGEGKRS
                     TPAAEPAAAWGMVTDSTEVRLCSSGSAAETSSGAPPCASTPIADVTAEKHQDSGASSF
                     GCLCTLVVGDAGVGKSRWLARHASTAPQAEQQGRMDGPTSSAAATGPTRYIEWIHVDQ
                     LPQGEGSEVSTATVLHEVFERARQSAPATVVMDDLHLICAREASSAGSRWAMSLIAHA
                     VAAELLDLQSRCLDVRVVASAPTLASLDACLTGATLFGGSVVSLEMPSGAQERLVCLR
                     TCLSELRRGGAAAGPGVSEDCLLEVAERAHGFTQRDLHRLVETSVVRAFQARQSTEPT
                     EADLRAASAAVHPSSLKRFEVSIPSVTWADIGGSAEAKQTLCDVVDWCLGKHSWVFTE
                     FNLTPPKGVLLYGPPGCSKTMLAKALANESHMNFISVKGPEVFSKWVGDSEKAVRDIF
                     ERARAASPCVVFIDELDGMCGHRGRGGVSDRVISQFLTELDGLPAAFEEKKNALVFVA
                     ATNRPDNVDGAVLRPGRIDRRVYVGLPTLPERCAITDIQFQHLPVVADLTASYVAERT
                     DGYTGAEVVAVVKEAAFHAITANAHASHVTVADVDAALQKVRPRINAADVEWYKHWPH
                     NKKISTAHM"
     gene            complement(<979560..>981518)
                     /locus_tag="LMJF_30_2550"
                     /db_xref="GeneID:5653799"
     mRNA            complement(<979560..>981518)
                     /locus_tag="LMJF_30_2550"
                     /product="putative heat shock 70-related protein
                     1,mitochondrial precursor"
                     /transcript_id="XM_001684806.1"
                     /db_xref="GeneID:5653799"
     CDS             complement(979560..981518)
                     /locus_tag="LMJF_30_2550"
                     /codon_start=1
                     /product="putative heat shock 70-related protein
                     1,mitochondrial precursor"
                     /protein_id="XP_001684858.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653799"
                     /db_xref="GOA:Q4Q740"
                     /db_xref="InterPro:IPR012725"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:Q4Q740"
                     /translation="MFARRVCGSAAASAACLARHESQKVQGDVIGVDLGTTYSCVATM
                     DGDKARVLENSEGFRTTPSVVAFKGSEKLVGLAAKRQAITNPQSTFYAVKRLIGRRFE
                     DEHIQKDIKNVPYKIVRAGNGDAWVQDGNGKQYSPSQIGAFVLEKMKETAENFLGHKV
                     SNAVVTCPAYFNDAQRQATKDAGTIAGLNVIRVVNEPTAAALAYGMDKTKDSLIAVYD
                     LGGGTFDISVLEIAGGVFEVKATNGDTHLGGEDFDLALSDYILEEFRKTSGIDLSKER
                     MALQRVREAAEKAKCELSSAMETEVNLPFITANADGAQHIQMHISRSKFEGITQRLID
                     RSIAPCKQCMKDAGVELKEINDVVLVGGMTRMPKVVEEVKKFFQKDPFRGVNPDEAVA
                     LGAATLGGVLRGDVKGLVLLDVTPLSLGIETLGGVFTRMIPKNTTIPTKKSQTFSTAA
                     DNQTQVGIKVFQGEREMAADNQMMGQFDLVGIPPAPRGVPQVEVTFDIDANGICHVTA
                     KDKATGKTQNITITANGGLSKEQIEQMIRDSEQHAEADRVKRELVEVRNNAETQLTTA
                     ERQLGEWKYVSDAEKENVKTLVAELRKAMENPNVAKDDLAAATDKLQKAVMECGRTEY
                     QQAAAANSGSTSNSGEQQQQQSQGEETK"
     gene            complement(<985970..>989200)
                     /locus_tag="LMJF_30_2560"
                     /db_xref="GeneID:5653800"
     mRNA            complement(<985970..>989200)
                     /locus_tag="LMJF_30_2560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684807.1"
                     /db_xref="GeneID:5653800"
     CDS             complement(985970..989200)
                     /locus_tag="LMJF_30_2560"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684859.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653800"
                     /db_xref="UniProtKB/TrEMBL:Q4Q739"
                     /translation="MRGGDDVRSGTVPVCGLQYTTSPSLPSAVKLTGDIMMKTSSTFQ
                     CVAGATGSSAMGSVSTRAAPARAIPFPQGTLQLYDSYYRSCRGTEPAVLETSGGGGRA
                     EWTDSLTLPDDLSGIGPSARRLLRLDAAQQHPRTNKNGSTKASRAPVILPVASRILPA
                     QACKSKAAATTPATAALSATAHLPVPARKCMGDTDNGVHASTATSRHLSLTTDVRPTM
                     LPCNITNPVHGGGGCGTTVSAAAAPPPLVTRLQSYIKRELVLNSGGTAIPSAMDQLNP
                     YREAFRALGSAFPAYGSLFDDIQCAYDNVIQAQAELLTDAYSTAAARHVEKMTQQENA
                     AALHQQVSALQEELSKMETALKSRAPAEEQERQQATMQSSRTCRTNDTLELQRELKAA
                     NQRVSELEHASQIDLEKILVLIGAVRECDRRLKEYERLVTSVMGQVSELDEFKCIAGE
                     AQAELQQFRKKYSEYVPASDFCLMRAHLTSELQAAQLMTRRWRRTAVVRGTQLDVMQC
                     RLNALEEDREALVKAATAAAAQPADVEAHDSDTDTVLTPRPSWKRIYERYPELSGYAA
                     DVGRLTTELDGDAADIDLFADEERSPAKRTSTSSTLAQDMPAVKGPKETRLQVEYLVQ
                     RIVALEGLLRTQWQQQQQQLQRNSTTGLAEGGDASTDAARTNSEKSLQEASLATKDKP
                     ADSSAPLQPRNSRHPHGLGDAPHSAVSGAIVGAPVPRMAPPLELPLLGLGYAPWVPLC
                     WRASGILCRRSVAPSTSMALIYHFFLDVLPTYLDQEDKAQQALEQDGATAQSSTDRLA
                     PFLYELLQSEMQTREDLNAYDSVAHLMMNLERDGQMREWHSDALHLFLLIAHGVMPPR
                     IGVDAVVVVAQVKRDVRALAKELQSSRLRRQALAECLQPVLELKTAAELAELRAALGG
                     ETTFSAEALCSDTHPFMQVLLVQECRASMELYVSFLRALTARACCMTAAGDRVASAAS
                     AGAPLKGVRDPKAPPAPKLAEGDRVLSLADVSAAVLEVEPCTPEVVLRELSVNAVMGA
                     VPVPAPVPGAFEEPPVVVRLSDMVRAIGTAPLIRRTVQSAKNDCVL"
     gene            complement(<998427..>999656)
                     /locus_tag="LMJF_30_2570"
                     /db_xref="GeneID:5653801"
     mRNA            complement(<998427..>999656)
                     /locus_tag="LMJF_30_2570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684808.1"
                     /db_xref="GeneID:5653801"
     CDS             complement(998427..999656)
                     /locus_tag="LMJF_30_2570"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684860.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653801"
                     /db_xref="GOA:Q4Q738"
                     /db_xref="InterPro:IPR002108"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:Q4Q738"
                     /translation="MPKVVCVWRGSDEIDHAIEHLDEAKVQLLYSKFPVGSGTFKRNK
                     FIYVQYIGPKCSIVKRGQGINEITNFTTNNIRGVPGFSTTDKASLSFESLVRHMRDTF
                     VMDSGNFSMEQIREEYRERLAAEQMMMHQERELAAVVAATAKRGRRNTTPSVRLAPKP
                     APPPTPKAERPSSPVEVSVQTNRVMTSLRQDNGSVNWVVFESNSEVLTVRAYGQHGIF
                     EMVKNLPDEEWLFGLFRISFSNGEVHQRRMIFFQWIGSSLKAMRGGSHTGVYPAMAKA
                     LSPFDYEIYLVGRQDLNPQAIIAKSKSAFRTPADRRIGVTQDFMIDSTVFTEENYRQS
                     LVEEQATAEVFEERPKKTHRLTMPIIPDGIEQSLASVATTSAADSPTALSFSVEETID
                     LVQAKEGGLVWAIFEVL"
     gene            complement(<1005675..>1006268)
                     /gene="PAPLE22"
                     /locus_tag="LMJF_30_2580"
                     /db_xref="GeneID:5653802"
     mRNA            complement(<1005675..>1006268)
                     /gene="PAPLE22"
                     /locus_tag="LMJF_30_2580"
                     /product="reticulon domain protein, 22 kDa potentially
                     aggravating protein (paple22)"
                     /transcript_id="XM_001684809.1"
                     /db_xref="GeneID:5653802"
     CDS             complement(1005675..1006268)
                     /gene="PAPLE22"
                     /locus_tag="LMJF_30_2580"
                     /codon_start=1
                     /product="reticulon domain protein, 22 kDa potentially
                     aggravating protein (paple22)"
                     /protein_id="XP_001684861.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653802"
                     /db_xref="GOA:Q4Q737"
                     /db_xref="InterPro:IPR003388"
                     /db_xref="UniProtKB/TrEMBL:Q4Q737"
                     /translation="MSAIAKEFKGLTTKDIVTWHRPIASAIIFSSFFTIWAIFVFAEY
                     TLTTFLSRIVSILLIAGAAAAVTKRTIVTLPKDVTASMDRAYESVRPCVTKLVDSTIS
                     LFTWRDYAASAKFFMTTLVMAFLGNWMSDTTLMLVILIVAFTAPVAYEKKQNEIERAV
                     QQVRAYADKYLGMIKTHAESKKSSVEQQLQDMERKAQ"
     gene            complement(<1007308..>1008789)
                     /locus_tag="LMJF_30_2590"
                     /db_xref="GeneID:5653803"
     mRNA            complement(<1007308..>1008789)
                     /locus_tag="LMJF_30_2590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684810.1"
                     /db_xref="GeneID:5653803"
     CDS             complement(1007308..1008789)
                     /locus_tag="LMJF_30_2590"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684862.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653803"
                     /db_xref="UniProtKB/TrEMBL:Q4Q736"
                     /translation="MRPHTPAKVATTASDGATTTKTTSHPVLLGCGLNWASFVASHPF
                     EVKELTSVLVGDGSDDDGVPEERDALVQAQLPVASVVTSGATLERVFTEAMVCASARA
                     EVARKVQHIATVWCLHPSSEYVATLCWPMEGGESASTTTAVLKVQTEGGRAPLDLRAV
                     SLHVVDRGSLVFHPEFTRCILAQGAERFMYYVPPNPLEATTALPFMRGLWYNGLFSLL
                     ELLRIGPQHVVMLFVLPNGDTRYTLDLAPESPAVPAPSSTHQQGSGALGSAASRNATA
                     SLYPWRRQSKVRRVIRSGAYVVVVRDDTAGVVESLQRACSYHGQNKRSTWLNDIFIHL
                     MGQCSRRDILCSADAAASQPAEADKANDVRLLCIELVEKATGEVMAGCCGMAVGCAYH
                     DYTMYTLRQTKDGLGTFLTKLIGEALQRCGYTLWYWGFCVEYMRHFERHFGAVDMPRD
                     VFYRRWSAARDAAPECSIDAYLRSHKGMVPYYEGTSALVKSKP"
     gene            complement(<1011341..>1013209)
                     /gene="FTHS"
                     /locus_tag="LMJF_30_2600"
                     /db_xref="GeneID:5653804"
     mRNA            complement(<1011341..>1013209)
                     /gene="FTHS"
                     /locus_tag="LMJF_30_2600"
                     /product="formate--tetrahydrofolate ligase"
                     /transcript_id="XM_001684811.1"
                     /db_xref="GeneID:5653804"
     CDS             complement(1011341..1013209)
                     /gene="FTHS"
                     /locus_tag="LMJF_30_2600"
                     /EC_number="1.5.1.5"
                     /EC_number="3.5.4.9"
                     /EC_number="6.3.4.3"
                     /codon_start=1
                     /product="formate--tetrahydrofolate ligase"
                     /protein_id="XP_001684863.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653804"
                     /db_xref="GOA:Q4Q735"
                     /db_xref="InterPro:IPR000559"
                     /db_xref="InterPro:IPR020628"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q735"
                     /translation="MATRKLHCVWPVPADIDIAQSVDAQPITSIAEAAGILLSELSPY
                     GSTRAKVKLSVLKRLEGCPNGKYVVVAGMNPTPLGEGKSTTTIGLAQALGAHLHRRCF
                     ACIRQPSQGPTFGIKGGAAGGGYSQVIPMEDFNLHGTGDIHAITAANNLLAAALDTRI
                     FHERTQDDAALYRRLTDELKTFTPIMQKRLDKLGIRKTDPKSLTEEERVCFARLDVDP
                     GTISWRRVTDVNDRFLRDIEIGMGKAEKGISRRTGFDISVASEVMAILALVDDLADMR
                     QRLGAIQVAKSKTGASVTAEDVGCAGAMAVLMKDAVEPTLMQTLEGTPVLVHAGPFGN
                     IAHGNSSVVADRIALKLAGADGFVLTEAGFGADMGCEKFFNIKCRTSGLKPDAAVLVA
                     TVRALKYHGGVEPKDAAKENADALRAGLSNLVRHIQNIRKFGVPVVVALNRFSTDTEA
                     ELALVKELATQEGDAADVVVTDHWSKGGAGAVGLAQALIRVTETAPSNFQLLYPSNAS
                     LKEKIETVCREIYGAAGVEYLNDTEEKLADFEKMGYGDFPVCMAKTQYSFSHNPELRG
                     APTGFTVPIRDVRVNCGAKFVFPLLGDISTMPGLPTRPAYYNIDIDCETGRIVGLS"
     gene            complement(<1014695..>1015345)
                     /locus_tag="LMJF_30_2610"
                     /db_xref="GeneID:5653805"
     mRNA            complement(<1014695..>1015345)
                     /locus_tag="LMJF_30_2610"
                     /product="putative RNA-binding protein"
                     /transcript_id="XM_001684812.1"
                     /db_xref="GeneID:5653805"
     CDS             complement(1014695..1015345)
                     /locus_tag="LMJF_30_2610"
                     /codon_start=1
                     /product="putative RNA-binding protein"
                     /protein_id="XP_001684864.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653805"
                     /db_xref="GOA:Q4Q734"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4Q734"
                     /translation="MSSNQGDHGGEMISAEDQFSVDMDAEAELEEMKRQVDSLQEDMQ
                     LKALQESAAKDEGTRKTAAAAAATSGQSKTNTSIFVGDLDLRTTDADLRVFFASCGAI
                     TRVTVLKDRQGNPKGTAYVEFETEGQAHAAILKDGQSLHGKPLKVAMKRDNIPAFQRG
                     ISRGGAYALRGRGAGNPMQQQMAALAMMAGMMSQGFNPYNMGRGGGRGRGRGRGGY"
     gene            complement(<1016951..>1019110)
                     /locus_tag="LMJF_30_2620"
                     /db_xref="GeneID:5653806"
     mRNA            complement(<1016951..>1019110)
                     /locus_tag="LMJF_30_2620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684813.1"
                     /db_xref="GeneID:5653806"
     CDS             complement(1016951..1019110)
                     /locus_tag="LMJF_30_2620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684865.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653806"
                     /db_xref="UniProtKB/TrEMBL:Q4Q733"
                     /translation="MELHVCHVTDKPEAHEPQSSSCPREEESNADRTASKSEVLSHSS
                     PSSCVSDRDPKGTGGENAPVSGSGTPEETSVPASQPAVATTGAMAALMSLSQQSLSEK
                     GKVHPDYAEAEEAHGEAAEGVVYQRAGKRPSSKHGGTVASENRLTGASASSAQDSVGE
                     AGSSGAPVAPHRFSGGTQVPAVSHNGAATARQKAWEAKDRSCRSLHLTSDDYVRAYAL
                     SVASSSSLPRQTPAHVVVHCHIPDRSPETKRNASRVSTTGAAQHEVLPPIDVGSKGKS
                     RLRSSSSSAKPCTAPKKVSKTASTSRSMPAVSHASNALSVAGSATARAVVPTEASYLT
                     QYSTAGGAMKGLVDHVDRNSFGFHLRNMFQRIDFADVQREVQRGEKESAALQMCRRLF
                     CAIAKNKDSVSVEDLHELLLMFTPCGVSLREGADFLWEDCGGKLSLTFRDFLQYGAAL
                     RARLRDYELFEQLSDQQKLIVMHARILPGEPPDDANTARVNLLRVADQQMQGQLPQHT
                     RSLRLYEELFLVDYHERLHDAALIPASEVPPQGLKSDYAHEYGREQQARPFPVLPQLS
                     VPVLKEDMEWRHTEVAYSTDSDAIDAAMHAAAAEKRAAAAHNESEYPTLSRSTHLVGA
                     TKAPGKAGSRTVGQRKHLQRRHRAAVASSMGAGTTYSDRSRRAGLGSERFVVDLQRQP
                     PPPQQKKMGRFVEEEYWERRIMDDHLITQLQSMYKTQ"
     gene            complement(<1019705..>1020769)
                     /locus_tag="LMJF_30_2630"
                     /db_xref="GeneID:5653807"
     mRNA            complement(<1019705..>1020769)
                     /locus_tag="LMJF_30_2630"
                     /product="putative replication factor C, subunit 2"
                     /transcript_id="XM_001684814.1"
                     /db_xref="GeneID:5653807"
     CDS             complement(1019705..1020769)
                     /locus_tag="LMJF_30_2630"
                     /codon_start=1
                     /product="putative replication factor C, subunit 2"
                     /protein_id="XP_001684866.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653807"
                     /db_xref="GOA:Q4Q732"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR008921"
                     /db_xref="InterPro:IPR013748"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q732"
                     /translation="MSSSSQPAQKRAKTEGASDTAGAAAPWVEKYRPRTLAEVEAQDE
                     AVGALRACLKEGANMPHFLFHGPPGTGKTTSILAVAHELFGPDYIRSRVRELNASDDR
                     GISVVREKVKIFAQGAVSSSGSSVTQSDGKVYPVPPFKLIILDEADALLPDAQAALRR
                     MMEDFSDVTRFCILCNYVSRIIDPIASRCAKYRFKPLVKSALYHRIEYVAQAEGITLS
                     PASLHALDTVSGGDLRLAIMHLQSAQKAKGDDLSKEDFVSVSGSVPADVMQQYLSALF
                     SHRLEEVIQASRRLVAEGFAAAQVLLQMQHYLVSAECPLNSAQRGKIMLKLCQTERRL
                     ADGGDDYLQLLDIGSAVCSA"
     gene            complement(<1021565..>1024060)
                     /locus_tag="LMJF_30_2640"
                     /db_xref="GeneID:5653808"
     mRNA            complement(<1021565..>1024060)
                     /locus_tag="LMJF_30_2640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684815.1"
                     /db_xref="GeneID:5653808"
     CDS             complement(1021565..1024060)
                     /locus_tag="LMJF_30_2640"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684867.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653808"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q731"
                     /translation="MDVDTLLTRQMELHTSLRQPPKNPQDLVQLMDMMRNYKHYFGSL
                     RTLAERFSVEPETVFQAFMHISVGGTVNFDRQHQDGAVPMHQAKVLPRSKAIELAPRL
                     CKELPNPELMVYVGLSRDLRNTLRVKVEDGNDLKTAEKSVCEAVEYLDFIKSRAHHNT
                     GKLYALYMAEDPHSLSSLLGDGESSMAASWATFQDTFSSTTPSMQLPTLGDDGAPLEN
                     EPTALPSPLSSFIPELKKQCAAASDVSPISGGATKRLKASQVLLDWIAIVPAEYFAQH
                     AEGIVDAVSSTLSLLAAEKRSALCRVGCDIIIMLMQRLSPEPVFIEDVRRGTCSTNPA
                     TFSGALSQWVSSLAKGIYVTIAVISSATDAALRAIAIQSHGHPNVVKTLLTALSSGAQ
                     TELRRKCLGYLALCVVAAHQKLPERMRELVHLLGPVAVKYVANGDSPSRKMARALCSV
                     LRVLAPATSPRGSDRLLHIADERIEVLLQQERPQVEPAVLGGPQALENLLFEADTFVS
                     SIRSTFSAGSQRSLLGSMRGRGRQMSFGAGRSELPQRDAAAADRGGRGRQNKSGATDA
                     GAAAGSRPSTKHSEGTATAALAELRVTARSPTCQHSTAYAVPHGRAMVEVQGPTRSAA
                     GRRSLSPSGGLSPRSNVAAGQARTHNVSSHRAKTRLGSIYDAEAFLGGHNATPTSAAK
                     RAAAGESPQRSVVSRNTLATHAPPLESGMGGHGGGAGHVTAITAGSNGGHQPLLPTLT
                     SARRRTPHADRTAAAEEEGVLPPPRGAALPSSDRLVPLSLRNHVGHDSEAAYRGLVSP
                     NCSSGSAAAGSNAPRISQSLRRKIEENKGALGL"
     gene            complement(<1025419..>1025760)
                     /locus_tag="LMJF_30_2645"
                     /db_xref="GeneID:5653809"
     mRNA            complement(<1025419..>1025760)
                     /locus_tag="LMJF_30_2645"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684816.1"
                     /db_xref="GeneID:5653809"
     CDS             complement(1025419..1025760)
                     /locus_tag="LMJF_30_2645"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684868.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2645"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2645"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653809"
                     /db_xref="UniProtKB/TrEMBL:Q4Q730"
                     /translation="MVQCPWDDVMTEAFRRAQMAGRVFPQLCDFPPSVPRDVAELKYL
                     MPLRAFSEVGRGGKPMHTAPLWCGPLESTGFSDSMEGEEESLLMTHGGDAWSAALFVA
                     SHTQSGGSGVC"
     gene            complement(<1026642..>1027112)
                     /locus_tag="LMJF_30_2650"
                     /db_xref="GeneID:5653810"
     mRNA            complement(<1026642..>1027112)
                     /locus_tag="LMJF_30_2650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684817.1"
                     /db_xref="GeneID:5653810"
     CDS             complement(1026642..1027112)
                     /locus_tag="LMJF_30_2650"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684869.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653810"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4Q729"
                     /translation="MTTSYAAGGAASTAAVVPFNYLRLKRHRRTIFLYCDFQQDTVQA
                     IKERIEKLTSRTFYTMCLYYGTQRLSDESTLFSASISDDGTELWIAYSKGKTAEGETI
                     WEDVEEAMAPVAAAAPELAPENTGESLAGTTFGADGQGAGQHSVTVTDNVEVIL"
     gene            complement(<1028041..>1029552)
                     /locus_tag="LMJF_30_2660"
                     /db_xref="GeneID:5653811"
     mRNA            complement(<1028041..>1029552)
                     /locus_tag="LMJF_30_2660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684818.1"
                     /db_xref="GeneID:5653811"
     CDS             complement(1028041..1029552)
                     /locus_tag="LMJF_30_2660"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684870.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653811"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:Q4Q728"
                     /translation="MCTRVFDVSQRFILLVSLPPLSLSLRPSCCSRKAATRRRRSTAS
                     VLLATDALSLFVRTHYPSPLLFLLLPNFPLPIHSPRKQMRAAVGAVLQPSSSVGALRC
                     QARFITRLYTSYFKGELFPNQLARPLERLPRGVSLAAARKGQQAAAPSSSGSGNPATT
                     ASLDVVTWGDVDSTDLVHANEQSRAVAPQAGLAPRRPYVPLGEVAKLELQGDYLTEGG
                     LHQEALEYYGVVAKAYELAYPKDHPQVAGIRLKLAGAFRRTGRLTSSKANCEAVLQML
                     DSAVQPPLELIVEALFELGLTSEAMSDAAAGTVFEEAVALVDMFHNSGQSHKMLRLLP
                     RLGRRFNLNFEEKFVYFSPFDYDRVFALADQCLERAEVFYQARNDRAGVMRVLQQRKE
                     LIDKKFFNMRDFAGRIHTMRGHWKRRAQVLTNAPTPDELLRYSPTIHQVYRDFKYELN
                     APIGREKEVQPGVNRVVHDMGNPYRRSGVRSQRMFRDAEKNFEKYIRADAFEA"
     gene            complement(<1029970..>1031076)
                     /locus_tag="LMJF_30_2670"
                     /db_xref="GeneID:5653812"
     mRNA            complement(<1029970..>1031076)
                     /locus_tag="LMJF_30_2670"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684819.1"
                     /db_xref="GeneID:5653812"
     CDS             complement(1029970..1031076)
                     /locus_tag="LMJF_30_2670"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684871.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653812"
                     /db_xref="UniProtKB/TrEMBL:Q4Q727"
                     /translation="MSDFASGSGRRPRAAGPLLASGVLLLALLTVVCAPVNAEVVVAP
                     LCAEKHGFAGEFNDHYSIPVEQAPAAGEAIVLIARAFPLNLGNMLARWLYINATYRIS
                     EGAQLTEASDNNGILELANVAAGTDIEVRVMRVRTDGPTPFRFFSFFANRPVCHVAVA
                     PDNSFIAPMPHRLRATPQLPLTMYFKAVLPPTVNALIVRVSADGRTDEKFRSGDRVYT
                     SGDLVRADSGGAVLFAYTSPMENTATPYYFTQVSVSYGEWEGDGAAKPNASNTSSSGG
                     DSRDSMQPTQSTPVLRRLLLISLFLFLLYQAAASAHNYYVLGKRDVMDIVPCAKSAAA
                     GVRAAQLVTLRCMGRSQRHKEGYNSLQNPDDSYS"
     gene            complement(<1031852..>1032829)
                     /locus_tag="LMJF_30_2680"
                     /db_xref="GeneID:5653813"
     mRNA            complement(<1031852..>1032829)
                     /locus_tag="LMJF_30_2680"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684820.1"
                     /db_xref="GeneID:5653813"
     CDS             complement(1031852..1032829)
                     /locus_tag="LMJF_30_2680"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684872.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653813"
                     /db_xref="GOA:Q4Q726"
                     /db_xref="InterPro:IPR004853"
                     /db_xref="UniProtKB/TrEMBL:Q4Q726"
                     /translation="MGTASLLFSLLLNITSSIGVIIANKRFVFIEAHFEFSTVLTIIH
                     FVTTFLGCVFFAYGVKLFTPKKLSIRRVLPISCAFCGYVVFNNLSLLTNSVSVYQVLK
                     ILCTPLIVFVEWFHYGKREKLSTLLSLLPVCIGVGVTFYADTDVNWMGVVWAFLAIIA
                     NSLYTIWGKTKQVELGAQPMQLLIYETPLSAVMLLLVVIPLDGGEKLAAYEVTFKTVW
                     TVLLSCIFAFGVNFSFFLFVGKTSPLTMNVVGYLKTSLVFVLDFIFVSADMPQKKLIG
                     ISITLLGLAGYSYSKIEPPLPRSHTTWRSSSRSSPYQQRRAVEVNVISV"
     gene            complement(<1035799..>1036683)
                     /locus_tag="LMJF_30_2690"
                     /db_xref="GeneID:5653814"
     mRNA            complement(<1035799..>1036683)
                     /locus_tag="LMJF_30_2690"
                     /product="SH3 domain protein-like protein"
                     /transcript_id="XM_001684821.1"
                     /db_xref="GeneID:5653814"
     CDS             complement(1035799..1036683)
                     /locus_tag="LMJF_30_2690"
                     /codon_start=1
                     /product="SH3 domain protein-like protein"
                     /protein_id="XP_001684873.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653814"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR011511"
                     /db_xref="UniProtKB/TrEMBL:Q4Q725"
                     /translation="MRYFVVAHEFQAEEDVELSVFKGEILCATEGVAQDGWIKVEATT
                     DARRRGFVPMSYLREISAAEASTSMSAPASSAPPLTGESTSPMRTPQRAGGESSARAA
                     LANTTVSTSLDLGNCSGVVAKGFSPSLQPMRSPETTAVHAAPASSSIHLTPAQQAAGP
                     VSRHLLENPNAVVDAFMKNEVYFNQLMQRRASALAQMQSGLEEAMTEVAACKDRSAVL
                     TRKLHDLDGVVERERQRWMDRVEEEKVHVSRSIPYSAPLAVPVSSGTTPLRSPIIGPH
                     SGVGRSVLDDDSPRQLRA"
     gene            complement(<1038468..>1039613)
                     /locus_tag="LMJF_30_2700"
                     /db_xref="GeneID:5653815"
     mRNA            complement(<1038468..>1039613)
                     /locus_tag="LMJF_30_2700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684822.1"
                     /db_xref="GeneID:5653815"
     CDS             complement(1038468..1039613)
                     /locus_tag="LMJF_30_2700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684874.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653815"
                     /db_xref="UniProtKB/TrEMBL:Q4Q724"
                     /translation="MSLSRRVLDPNRRRVDLSDQRGGLTAGVLESLRTFLRYNDRYVH
                     LCVSDNVLGSAAIAGLCALIKQHPHLTALEAQHCGLLDKDFRFYVGPAILTMTHLTFV
                     DLSRNCGLTDVSAETLARILVETDVETVRLFGTSLTERGGRVIATAAANTTTLVSCEL
                     PFTVGSAVLEDIEVCTRRNRAHRAILQNASVHYTRLQVRRSRWPCSPALKHMEANPVV
                     AIDELPSLESKPGASPRSPAIDVAPKVCYTETDRQWRACIHKGRKNALMHTETLLPPS
                     LLSSVPSAQVPSSSAAASVATTKVASTALTRRGKATPDSLDEVTMWDWADPAMSTTLH
                     CLYLLDRQAQLAPNRAASAVAAPNIHGLSHTGPSKKATGGTVRLPYL"
     gene            complement(<1040867..>1043665)
                     /locus_tag="LMJF_30_2710"
                     /db_xref="GeneID:5653816"
     mRNA            complement(<1040867..>1043665)
                     /locus_tag="LMJF_30_2710"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684823.1"
                     /db_xref="GeneID:5653816"
     CDS             complement(1040867..1043665)
                     /locus_tag="LMJF_30_2710"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684875.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653816"
                     /db_xref="UniProtKB/TrEMBL:Q4Q723"
                     /translation="MDDDRYIYSRPVVVTEDRIKEALEKQAKQKALKAALDRQVREAE
                     RLKAEKHRAKGKQDKQWGNPNVNVPPTSSSSANAENKTQTASPAVTTSVAGPSPPTMG
                     ATVAPGAVESARYNFSFRKGQATFEVDGSPARRLRTALQTSAEARERSGGAAPPGTGG
                     ENGKSPAPRGRRQPASRDASSGAGPRNSRGRSTAAANGGEYQTNSLPINFSITKEGAG
                     KKAPPLERRPSDCGRPSCGTSGERGGGSDASGHSRNKGNGGYDTQSLPTELIYKFGQA
                     NNNAAVVKPSLRRVTTPLRAPSSGRTSEPRGHQSPLGLLTGAVSASSMTAGRENFKSP
                     LNDRTKSPDYAGVGGAHPHLSPGGALKGVPRVLGSGGGTPNAKALGARYVSPRPTARL
                     AGGILPPLNPHNDSDVIEMSAVLDVVTPTREYSVIGTATGALSGRTPGSSAQPLSCKR
                     TNSTPAERPARPSPPGSPHAAAAAEQERKQAEREKAWAQQVKQIKAELRKTRAKGPGK
                     SGMKLEDRGAMSNIPRRAETAPDPAPHPPMRGGLGGAAGGGASGGGGAHGRNGAGGGG
                     KSNVGGGRSHQVEKMDFAKAHIFTRENFRPITAPEDAASYFGMLSPPPSLPPLARAPK
                     FKPREQARSSSESVTVAERKEEAMGTEAASSPSINGIHTFVSTGTSGEESLKLASLTT
                     RQVTLGLPDYGNSDPVPIQFNHLLEFVEAQIITASQAENLWDFFAASADVARGGGSGR
                     DAGRTVSSFSVSSAQGMWGRAARGDVNGAVGEGKPSTLEIEAVDERPAANGVGAAKGD
                     ENVNGDNGRAFCVPYSPSQLPTSAVLAPALRRKISQQHSEQETARLHGPYKPLQNGRP
                     WRSSSGAGGRGASGGPGGGDSGQRTSPHIARGLQNHFSTASEPGNEGGDEAHGGVNMF
                     DTFSELVLPTDLKDDDSG"
     gene            complement(<1045896..>1048091)
                     /locus_tag="LMJF_30_2720"
                     /db_xref="GeneID:5653817"
     mRNA            complement(<1045896..>1048091)
                     /locus_tag="LMJF_30_2720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684824.1"
                     /db_xref="GeneID:5653817"
     CDS             complement(1045896..1048091)
                     /locus_tag="LMJF_30_2720"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684876.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653817"
                     /db_xref="InterPro:IPR004182"
                     /db_xref="UniProtKB/TrEMBL:Q4Q722"
                     /translation="MSAKSRTPVEIQRRFVQHVQNISSHTRGISDELALMSQGLRDGI
                     QSSTGPATDLLAATSELSRLTMKACTNLSSCLEDLVNMGEAMAPVLAANPEAEEPLLL
                     NFFSTFVTQMGAFYNEINAWWGKGCESFGRCKAAFFRELSVSSTTLATREPTASTTPT
                     GVVPTADIEREVPETAAASTVNAGRRGNHQLLEDDVAGGEPPPQPHDWYSESAPGGAA
                     PKKRRKKKATTATGAEASATVATTSTTKQTQNFDPLPNSQSSCGSAEDTMADLAAAAE
                     SGAQTALPQRPEKNSSRSVLPVAGAPAELTPEDLNALARCEPPYLLLTSTLEDALGAV
                     VMDSRPNVFSNLTSLTYNEPVSTYYIRLVRPGSLAYFVYCNYILGSADTQADFLCDVL
                     ETDCAEVDPFTSPAGEVMVEDAADLSRLPACAWGIGSSEDNERRLYTMYALIEQPPRV
                     SPTAVIQDSLNIGAVRDEVLHMVTLVDGVPEFARVTCMVHSEVRTAEIPTQKQAAILS
                     FSRSGFAHTGFVEVSDSEVEAAMSRMRRKKQNTADDKMVLFPTQELDATMTFQPPVQL
                     ASLNQPAGGAGISLGGVARGAVQGGFEVLKAPFTVGRAVGGALLDATGVTGAVRNNIE
                     GVFRKSFPDLAGETLVDSFNCAWVERSALKQGYLFITPHWLCFQSTLAAAHFSIEYDE
                     IKDIIKSKSVKMFENAIEVKTHLNDTIFLTNFLQRDQAYSALMSQWLKK"
     gene            complement(<1050916..>1053558)
                     /locus_tag="LMJF_30_2730"
                     /db_xref="GeneID:5653818"
     mRNA            complement(<1050916..>1053558)
                     /locus_tag="LMJF_30_2730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684825.1"
                     /db_xref="GeneID:5653818"
     CDS             complement(1050916..1053558)
                     /locus_tag="LMJF_30_2730"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684877.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653818"
                     /db_xref="UniProtKB/TrEMBL:Q4Q721"
                     /translation="MLPDGAEKVDVTRTVFVVNRPQPPEYLRFPVYRFARVSARAGSS
                     DTQALWERRPGEETARYVPEILLINATTEEVSLRYKDTEIEAPCAVPVENISSLPNIP
                     ADVVRFSKQLEAMLKNEATLDRSYSVSFASGGDTNVLDVGAAALSGASGRSGGLGGAS
                     TAVGGGGASGGGGGSSLGDYAFVLVDYTTTTAARQEGYLMKVSNLDRLLKTLTTFLQR
                     EKTAAAAATSGAERFNGSGDAPAAAASESIVTPLTKAGLLSTMSSTRRAPPGSSANDT
                     IKTTAHDIRLPFTPDMYGGCHFGLSGEGSPAFPEPRLAGGGGGADTQSTTSSMEQSGH
                     LMLPRTGPTSSGDDSDADLVAGGHHVDASSTAAVAAAATQKGRQGASTEASRPVLFGL
                     CAVVSKRDSTARRGGITKSVAMLGPSLVWLEPFFPILVAAAQYCCDVNGTGESAVREL
                     QRILKRCYDSVNNAAWMVAAGRAKVDQLTAEIGKYCTLSSGQQAYVYYNDAPFGNTIK
                     AKISLSPESNDIVFTRYSLESLIEALGPSTLHLLLGILTEKKILILCRKGEAADVCEA
                     ALSLGVIGNMLDRDFMARKVFPYVSVSSVNHFMQVPGYIVGTLNPIFDNVNLWGWDLL
                     CDLDNKSVITAAERLQRKTTGLSSSAGGNWSAATAGLANAVGVGGGNDAEALRNFPAP
                     LQQLYKQLTNTIYHLRALRIGAVERNHRLRLMVEDFVYTVVLVGYVNGGSVSVPNALY
                     STFTHRSLSALRSEMMLTSMMDNIRTHVLHRGENPALLLHCVALRHCAWGETPVQRTL
                     QALLDLLNTECDVKLFLRRMPLAVGGLNAVSMQLTSPSAEARAAAAALLARVELVPEG
                     KAAIASMNNFFVMIYENGMTGAGQ"
     gene            complement(<1055165..>1056391)
                     /gene="SGT"
                     /locus_tag="LMJF_30_2740"
                     /db_xref="GeneID:5653819"
     mRNA            complement(<1055165..>1056391)
                     /gene="SGT"
                     /locus_tag="LMJF_30_2740"
                     /product="putative small glutamine-rich tetratricopeptide
                     repeat protein"
                     /transcript_id="XM_001684826.1"
                     /db_xref="GeneID:5653819"
     CDS             complement(1055165..1056391)
                     /gene="SGT"
                     /locus_tag="LMJF_30_2740"
                     /codon_start=1
                     /product="putative small glutamine-rich tetratricopeptide
                     repeat protein"
                     /protein_id="XP_001684878.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653819"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q4Q720"
                     /translation="MEERDQPITDDHRKLVFSFIRMMRRSQVENPERAEAVAQMLGEE
                     FGVDPAGSGGLHDTEVDVLEAFKTALREHERRSGAEQDEKFVSFVELLEKKGYFKGVE
                     KGSDEYAQRLEKAREKFNQRNNPYEGLTAEQIKNKGNELMSQAKYKEAIAYYTKAIEL
                     QPDNAVFFANRAAAHTHLKDYNNAIIDCERAIIINPEYSKSYSRLGTALFYQENYSRA
                     VDAFTKACELDPDNATHKEDLKRAEEKAKGTALSTGGGLGGFPGMGGFPEMGGMPDMS
                     QFANMMSNPQFMETAQRMMQNPEFSNLVANMASKFSQGGMNPAELNRLGADMGMRNVD
                     EEGNVVTPFGKVNRAAIEQLQEEEVRKNPKLAGIMADVQANGYGAFQKYLGDPDVMNL
                     MMKFQNLMFTNPNRSP"
     gene            complement(<1057177..>1057881)
                     /locus_tag="LMJF_30_2750"
                     /db_xref="GeneID:5653820"
     mRNA            complement(<1057177..>1057881)
                     /locus_tag="LMJF_30_2750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684827.1"
                     /db_xref="GeneID:5653820"
     CDS             complement(1057177..1057881)
                     /locus_tag="LMJF_30_2750"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684879.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653820"
                     /db_xref="GOA:Q4Q719"
                     /db_xref="InterPro:IPR026569"
                     /db_xref="UniProtKB/TrEMBL:Q4Q719"
                     /translation="MLRQSSLLCFSTFALNPETSRAPHGPPRGLINRYISMGLPPWAA
                     WCNRVNRHALYRMSDVSPRSFLPKAPHEMDVIWMNERVRERVRTSRQVQHVYRQLKYP
                     FVKTGIHYSDTLDHWVQVPMVEAAMFEIEKDGGFDNFILKRSGPELRSTYGERIRRHL
                     LVRQKETQKNFVLDQQAKALAEVTQAELMKATSEEELDAVLAKYGMDAEEFKRLMAKR
                     VMEQRKSVAAAGLRSK"
     gene            complement(<1058860..>1059009)
                     /locus_tag="LMJF_30_2760"
                     /db_xref="GeneID:5653821"
     mRNA            complement(<1058860..>1059009)
                     /locus_tag="LMJF_30_2760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684828.1"
                     /db_xref="GeneID:5653821"
     CDS             complement(1058860..1059009)
                     /locus_tag="LMJF_30_2760"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684880.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653821"
                     /db_xref="InterPro:IPR015157"
                     /db_xref="UniProtKB/TrEMBL:Q4Q718"
                     /translation="MSSRQGGKQKPLKQPKKERGEMAEEDIAFKQMQREQKKAEKEAI
                     AKMKK"
     gene            complement(<1060833..>1061162)
                     /locus_tag="LMJF_30_2765"
                     /db_xref="GeneID:5653822"
     mRNA            complement(<1060833..>1061162)
                     /locus_tag="LMJF_30_2765"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684829.1"
                     /db_xref="GeneID:5653822"
     CDS             complement(1060833..1061162)
                     /locus_tag="LMJF_30_2765"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684881.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2765"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2765"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653822"
                     /db_xref="UniProtKB/TrEMBL:Q4Q717"
                     /translation="MLPPTHVYSLIIHNKTSKEMTVMVTYSNMIDNTLAQHSVVVAAG
                     EKGVAEQRTFAWNGATFAVVITAVSVKDAQAALTAPFPGVDSPTSDYRITIVEESGTV
                     HLKAGQP"
     gene            complement(<1062070..>1062876)
                     /locus_tag="LMJF_30_2770"
                     /db_xref="GeneID:5653823"
     mRNA            complement(<1062070..>1062876)
                     /locus_tag="LMJF_30_2770"
                     /product="putative superoxide dismutase"
                     /transcript_id="XM_001684830.1"
                     /db_xref="GeneID:5653823"
     CDS             complement(1062070..1062876)
                     /locus_tag="LMJF_30_2770"
                     /EC_number="1.15.1.1"
                     /codon_start=1
                     /product="putative superoxide dismutase"
                     /protein_id="XP_001684882.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653823"
                     /db_xref="GOA:Q4Q716"
                     /db_xref="InterPro:IPR001189"
                     /db_xref="InterPro:IPR019831"
                     /db_xref="InterPro:IPR019832"
                     /db_xref="UniProtKB/TrEMBL:Q4Q716"
                     /translation="MRLSLLRRFCEYVPKGAPTQVSLSVETPYGVTRAFRMTEMAAAA
                     ADAERDAKGFFYLPRMDYDVGQGVAPLMSRKQFDVQYNVFHKAAVDRLNAHTLGSELE
                     GHNLNVVIRNSSFDASHAVIHAAASEHFNYCFWYRSLRPWGTAVPARLKEELQLQYSQ
                     NGTLDAVKEVQRLFTVAALSQQSAGGWVYLVWTGKAFDVIPFDHGTCPIGSDLIPLLA
                     LNTHESARCYDYPLAAEDEEGDEVERFVRNFFKTCNWRLVEHYFLQCGRA"
     gene            complement(<1064707..>1065723)
                     /locus_tag="LMJF_30_2780"
                     /db_xref="GeneID:5653824"
     mRNA            complement(<1064707..>1065723)
                     /locus_tag="LMJF_30_2780"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684831.1"
                     /db_xref="GeneID:5653824"
     CDS             complement(1064707..1065723)
                     /locus_tag="LMJF_30_2780"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684883.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653824"
                     /db_xref="GOA:Q4Q715"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:Q4Q715"
                     /translation="MGGQAVMHELPSTARLSSELCATFSEYLESACPHSGPLSWNEAA
                     QLLSAFTGGSVHHITAALGWAAACERATVSKDDLHSSLEQLMRTEGSIDAWWDSPGVT
                     MPELTGAADQEASEGAGSTKHCGWESLTSVQARSHRPLPPESTSTEGPHDSKMGAWSG
                     QPLLHRTLNSWGRRDSKPSGACSVPSVLSDRPHSTAASMECVVATALGELDLYVEDEQ
                     CSIQFHPDRRSLRFPSEATNETERFGMAAAQHRRAGDRSHSPSPVHPADKQAACHPRS
                     PVAPTSTLAELDRFVHRGKTKKVCKQFVQTGRCTFGARCLYHHPTAVAIALNALHVAP
                     QRLP"
     gene            complement(<1066682..>1067245)
                     /locus_tag="LMJF_30_2790"
                     /db_xref="GeneID:5653825"
     mRNA            complement(<1066682..>1067245)
                     /locus_tag="LMJF_30_2790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684832.1"
                     /db_xref="GeneID:5653825"
     CDS             complement(1066682..1067245)
                     /locus_tag="LMJF_30_2790"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684884.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653825"
                     /db_xref="InterPro:IPR008590"
                     /db_xref="UniProtKB/TrEMBL:Q4Q714"
                     /translation="MRQRQHTPDASATPVLLDPNVDLSEEWRAMNTEYGGYSSEQPPR
                     TLSEFREQLQQARKARSKRSLESEEEEDAFYRTVDGNPKDYALRVVFDWLCPANPTKA
                     RLRVERIYWIAWKQFLYGFFMSGVGTMLMLVGIGCTAQYCVEKARGVGVMLGAFLLCV
                     PGYYSLFVLYMYVTCRGGYTYLQLPEA"
     gene            complement(<1068812..>1069636)
                     /locus_tag="LMJF_30_2800"
                     /db_xref="GeneID:5653826"
     mRNA            complement(<1068812..>1069636)
                     /locus_tag="LMJF_30_2800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684833.1"
                     /db_xref="GeneID:5653826"
     CDS             complement(1068812..1069636)
                     /locus_tag="LMJF_30_2800"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684885.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653826"
                     /db_xref="UniProtKB/TrEMBL:Q4Q713"
                     /translation="MLRKHILSAPLACSTLPEVLCSGSMCVVATRPFHSTRVSFRNGS
                     NGNDTQQRSAAEEDNEELERERHLREQFAQKIQQGLPRQQGGAGAGAGNMGVGFGQGP
                     EWGMGGGTAPFAGQPPVNPDIFRKMLNFMFYLTTLLLLMLMVPLANANSPLYTMQGLP
                     WWELPIGSAAYFLLLRALYSRHEQNRIKTEFENAARANPTLTFDQFITQTYPTMFQGY
                     RTSQPEVLAAVSACLSSAKDLRFAQTMVRAAGRATDPRSSTDDVMDALRRDFPQLF"
     gene            complement(<1070596..>1071213)
                     /locus_tag="LMJF_30_2810"
                     /db_xref="GeneID:5653827"
     mRNA            complement(<1070596..>1071213)
                     /locus_tag="LMJF_30_2810"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684834.1"
                     /db_xref="GeneID:5653827"
     CDS             complement(1070596..1071213)
                     /locus_tag="LMJF_30_2810"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684886.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653827"
                     /db_xref="UniProtKB/TrEMBL:Q4Q712"
                     /translation="MLRWSRLLREMAPELQLEYIPIIFTRTILGPQGGFAGEERLIKR
                     EVAQKYMSEGNAVTPSAEFHQGVWCYNPDSEQYDRFVERNAEFLDFAARKRQWLDVYW
                     RVNTGYLLFGRQSWGQGWLLNCPLRKKDIAQKLWEQYKVRVDPRLIEFREKDRRTGIQ
                     DLGHNWCWLYLPGAEELAIDREVYDNKRVKVRMHIRKMSSYGALY"
     gene            complement(<1072185..>1073801)
                     /locus_tag="LMJF_30_2820"
                     /db_xref="GeneID:5653828"
     mRNA            complement(<1072185..>1073801)
                     /locus_tag="LMJF_30_2820"
                     /product="putative chaperonin HSP60/CNP60"
                     /transcript_id="XM_001684835.1"
                     /db_xref="GeneID:5653828"
     CDS             complement(1072185..1073801)
                     /locus_tag="LMJF_30_2820"
                     /codon_start=1
                     /product="putative chaperonin HSP60/CNP60"
                     /protein_id="XP_001684887.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653828"
                     /db_xref="GOA:Q4Q711"
                     /db_xref="InterPro:IPR001844"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:Q4Q711"
                     /translation="MFSLSRRLASGKSIEFGGEARQLILSGIERIATAVGVTLGPKGR
                     NVIIRQPDGEPKITKDGVTVARSIEFHDQFEDVGAKLIRQVAGKTNDVAGDGTTTATI
                     LAWSIFAEGYKSVATGANPMDLKRGIDAAVEIILDNLAEQTRPVKDFAMLENVATISA
                     NGERSLGTLIAQTVQAVGVKGFISVLDGNTAATEWSRYDGWSTEHGFVSSALMTDSAN
                     LRSRLDNPLVFVTAQPLEAVQDVVRLLEAARAQQRPLVLIGPSFAKPVLQTIILNHEC
                     GVVQCGVVCVSELKEEELHDVAFSCQCSVEKVSSVGYVEDVRCLLGSAKHMEQTMDNT
                     VVCGTGDTSARVRLLQSRLERLMTEESREAIRERISKLNHTHAVIRVGGRSAIEVSES
                     KDRVVDALNAARNALGEGIVAGGGAALLHASKKLDELLLNDEEMEQDRRTGIQIVRNA
                     IRLPLKKISENAGEEGAVAVENVAEYQETSMGYDAQHSTYVDMFEAGIVDPVHVVRSC
                     VVDAASVAGLMITTEASVCDYRPTPDKRRK"
     gene            complement(<1074976..>1077375)
                     /locus_tag="LMJF_30_2830"
                     /db_xref="GeneID:5653829"
     mRNA            complement(<1074976..>1077375)
                     /locus_tag="LMJF_30_2830"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684836.1"
                     /db_xref="GeneID:5653829"
     CDS             complement(1074976..1077375)
                     /locus_tag="LMJF_30_2830"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684888.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653829"
                     /db_xref="UniProtKB/TrEMBL:Q4Q710"
                     /translation="MSSLKDAPSLSPTSRKGFSFAAIDYDDDYIGPAEMVEEMHHPSK
                     STSRSKKNKARDSKKSKRKKGAAPVSEVDEPVSSSSSVQKTSGSKPVAMSDNQGDDYA
                     DDFEDPVDSDDYISSVGTSPPAATLSPVAKPKALMADVEAEEKRLYATVQEQLHLEKE
                     EVMQRIAKWEADQAQKAEEMRQREEELKRQLAAQQQREQEVKQHLSDLVEQQVSQHVA
                     AASATGKAAAAPTNTATHRTAAKAVEYDETEDADEPGTGVSRAELQRRRRREHERAVS
                     LRRAEEEEAAHALFQRLAQDVREVFHELNLSVVAAEKERLIKDERYRRERELRDRRED
                     MARAEKLEKELKEREEREAKFWAMVEQRDEKFRTFLEERTNKDEEEREARLRRDLEDR
                     ATRLRNERELREEMDKMEKERRAKAEEESRRHDGLVLTAQIEEVSARYRAQLEEVRRQ
                     MEAESLRKDELQKAELAMMAKRHEAALEQLQRQHAQQLATMDGHVGNVSRIEALVAAM
                     QETMEATKAMNEKLLAERMSVLQQKERQLDERQAVLDAMVAEMKVSQETVAAERARVA
                     GLHAKFELALSSFSKNSEEDRRAFREAHAHYDTLRQQAEKDRRLMLGEVAQERKLLEQ
                     QFEEFLAKKMEAMAELQNERIAIARERAEASMVRERQNRDETDLLKALRSREEEYKMK
                     LESIESDRATACHMKDEHKRLCDAAAAERQALRHEREKFELEKEELLSRFEAIRRQAE
                     DAASSQERLRIQLMGDRSDVLDGNGAAVGLLRGGPLVCKAASRFQMDLARQRAVLQNI
                     S"
     gene            complement(<1078014..>1078988)
                     /locus_tag="LMJF_30_2840"
                     /db_xref="GeneID:5653830"
     mRNA            complement(<1078014..>1078988)
                     /locus_tag="LMJF_30_2840"
                     /product="GTPase activator-like protein"
                     /transcript_id="XM_001684837.1"
                     /db_xref="GeneID:5653830"
     CDS             complement(1078014..1078988)
                     /locus_tag="LMJF_30_2840"
                     /EC_number="3.6.5.1"
                     /codon_start=1
                     /product="GTPase activator-like protein"
                     /protein_id="XP_001684889.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653830"
                     /db_xref="GOA:Q4Q709"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:Q4Q709"
                     /translation="MGFYPTSTKRWVAIEAERLQEYNGVLEACGLGPDPSKFEPNAVS
                     RFIDVDVPRTMPSLNFFLADESRLESSRDDSTAEVAHFTPSQHALRRILISTAMANKS
                     LEYVQGMNEYVAHLLYAFAKGKASNLTASVEADTFFCFQTLLSYLGDDFCRSFDFDAA
                     CGLTSTMRLFDNVLRFFDPSLFQHLEYLGINAEHYALRWIMLLFTQEFNIADGLRVWD
                     FLLSFGDEIRNAAFFVAAAMCHHLRSSILSGEAMSDVLPLLQEYPAGDVNLFLRIALK
                     WIVKFDFDLLHELKPLSPEGVQALRCSRGLEGGMNFVQVMQSWVPSIF"
     gene            complement(<1079949..>1080263)
                     /locus_tag="LMJF_30_2845"
                     /db_xref="GeneID:5653831"
     mRNA            complement(<1079949..>1080263)
                     /locus_tag="LMJF_30_2845"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684838.1"
                     /db_xref="GeneID:5653831"
     CDS             complement(1079949..1080263)
                     /locus_tag="LMJF_30_2845"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684890.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2845"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2845"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653831"
                     /db_xref="UniProtKB/TrEMBL:Q4Q708"
                     /translation="MPATVKRPLWSLLLPHTYTSRVHALAFHAPTIVFMIAVCAIVSK
                     QSYYRSSLADEDPKTYDRIDRRAYVALPDGRMALVYPIIDTQTSFTRTVISFLDAVNP
                     FP"
     gene            complement(<1080826..>1081173)
                     /locus_tag="LMJF_30_2850"
                     /db_xref="GeneID:5653832"
     mRNA            complement(<1080826..>1081173)
                     /locus_tag="LMJF_30_2850"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684839.1"
                     /db_xref="GeneID:5653832"
     CDS             complement(1080826..1081173)
                     /locus_tag="LMJF_30_2850"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684891.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653832"
                     /db_xref="UniProtKB/TrEMBL:Q4Q707"
                     /translation="MPNLCVSCTFNPPTITLLGSTIREDTVRAMEAQLPLATSTAVNP
                     SKDPAKFIFLSNPDHWRMDLNQHFCDELHKSLVFLVILHSLEEEGWCLRASNNVSNKE
                     NDRETVKLFFTRS"
     gene            complement(<1087189..>1088256)
                     /locus_tag="LMJF_30_2860"
                     /db_xref="GeneID:5653833"
     mRNA            complement(<1087189..>1088256)
                     /locus_tag="LMJF_30_2860"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684840.1"
                     /db_xref="GeneID:5653833"
     CDS             complement(1087189..1088256)
                     /locus_tag="LMJF_30_2860"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684892.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653833"
                     /db_xref="UniProtKB/TrEMBL:Q4Q706"
                     /translation="MISVSRALLSPLRSQLQDILCQPLPITEEGLLCALQVGADLTVP
                     LTIIGSCDDGDSEADVKSKLVVHTTGLPGGFVVSEEELVRGRPRLRPPLPPAAGDTPS
                     SLGSVCLIEAVTRDLLTASNNSPTPSASPRGVLDAFYRLARRRHFSLAGIARVLECGS
                     WLHPDALQLDFPYHCGSAHATKRYLDITAEVADVFGANMRHGTKVLSRYGVAVSVGVV
                     DRLTSLKTPALMWHPSGAPAACLAPVLLGSPVLPLGTVALDYNGPVPGSSLTIKEDPR
                     RYMNIIGDDRYDNSVWLTQGLFGVKPGASWSRPGKAGNDAGAALARYEVVGVRYDEAA
                     EEMELLVRDAVTNEVVAAADV"
     gene            complement(<1089151..>1090602)
                     /locus_tag="LMJF_30_2870"
                     /db_xref="GeneID:5653834"
     mRNA            complement(<1089151..>1090602)
                     /locus_tag="LMJF_30_2870"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684841.1"
                     /db_xref="GeneID:5653834"
     CDS             complement(1089151..1090602)
                     /locus_tag="LMJF_30_2870"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684893.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653834"
                     /db_xref="UniProtKB/TrEMBL:Q4Q705"
                     /translation="MFSLLNNWVESAADAVKSVSSKGIDAVRQTGVLDALESVSVNPN
                     SAAAAAAPQEKTLSVPDIMTPPATWAGSEEEWVWCVEAALRDPNTCALTPATLRVDAS
                     LWEEMKTTVAHLLDAPPSPGKNDLSAPTPTANSTEASAALAVKLLERTGDPYTPAADL
                     VKYIQEHYDVYRVRSYIVPRFTSDDDYWLNIGWRIDLYRQCTNAGQLLTLMQTLSRLP
                     QPLRDIVAAARKPAAPKSEAVGSAQHGGGDAPQNDDEDEDCEEEVIHLKDSTKYWHNI
                     RMQYEVIQEKFVWLRETEERVRKEMELAGGNVKLLSSLIQRKEASTALGASVFDSCQY
                     HKVKLSRLIADICAAPAEHSEGTLLDSHSGTLFHALVKCNDYVKAVLEAYADRPPSGS
                     GSPKGVVSSPTAAAPPSAKQDSPAQCKDSSTEAGTAEATTSALPKPSDTGGSSPVELR
                     LSASDSALDPDNNKADGSGEESFEAKLPWSMDN"
     gene            complement(<1092332..>1094353)
                     /locus_tag="LMJF_30_2880"
                     /db_xref="GeneID:5653835"
     mRNA            complement(<1092332..>1094353)
                     /locus_tag="LMJF_30_2880"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684842.1"
                     /db_xref="GeneID:5653835"
     CDS             complement(1092332..1094353)
                     /locus_tag="LMJF_30_2880"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684894.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653835"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:Q4Q704"
                     /translation="MKAGGGLVALLAQTVVAGDVNACCGVLRRVFSETLQEDRRLTAL
                     ASNAARSVRRRSHHSAGTAPSFATAPAAATKTLSSSASSSSLSSSSALATSSGPDDVV
                     NFARYAQHQRAQAHSFANAAAQAVLRTSFVPPDGVRPLAVAAAGTKGHPTDAEVPQSH
                     RASSAFGAPTDTPIAQRVWKLARSTLSTDSALVKTSSLHVLCHTAQRTGYWEEALHFC
                     EYLPQSPAPLFLSSLLRPDNVNPILQHCATRGWALDVTNAIRVLAEEHGSWSAALVVA
                     QDAEHRLPCGEAYSLGVLVPYLAVSGATAQARQLFESGLAHGALIDPVLVQQLVMQTA
                     TLRQWETCLHMLQCLYRTQETAQLLPADADFFCRLMEVSPGWVTSLQLLHMARASDVK
                     PNERTVAILLTQCDQAGAWREAAAVYDMAVKEDFIDSLAVGSTYHTLVRSFSAIQQWQ
                     KALEALSWMSKADDASLTAGMMELVTLCEQSGQWEAALSVGSTLMDSGVHLLSTQTSM
                     ALLFLCAKGAQWEFAMRLFDAQLHDVRVDPHPLSLCAVMQACVAARQWEAALRVYDAA
                     KASQPRMVVPPLAHRIAVKACVSAGKWNLAIAVLDATRQDGLPLDNYSQRLGLWAAAI
                     QGQWELSLAFFQGIPRRSRTPQDRMMVRHVTRAISPAVDAIALRFLQSH"
     gene            complement(<1095076..>1096449)
                     /locus_tag="LMJF_30_2890"
                     /db_xref="GeneID:5653836"
     mRNA            complement(<1095076..>1096449)
                     /locus_tag="LMJF_30_2890"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684843.1"
                     /db_xref="GeneID:5653836"
     CDS             complement(1095076..1096449)
                     /locus_tag="LMJF_30_2890"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684895.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653836"
                     /db_xref="UniProtKB/TrEMBL:Q4Q703"
                     /translation="MSVFPGLCGDVATTNYRVFLGTLPNLAVEERFLRQVQPVFPWYA
                     SRKHVKEQASEFLEIDLASCDPELLLRYTHVYYVRRQLYDELVDRQLTLMETGKAAKV
                     ADSALLTCLAQVNAAITPRLQYELHLLQQAKKACRVPRRRELNPDAALEAHDYLCMMR
                     VVEEDVGGIPDAEMQARAYLPREVLEAKVKELAAMIFGDGGSATKGTGAALERKEQKL
                     LQRMIPADYNKVGAVEKLRPVDVTALYRFTGERVCGRPADKPFARALWGHVFRKVGSH
                     PLYLQRASLYWARHSGLDPQSATSAMPADLATAVCVQQALFPALKYRCQYLYTSPDIA
                     RQQWRTGHVVPLLRLFPLLGAPAAEDLAAQLVVEGEWAKLGIEADTNLLHDTVLRQLK
                     DMVEQVSALYESDAGAVLKRVEDGAKVLCPSLSERESLTMRGAPEDTSREVSAAAAAR
                     VANAAPA"
     gene            complement(<1098113..>1099870)
                     /locus_tag="LMJF_30_2900"
                     /db_xref="GeneID:5653837"
     mRNA            complement(<1098113..>1099870)
                     /locus_tag="LMJF_30_2900"
                     /product="putative aldehyde dehydrogenase"
                     /transcript_id="XM_001684844.1"
                     /db_xref="GeneID:5653837"
     CDS             complement(1098113..1099870)
                     /locus_tag="LMJF_30_2900"
                     /EC_number="1.2.1.3"
                     /codon_start=1
                     /product="putative aldehyde dehydrogenase"
                     /protein_id="XP_001684896.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653837"
                     /db_xref="GOA:Q4Q702"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:Q4Q702"
                     /translation="MFLCNLLMVDLCLRAYTVFKWLWACVAQTFDRYTAPTIEVPLPE
                     VNFTAAPAVEPLHPRSAGEGQIQCYDKGTNVPIGTVKAFTPAEVREVVEKARKAQQVW
                     ALTPFSTRRKLLFALMDYILAHQEFICQTACVECGKTMMDGTLGEMLTTFEKLRWTAA
                     HGEEVLQEEVRDVGLMTIHKRASVHYVPFGVIGAIVSWNYPFHNIYGPMISALFAGNA
                     FVGKVSEYSSYYASYYESIVKDGLRQLGYSPDLVSFLTGFAETGEAVVASVDKLTFIG
                     SPSVGKIIMRNAAATLTPVVLELGGKDPAIICEDVDLEQVIPVVMRGNFQNCGQNCVG
                     LERILVQEKIHDQLVLEVTRLTRALTQGPASQGQYDLGAMTMGKAAIPKIQQLVDDTV
                     KAGATLICGGKTTSDQFYPATILTDVTPDMPIAQEEVFGPVMVIMKFKTDQDAVKMVN
                     ACAYGLGSSVFSADIPRAQAIADRIRTGMVNINDFGINYLCQSLPFGGVKISGFDRFA
                     GREGLRGNCIVRASTTDRIPGVKTTIPLILQYPISPAAFTFMENLAQVIYGRLPRMIA
                     SVSKLLVIKPSNGTDKKKA"
     gene            complement(<1101891..>1103054)
                     /locus_tag="LMJF_30_2910"
                     /db_xref="GeneID:5653838"
     mRNA            complement(<1101891..>1103054)
                     /locus_tag="LMJF_30_2910"
                     /product="putative mitogen-activated protein kinase"
                     /transcript_id="XM_001684845.1"
                     /db_xref="GeneID:5653838"
     CDS             complement(1101891..1103054)
                     /locus_tag="LMJF_30_2910"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative mitogen-activated protein kinase"
                     /protein_id="XP_001684897.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653838"
                     /db_xref="GOA:Q4Q701"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q701"
                     /translation="MASNAAANGSFGSSANAVQLVSTQRGRKVYCVRGQSFDIDDNYT
                     VTSVIGHGAYGVVCAALDDRTFQEVAIKRVSRVFEDLIDGRRIWREILLLRILKECGC
                     RNVLRLIRVLPPRDPIMEFRDLYLVTDLYDIDLFSIIRQNKCESIDLLRRISVRVLRC
                     LADMHSMGIVHRDIKPSNILLRDEKNAEEVIVCDFGLARAGLHRLSEPLDLTDYVVTR
                     WYRPPELLLMCPYSYPIDIWAVGCVMAEYAMQRPLFAGRDYIHQLQFVLSSIPITGVD
                     FIERSSSSSGLANMNEIAKKYKGTRPLPQLLSKLPRDGLELVTEMLAFEPNKRITAQE
                     ALKHPFFSSVGGPDCKSYPAPPELDLGFDMHAEVSECQLRRAIWDELQYYRKQ"
     gene            complement(<1104533..>1105903)
                     /locus_tag="LMJF_30_2920"
                     /db_xref="GeneID:5653839"
     mRNA            complement(<1104533..>1105903)
                     /locus_tag="LMJF_30_2920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684846.1"
                     /db_xref="GeneID:5653839"
     CDS             complement(1104533..1105903)
                     /locus_tag="LMJF_30_2920"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684898.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653839"
                     /db_xref="UniProtKB/TrEMBL:Q4Q700"
                     /translation="MAALLLASRQHVFLYMDESMSAEEMLATAAEMQQVRESLLSFSN
                     PLGVDAERARQTAGSSNSGASPLHMSCTLNALAHTDGEYELLLAAVSQEWAEQQEQRS
                     TRRPHGAATAPGDGEDGSVPLPATFQRELEEARSAQRDTEDTLAEQRRAHRKELLLLR
                     AELESVQRSGDDTVVSEVANGSTVNGKAVSHTLLHSRQQQHSHHQHHHHHSSDAESSA
                     VVSQLQKALQDARKAQQFAEEKVRLLELRQSLTSGSKGAPTAAGDASGAVTSPRPSLR
                     LEPSRVTSIASLSPSAAAPPAWEQNLLKQENTALVAEFQRKERAWQQQLLQASAEAAQ
                     LKQERATMEATLRLQSQAIAAAQQALVDSRVAQEQEMKQLLERVRVLSQESRSRHRSQ
                     TQSADTDQTRGSHAGGDVPEARVLSPSVRLSRPLQRQATPEPSPVGSPRQKTTASIGG
                     IMSPDR"
     gene            complement(<1107171..>1107746)
                     /locus_tag="LMJF_30_2930"
                     /db_xref="GeneID:5653840"
     mRNA            complement(<1107171..>1107746)
                     /locus_tag="LMJF_30_2930"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684847.1"
                     /db_xref="GeneID:5653840"
     CDS             complement(1107171..1107746)
                     /locus_tag="LMJF_30_2930"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684899.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653840"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6Z9"
                     /translation="MPISANSLVRWSLAAVGVSGAALGGTYVYKTYFHQHPARNEKIV
                     QLAAIALSGEVVDKSLHDPEVLSELRTFGLHVLTHPVVVAHLKKFFIHELTGDTPTRA
                     ALRTFVVRDVIQDAWVKEELIGVAEDLVDSVKDNPDLFPDRILAQIGASAVEGLQTDE
                     FWWAMRRSGKAAGWIAFISPPPHDMTFEAPF"
     gene            complement(<1109051..>1110073)
                     /locus_tag="LMJF_30_2940"
                     /db_xref="GeneID:5653841"
     mRNA            complement(<1109051..>1110073)
                     /locus_tag="LMJF_30_2940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684848.1"
                     /db_xref="GeneID:5653841"
     CDS             complement(1109051..1110073)
                     /locus_tag="LMJF_30_2940"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684900.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653841"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6Z8"
                     /translation="MLQPCVPRLSAVLCVIAVLVLLGCVTTQAQENCGTTASCKPYDT
                     NGPACARKKRMNLRFMLQTCRENNFTVDTQVHHLATYSFCPIVDQLSSFTLIGAPFMT
                     SCYITKDETSGVVTDHLSMDTGPRYLSVYGFGASNSTLYPQKGVSTGTVLIAVNGADH
                     TGVSNSVGIVTMLSLEIGLHNGLFNYDGAAAASETTVANPNYDPVLCNNGTIPPAGIN
                     YCDKNITIPVAATVVQPAKVGFTPTCSAEDVCTLGDPSVYTCIGEVPGQKNCGVYRTD
                     PTEIRKLQMTVWVSYYGTDWRRNVLTSGGRNPLNYLTFVKENALQTLGSKIDSLFHGN
                     LSDRTL"
     gene            complement(<1112899..>1115112)
                     /locus_tag="LMJF_30_2950"
                     /db_xref="GeneID:5653842"
     mRNA            complement(<1112899..>1115112)
                     /locus_tag="LMJF_30_2950"
                     /product="phospholipase c-like protein"
                     /transcript_id="XM_001684849.2"
                     /db_xref="GeneID:5653842"
     CDS             complement(1112899..1115112)
                     /locus_tag="LMJF_30_2950"
                     /EC_number="3.1.1.5"
                     /codon_start=1
                     /product="phospholipase c-like protein"
                     /protein_id="XP_001684901.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653842"
                     /db_xref="GOA:Q4Q6Z7"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR000909"
                     /db_xref="InterPro:IPR001192"
                     /db_xref="InterPro:IPR001711"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR017946"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6Z7"
                     /translation="MPALTIGSTLPDPPQTKEELLAVQNLLSHLQTSLTLQRLTKRSF
                     VRRKTISLTSDGKALEYKPTRKLKRQLLVFRDLYEVTKVDPASKVYKKAKLNSNTNVI
                     VEMNTRIHRGWHIVFDDEASANTWLQMIGYKVKGGALAPSGAVPKEGTLTGCICAAWE
                     RADTSRDGKVDLKEAKKMMVRMNVEISDDLLADLVRKHDASGDGALDLKEFTTLFIQL
                     TQHEELRPLFASFAAQVDWMTRAEFDCFLKAQGDVSSDVLFNTLKPDKNGRITFTQFV
                     HYLLSPCLNPALDPAHQTGVVDEMTHPLKDYFINSSHNTYLSGDQFQSSSRIEMYRRA
                     LLAGCRCVELDCWDGKDNDPVIYHGHTRTSKIRFADVIETIRRHAFTASPFPVILSLE
                     VHTSDEQSMVMAGHLRTILGDMLMTAKDIPNMMYTPESLKGKVLVKWKLPHNDVDDAK
                     EGMTSSDNDNGVARSPSQKAEASAQGALSHLLRCCVTVGAFKTSDWGRDAEPYYIQSY
                     VETVVKELALGHRDEFIGQTSRMLVRVYPKGTRIGSSNYNPTTAWSVGAQLVALNYQT
                     WDDDMRLNDGMFSLNKGCGYVLKPDYLRNPSGKAKATPCTITVTVLSGTQIPKPSLQK
                     KGDITDPYVKLYINKRDRTEVKTSVVRNNGLNPYWMETFTLACESKEIGLLTVKVMDE
                     DTTSANDSVCEMVIPVRALRTGYRAVPMKLCRNGASLPGASILCKFDIVDLPPQS"
     gene            complement(<1116663..>1117340)
                     /locus_tag="LMJF_30_2960"
                     /db_xref="GeneID:5653843"
     mRNA            complement(<1116663..>1117340)
                     /locus_tag="LMJF_30_2960"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684850.1"
                     /db_xref="GeneID:5653843"
     CDS             complement(1116663..1117340)
                     /locus_tag="LMJF_30_2960"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684902.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653843"
                     /db_xref="InterPro:IPR019401"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6Z6"
                     /translation="MKRTLPLLWTFSDNRGYYGPPVYMPLEYASRITNQKQLVFTHPK
                     DPKYTWNTGIDELSSLHPGILGPGRKTPQLNYTSRGGIICEIPPVPVYRSRIWCMGHG
                     HFILQHPRIFIKCPRNKVVCCKWCRLKFINMSTDEDNDDDWFEEEHKISTTPESEEDL
                     RQPIRDLGGVLRNSPFQDGKEPDPHVYRSVFDPERYRWKHPGKASYEVHPAYAKKDSA
                     HEDCGHQ"
     gene            complement(<1120527..>1121612)
                     /locus_tag="LMJF_30_2970"
                     /db_xref="GeneID:5653844"
     mRNA            complement(<1120527..>1121612)
                     /locus_tag="LMJF_30_2970"
                     /product="glyceraldehyde 3-phosphate
                     dehydrogenase,glycosomal"
                     /transcript_id="XM_001684851.1"
                     /db_xref="GeneID:5653844"
     CDS             complement(1120527..1121612)
                     /locus_tag="LMJF_30_2970"
                     /EC_number="1.2.1.12"
                     /codon_start=1
                     /product="glyceraldehyde 3-phosphate
                     dehydrogenase,glycosomal"
                     /protein_id="XP_001684903.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653844"
                     /db_xref="GOA:Q4Q6Z5"
                     /db_xref="InterPro:IPR006424"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020828"
                     /db_xref="InterPro:IPR020829"
                     /db_xref="InterPro:IPR020830"
                     /db_xref="InterPro:IPR020831"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6Z5"
                     /translation="MAPIKVGINGFGRIGRMVLQAICDQGLIGNEIDVVAVVDMSTNA
                     EYFAYQMKYDTVHGRPKYTVEAVKSTPSVKTPDVLVVNGHRIKCVKAQRNPADLPWGK
                     LGVDYVIESTGLFTDKLQAEGHIKGGAKKVVISAPASGGAKTIVMGVNQHEYSPTSHH
                     VVSNASCTTNCLAPIVHVLTKENFGIETGLMTTIHSYTATQKTVDGVSLKDWRGGRAA
                     AINIIPSTTGAAKAVGMVIPSTKGKLTGMSFRVPTPDVSVVDLTFRSTRETSIQEIDK
                     AIKKAAQTYMKDILGFTNDELVSSDFINDNRSSVYDSKATLQNNLPGEKRFFKIVSWY
                     DNEWGYSHRVVDLVRYMAATDAASAKM"
     gene            complement(<1122342..>1123427)
                     /locus_tag="LMJF_30_2980"
                     /db_xref="GeneID:5653845"
     mRNA            complement(<1122342..>1123427)
                     /locus_tag="LMJF_30_2980"
                     /product="glyceraldehyde 3-phosphate
                     dehydrogenase,glycosomal"
                     /transcript_id="XM_001684852.1"
                     /db_xref="GeneID:5653845"
     CDS             complement(1122342..1123427)
                     /locus_tag="LMJF_30_2980"
                     /EC_number="1.2.1.12"
                     /codon_start=1
                     /product="glyceraldehyde 3-phosphate
                     dehydrogenase,glycosomal"
                     /protein_id="XP_001684904.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653845"
                     /db_xref="GOA:Q4Q6Z4"
                     /db_xref="InterPro:IPR006424"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020828"
                     /db_xref="InterPro:IPR020829"
                     /db_xref="InterPro:IPR020830"
                     /db_xref="InterPro:IPR020831"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6Z4"
                     /translation="MAPIKVGINGFGRIGRMVLQAICDQGLIGNEIDVVAVVDMSTNA
                     EYFAYQMKYDTVHGRPKYTVEAVKSTPSVKTPDVLVVNGHRIKCVKAQRNPADLPWGK
                     LGVDYVIESTGLFTDKLQAEGHIKGGAKKVVISAPASGGAKTIVMGVNQHEYSPTSHH
                     VVSNASCTTNCLAPIVHVLTKENFGIETGLMTTIHSYTATQKTVDGVSLKDWRGGRAA
                     AINIIPSTTGAAKAVGMVIPSTKGKLTGMSFRVPTPDVSVVDLTFRSTRETSIQEIDK
                     AIKKAAQTYMKDILGFTNDELVSSDFINDNRSSVYDSKATLQNNLPGEKRFFKIVSWY
                     DNEWGYSHRVVDLVRYMAAKDAASAKM"
     gene            complement(<1124240..>1125559)
                     /locus_tag="LMJF_30_2990"
                     /db_xref="GeneID:5653846"
     mRNA            complement(<1124240..>1125559)
                     /locus_tag="LMJF_30_2990"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684853.1"
                     /db_xref="GeneID:5653846"
     CDS             complement(1124240..1125559)
                     /locus_tag="LMJF_30_2990"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684905.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.2990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.2990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653846"
                     /db_xref="InterPro:IPR021259"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6Z3"
                     /translation="MADAFFCCFSCLPRCHAHHCIHTQTHTHTRIMAVSCEFILSAFL
                     VIITGLLFIDLVPLQETMLCPGNYTSAIDCPEVYYSSSYQLARERFLAAAEAAHAQIE
                     HHLIAKRGNEEYYMDTAFFPGKRKDKLLVHTSGTHGVEGYTGSAIQVKLLQEWNETAL
                     SGPSVLFVHAVNPHGMAHFRRFNEENVDLNRNYLSTEEWAAVKVRDVNIAGYEDLRPL
                     LVPKAPPRFIDRYVLLYVAAKTLARQGFVKLKRAFVTGQYHDPAGINYGGDREQKSIS
                     VLREVLKKHAVATGATEAVYIDVHTGLGPTGVDTMMMKSSQEAEKCRKVFPGARIDNS
                     QTATSGPSAGYNLAAGSIRPVAELGPNTLAVTEEFGTVNPLFVARAMILENAAYRLCR
                     GSYVHAVMQSWMRDVFYPQEISYKRATLKRGSVAFWNAWTYLAESQA"
     gene            complement(<1126141..>1126755)
                     /locus_tag="LMJF_30_3000"
                     /db_xref="GeneID:5653847"
     mRNA            complement(<1126141..>1126755)
                     /locus_tag="LMJF_30_3000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684854.2"
                     /db_xref="GeneID:5653847"
     CDS             complement(1126141..1126755)
                     /locus_tag="LMJF_30_3000"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684906.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653847"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6Z2"
                     /translation="MTTLSPPPHGGGTPRHPSFINTVKDFRPSDRPLLSFIALSAAQS
                     SVARSAEVVLDAALMPPTTPSSSESLAPSVAEISSADRLSARYPEVRVLLHLHYLRCA
                     LRDLQECPTHARRTFFSIIHEHLAALALVLPEPLFTAIAAVLQRFLAMSTDEALAKDR
                     CHVLEVQLMHIVEATQTELLRATKQLSTRAGVMTLRFHHDIPYL"
     gene            complement(<1127264..>1129807)
                     /locus_tag="LMJF_30_3010"
                     /db_xref="GeneID:5653848"
     mRNA            complement(<1127264..>1129807)
                     /locus_tag="LMJF_30_3010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684855.1"
                     /db_xref="GeneID:5653848"
     CDS             complement(1127264..1129807)
                     /locus_tag="LMJF_30_3010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684907.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653848"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6Z1"
                     /translation="MHTSTSSLTGATTSSRVPVSHYNPCLPPEDVVARYTDLLKRGAE
                     TRLTRLLRAKAYVQLHDYASACADLDDWIQETDRIVHGISAGAAADSLTEALFYRGVC
                     RARLSQVKDAVADFTDVLQRKPGHQRAHYERAACYARLDDFCSAIADYEAALQLDEVG
                     REWANLRRYQERRRCSEQQQPRRMRLPSLRPRLGPLPLGSTAVRPPSDAVSPLRQQVS
                     TPASEKAQLTDRSLAPEQSTPCSPASTRGAMASSSKRRSMDEASDSAVATVSLSEYTM
                     PPAVAGTTPLSAILGRRISQGFSDHSDDNLTSVSSSTESLLDGSVVNVDETVEDVSAA
                     RTHEIAASYRPRHENPENGHGMLAAMDPTCIRSSSNREGEEWLPDDVLEAETWQQSEG
                     SRAAACAATAGQPLSYAHDFYQRGLEHRRRGELEAAIHMYTRALELSPTHFKALFNRA
                     FCEDKLMNYTRAIEDYTAALDLDPRNPFTHYNLGISYDHKGNHARATQAFTRAIELDD
                     RHPDFYHNRGFTQRKQGAYAAAIADYTTAVSLDPKHFKSHYNRAYCFSKLGRYEEAVA
                     DYAAALQIDSNNANAYHNRGAALAQLGRLEAAVEDFNRALRLNPKLTFALNARGLVYD
                     QLQQYDKALADFTEAIRLDQRNSAWLHNRGYTYRNMGKLELAIADYSASIKLAPHSHT
                     AYTNRAFAFRKLGRYEAAIEDYTKALREHPGVATKVLNNRAYCFARLNLFEDAIRDYT
                     EVLATDPVNAHALYNRGISFEKCGKYNAAVDDFTRAIRLAPEAPSTANSYYSRGTSRL
                     QLHQVPQAAEDLKQALKLDLIACGLCGEALHAFRAEHPAWRLLQDLGAD"
     gene            complement(<1131194..>1131580)
                     /locus_tag="LMJF_30_3015"
                     /db_xref="GeneID:5653849"
     mRNA            complement(<1131194..>1131580)
                     /locus_tag="LMJF_30_3015"
                     /product="putative Lsm5p"
                     /transcript_id="XM_001684856.1"
                     /db_xref="GeneID:5653849"
     CDS             complement(1131194..1131580)
                     /locus_tag="LMJF_30_3015"
                     /codon_start=1
                     /product="putative Lsm5p"
                     /protein_id="XP_001684908.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3015"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3015"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653849"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6Z0"
                     /translation="MTTAAASSAAVAVEKRNLVMYVGNRVNVTLDDASVLTGRLVSLS
                     SCGNLILTDVERQRILKRRRNRDGVHATTRECYAAVLFVRGSSVVSVGYDSGITTDKS
                     VIDHVGGRQANSSRMVQLANAAPSTR"
     gene            complement(<1133241..>1134206)
                     /locus_tag="LMJF_30_3020"
                     /db_xref="GeneID:5653850"
     mRNA            complement(<1133241..>1134206)
                     /locus_tag="LMJF_30_3020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684857.1"
                     /db_xref="GeneID:5653850"
     CDS             complement(1133241..1134206)
                     /locus_tag="LMJF_30_3020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684909.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653850"
                     /db_xref="GOA:Q4Q6Y9"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="InterPro:IPR024166"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6Y9"
                     /translation="MAATATSNSKFFVPELTQEDVPGGACCVDETTFATLFPSYLESY
                     IKSIWPAVEELLGQHQLVGKLDLLEGSMTVATTRRTWDPYAIIDARDFIKLLARNVPL
                     AQAQKIFQTDITCDIINISVKGGSVRRFVKRRDRLIGPQAQTLKALEILTGCYVLVQG
                     KTVAVMGPVKGTQMVRSIVEDCMNNIHPIYGLKQLLIKRELSKREDMKHEDWSRFIPV
                     YKKTQPNKEKQKAVRKMKKERMKESKRKQAGKEKTIFPPAPPKRLEDIAMESGQAFLA
                     PRQRRRKDELELQSAASASTPASARTNNSKGSSSRRDAPASTIKK"
     gene            complement(<1135423..>1135710)
                     /locus_tag="LMJF_30_3025"
                     /db_xref="GeneID:5653851"
     mRNA            complement(<1135423..>1135710)
                     /locus_tag="LMJF_30_3025"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684858.1"
                     /db_xref="GeneID:5653851"
     CDS             complement(1135423..1135710)
                     /locus_tag="LMJF_30_3025"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684910.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3025"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3025"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653851"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6Y8"
                     /translation="MDQTKLFQDFACSVRCESKNTVVFVACPKGGRYGDVRKTLAGLL
                     QRPFNSVHVAPPIGDFAVPLDDDQVVEPAENEVIVPARILKATEQGGWEFE"
     gene            complement(<1137470..>1138732)
                     /locus_tag="LMJF_30_3030"
                     /db_xref="GeneID:5653852"
     mRNA            complement(<1137470..>1138732)
                     /locus_tag="LMJF_30_3030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684859.1"
                     /db_xref="GeneID:5653852"
     CDS             complement(1137470..1138732)
                     /locus_tag="LMJF_30_3030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684911.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653852"
                     /db_xref="GOA:Q4Q6Y7"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR002550"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6Y7"
                     /translation="MEGSYSDGHGEESLSSTQMLWYSVAAVVCVASAGFFVGLQIALF
                     SIDRLFLRVLSTTGTPKERQQAKSLLAVLKLQHWTLVALVLMNAVFVMTLPILLETIF
                     DEITALIVSITAVLFAGEVLPLAVFVRWAIPVCSYFIHAIWFAIIVTAPVSYPMGKVL
                     DRVLGHSEEPLDREDLAALIVGPRLGENEEESTMMEVTSVRVGDGDGGGESAQIAKEK
                     SSPGQLRESEVKMLQAAMLLSTDTVQQHLRTKAEDAFMLSSHDSLDRETILCILTTGY
                     SRVPVYFGEDRRHIIGVLVVNSLVSLCFSHPDPPPLVSDYSLREVLRLSQEASLYDAY
                     LAFRNGPSNMAIIYDPSGAMAGLLTLNDVLATLYNADPVAPATLSEQCLRRQRKMVEL
                     VEGMKVLQVTKRVVPVSVGTSRLGGPGT"
     gene            complement(<1140481..>1142076)
                     /locus_tag="LMJF_30_3040"
                     /db_xref="GeneID:5653853"
     mRNA            complement(<1140481..>1142076)
                     /locus_tag="LMJF_30_3040"
                     /product="eukaryotic translation initiation factor 3
                     subunit 7-like protein"
                     /transcript_id="XM_001684860.2"
                     /db_xref="GeneID:5653853"
     CDS             complement(1140481..1142076)
                     /locus_tag="LMJF_30_3040"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor 3
                     subunit 7-like protein"
                     /protein_id="XP_001684912.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653853"
                     /db_xref="GOA:Q4Q6Y6"
                     /db_xref="InterPro:IPR007783"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6Y6"
                     /translation="MSFELPELYINPQFSWGPPEEEMKLDDGAPFELYSKADALEAVD
                     WFTYKREADVSDSDSDDEAVAANKRKAFKQVEDNARLNALRTEREKTVMFNPRNNGPR
                     NAKLAAGKKGGKDNRNNNQRRNRRKVTELPNTYNASAMAVVQHVMKQTDMTKLRMSAL
                     PKVIELGLYGTPPIYNTGIEAATCARPLPLDESKYDEDYFMRGLTTEDPELRKIMGET
                     QRYPLVVVTDEILSLLMVCTRSSYPWHIRVLNYNNIWILVKGEDSNIEKQWVSETAGH
                     EVRPSEGADNRAERISSLGEESTKVYDCFARASCAKSFAQVRTNRSPFSRKQPRMYSY
                     RRYIMHDGTPDRYDIVVRCEVDALMPRTNDRVRCFALLEQCVVSEKDSSWRREGLLKN
                     AASFLPIEYAHNGCKIARWTALSLLSDAKLMKIGFVTCEEKMEKGQRVFDHKQHEVLS
                     VQTYSPASLATQFGIDVSNMWAIVDHIMRPFIEGHSICPSILMKPGDKSELIVVEEED
                     DDDESDEDDSEEDGDDGDDKDDE"
     gene            complement(<1142970..>1148669)
                     /locus_tag="LMJF_30_3050"
                     /db_xref="GeneID:5653854"
     mRNA            complement(<1142970..>1148669)
                     /locus_tag="LMJF_30_3050"
                     /product="protein kinase-like protein"
                     /transcript_id="XM_001684861.2"
                     /db_xref="GeneID:5653854"
     CDS             complement(1142970..1148669)
                     /locus_tag="LMJF_30_3050"
                     /codon_start=1
                     /product="protein kinase-like protein"
                     /protein_id="XP_001684913.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653854"
                     /db_xref="GOA:Q4Q6Y5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6Y5"
                     /translation="MLWADFEPPLRDFSGSDGQAAMGPILFAEATTVHYRGSVYHGLT
                     EEMLQRGGSTFSIQVSIPTFPTNVTLVRPIMMSILTSNVRLVDDAGTVVRRVQPAAHS
                     EAAAHAFNHTKAWLAWRRFVKDILSHSQIEVSPNGHLVKVRFASGKWVLPAQTSALIV
                     PCLPFSLFEQLGRLGMQDLPNNCLAGDPFFVSKKSFLQLDEARWNPSQQVFVTGGSIS
                     IPLTGASSTVFDKAELERRLRVMEGYTCLHTRSAVVRGSRWDVRDNVYRFTPHRGGVQ
                     TLCYVPYPDTLPFLSVKLMDSYEVAGPEGVSTDPPQVHADLEFAGTIYGTNLTEQDTA
                     VITDELCADFTSQNVFFVDLFFSSSSRVSFVGTFHKRGIYHVCYHREGSPMYVLVSTL
                     LVERGADVVIDNDSPNVLIDQDVKLLQSASVSRLNVQEKGNLNLRQRSLNVSYFLWSG
                     GSISGRGTINCTGYAKITTQGYETRVLSVPLYNYGEMTIDVQRLSMERDGAIHNYGNL
                     TLAVSSMGVDSISSVLSAGRRNAITNSPGGVIRIMALDERSYALLTGRFIFQGGSVML
                     LGKINLTDASSYADSTVTLKSGTLLTAHQTHLGGTVVVEERSVLTLMKGCVFVSATIS
                     GDGVVRLLGDDVVLNSLTVTGSIRALFGVGLIDPISVIAYGTTHFGENTLVHVTNANF
                     VTSSGHAKVTFLGRLLADFVTVRFTGNMILQIGGVAALYGNMSGEALNFHRTLTTLSG
                     YSLPLATASFVSRNATMFAIDTFRLDEAVDLSTRGDEDAAKGIVSSLDPFKSIVSGPA
                     AVATRACEVYLPTSQRLTVSGRLVLRGCVQVPAGGTISGAVVKLEDSADWELLHQTFC
                     IFADLETLPHLCRHDRRSAPPLRSGLSLSEKVYVRSPASFLLDELTLIHSHTRVTDSV
                     PITIKDTIIVRAGSTLVLTYGMVMAARHIVIEGTLVVNDPRNTVLKGLVEVKEEGIIE
                     LHGVSGMSCANELLVEGRLYLAPNARGFHFRCLSASDDDIGGEDSEAAPADPEGSGTM
                     KSVGRLDALLRKRALANLRPDMTCPDDVVHDYDSRRQFINLYWMRQAYDPPADQPTRR
                     DMIWMTLFGIACCFGTFHILLTMWGYTYKKWWSDIRAPCPLQLTLTWDELSYSAVNCF
                     SFCRFIIIHFLNTMAAFHPGLPAPLPSVAGMLLRGMGLLMPHHQTPISRPRKVGLFYI
                     AWLFTFLYVKKRGSWLITYLRRRHPYLLDAMQKLYTVLTILNFIFLAPLMSSVVDAIA
                     WPTLLRNVPTYEVMQQDIWVAISVISFVSMGVIAPSSILTNQMCIPHMDLRVRASNMF
                     VHFAVQMWETVMWKVFYNNPTCVVFNCIFFQFIRLAFFLCFPATPYKNVNRFMIFLLM
                     QPFFVYFVIILYMVLVRTGVYTSCTQGTDLFRVVSAAFVISLFVNFWRNVLFTQEQTT
                     ATGDVSIDALRCSMTQIRNRIHDLKFEVYASTDAMERENILNAIARMRIEYLEKQERY
                     RFETHRILRPFIFSGTGFDGDTHLQSHSSVASYSNDDGDDASNMHPAMSPNMQQGTLL
                     SVEEMETFSCGPALGKGSYGTVHLGILTNGKMVAVKYVNVVSESPETLASVEAEVNML
                     RELSHPNIIRYFGAHTIQDTMLVFMEFAVGGSLTSIVKKFTHLTEPVMQLYTFQILKG
                     LQYLHDKGVVHRDIKGENILIDGYGVAKLADFGCSKSLANIANSSQVGCGTLVGSPFW
                     MAPEVIRSEAYGTKADIWSVGCTVVEMLNGGEPPWREEFDNVYSAMFYVGSTNDIPQI
                     PEETSDPCRAFLFRCFEREVMKRASADELLQHPWLKSAAAASHAEDSSDNFLSFSTVL
                     SPSLKPAYDWHRAAGFSRSTPHSSREDLTSPLNGSTAPQPPNSSIASITSNASKKLK"
     gene            complement(<1152543..>1156118)
                     /locus_tag="LMJF_30_3060"
                     /db_xref="GeneID:5653855"
     mRNA            complement(<1152543..>1156118)
                     /locus_tag="LMJF_30_3060"
                     /product="putative kinesin"
                     /transcript_id="XM_001684862.1"
                     /db_xref="GeneID:5653855"
     CDS             complement(1152543..1156118)
                     /locus_tag="LMJF_30_3060"
                     /EC_number="3.6.4.4"
                     /codon_start=1
                     /product="putative kinesin"
                     /protein_id="XP_001684914.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653855"
                     /db_xref="GOA:Q4Q6Y4"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6Y4"
                     /translation="MSSAGEVSVAAGSAVEGEDSRLRAGDALDEDDDDSATAASPTST
                     TSAATKAKKKKSAKTPTNRRASGSGIDVGDNDDGQALSRCLVYCRLRPTIKQDYKEGG
                     HALVTLEDKRVVVKDERHYDFDGSFGPLAEQAEVFESVAIPCIDHAFNGFCSALMCYG
                     QTGTGKSYTMCNTDPQHLGIIPRAAKYIFEKIQANQASDPTRTYTVTGQFVQIYRDHL
                     GDLMVHEGKDRVEVHYDEENGVSLTGCTSHSLVSSKDFMRFYNEGNARRVIGSTAMNA
                     ESSRGHTAMVVYVTSEDTEDISKGKLRGKITFIDLAGYERFSKTGITNADPIRKDEAK
                     TINASLLALGHVVSSLSSGTKHVPWRNAKLTRILQDSIGGRSRTSIILTVGPSSEHLY
                     ETTNTLQFGLRAMAVKVEAKVSVTVDYVKLSKKLMGLLSERDERISSLEVQIANRDAE
                     RQELLERYQRDRGDLEQRFAAELQQLTASGASEQQIRNLKEVYQAEIENLQDQQQEEI
                     GYHDEIHSKEITQFIKEQKHQEAKSLMEMKLAQERLVEEFQRKLDNARGGTNEDLVRA
                     LQQLAEKDAILASRANDTARLHATIDALTAQVRSFGGTVQTDVDFPETFLDVSQVEEM
                     RARLQGEVERNYNKVVDLSTQLDRASMLAHDRMEEVSKLQQEAERLHEKLVQAGVEIS
                     ESNEELQELREKRAELVDPEELESLRLLMQADIDELRSQRDELQAELRRVNEARVRES
                     VARRRNVLDGPDTLKRILAEDVGEGTEDMRDNAAREQGRGDSGNAADGVHKVGPKAKA
                     MQRAYKKMIQKLNRQLSDSSRDRAALVQRIQQLERTLTLYGIPVQATPGCATEYKEAG
                     ASHVGNARGGPARPDASASDRESSSAESHTEESLLTAGSTDAALVLLFKEQEIEVRDG
                     LIAQLEVQLSKAVSAYENDQKCIQELKALLRDAGETPPETSSSGSQPVEGVPLEEYST
                     LLRQLRSHNRKLLVELLVLQLRPKAEATELPTTQRLIFEEQLEERDTELEMKDEMLLE
                     KNAMLQYMATLSARLINQMEALGLEPCCHLPERYQDLVKMEKDQLDIQAAKQRELEVH
                     LQREQDEKQKMKRLLEAINAEREKGAAVLQQTELRNKELRERENSAMTALQELTERTI
                     QKEMMRDEALRRTTHELMELQARCADQQHRRSSNLFERLLRSIIE"
     gene            complement(<1157468..>1158631)
                     /locus_tag="LMJF_30_3070"
                     /db_xref="GeneID:5653856"
     mRNA            complement(<1157468..>1158631)
                     /locus_tag="LMJF_30_3070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684863.1"
                     /db_xref="GeneID:5653856"
     CDS             complement(1157468..1158631)
                     /locus_tag="LMJF_30_3070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684915.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653856"
                     /db_xref="InterPro:IPR007356"
                     /db_xref="InterPro:IPR016009"
                     /db_xref="InterPro:IPR028564"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6Y3"
                     /translation="MMSRCAAAVTASPATPFGSSMQASGVDTQDTSASDTRDGAAEAS
                     QSTPTGHGRQRRTWTEEEKRAFWKQKKLEKRERRKAAAADRQKAQQVQWVRLTEEEKE
                     ARRAEAVLLHERRRQAETALVNRCEAQLADPHVPAIVFDLSFAWCMTVANTKSTVSQV
                     MLSYSALRTAGFPFRPVITSLMGKEASDAEHDAAAQAEVLQALNNYEGFRRFPPKVTQ
                     VQHWSELFAPSQVVFLTADSPDTLTSIEPDTAYIVGAFVDHNVYKGLSYASAQRHGVR
                     TARLPIKESVVLGNRCKVLTINHVVEVLIQYEKLRAAGTPDWAQAINGALPTRRAQQV
                     IKGRRKRGRVSVTGSGDKEGDDDEVSDEGCSNGEPDNENGSAAVRECACERVE"
     gene            complement(<1160445..>1161470)
                     /locus_tag="LMJF_30_3080"
                     /db_xref="GeneID:5653857"
     mRNA            complement(<1160445..>1161470)
                     /locus_tag="LMJF_30_3080"
                     /product="putative homoserine kinase"
                     /transcript_id="XM_001684864.1"
                     /db_xref="GeneID:5653857"
     CDS             complement(1160445..1161470)
                     /locus_tag="LMJF_30_3080"
                     /EC_number="2.7.1.39"
                     /codon_start=1
                     /product="putative homoserine kinase"
                     /protein_id="XP_001684916.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653857"
                     /db_xref="GOA:Q4Q6Y2"
                     /db_xref="InterPro:IPR000870"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR013750"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6Y2"
                     /translation="MSDEAAKPLPEKVSLRVPATTANIGPAYDTLGMALSIFMELTVE
                     LAEAFSMTVTGEGQEHISTGEDNMVVQTCRIAFEEYAHKSMPPLKFTMHNNIPYKCGC
                     GSSSAAAVAGFVAGMMLSGLTLETHNSESLLSAISKIEGHSDNAAPAIYGGIQLVYKK
                     DDGRTMTYHVPTPPNLSIVLFVPHKLMKASTHVTRELVPTAVSLRDAVHNISGTAILT
                     LALSTGDLRMLKDASDCLHEQQRSRKLYPHYSACAKAAREAGAEYAFLSGAGPSVCAM
                     VSGRHGDLLTQPMEERKAEMVAEAMVKAAEAVGVQGRVIITMPSDVGVHLSGTTCIRP
                     NIQYTSI"
     gene            complement(<1164005..>1165021)
                     /locus_tag="LMJF_30_3090"
                     /db_xref="GeneID:5653858"
     mRNA            complement(<1164005..>1165021)
                     /locus_tag="LMJF_30_3090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684865.1"
                     /db_xref="GeneID:5653858"
     CDS             complement(1164005..1165021)
                     /locus_tag="LMJF_30_3090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684917.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653858"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6Y1"
                     /translation="MAAAQQVANAFTVDFVERVAKNAANIADLYGRHATLTVNDFELG
                     ISEVHDSYVPIAVQKWAVSLQGSRLRVDSVNAAPLYGGVNVFVTMTAFGEMQQYYHIV
                     TTLESFQDTYGMDGYYVRHQVIARIGAVTPEPPAPEPTPAAAEKSEAPKKSKPPTPEP
                     EAAPAQPAPKPEAAEEPASAAAPAELEDEEEKPAPAPVSSKPKSWASLVSRAPVKTVE
                     HKPMRVVAHEGGKKPTTEPAATTAAAPASKRLPPRERKASEAVGDRLMFNTTGIVTDD
                     EIRAALGPMSAHLVSLRNNSAKGHVFMDFAEKVNVFDELSKAQLVIGTSKMKMSVFRQ
                     RARE"
     gene            complement(<1166098..>1168017)
                     /locus_tag="LMJF_30_3100"
                     /db_xref="GeneID:5653859"
     mRNA            complement(<1166098..>1168017)
                     /locus_tag="LMJF_30_3100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684866.1"
                     /db_xref="GeneID:5653859"
     CDS             complement(1166098..1168017)
                     /locus_tag="LMJF_30_3100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684918.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653859"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6Y0"
                     /translation="MRCVTLRLSSQAAGRRSFTPYQVVLKAVEHDGRGLLAAAEVFKQ
                     FQRFYRSYQQKEGQRTRAASTSAESSSTTGDDNATAEPHFIPGKPLTQFCGRAEDVEP
                     MTVLLLKVLCDLQKLEEMRFLFTQCLLEMEDRTPSVELFNVFLLAISMTDTFNQYEVE
                     NLVELQQSKGIVPDVVTKLSMFLLYLRLGNQNCVAWWPGIREEVEIIIDTDAVARYPL
                     LPLRLQHCFQTLLRVHYDTAVIHESFELLHRAAPERVTPSIGLPYLLLSAMNMSTPPF
                     AVVKVLKLMQARERHSSSSPTKVASEHTADTSSSSSSTATTAATQEPVLSSEITVFRL
                     LAKCAKYGDADAAAYMRSYINTHRQFGLVAKENEPVAALLYVEALTKAGRVRSALRVL
                     EREVPAPYNRPGERPKLFLQSRRLSLLSTDPVRNVVAALTPLVAAAHVEDPAVSLISE
                     KTSAADAEEREPVPVTSVTLDLLLAACQFAGSAKRAEEVLCLYPRYETVPTSTTYALL
                     LEVYAATAPVDGALRLPSLQREMEDAGIAVNAAWLHAAMAVALDARDIGAALRVAELS
                     VAHKSSVDVKHGARLLRELAVAADAAAMRRALHLLRSSNSTVDSRSVALCTAVLRSLG
                     VPAAALRVDAPAHES"
     gene            complement(<1172929..>1174077)
                     /gene="ADOMETC"
                     /locus_tag="LMJF_30_3110"
                     /db_xref="GeneID:5653860"
     mRNA            complement(<1172929..>1174077)
                     /gene="ADOMETC"
                     /locus_tag="LMJF_30_3110"
                     /product="S-adenosylmethionine decarboxylase"
                     /transcript_id="XM_001684867.1"
                     /db_xref="GeneID:5653860"
     CDS             complement(1172929..1174077)
                     /gene="ADOMETC"
                     /locus_tag="LMJF_30_3110"
                     /EC_number="4.1.1.50"
                     /codon_start=1
                     /product="S-adenosylmethionine decarboxylase"
                     /protein_id="XP_001684919.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653860"
                     /db_xref="GOA:Q4Q6X9"
                     /db_xref="InterPro:IPR001985"
                     /db_xref="InterPro:IPR016067"
                     /db_xref="InterPro:IPR018166"
                     /db_xref="InterPro:IPR018167"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6X9"
                     /translation="MNVCSNTTKDPLTLMAMWGSMKGYNPEQGFSFEGPEKRLEVILR
                     STLETHVDGLRSLDDSVWSGVVGSLNAQIVSRESNEYINSYVLTESSLFVMKNRIILI
                     TCGTTTLLNSIPNILEAISAVRGELEWVSFMHKNYSFPWMQKGPHTSLADEFATLKQH
                     FPTGKPYIFGPVDSDHYFLFCYDDIIRPCSSEDDTQLSMTMYGLDKEQTKYWFRDRFI
                     STSAETAAIRAATHLDRVVDGTWTLHDLQFEPCGYSINAIRDEEYQTMHITPEDHCSF
                     ASYETNSRATNYSDRMKKVLGVFRPQRFTVIVFLDPESPVGKAYNEGKGIGVEPEYYP
                     EYSLLHRTTNEFAPGYVAMKINYVRTAAVEETDAAVGGAEPGAKSGPD"
     gene            complement(<1179434..>1180327)
                     /locus_tag="LMJF_30_3120"
                     /db_xref="GeneID:5653861"
     mRNA            complement(<1179434..>1180327)
                     /locus_tag="LMJF_30_3120"
                     /product="putative S-adenosylmethionine decarboxylase
                     proenzyme-like"
                     /transcript_id="XM_001684868.1"
                     /db_xref="GeneID:5653861"
     CDS             complement(1179434..1180327)
                     /locus_tag="LMJF_30_3120"
                     /EC_number="4.1.1.50"
                     /codon_start=1
                     /product="putative S-adenosylmethionine decarboxylase
                     proenzyme-like"
                     /protein_id="XP_001684920.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653861"
                     /db_xref="GOA:Q4Q6X8"
                     /db_xref="InterPro:IPR001985"
                     /db_xref="InterPro:IPR016067"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6X8"
                     /translation="MSLWGGFSNPTSYSDSGLEKRLEFDFAAAVDVQTFAVEELEDVL
                     AAAGQKLQHHFSAEGLLSLEMTQCIIILTPCKLVVTSASEVMLHQVITPTIALLTSKG
                     VRVEWASYLRKNTTSPWCAESEMSDIMAQEYAELKAAFPAGKSFLTGPVDGHHCFNFV
                     YDNVERIAGRKEEDVQVNVFLNDVAAGLEEVNKTTQRFHALQSGEYEVMRTFAGVPCI
                     SFETNAKAAVASPTRVQKLLDTFQPTHFTVAALQDRDADESALRCNFNAFTPYTLQNR
                     TVNLFGEGYAFHQLLFARSAD"
     gene            complement(<1182367..>1185270)
                     /locus_tag="LMJF_30_3130"
                     /db_xref="GeneID:5653862"
     mRNA            complement(<1182367..>1185270)
                     /locus_tag="LMJF_30_3130"
                     /product="putative valyl-tRNA synthetase"
                     /transcript_id="XM_001684869.1"
                     /db_xref="GeneID:5653862"
     CDS             complement(1182367..1185270)
                     /locus_tag="LMJF_30_3130"
                     /EC_number="6.1.1.9"
                     /codon_start=1
                     /product="putative valyl-tRNA synthetase"
                     /protein_id="XP_001684921.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653862"
                     /db_xref="GOA:Q4Q6X7"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002300"
                     /db_xref="InterPro:IPR002303"
                     /db_xref="InterPro:IPR009008"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR010978"
                     /db_xref="InterPro:IPR013155"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR019499"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6X7"
                     /translation="MAATYDPARVEADWYPWWEKSGFFRPASDHNSETATKPFVIIAP
                     PPNVTGYLHLGHALTGAVQDTLIRFHRMKGDNTLYLPGTDHAGIATQVVVERRVMKEE
                     GKSRHDLGRDEFMKRLWEFKKSHAGMITEQFRRIGLSLDWTRERFTMDEQSSAAVVEA
                     FVRLHEDGLVHRDTRLVNWCCALQSAISDLEVEFVEVPKTSKMTIPLYDRKVDMGSLT
                     HVAYKLVDSDDELVIATTRPETLLGDTAVAIHPDDERYKKFHGKFLKCPFRDDIIPIV
                     LDATLVDMNFGTGAVKITPAHDPNDFESGKRHNLQQLVMMDLKGYVTMEPFKGMHRFD
                     CRREIVKKLEEMGLLRGVEPYEYRVGRCERTGDIVEPMLMPQWFIDCSDMARRAVEAV
                     RNGDLCLYPPSHEAVWYHWLENIKPWCVSRQLWWGHRIPAYKVVGSLPKDVDPWVVAR
                     NLQEAHAKAKKKFGLTDEQVAEASFEQDPDVLDTWFSSGLWPFSTLGWPTDSDDMKRF
                     FPNSLMETGHDILFFWVARMVMLSLHFTNKLPYKEVFLHAMVRDKNGEKMSKSKGNVI
                     DPLYVIHGVSLQTLHDTVRSGNLSDKEVEKAIKQQKEFFPEGIPECGSDALRFGLLSY
                     TQSGRSVNLDIQRVVAYRQFCNKLWNVVRYVLYHALGTDYVPSKQQFSPAEDAAMLPL
                     ECRWILSRLDAAIAETTQGMSEGLYDFALATGAVYRFWLHELCDVFLELTKPTIQKGG
                     EKQQLVQDVLLHVVEKALRLLHPMMPFLTEELWHRLPNYSSFGSESIMLAKYPTPSGW
                     SSAASDSAMSIILDVVHSVRSIKASYSLTNKHKPDVWVTAHTAELQELFAVGKMMIST
                     LGVVGEVTVVSPAEEAAAVPKGCGFSLVTKEVGVNMMLMGFIDVGKEVAKLEKQLDGL
                     TKQIEGMKKKMSIPNYETKVPAEIRVANAEKLSTLEAQSAQLRDGIEKMSSLK"
     gene            complement(<1198671..>1199363)
                     /locus_tag="LMJF_30_3140"
                     /db_xref="GeneID:5653863"
     mRNA            complement(<1198671..>1199363)
                     /locus_tag="LMJF_30_3140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684870.1"
                     /db_xref="GeneID:5653863"
     CDS             complement(1198671..1199363)
                     /locus_tag="LMJF_30_3140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684922.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653863"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6X6"
                     /translation="MMGEEDRMLNVVVLSDDSNESSPCDQLAQSFASIASSLGTQCTS
                     HSDSYSFKEGDVLFEFDEENSEESEETPAEAAERMRQERRYHLRYGPSRANRSHDRQS
                     ILSARQNLLNEFILRETKEATVSRQDHHIMLRQLISAAYFRDPNRVSNRPLWRRIMAA
                     IGKEYYGSKAIFSLSPDPYDSVVAKLSSMMLWDDEIRHWAYGYCDSEITRRRNAQVET
                     LKKLEASGRLFL"
     gene            complement(<1201237..>1201875)
                     /locus_tag="LMJF_30_3150"
                     /db_xref="GeneID:5653864"
     mRNA            complement(<1201237..>1201875)
                     /locus_tag="LMJF_30_3150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684871.1"
                     /db_xref="GeneID:5653864"
     CDS             complement(1201237..1201875)
                     /locus_tag="LMJF_30_3150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684923.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653864"
                     /db_xref="GOA:Q4Q6X5"
                     /db_xref="InterPro:IPR001434"
                     /db_xref="InterPro:IPR008856"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6X5"
                     /translation="MAALKVLLLLCLATLVATTCFAQVAQEAEINPHPLLFVSKTTSN
                     DDIVLGSSVEVVVTVTNYGQSPAFDVQISDLLDDGSLQSKSIAYLPYSASETLRYTVT
                     PTALGNYAVSVAEVTYNVEQGNPATSRKALSNLIREGEAYYYGEGVDDESFRGVISVL
                     TRDRYDRLHARYIKESTAYIFLGAIPALFPYVLYRVKQSEVDALLRQRKASK"
     gene            complement(<1203162..>1204109)
                     /locus_tag="LMJF_30_3160"
                     /db_xref="GeneID:5653865"
     mRNA            complement(<1203162..>1204109)
                     /locus_tag="LMJF_30_3160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684872.1"
                     /db_xref="GeneID:5653865"
     CDS             complement(1203162..1204109)
                     /locus_tag="LMJF_30_3160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684924.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653865"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6X4"
                     /translation="MRGQERIWKAAPLPQAFHAALESGNWLRALQLYQRHPYHTPPAD
                     TFDLLKAIMHYTGVGIEDVKVRFNEKMRLSASLQRRKSEEVEWSLFWEALNKGDGKMI
                     SEALSGASVSGATQQIGMAEACAVLLKGAGKEWHTRIVDDLPFSTVTRCSLLHAALAE
                     KRPDVAAEMLSHARVTRSDLSSLWPLMAKCTWEEVLRMISACPKNAVPYNQALPFILK
                     QGCSLQTLSEHLEHARVLGDADVVAPLLAYAVEMEDWPYVERCVGHLVDIGKITPSAR
                     EAFGHLCKLHGPKRVCHRLMEHHVELSSMTIEDLESLRF"
     gene            complement(<1206594..>1207829)
                     /locus_tag="LMJF_30_3170"
                     /db_xref="GeneID:5653866"
     mRNA            complement(<1206594..>1207829)
                     /locus_tag="LMJF_30_3170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684873.1"
                     /db_xref="GeneID:5653866"
     CDS             complement(1206594..1207829)
                     /locus_tag="LMJF_30_3170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684925.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653866"
                     /db_xref="InterPro:IPR026504"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6X3"
                     /translation="MRAAKVKAAAADEALAAELAEQQRLEVKDTKMLQLVRDYPEVRA
                     LESQLKDAYLRKSRAEQVTDRSAAKALEVEEQRRYMEYLAEQDRLAKAEEEKKHQEDM
                     ERFRRHQAAQLEIIRQHRCAAMEEAKQREQERIAVDAVMARVQEQDFLETLARRDRQR
                     RIMEEQDEFCRLRAAIKKAEQDREAKEEAAIRAYLDEQARRKEMDDKMARERDVVKAR
                     ILEEQGRRIVEEERKKRELEELLQEYYEEERLTKEQMLIAAEKASRDRMAAAVNQENQ
                     KLIEQRRLAKEERLAEEMRFRQEAVEQMAAEAKLQQFNRQKQAEIKRQHIAEAQQRLE
                     ERRRLKEQEKELERKVEEQNRKQEEQIQEYIRRARAQLLAQHLPQLGSYAPVFALRDE
                     EKLQFLPQSKTADAALPAR"
     gene            complement(<1210509..>1210952)
                     /locus_tag="LMJF_30_3180"
                     /db_xref="GeneID:5653867"
     mRNA            complement(<1210509..>1210952)
                     /locus_tag="LMJF_30_3180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684874.1"
                     /db_xref="GeneID:5653867"
     CDS             complement(1210509..1210952)
                     /locus_tag="LMJF_30_3180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684926.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653867"
                     /db_xref="GOA:Q4Q6X2"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6X2"
                     /translation="MDSFGRMNSKAILFVSNISSIANAQYLERLFSAYGTVHHVELFG
                     EGPHRYAEVTYGTVDDADAAVAALHCHYQTCRNLPMIVLYSQKSPAVSVYGHQVGEEF
                     MKAAEEKRPPRPLMLDEFDSNYQRLGVQPPPSESEIILEHHTPGY"
     gene            complement(<1213144..>1214448)
                     /gene="HMGR"
                     /locus_tag="LMJF_30_3190"
                     /db_xref="GeneID:5653868"
     mRNA            complement(<1213144..>1214448)
                     /gene="HMGR"
                     /locus_tag="LMJF_30_3190"
                     /product="3-hydroxy-3-methylglutaryl-CoA reductase"
                     /transcript_id="XM_001684875.1"
                     /db_xref="GeneID:5653868"
     CDS             complement(1213144..1214448)
                     /gene="HMGR"
                     /locus_tag="LMJF_30_3190"
                     /EC_number="1.1.1.34"
                     /codon_start=1
                     /product="3-hydroxy-3-methylglutaryl-CoA reductase"
                     /protein_id="XP_001684927.1"
                     /db_xref="GeneID:5653868"
                     /db_xref="GOA:Q9Y0F3"
                     /db_xref="InterPro:IPR002202"
                     /db_xref="InterPro:IPR004554"
                     /db_xref="InterPro:IPR009023"
                     /db_xref="InterPro:IPR009029"
                     /db_xref="InterPro:IPR023074"
                     /db_xref="InterPro:IPR023076"
                     /db_xref="InterPro:IPR023282"
                     /db_xref="UniProtKB/TrEMBL:Q9Y0F3"
                     /translation="MRRSLLLACSAAKGESWASMSDTEIMKQVENKKIAFHGLEQALA
                     PDYDRAIAIRREIVKKKICPSPAATHPLERVPYKNYDWSSVVGQSCENILGYVPVPVG
                     LAGPLLLDGKEVALPMATTEGALVASAHRGARAINLSGGCRTAVLKEGMTRAPVVEVN
                     SFDEAITVIKFCEERFDVLREAFESTTRFGKLLSIKCAMAGRQVHLRFSAFTGDAMGM
                     NMITKGCDKALQVLQQHIPSVRVLTLSGNFCTDKKPSALNWVEGRGKSVVAEAVIKRD
                     VVESVLKCTVDSVVSLNVTKNLRGSALAGSIGGFNAHAANIVAALYIATGQDPAQVVE
                     SATCMTTVDKAGEDLVISLMMPSIEVGAVGGGTGLSSQRAMLELMGCAGSNKEDPGAH
                     SRQIARVVAGAVICGELSLLSGLAAGHLLSAHMKLNRKPPTP"
     gene            complement(<1216124..>1216462)
                     /locus_tag="LMJF_30_3200"
                     /db_xref="GeneID:5653869"
     mRNA            complement(<1216124..>1216462)
                     /locus_tag="LMJF_30_3200"
                     /product="putative ribosomal protein S26"
                     /transcript_id="XM_001684876.1"
                     /db_xref="GeneID:5653869"
     CDS             complement(1216124..1216462)
                     /locus_tag="LMJF_30_3200"
                     /codon_start=1
                     /product="putative ribosomal protein S26"
                     /protein_id="XP_001684928.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653869"
                     /db_xref="GOA:Q4Q6X0"
                     /db_xref="InterPro:IPR000892"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6X0"
                     /translation="MTTKRRNHGRSKPAHSRGRVKPIHCFNCGRLTPKDKAVGRFVVR
                     RMLDAASARDVAEASPVYGANFPMPKLYMKQRFCIACAIHSRTVRARPVGNRKIRYTK
                     KVPFRPGGKK"
     gene            complement(<1217140..>1219521)
                     /locus_tag="LMJF_30_3210"
                     /db_xref="GeneID:5653870"
     mRNA            complement(<1217140..>1219521)
                     /locus_tag="LMJF_30_3210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684877.1"
                     /db_xref="GeneID:5653870"
     CDS             complement(1217140..1219521)
                     /locus_tag="LMJF_30_3210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684929.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653870"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6W9"
                     /translation="MQFAAEDAAIEFCAQVAVAMFGAAGEPTDSILSCDVVKGKENKQ
                     IFVGDLVKTLYRVWVVQSNDSSDGLPRLGSLLEKESEDTVKFTAPASHQCVTASMRGF
                     EGMTVGMREGGQRLMVIPVRAKRGRGPNVSMCFYVEIIRRKDQQTSSTFQSHRGAKER
                     GPLLLTGGDCRTATGSPAQLLAINSGFVDGHPAMVASGFSKEQFLLVDRLRDQVFTLT
                     QQLRDTRRELDSLCADLKRHERQSGAQSLTRAQIEYSIEHLLAEGDTKKKVLEDKRAL
                     IGETEARNRELEARLAKFLQTTKTLGEETKAALDDSAGERIDLDRQLADTQARIVRLN
                     GEVEDLGRLLCGLEDTFRLTALKVKEEKLRLTLSITDHEGHEERLLRLQEKYSEEVAR
                     RKLLESKLAPLQEELRNLEDDTQLKESLTQQIRAKTESDRTHYAQLIQQEREQAAIEL
                     RQLKQDLIEELAARDRQYEEAKERVSTEAYEQGMAQGVEEGLADAANEGDVIAHDMAV
                     NAQRCKAEAAALQVRVQANCAANEADERRLTSQIESLQASLTRVLHDNNTLSAQLEAT
                     QEEHAVKVGEVYQRLVRLIRLCGAASISQPCLAAMMRAAESGAEFDPFRFQQMESARE
                     AQLARDERAAVAAWVQASVYNQPTHMPPLRPPFPYAPTSKGPVLSAETMGTKVLLNPA
                     VHHRLPVLTATTTSVTAETPAPIPSATPAAPGEVEPVIPAPSLALPPTPVAPAQPSEV
                     SESQQSEPQNTAAIEKASTRQRVKFPSTKIRYLGDSGAAGGTEATAHQRQPSL"
     gene            complement(<1220213..>1221352)
                     /locus_tag="LMJF_30_3220"
                     /db_xref="GeneID:5653871"
     mRNA            complement(<1220213..>1221352)
                     /locus_tag="LMJF_30_3220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684878.1"
                     /db_xref="GeneID:5653871"
     CDS             complement(1220213..1221352)
                     /locus_tag="LMJF_30_3220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684930.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653871"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6W8"
                     /translation="MLAKYGDLTVVKDDLTLLEKTESYIAKWRLNRWEFRVPPLLYPA
                     VREKVMLQQEILKALCLNRAEEHKHVLGDIQIVASITGISPESVREKNRAWLQEEASK
                     LRWKGEVNKAKELRDAFLRLEVYGSRDHRLLERLCCIYGMGMQGTFDEAFSNIIVQDP
                     STGKLAVDEANPFAELQAYILSRYPQIDLIHDFLGLNVVSGYRPSLGRFLIHCLSKKN
                     NISNPVSNGRVLLHVSTSKETLFDYGDSKNQVAHDDSIYGLPDFMYVRGNDIFLIIIA
                     ADNHWLRKRQVPHTKQLEGIARRCSFVLGIPFDKVRIRNLLLPPNYVDSSSLRRLTET
                     VFDMSPASVKEAVPWISLYEKGLDAQDVDYCELEKTVNEEEWLTL"
     gene            complement(<1222067..>1222492)
                     /locus_tag="LMJF_30_3230"
                     /db_xref="GeneID:5653872"
     mRNA            complement(<1222067..>1222492)
                     /locus_tag="LMJF_30_3230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684879.1"
                     /db_xref="GeneID:5653872"
     CDS             complement(1222067..1222492)
                     /locus_tag="LMJF_30_3230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684931.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653872"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6W7"
                     /translation="MLRRTAARLYRYQEFEMHNEAKYPFNYPREAPNTSVFHQYQLNF
                     WMFWGYGRQELWIDRDNRRYETTWEMFRRLVMWFFPCYFVFPFGLPKFIAANAFGEYG
                     EKPYLDAMMHSPMDNHYIEWGGSTLDAEWLRHIHSKESF"
     gene            complement(<1222893..>1223180)
                     /locus_tag="LMJF_30_3235"
                     /db_xref="GeneID:5653873"
     mRNA            complement(<1222893..>1223180)
                     /locus_tag="LMJF_30_3235"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684880.1"
                     /db_xref="GeneID:5653873"
     CDS             complement(1222893..1223180)
                     /locus_tag="LMJF_30_3235"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684932.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3235"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3235"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653873"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6W6"
                     /translation="MLRRSNRWCMKYANLELTTRGEFPHGMKEPGFVKKLDKNIPWYF
                     STYRSMYHWPVAGDGWSDLNEAEKHHDLHMYYTLAWWKLGEGIFDADDEDR"
     gene            <1227064..>1228848
                     /locus_tag="LMJF_30_3240"
                     /db_xref="GeneID:5653874"
     mRNA            <1227064..>1228848
                     /locus_tag="LMJF_30_3240"
                     /product="putative glutamyl-tRNA synthetase"
                     /transcript_id="XM_001684881.1"
                     /db_xref="GeneID:5653874"
     CDS             1227064..1228848
                     /locus_tag="LMJF_30_3240"
                     /EC_number="6.1.1.17"
                     /codon_start=1
                     /product="putative glutamyl-tRNA synthetase"
                     /protein_id="XP_001684933.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653874"
                     /db_xref="GOA:Q4Q6W5"
                     /db_xref="InterPro:IPR000924"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR004526"
                     /db_xref="InterPro:IPR011035"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR020056"
                     /db_xref="InterPro:IPR020058"
                     /db_xref="InterPro:IPR020059"
                     /db_xref="InterPro:IPR020061"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6W5"
                     /translation="MRRFLPMCMLVNIHLKALTLSNTYFTAAPQREGNEKLQLSSAEK
                     GKVVTRFPPEASGFLHIGHAKAALVNRMLADAYEGKMLFRFDDTNPSKEKEHFEAAIE
                     EDLKTLGVRYDSGPTYSSDYFDLMFEKAEDMIKRGLAYCDKTPREEMQKCRFDGIPTK
                     YRDASVEENMRLWREMKKGTKEGQITCLRAKVSIDDPNKAMRDPVMYRVSMIPHARHG
                     TKQVAYPTYDFCCPLVDSVEGVTHALRTNEYHDRNAQYYWFCDAMGIRKPTIEDFSRL
                     NMEYSVMSKRKLTKLVDTHVVDGWDDPRLPTVRALVRRGMKIEALHQFVAEQGMSKSV
                     NFMEWSKIWYFNAQILDPTSPRYTVVSNTLKVRCTVEGQRNMAAAKKPLHKKDPSMGE
                     KTYYKSDIIFLDAEDVVLIKDGDEVTLMDWGNAYVKDIRRPSADALPTEATIVLHPEG
                     DVKKTKFKLTWVPESDKAVILTLNEYDNLLTKKKPDPEESIDDIIAPVSRYSQEVIGE
                     EALSVVKKGDIVQLERRGYYIVDDDEAEKKVLISIPDGRDKVNHLSAKAQYLKTLPKK
                     ASAADELAAKRAAKAAKKAAQKAATKSS"
     STS             1227179..1228745
                     /locus_tag="LMJF_30_3240"
                     /standard_name="D1S3695"
                     /db_xref="UniSTS:474273"
     gene            <1229843..>1232920
                     /locus_tag="LMJF_30_3250"
                     /db_xref="GeneID:5653875"
     mRNA            <1229843..>1232920
                     /locus_tag="LMJF_30_3250"
                     /product="putative ATP-dependent RNA helicase"
                     /transcript_id="XM_001684882.1"
                     /db_xref="GeneID:5653875"
     CDS             1229843..1232920
                     /locus_tag="LMJF_30_3250"
                     /codon_start=1
                     /product="putative ATP-dependent RNA helicase"
                     /protein_id="XP_001684934.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653875"
                     /db_xref="GOA:Q4Q6W4"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6W4"
                     /translation="MPKKATISFADLGLGTPLPSVLAKSRDERRKEQRIKKEERKERT
                     REAMAEIAAARDIVEQHKRLVEAEAAQERKLKEMHKRELRVEHLKARCEREESHRQHT
                     AQLHVTQKKIITELMTARREEEAEMQRVQALLERETAERAKAAPANVHIEIHRTEEVK
                     QQRAGLPVLREEQPIMEAISETRRTCVLVCGETGSGKTTQIPQFLWEAGYGHPEGHPF
                     GREGCILVTEPRRVAAVSMAQRVAEELNVSFGKEVCYHVRYDNNLSDKCRLKFATEGI
                     VLKEIQSDFLLRKYSVIVIDEAHERSISCDILIGLLSRVVPLRNDLFEEELRKHHGDV
                     DKTSIKPLKLVIMSATMRVTDFKDNRTLFPITPPLISIEARRYPVTNHFARRTELKEY
                     VDQAFNKVRQMHKKLPPGGILVFVCTQQEIEDLCGRLRRHYAATKIEYYDNAYSKHRL
                     LTGRSQEETAAASSDSEGDGAATVEESEEKDEYGLHTTDYALDDENVTGGNSEEIETV
                     QEGRLRRPPQPSGGRGKHPRGEAGARLAGRNHWGRSDEHSAVAAEGLTIFPGDEEQEE
                     EVNGEFNTLHVLPLYALLDFQKQQEVFKPPPKGTRLCVVATNVAETSITIPNIKYVVD
                     AGRAKSKVIDEETKASCFRIEWTSQASAEQRSGRAGRVGPGHCYRLYSTAVYANLMAK
                     HGDPEVLRTPLDSVVLLMKHIGVKNVGGFPFPSPPRESDLKAALQHLSVIGALDAANN
                     YNITELGRQLVAYPVPPRFARALLEVLQQQKARSADVQDMVAAIVAVATTTTNVFTGE
                     GNQLKARKLNELADTPTDPRQGRIRSLLNPGSDLVTYLNAFYAYRSDPRHSCGMFCLV
                     QKSLHEARLLYTQLRSQMRQHNKEQDELVDTLDEGEVTMHEKGEQKIGSHTSGGCPLS
                     KDTELLLRQVFIPGLMDQVARRATVHECRSLAVEYNDKRATKAPYLVLGANRTIAHIH
                     PTSAVARTFPPPEYVTFGFLQKVRRSDTKEAQTMMMGVTVVMPEWLRAYGFEE"
     gene            <1234008..>1235243
                     /locus_tag="LMJF_30_3260"
                     /db_xref="GeneID:5653876"
     mRNA            <1234008..>1235243
                     /locus_tag="LMJF_30_3260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684883.1"
                     /db_xref="GeneID:5653876"
     CDS             1234008..1235243
                     /locus_tag="LMJF_30_3260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684935.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653876"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6W3"
                     /translation="MNFGVIGGQQGPKALLDAVQQAVRDGNLETLRRLSKEFLAVSDN
                     VEKCRDENGNTIVHLALGKNTTTLEYVIESLHANVNATNAQGRTPLHEAVTQDYIACC
                     QVLLDHGADDTIQSTTQSTPFHTAAACGSIEGMEVILRHSGNPEVKVNELDRQRSSAL
                     HKCAFDGDVRVSRWLVEHGANVDAADSTDATPLLIAVKMGQTEVAEYLLRNGADCNRQ
                     DRRGNSGLHFCAVRGDVKAAQLLLAAGADPRLLNEEYDTPLHIIARNSHLDSGAWEMV
                     GLLLMAGCDPLQVNASNKKPSDYVSRGLKKMFTKEEVEQRLRREAQLQEESDAELAKA
                     WEQCAQWKTKVLENISSRRLVEAAEDARLAREKEERIRAANDARMTYDEEIAKCQFLE
                     AEIQRKKAMLEKTLTKSGR"
     gene            <1235814..>1236440
                     /locus_tag="LMJF_30_3270"
                     /db_xref="GeneID:5653877"
     mRNA            <1235814..>1236440
                     /locus_tag="LMJF_30_3270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684884.1"
                     /db_xref="GeneID:5653877"
     CDS             1235814..1236440
                     /locus_tag="LMJF_30_3270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684936.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653877"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6W2"
                     /translation="MERLFFPISLWSRECILSTSLTHSHLRSATLLNEVRRTKRIVGM
                     KSVKERDVAGMAAFELALQYSFIRQDRSYHFVQLLTALCSFVFFSQLTALNVLLVLPP
                     LVPSVEPYVEFLRAYSHPLLAVLSLVALLLIRASKKRFVIEPGEHTMERLNRDVLEPC
                     LGMKFDTRTGMLFSDCRAGSLRGRENYYSLRYLDDPPQPLASATEMEA"
     gene            <1237391..>1238506
                     /locus_tag="LMJF_30_3280"
                     /db_xref="GeneID:5653878"
     mRNA            <1237391..>1238506
                     /locus_tag="LMJF_30_3280"
                     /product="putative serine/threonine phosphatase"
                     /transcript_id="XM_001684885.1"
                     /db_xref="GeneID:5653878"
     CDS             1237391..1238506
                     /locus_tag="LMJF_30_3280"
                     /codon_start=1
                     /product="putative serine/threonine phosphatase"
                     /protein_id="XP_001684937.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653878"
                     /db_xref="GOA:Q4Q6W1"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6W1"
                     /translation="MVLPWKKSLSVLLSAALIIAAFAVALSAEARRLVAVGDLHGDYE
                     QTVSVLRLTRLIDKRNHWIGEDALLVQLGDILDVGPDDILIVRLLMRLQQEAHAKGGD
                     VIELLGNHELRNFRGDYKAVDKASLAASGGQKGRDVLLSNATDLGRYLRTRKAVFHYG
                     PFLFMHGGFSTATAGMITSLSKVEQFNSELTKALLNGTISPLARNGLDLTEDDVDDVA
                     NPILVRSILTVKCNALSKVLDKKFPGIQSVVVGHVPHDPRDFDGWRLCGGRLIDIDFG
                     MSRWKKGDPGHVAALEIEEATWHVQLIETSTASSLVSGTNAPFPDSVAAYYLVSFSVL
                     IVVGVVGVLLAVYCLPLCYAAACEPLLEAGTNQYGTV"
     gene            <1239874..>1242996
                     /locus_tag="LMJF_30_3290"
                     /db_xref="GeneID:5653879"
     mRNA            <1239874..>1242996
                     /locus_tag="LMJF_30_3290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684886.1"
                     /db_xref="GeneID:5653879"
     CDS             1239874..1242996
                     /locus_tag="LMJF_30_3290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684938.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653879"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6W0"
                     /translation="MPKKEKEKRAPTPSVTPPGTTEEECLLEVHLHWDVEAQAVPDML
                     VLLRLCQEDHFILPRQLPVDANSDCAADGQQQSHQQQPSAAPPLLLLVKQTVIVGGPT
                     VRHTLLNDSKANRIDVYALPSAGIGDDAGGKQAGGAAGKRFKSATPTVTKSKGKAAAG
                     LTALPDGARHIGGTTLLFVPLLSSSTMDVSVPLAAGSLVDADDCLNFRVRCHDSLLLS
                     AQCMSQCRPVLVRVYGVSGLPTLESTSGSSSTKDIAVAATADSRRRLRACVTLAGGCV
                     TAPILPITPAISAEEAVAPSSSPPHRPTATFHDHILFLHELGTPLDVYRKLYSAPCEV
                     SLWQSFEMDAQGTAAAAASAASPPEKGTEVLLGSGSFSVRDFLTDDQTRFTETVQLLP
                     GRSTVNLAKDSTCLTTGCSVSVRLDFFQPFAPLQHVDKEGQPLPRKVFLTRALVRLPY
                     SAPWIADFLTLLLREATALPRATEDVQLYLPPPPPPPPIETAEKEKPAGGRSGTTHAR
                     GAAPLAASSSSKRSGSGSGNRKAVKASGRPAPADPVPTPPLPSFAGELKVYSPPGLSG
                     FEVADGEERLWCFEATVPELQRVLSQLGSFVEARGGAKSQVHIHFNAELFVPQRAYLK
                     FPPLVVPAAGMAAASPPPSEADDTSVALEVEPSGTGGRLHRIRLRSAVGALCQRQSHY
                     VRHNLSDDCLQCLLSLAALLRAASMREVEMRGWMPSATLLIAAERSFGQTLEKEDLFG
                     VTFPTPAASQTAVAASGSMDDTTDRASESNASGAAASLMAEAAVGSVVFFDGMLKAGT
                     RRPVPAAVLLRFPVSFWMVVTKTKEEVLCTFPHNTPTGLVQYHIEGQVVRCSTVTLLY
                     VLKCLCLARSVTQSHNAAYELVLRQRQREQHVLQQERMAQSATGKLMAVRRPSADAAG
                     DGRDALCRSLDKTRGPAVSQIRGTNSSDEDGAEEADWLDSSMDRHLYTSSASPSRSSA
                     LSRRLRTDRTSSHKTLAHTTQRRQVPGVSSSPTELTYDDLWRMYEQRAPSSATAAPAR
                     GHEKLPPIRF"
     gene            <1244166..>1245443
                     /locus_tag="LMJF_30_3300"
                     /db_xref="GeneID:5653880"
     mRNA            <1244166..>1245443
                     /locus_tag="LMJF_30_3300"
                     /product="UV excision repair RAD23-like protein"
                     /transcript_id="XM_001684887.1"
                     /db_xref="GeneID:5653880"
     CDS             1244166..1245443
                     /locus_tag="LMJF_30_3300"
                     /codon_start=1
                     /product="UV excision repair RAD23-like protein"
                     /protein_id="XP_001684939.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653880"
                     /db_xref="GOA:Q4Q6V9"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR004806"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR015360"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6V9"
                     /translation="MKVILKTITGKQHEVDVEATSTILDVKRLLEDEYEPASLRLCFN
                     GAVLEDSMMLADAGVKDNDSLVLAGRKRKIPKPPAPQTAETPTTEAAPESSAPASSTP
                     PPAMSAPALTTTSPATSAAPVDPPAPAVPTAAAAPVTSTTPAGPAVPAAPAASTTNTY
                     GVAPNLIDEVASMGFEDRSQIALALRAAFMNVERAVEYLFEGIPSHLVEELAPFSAPA
                     APAAAPGASNPSASSATAVAPASASPAPAATPSSAESEMRAALSRIPQFDEIRILYNQ
                     NTDTLPVVMQQIALRHPAVYEQIERDPEVFLSIMSESGQPGTASAPAGSAAPSTAQAV
                     AGDAEESSFMNQLQSGLELTAEDRTAVQQLVELGGGMWDEQSAALVYLATQRNQEVAA
                     SVLFEHGGVPAELLAEIATQMVDEEAEDYEDEQ"
     gene            <1249633..>1250709
                     /locus_tag="LMJF_30_3310"
                     /db_xref="GeneID:5653881"
     mRNA            <1249633..>1250709
                     /locus_tag="LMJF_30_3310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684888.1"
                     /db_xref="GeneID:5653881"
     CDS             1249633..1250709
                     /locus_tag="LMJF_30_3310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684940.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653881"
                     /db_xref="InterPro:IPR003409"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6V8"
                     /translation="MMYTGEIENGQMHGRGCLIYPNKEKYEGDWVYGKRHGHGVYTYA
                     DGSKYDGEWVEDKVHGKGTCYYASGNRYSGDWTFGRINGRGTLEYADGDRYDGEWKDG
                     RMHGKGLYYYSNGDRYDGEWKDDKRHGKGTVTYAGPDGSVSEKFDGDWVEGRMQGWGK
                     YYYADGGVYEGEWQDGKMHGKGTYIFPNGNKYEGEWCDDVKQGYGVLTYVNGERYEGY
                     WLDDKAHGTGTLTYLQGDRYTGEWYQGKKHGRGTLAYSNKDTYEGEWRNDSATGRGVL
                     EYANGCRYEGDWLDDRRHGEGQLLLPDGSSYEGGWVNGKKEGRARIILKCGAVFVGTW
                     KDNLIVGQGEFYLSENCDLNNPDY"
     gene            <1253213..>1254289
                     /locus_tag="LMJF_30_3320"
                     /db_xref="GeneID:5653882"
     mRNA            <1253213..>1254289
                     /locus_tag="LMJF_30_3320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684889.1"
                     /db_xref="GeneID:5653882"
     CDS             1253213..1254289
                     /locus_tag="LMJF_30_3320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684941.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653882"
                     /db_xref="InterPro:IPR027267"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6V7"
                     /translation="METLKGFARRTTQSLREMVSRTEVSPEEMRLTEVMTKVRILETK
                     GEMICEKVIQAARLMGELGKTLRDIGEEYKGVPDLPKESRELAEDVFEVGVKLVETSQ
                     EHQKGLKDNGFELLRSFAKQCAQLREVEDARRHHQLEYDFFKSKVQYLRSSPQRDFTR
                     LPRNEQILENWRVELWRATEHSKALCSELFVSGRQAIDRSVLTTIQVLHSFVEIASTG
                     FSQTFQGVRLPTYPKAPVLPPAALPPAPAPSTPYAYSSQTAVAVSTGAIIPTSPAAQV
                     PMPGASYASTPLLSPGNPPGPVAVPQQSPLAPATGTPYEGAPSYAVAPEAAGSSFARY
                     QPPPLGMHTSTDNGTTTYQPPPLQ"
     gene            <1256749..>1257921
                     /locus_tag="LMJF_30_3330"
                     /db_xref="GeneID:5653883"
     mRNA            <1256749..>1257921
                     /locus_tag="LMJF_30_3330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684890.1"
                     /db_xref="GeneID:5653883"
     CDS             1256749..1257921
                     /locus_tag="LMJF_30_3330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684942.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653883"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6V6"
                     /translation="MQRLVLSRRNLDGCGNTLAIVVTEVYVGGTGAQPKAEVFAQDCV
                     TQVVFVKEEVIYMRLKGMSAFAAPSRLTSPPPPPPQTNGSSATCGAIAACSDRTSQPT
                     ATATASSLLKGSATSKNEAELATEVKRSAPKTSEPPAATAKSAATDATTQQAISDGAD
                     TAAAPTTAEPLAPKAEALRRRRGWGPEAYELFPENYMSTPGKRPRMVRSEKKTTSAQA
                     AKCSKTESSNAAVASTKAGGGEESSDKQAPADKHLGWGPEASKLFADNYVSSPEKLAR
                     RKRSQRRVMDESAESAAPAGAAALPKSALKAPVSRALQYPTADTEEGRTTVGHAVDNA
                     IVVDETSPAVELPKGWGRESLKFFDPNTYCDDPAKARLLPNMDYSRSRRHRRPATL"
     gene            <1258906..>1259478
                     /locus_tag="LMJF_30_3340"
                     /db_xref="GeneID:5653884"
     mRNA            <1258906..>1259478
                     /locus_tag="LMJF_30_3340"
                     /product="putative 60S ribosomal protein L9"
                     /transcript_id="XM_001684891.1"
                     /db_xref="GeneID:5653884"
     CDS             1258906..1259478
                     /locus_tag="LMJF_30_3340"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L9"
                     /protein_id="XP_001684943.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653884"
                     /db_xref="GOA:Q4Q6V5"
                     /db_xref="InterPro:IPR000702"
                     /db_xref="InterPro:IPR002359"
                     /db_xref="InterPro:IPR020040"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6V5"
                     /translation="MVKVKSLCTLQIPEGVTVDVKGRKVTVTGKRGTLTKDLTHLQLD
                     LRVDKKNRTFTVIRWFGSKIPIACLNTTKAHVQNMITGVTKGYRFKVRCAYAHFPINV
                     SVDGQNIEVRNFLGEKRVRRQLVPNTVKVSQTDPSKVKDEIVFDGNDLEQVSREAAVL
                     HQMCLVKKKDIRKFLDGIYVQTKTNIEGTE"
     gene            <1260417..>1261382
                     /locus_tag="LMJF_30_3350"
                     /db_xref="GeneID:5653885"
     mRNA            <1260417..>1261382
                     /locus_tag="LMJF_30_3350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684892.1"
                     /db_xref="GeneID:5653885"
     CDS             1260417..1261382
                     /locus_tag="LMJF_30_3350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684944.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653885"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6V4"
                     /translation="MRCTPVRRMSMWDSPVFEHNPLTRYWKKMMDRTGNTLSSQSIPR
                     HIHGYLEGSNARTESHIRWFPYKQEMTVEGRYIPTFKDVIYTHYFPKEFNDDERVKYI
                     SIKTGRSELEVADEIFLMRKMKLFTAQLLRNKLRSRPLRMPQGVDYSGIERRYTIGVS
                     KVAQAMGMSMYSTNSYDPVLMYSPYLDMGDCVDLIVTKQLRTSLQYLLCDIVVHRGIH
                     RARLPHLKGEPKEPLCHIEPCLYQFIKLRLAVLSLIAKQEQYVVDHHFDGNHRYGGCL
                     IHLFPSPLDPEIIDHHVEHIELDLELAQTWMKHYYDHYIAPRRSA"
     gene            <1262273..>1264450
                     /locus_tag="LMJF_30_3360"
                     /db_xref="GeneID:5653886"
     mRNA            <1262273..>1264450
                     /locus_tag="LMJF_30_3360"
                     /product="putative calmodulin-related protein"
                     /transcript_id="XM_001684893.1"
                     /db_xref="GeneID:5653886"
     CDS             1262273..1264450
                     /locus_tag="LMJF_30_3360"
                     /codon_start=1
                     /product="putative calmodulin-related protein"
                     /protein_id="XP_001684945.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653886"
                     /db_xref="GOA:Q4Q6V3"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6V3"
                     /translation="MSLSKRPDDVMDGTGDREVATILRSLAPEEVDMLRDTFIYMDRD
                     SDGFVSREEMMAKVASCVGAERFPPLQEYLVPLFQVADKDRDERLSLTEFLMAFADGP
                     GVVPAEVVNSCVADVQVRLTDEEVSALQSNFNRIDTNQDGVIDSEELEVALRTYLAPT
                     FPDLTDENFKEIVSVVMASADADQNGVISLSEFIRSYQEDQGVLPATYLEPTQKSLVG
                     ARQLTDDEETVLREAFAVLDRNNDGFVDLEDLYLVLSDALGSATEEESQIRDLCHLVM
                     RSSDRSKSGQLTVTDFVRSFLRNIQLMQIPVALAHERVRVACEKLQQMQDSGELERLV
                     KVFEDLDSDGDGFVVRSELVKVLKVLFHDAFPGWDEEMLTSVMTAIVVGAERNNGGRL
                     SLEEFIRSFVDGPGVLPPEAVKKWDSVPRRGSYSTEDALKQSCYRPSTATDADLGLIG
                     EALSRLYAEKGADGVITEDELHSGIAELYVDDPNRGEEMFHFALQQFVLPRKDGGLMW
                     SANVLFEDDVEEEVRGMRASGLDPSDSAVMRSSTSSSRRPRASVLVSANEVVEPTPSA
                     PSRTAWMSSTQSPKHQILSPAADAMVHTAAPWSQSSSDKALSCTYAQPKRIDEAAMTP
                     AASVMHDWGEKRPLSVNELCSFRPDSTILTEKLKQQFDYYDIEQKGYLDRDTFKKIYA
                     TMENYGLDPSPMEVDRRFRRYSRMSDKIFFNEFCILMLQRARL"
     gene            <1268132..>1270009
                     /locus_tag="LMJF_30_3370"
                     /db_xref="GeneID:5653887"
     mRNA            <1268132..>1270009
                     /locus_tag="LMJF_30_3370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684894.1"
                     /db_xref="GeneID:5653887"
     CDS             1268132..1270009
                     /locus_tag="LMJF_30_3370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684946.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653887"
                     /db_xref="GOA:Q4Q6V2"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6V2"
                     /translation="MGGCCKGARCPFSHELVQLPPKGVDASGGYFISGNVANYRAAAS
                     TSTASPSSRSFVGRWDDPTASSSTDGLSTLASPSSCCVTTGTSLSAEAKEWVGADSAA
                     TSSSANSATASITSVQSLRGAASPTFCVSSSSLRYRSAALRRTAQQVSPLPMPHSQRD
                     SQPQPQQAQTQLQSQQSQKPQPSPPQPQLHQQHKRQYQPPPQPRSVANALSALLPNHS
                     ESSAAAETRHTSAAPAHPAATARTVSFTQSSNGSGSTTIAALASFFDMQRVSTGAPSA
                     TPSSAASQPSKVVFATRRDDQTPATAPTPATAAPPRYTAACITLAASNQRFDPSPSAP
                     SIPTTATPAPAHGSSRSATTSQHMEAPLPRSREALATGAEHQTATVAKAHVTQSAAPP
                     SAAAAPTSPPQYESRTASSAQTRVMPPAPRSQQQQAAHQAQQLRAQEEAQRQVQIQQQ
                     LHAQQQAQQLAQQQAQLQQFQQQIQPQKPPPPQQTVYMLTTSRPPTTSTPPHEGIVAP
                     DQLPLGYTLAYAVSTPTPTASAATPILISEQPSAARPTYTLLSSCPPQSQLQSFQTAK
                     GTVLYATPAQVLTQAAAPSENDAPRLILVNTDGTFTVLQAETLAATAGLGLSPTIMRA
                     H"
     gene            <1278599..>1280182
                     /locus_tag="LMJF_30_3380"
                     /db_xref="GeneID:5653888"
     mRNA            <1278599..>1280182
                     /locus_tag="LMJF_30_3380"
                     /product="putative PAS-domain containing phosphoglycerate
                     kinase"
                     /transcript_id="XM_001684895.1"
                     /db_xref="GeneID:5653888"
     CDS             1278599..1280182
                     /locus_tag="LMJF_30_3380"
                     /EC_number="2.7.2.3"
                     /codon_start=1
                     /product="putative PAS-domain containing phosphoglycerate
                     kinase"
                     /protein_id="XP_001684947.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653888"
                     /db_xref="GOA:Q4Q6V1"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR001576"
                     /db_xref="InterPro:IPR013767"
                     /db_xref="InterPro:IPR015824"
                     /db_xref="InterPro:IPR015901"
                     /db_xref="InterPro:IPR015911"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6V1"
                     /translation="MYQDSKILMIFKSLRDIVVIGDNDMVITDMNAAAVAFFGWKVDD
                     VKGKSITFLVPTHPLDVQDNTVTLMAHLANSTDVPVVIQTTRDPHATVVAWTILPIRL
                     PRVYEFGVHINIRAALTPKLSVSDLDFKNRTVFLRVDFNVPFDRETGAIRDDSRICAA
                     VPTIRKIMEDGGRVVIGSHLGRPKKPNANQSLKRILPRLQEVLEKEVTFCTDAFTAGK
                     DVKKMRSGDVMLLENLRFFKGEDSKDAAERNKLASALASFSDIFVCDAFGTVHRMTAS
                     MTGVPRVLGAGVTGFLIEKEISAISKVMRNPEQPLVAVVGGSKVSDKINVLSSIFNFA
                     HTVIIGGAMAYTFLEAQGYSVGKSKVERVVREKGRDVDLHNTARDLMDLAKARKVRLI
                     LPIDHSCAKEFKDAEPFVTNNADIPAEYMGLDYGPKSIQQAKKAVAEARTLIWNGPLG
                     VFEFSHFATGTNAIAESIKDNKQVVSIVGGGETAAATKDYHECITHVSTGGGAFLELL
                     EGRALPGLICLTARASPKL"
     gene            <1283405..>1286332
                     /locus_tag="LMJF_30_3390"
                     /db_xref="GeneID:5653889"
     mRNA            <1283405..>1286332
                     /locus_tag="LMJF_30_3390"
                     /product="putative CAS/CSE/importin domain protein"
                     /transcript_id="XM_001684896.1"
                     /db_xref="GeneID:5653889"
     CDS             1283405..1286332
                     /locus_tag="LMJF_30_3390"
                     /codon_start=1
                     /product="putative CAS/CSE/importin domain protein"
                     /protein_id="XP_001684948.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653889"
                     /db_xref="GOA:Q4Q6V0"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR005043"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013713"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6V0"
                     /translation="MQPINPNDRNTQAQFVEIACRAVSPDPTVRTPAERELLAYLDAV
                     DQQSGLPQLLLELTHGETPHDTFFAISFKNMVKKCWDPSTSEHCVQECDKVAVRATII
                     ESMLRSSGAVQRNLAEAIALIAQVDFPTAWADALSLIVKVLTSGNDVAQLRAALSTSH
                     SVLRKYRHQGELTEALVHELRAIYSLLCPALVRSMESLLLTTETQGANVTEVYKGITD
                     AVECLRDITSLDLGDEFIERIGPIVSMYNQCLSRVSAPSALYGAQASAMIDMNSAVIA
                     CMTHWLNSFDEDFEKFAPQFIEVVIGMLANQMSSDPSMDDLVVCSLELVSSACRGTTR
                     SHLNAREKLQYILQFIILPNLALREDDLETYTSDPDEYIKKNIEGSNFHTRRRAAVEL
                     VRSLLLYLPEVARPLLAEVTTSLLQTAHGDWRAKDTAIYLAFVLVVDGQLVNTQRGVT
                     AQQLSEIIPVAQILDGHVFPEVRCDLSAQSPGIVKADCMLVVAAFRHLIASTAYEFLV
                     PALTRHIAVGDAVVMTYAAHTLKCFLSITEASAAAALEAVFTGNALSILEGLCVRIQQ
                     TEAPNPYLMQYLMSVCFRFPKLVAPFAAQVMASLHTPLYRAVRNPSNALYSHCMFEVT
                     SKCVALQPGARAEFEGMLWPNFAHVLRENVVEYVPYVLQIFAQLVRTYQSSDAAQRWA
                     ENPAENYQALVCPLTQPQMYEMRTQIPAPVCLLCAFVEVYPGYMHRTGLTNPALNVFN
                     ILVRLKNYDNEGLNILTSMLLAYPADVMDVYMDTVFKVLMDRLQSSSTPKYVRILILF
                     LSVVVVQRRDADYLANRLNNIEGGLFMRVLGNVWLPRVQKITGDVERKTCVVALARLL
                     CESTALQSDTAAWVTSASSCLRMLHDGVEPDDHISFTPAASAAPNPESLLGSAIGADE
                     LTSSFHPLREAMQSPRDVCSHVPDAQAFFQTELSSFLKGRGAHLSASLKQWLGPHTPT
                     WLP"
     gene            <1290337..>1291041
                     /locus_tag="LMJF_30_3400"
                     /db_xref="GeneID:5653890"
     mRNA            <1290337..>1291041
                     /locus_tag="LMJF_30_3400"
                     /product="hypothetical protein"
                     /transcript_id="XM_001684897.1"
                     /db_xref="GeneID:5653890"
     CDS             1290337..1291041
                     /locus_tag="LMJF_30_3400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001684949.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653890"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6U9"
                     /translation="MKLHLEGAYEELCAEYNTTPLCSFRSSLRNTYASPDGEVFIDAS
                     YIEGDNFCVFAELLRRLLRRPVAFIKPTIVQLGTAAPPLDHSALYVPEGQVGRVYYAV
                     PPRLLRIKLLLSRNVNNADVERVCRLIVAQKVLDCVPFQALHSNSTKANVQATGILPQ
                     LSWPERAAIESIDLHNCVFVSLPGGRALRAAARRNVYVQNVFLEGCSVNAAVVAQIAR
                     ATRGNREQFRLVCASS"
     gene            <1293238..>1295091
                     /locus_tag="LMJF_30_3410"
                     /db_xref="GeneID:5653891"
     mRNA            <1293238..>1295091
                     /locus_tag="LMJF_30_3410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684898.1"
                     /db_xref="GeneID:5653891"
     CDS             1293238..1295091
                     /locus_tag="LMJF_30_3410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684950.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653891"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6U8"
                     /translation="MATVYTSVPGKDFAKGVTLDEANRIVRVDAGLPLLSALQVGMIV
                     RSIGGVPVGDGRCEQARHHSNRSQVLVVLGAPPKDEFDLCSDDDDAANLKPPSTLPPL
                     PPEFNNSVAQNSSGVVYEATVKCGEGGCVIIMCEGANPALAITLAAEKAKAEVMYIDT
                     VARMKTRQTLENAGEVLKKSLEKGLWIYVEQATKSITLLRQISDCIMEVRAAGKMHAQ
                     SRVLLMCEPHPHFPEALMRGSVTLRSRLQNNNMAEVDIREDLSESAHRKQAIHGDDVA
                     SSETAAKPEVTKTRKKVRISNQVNIVHLEKSTFMEMSASAQPPLESGTSHDGISRVAK
                     YSFGSNENLISLSYVRDHRFAIGTNSGYVVLIDRNGLPLIQFRPHKACIWDVSFSSQF
                     DFSTACEDGTSVIYKYSLANQELTTVSVASFQNDVFAVTYANPNDVNSGVLSGGLSAT
                     VCVLHSDRQNSSFIACRTSIQAMCATQMNQVIVGGGTGACTLIDTNHCVVTDITHAHN
                     KKVPAVGTHGNVAVTGGFDCVLRLWDVRNGFHLTSQRQLNEVITAVAMNERYISACSG
                     SSLYVWDPRKMDRTLAVKANAWKDLTRGLVLDGSTIVTASVDGVARIWEVS"
     gene            <1297540..>1300161
                     /locus_tag="LMJF_30_3420"
                     /db_xref="GeneID:5653892"
     mRNA            <1297540..>1300161
                     /locus_tag="LMJF_30_3420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684899.1"
                     /db_xref="GeneID:5653892"
     CDS             1297540..1300161
                     /locus_tag="LMJF_30_3420"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684951.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653892"
                     /db_xref="InterPro:IPR008862"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6U7"
                     /translation="MSTGADAAGDGGDVAAPKDAPAPKQRVRISDSMRELSADLQQLE
                     DLGLSLDPLRPPSSDSVEHILITDSWSCSMCGTTGAAICPLTGKPHRRRLVSIAQHAL
                     RLIELHVGKMYVRPAPLSKRVGGEVQVRIQRRLTMNPHTFLLAFYFASQASTAPEAAA
                     DGARAPPLSRKSGTPGSRGSAEWTGECARHLLDVVREIKVYGASPTDDAYCHSLLKSM
                     RGAWLQYSRQVKRELATDSASEFESPKSRLGDESTQASPPQTGKARDELVSCTRATLI
                     EAVAHSRKDPDNHDLKRFTALLYQRLSRLCTADEFADVKRRVEQIEAYDPTRRIEYAT
                     PPCVMLDANTTASEDEAGGATAALAGSSTPGGATASGCERRHAGPELPPGWYVDERGI
                     SRPPADHEERKRRERYLQKEFKAQKAYEAVMQMETDKDKPERPQARMAAALTQAELQL
                     LATDLNTTPPHLQRLFGLLALVEDRFVEALPPRLRPRLRQEFHDVLDWNIIQRQARGN
                     ARNISNLVRFVGEKVIECSSPVREATMMARMSAVCDNIEHCTPDVGTAVANAFAFLFE
                     AIRELREDVAKFSLVMINASLKQNAVQYIQEFISACLPLPRKWVHSIAFLQRFINDER
                     VLLWSSVSVPLAWTSVTAEERRVRGALLIGTLDLLRSGRHTSLDRWVDLPPEIFYFEK
                     HIIFKAANTVQECTLLLLLDGAISSVLARRAMKPSTVSTVIRHLHSQIMSLLAEDIRL
                     DTLKDSVIDFVESQLYHLHVGEAAPDDTASLAAVAPKVTLADTEKQTVRSTIDKMTNT
                     EDPLYVTFERRVLQFMEAMLVRNTDDVAPLGLVTDTLKQQVQLLRHMLVFHWEVYMPS
                     YRELLPSLSLESTATVT"
     gene            <1302278..>1304668
                     /locus_tag="LMJF_30_3430"
                     /db_xref="GeneID:5653893"
     mRNA            <1302278..>1304668
                     /locus_tag="LMJF_30_3430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684900.2"
                     /db_xref="GeneID:5653893"
     CDS             1302278..1304668
                     /locus_tag="LMJF_30_3430"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684952.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653893"
                     /db_xref="InterPro:IPR022039"
                     /db_xref="InterPro:IPR022040"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6U6"
                     /translation="MYPHSKQSMASTIQSFVTETKIEEKGLKLSELRRLPNSNQVSIV
                     FDGNRVLDDVVQDVHVTGPLTIFTASTPWSAYTIISEYTEMVRKLGEYFRACDADFKP
                     MFVFNGCGFHPMEDQDTTSPAPPMEVASYSAYNKNKTVRSVPAEAQKKFASRFAIEED
                     VEGLIVRKLCEVAEETMRAPYLAWSQISAFFAPSNTMTSETFGSLELLAFPGIDRVIT
                     NIDVDAGTFDCVSKASMMAALRRRYDAEFSEDDFSAIALYETKNRLFRVKNRRETFDD
                     LCRLPRDPTRVDAFMKQHRVGEDQKLLLRRNLGALDAPVFTVDAQLVPLSTLHNRPRR
                     CEIRPIFGSPMPIVFFYLFMSGPLLPLPFAIHSQEVLADDWPLIDTSAYRRAAESILP
                     LRVQVVFQLFPIAPKTSDFYWIRQYVVFKKQQQAPESQSRVCKLSNPPTIDLAYWSFM
                     EEELLQSTRDADNVYFTDIVSFCGCAVAEPVIYKSVQATLAAVYLRSLDFLGYFTHAT
                     DGAESSGPSVYCKALERFDCPTLSEYGVLLIELMRTGTLNDDPLVVVLNRVDDTIPMG
                     VRFASRLVSIIPANVCGPWSGPFDPEMAAFGVISRLFSRTLRVLHEVVAMLLFANRAT
                     TVPWDQFNNVVQRLPFNFPAEFSAGFLMTYVLCNPQCTMEELCTTFPEMYALDTDLQT
                     LFWFFTMGFEAIRVINYEEPLSYDMVQVVNAARRLVGQACERLCPDVFVAHFPTADIL
                     FVAQNQGMDMGPMDPQMDVPMPMNNMHGQMPNMNMNMNMHPGMNSNMMQYQPPRMY"
     gene            <1310400..>1312445
                     /locus_tag="LMJF_30_3440"
                     /db_xref="GeneID:5653894"
     mRNA            <1310400..>1312445
                     /locus_tag="LMJF_30_3440"
                     /product="putative DNA ligase I"
                     /transcript_id="XM_001684901.1"
                     /db_xref="GeneID:5653894"
     CDS             1310400..1312445
                     /locus_tag="LMJF_30_3440"
                     /EC_number="6.5.1.1"
                     /codon_start=1
                     /product="putative DNA ligase I"
                     /protein_id="XP_001684953.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653894"
                     /db_xref="GOA:Q4Q6U5"
                     /db_xref="InterPro:IPR000977"
                     /db_xref="InterPro:IPR012308"
                     /db_xref="InterPro:IPR012309"
                     /db_xref="InterPro:IPR012310"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR016059"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6U5"
                     /translation="MALVADVPPPTATSMAKLFQESSFDPVTTFEAVWLPPRVPAAPP
                     TAGASEPVPFAAVVDVLADISATGSRLECLKQLTFLLLAVIERCPEDLVPVMYLVINK
                     HAPQHEGVELGIGDAVLVKAVAECCGMTETRAKEEYRQSGDLAEIAQMHKQKQGTLMK
                     PKPLSARSVFKTYKEIAMMSGRDVMRRRSDLIKGLLRDAQGPEVNLIVRGLQQKMRIG
                     LAEPSALAAVGYAFALHFLGGAQMHKMDEVQLQTLLNTGADSLARIFYEVPSLDVVLS
                     AVLANGFMTLVPGSSIAKQYAKDLSIRPGLPVKPQLAYPTSSITVILDRLQGKKFTSE
                     YKYDGERAQIHYDKDKGFHIFSRNSETHTGKYPDVISMLPKVFDPVEVQSFILDSEVV
                     AVHSETGALQAFQVLQHRGRKNIAEEDVSIPVCVFVFDILYFNGEPQLNKTLQQRREL
                     LWRCIHPLPAKLSFATHLDSEKVEDVQTFLERSIADGCEGLMVKTLEEEANYTPAKRS
                     HYWLKLKKDYMDGVTDTLDLVPIAAFYGKGKRTGVFGGFLLACYDPKADEYQSICKIG
                     TGFQDEELEKLTQSLKPFVVDEKPRYYRAGGEEPDVWLTEAQVWEVKAADLSVSPVHQ
                     AAVGLVDPDKGIALRFPRYLRQREDKKPADATNARQVADMYKAQSLAAEHDANGDAE"
     gene            <1313022..>1313585
                     /locus_tag="LMJF_30_3445"
                     /db_xref="GeneID:5653895"
     mRNA            <1313022..>1313585
                     /locus_tag="LMJF_30_3445"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684902.1"
                     /db_xref="GeneID:5653895"
     CDS             1313022..1313585
                     /locus_tag="LMJF_30_3445"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684954.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3445"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3445"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653895"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6U4"
                     /translation="MTVAPPHAIRPFLSLSSPAQPQTHTRTGDAISGSFRDAAVSLAL
                     MGTYLSLRVRKRPRKDGSDDASSAAGCSASDAASLPASSLSHVLLRLRYRCASPSRIG
                     SEVCRSVAEDEATRRTYGCHAHVYETDTVDGSHGVALAWRVDKFASPLSALSLLSLCR
                     VANSCRKKTLVTTPKGEAVVLAYTASL"
     gene            <1314671..>1315876
                     /locus_tag="LMJF_30_3450"
                     /db_xref="GeneID:5653896"
     mRNA            <1314671..>1315876
                     /locus_tag="LMJF_30_3450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684903.1"
                     /db_xref="GeneID:5653896"
     CDS             1314671..1315876
                     /locus_tag="LMJF_30_3450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684955.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653896"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6U3"
                     /translation="MAALAALEKEVADLKRVRVFNETVRTGVERVLASLPSPENEKDT
                     STKVRILLLRSQATLLLPRVSREAEKDLNAALKLQPGSATTWVELSECLLRRNAFKEA
                     CDALDNALRVNPAHTEALCKYSQIQRNRCGGEGVTADQRKAYLEDAVAKARAAVGSNV
                     DDADAWNTLALSLLSKVTLEGMTFDGVRKALAAMQQAERKCPEDPDVPYNKAVLESLL
                     GHFGAAAMDYWRAHALDKDRLKGTRHLSEENAKVLLRAQSRMRTSSGIGKRDFQRICT
                     RIEQAHKKYTQSTSAKVVGVLDIVTEPTMQPVTLLVSDGKGDFVLLLLHEVRPTCFKI
                     GDVIAYPVTTPVETITHNIVACPGVEEEPLKLTLSHAYPNPKSILVNGQPLPSSAHVP
                     LQMSSRLFA"
     gene            <1316814..>1317248
                     /locus_tag="LMJF_30_3460"
                     /db_xref="GeneID:5653897"
     mRNA            <1316814..>1317248
                     /locus_tag="LMJF_30_3460"
                     /product="putative zinc-binding protein (Yippee)"
                     /transcript_id="XM_001684904.1"
                     /db_xref="GeneID:5653897"
     CDS             1316814..1317248
                     /locus_tag="LMJF_30_3460"
                     /codon_start=1
                     /product="putative zinc-binding protein (Yippee)"
                     /protein_id="XP_001684956.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653897"
                     /db_xref="InterPro:IPR004910"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6U2"
                     /translation="MVRRLRTRLAAPSGGEGGFGCAFCGAHLCVTEDIVSDNFRGRHG
                     KAFLVSRCENTYYGHQEEKQLMTGLHRVRDIFCSNCDQYVGWGYDFAVDEREMYKMQR
                     FVLERQLIRVITHGQLRGALGYSIPEGSITFSLPVARSYTLE"
     gene            <1318129..>1319259
                     /locus_tag="LMJF_30_3470"
                     /db_xref="GeneID:5653898"
     mRNA            <1318129..>1319259
                     /locus_tag="LMJF_30_3470"
                     /product="putative casein kinase 1 isoform 2"
                     /transcript_id="XM_001684905.1"
                     /db_xref="GeneID:5653898"
     CDS             1318129..1319259
                     /locus_tag="LMJF_30_3470"
                     /codon_start=1
                     /product="putative casein kinase 1 isoform 2"
                     /protein_id="XP_001684957.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653898"
                     /db_xref="GOA:Q4Q6U1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6U1"
                     /translation="MGTRSKRAQDVLIGGRFRIQERLGGGAFGEVFRGVELNSGHPVA
                     MKMELTKDGYRSHLNLENRIYKKLNECPVTVGIPKSYYCDRVGDYTVMVMDLLGPCLD
                     DLFEVCHHKFSFKTVCMIGIQVIQRLQYIHSVGFLHRDIKPENFVMGVGTNSHIVYVI
                     DVGLSKAWHDSTGKHILYAEGKSLTGTARYVSINTHRGIQQSRRDDLESVSYLLAYFA
                     RGHLPWQGLKSPKKDARFERIRDVKTATSPAELCKGYPHQFADYVEYTRSLGFEAEPD
                     YSYCVGLFSSAMADMGEQYDYCYQWIDRSEAEVKSELDALGSTHSLRTSGAQTSVAVG
                     GSDLMASSVFMGDSAVNEMSKSLLNTNFMEENQDYYGLNDYI"
     gene            <1325361..>1326107
                     /gene="CPC1"
                     /locus_tag="LMJF_30_3480"
                     /db_xref="GeneID:5653899"
     mRNA            <1325361..>1326107
                     /gene="CPC1"
                     /locus_tag="LMJF_30_3480"
                     /product="putative chromosomal passenger protein"
                     /transcript_id="XM_001684906.1"
                     /db_xref="GeneID:5653899"
     CDS             1325361..1326107
                     /gene="CPC1"
                     /locus_tag="LMJF_30_3480"
                     /codon_start=1
                     /product="putative chromosomal passenger protein"
                     /protein_id="XP_001684958.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653899"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6U0"
                     /translation="MEAVAWTPDVVEDLLFRQFIKDEDISRQLPPAPQVSSENFLEKY
                     DQSTKILFSYVRNGPVAALASQNVNTAAVGKYGGATPLKGFVGRTPATKPAPPESSRS
                     FARTATPAPAPTSHAPSVQKATTSSPPPAKAKRQRVEWPADVPTNQMLKSNSRSKVAH
                     LTAKRVAAQQGVDPDLIFTQNCGDLPLNVIFASYPKALKSVSAVRNASGDWRTDTFTV
                     EEEASYKKDLGYVHCGSSQCRYSDWLPSQS"
     gene            <1329067..>1330179
                     /locus_tag="LMJF_30_3490"
                     /db_xref="GeneID:5653900"
     mRNA            <1329067..>1330179
                     /locus_tag="LMJF_30_3490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684907.1"
                     /db_xref="GeneID:5653900"
     CDS             1329067..1330179
                     /locus_tag="LMJF_30_3490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684959.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3490"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653900"
                     /db_xref="GOA:Q4Q6T7"
                     /db_xref="InterPro:IPR004181"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6T7"
                     /translation="MHALSEALPAARSAAKRTSGRSSSLLSAGDGEGGDASEEDEDAL
                     PFVRAARRHVLEVLRHEVFENPSRFVLSPVYHFMDMLGAVVVENSNLTTTLPAPHTLH
                     ERPAEGFSPQRRVLLVPLTEAYEHTTGWMVPTEMEGAQLAMSLYVNDTPVSLPPNWQL
                     SPAKEAAAVKTAMAVDITPLVLSIERDLFSLQVIFSGDVAEMEMWRGVIACVLVEEVE
                     LAQLGERIVSTYHKRRAPVIRRSPLSSCGERGVVAITEVSVKIQCPITTLTMEIPVRG
                     MYCEHLQCMELAAVLIQCARQNVWNCPLCSAAMKPEDIIVNHRLKDWIASHSREVVAQ
                     VEYIVETELGRPLKIVYKAARPEQHSTIEVIDDEEK"
     gene            <1330874..>1332052
                     /gene="METK1"
                     /locus_tag="LMJF_30_3500"
                     /db_xref="GeneID:5653901"
     mRNA            <1330874..>1332052
                     /gene="METK1"
                     /locus_tag="LMJF_30_3500"
                     /product="S-adenosylmethionine synthetase"
                     /transcript_id="XM_001684908.1"
                     /db_xref="GeneID:5653901"
     CDS             1330874..1332052
                     /gene="METK1"
                     /locus_tag="LMJF_30_3500"
                     /EC_number="2.5.1.6"
                     /codon_start=1
                     /product="S-adenosylmethionine synthetase"
                     /protein_id="XP_001684960.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3500"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653901"
                     /db_xref="GOA:Q4Q6T6"
                     /db_xref="InterPro:IPR002133"
                     /db_xref="InterPro:IPR022628"
                     /db_xref="InterPro:IPR022629"
                     /db_xref="InterPro:IPR022630"
                     /db_xref="InterPro:IPR022631"
                     /db_xref="InterPro:IPR022636"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6T6"
                     /translation="MSVHSILFSSEHVTEGHPDKLCDQVSDAVLDACLAGDPFSKVAC
                     ESCAKTGMVMVFGEITTKTVLDYQKIVRNTIKDIGFDSADKGLDYESCNVLVAIEQQS
                     PDICQGLGNFDSEDLGAGDQGMMFGYATDETETLMPLTYELARGLAKKYSELRRVGSL
                     EWARPDAKTQVTVEYDYDTREGKQVLTPKRVAVVLISAQHDEHVTNDKISVDLMEKVI
                     KAVIPANMLDAETKYCLNPSGRFVRGGPHGDAGLTGRKIIVDTYGGWGAHGGGAFSGK
                     DPSKVDRSAAYAARWIAKSIVAGGLARRCLVQLAYAIGVAEPLSMHVETYGTGKYDDA
                     KLLEIVKQNFKLRPYDIIQELNLRRPIYYDTSRFGHFGRKDESGTGGFTWEVPKKMVE
                     "
     gene            <1334205..>1335317
                     /locus_tag="LMJF_30_3510"
                     /db_xref="GeneID:5653902"
     mRNA            <1334205..>1335317
                     /locus_tag="LMJF_30_3510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684909.1"
                     /db_xref="GeneID:5653902"
     CDS             1334205..1335317
                     /locus_tag="LMJF_30_3510"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684961.1"
                     /db_xref="GeneID:5653902"
                     /db_xref="GOA:Q4Q6T7"
                     /db_xref="InterPro:IPR004181"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6T7"
                     /translation="MHALSEALPAARSAAKRTSGRSSSLLSAGDGEGGDASEEDEDAL
                     PFVRAARRHVLEVLRHEVFENPSRFVLSPVYHFMDMLGAVVVENSNLTTTLPAPHTLH
                     ERPAEGFSPQRRVLLVPLTEAYEHTTGWMVPTEMEGAQLAMSLYVNDTPVSLPPNWQL
                     SPAKEAAAVKTAMAVDITPLVLSIERDLFSLQVIFSGDVAEMEMWRGVIACVLVEEVE
                     LAQLGERIVSTYHKRRAPVIRRSPLSSCGERGVVAITEVSVKIQCPITTLTMEIPVRG
                     MYCEHLQCMELAAVLIQCARQNVWNCPLCSAAMKPEDIIVNHRLKDWIASHSREVVAQ
                     VEYIVETELGRPLKIVYKAARPEQHSTIEVIDDEEK"
     gene            <1336012..>1337190
                     /gene="METK2"
                     /locus_tag="LMJF_30_3520"
                     /db_xref="GeneID:5653903"
     mRNA            <1336012..>1337190
                     /gene="METK2"
                     /locus_tag="LMJF_30_3520"
                     /product="S-adenosylmethionine synthetase"
                     /transcript_id="XM_001684910.1"
                     /db_xref="GeneID:5653903"
     CDS             1336012..1337190
                     /gene="METK2"
                     /locus_tag="LMJF_30_3520"
                     /EC_number="2.5.1.6"
                     /codon_start=1
                     /product="S-adenosylmethionine synthetase"
                     /protein_id="XP_001684962.1"
                     /db_xref="GeneID:5653903"
                     /db_xref="GOA:Q4Q6T6"
                     /db_xref="InterPro:IPR002133"
                     /db_xref="InterPro:IPR022628"
                     /db_xref="InterPro:IPR022629"
                     /db_xref="InterPro:IPR022630"
                     /db_xref="InterPro:IPR022631"
                     /db_xref="InterPro:IPR022636"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6T6"
                     /translation="MSVHSILFSSEHVTEGHPDKLCDQVSDAVLDACLAGDPFSKVAC
                     ESCAKTGMVMVFGEITTKTVLDYQKIVRNTIKDIGFDSADKGLDYESCNVLVAIEQQS
                     PDICQGLGNFDSEDLGAGDQGMMFGYATDETETLMPLTYELARGLAKKYSELRRVGSL
                     EWARPDAKTQVTVEYDYDTREGKQVLTPKRVAVVLISAQHDEHVTNDKISVDLMEKVI
                     KAVIPANMLDAETKYCLNPSGRFVRGGPHGDAGLTGRKIIVDTYGGWGAHGGGAFSGK
                     DPSKVDRSAAYAARWIAKSIVAGGLARRCLVQLAYAIGVAEPLSMHVETYGTGKYDDA
                     KLLEIVKQNFKLRPYDIIQELNLRRPIYYDTSRFGHFGRKDESGTGGFTWEVPKKMVE
                     "
     gene            <1338805..>1339548
                     /locus_tag="LMJF_30_3530"
                     /db_xref="GeneID:5653904"
     mRNA            <1338805..>1339548
                     /locus_tag="LMJF_30_3530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684911.1"
                     /db_xref="GeneID:5653904"
     CDS             1338805..1339548
                     /locus_tag="LMJF_30_3530"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684963.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653904"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6T5"
                     /translation="MKAARLLFQSDRRTRHHMMIDGAINPREWFNWHPKEYQPWYFDR
                     HKFIYEQGQYAAYNHLLCHQAYLKDIEHLTRYPEPRTFVIDCRMSPAKMHRWVPHSMW
                     LPRDEVEYALQLTNDEFQEMYGFIKPAKDDDVILISHNGLASEQAGWEWRKQYYQHVY
                     NYRGGTNELFGEDYQDFILKDRLDPWKGPYPQKSIFVDKWSKRKVLTRTGPFDRQYEM
                     QDFALPDLELERPRHSEDGPRQNMPYGLQ"
     gene            <1341097..>1342467
                     /locus_tag="LMJF_30_3540"
                     /db_xref="GeneID:5653905"
     mRNA            <1341097..>1342467
                     /locus_tag="LMJF_30_3540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684912.1"
                     /db_xref="GeneID:5653905"
     CDS             1341097..1342467
                     /locus_tag="LMJF_30_3540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684964.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653905"
                     /db_xref="GOA:Q4Q6T4"
                     /db_xref="InterPro:IPR000352"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6T4"
                     /translation="MRRAAVAPRSSVFSHTIYDGARFVHAGESVEKRPSRRRYAAFNT
                     SGRVAQAKELVDVMKKKSAQDAKAFYEALQPRDRLDILRLLYERRKKRQSDQASSELT
                     KYYSVPFEKKYFFREEDVEEESTLGRGPGGQATNRRMQTAIVKHVPSGLIVKFSRFPS
                     LWLNRRAARELLNLRLEEHLLGPSSRLGKARVARERRGRRRQRTMAYLSEKGTRLQAR
                     DARRCHWLAFLTGESPLPSAAVSQMALKEDAAAVPVTTAVLFGSECHTWWPKLRAATE
                     SAAAAAPDSTSDDCVPLLLQYLFPVVYADSGRAEREEMEACKSNKAVHTNVRRALTCF
                     CELFGLRLRHILASVPPEASRVVLEKDGLNWVMHRSRMIANGSLTRLARTCWPRVYMS
                     VRELGMTPEARAIIVFFKKEVSTAAGSAAGAWATEALQCFSEAVRRSKPPVTVQLSSV
                     PSSPGT"
     gene            <1343581..>1345107
                     /locus_tag="LMJF_30_3550"
                     /db_xref="GeneID:5653906"
     mRNA            <1343581..>1345107
                     /locus_tag="LMJF_30_3550"
                     /product="cytochrome p450-like protein"
                     /transcript_id="XM_001684913.1"
                     /db_xref="GeneID:5653906"
     CDS             1343581..1345107
                     /locus_tag="LMJF_30_3550"
                     /EC_number="1.14.14.-"
                     /codon_start=1
                     /product="cytochrome p450-like protein"
                     /protein_id="XP_001684965.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653906"
                     /db_xref="GOA:Q4Q6T3"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="InterPro:IPR002403"
                     /db_xref="InterPro:IPR017972"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6T3"
                     /translation="MAAFSRLLGVQLPYVMEVVIFLALAYATAYVLTNIMFASIHKFK
                     MAGPLTAIPVLGGVVGMIRDPYSFWERQRQYEPHGYSWMAILTQFVVFVTRADLCHKI
                     FATNGEDTLTLQLHPNGKLILGDNNIAFQSGPGHKALRSSFMNLFTTKALSLYLPIQE
                     RLIHEHLSRWVRDYPWGGKPEEMRTHIRELNCETSQTVFLGEHLHNHTEFTHNYNIIT
                     RGFLSAPLYLPGTPLYKAVQARKLTMVELQAAVRRSKARMAKPDAEPHCLLDFWTATV
                     LEKIKEAEEEGGDAPAYSSDHAMADTILDFLFASQDASTASLTMITATMADHPEILER
                     VRKEQARLRPNNEPLTYDLVQEMTFTRQCVMEQLRLFPPAPMVPMKVHGDFQLDEKTV
                     VRKGSMIIPSLVACCREGFTNPDTYDPDRMGPERQEDRKFAKQFIPFGVGPHRCVGYN
                     YAINHLTVYLALIAHHVEWQRTRTPDSDKILYLPTLYPHDCLQTWRYREGIEPTAEKV
                     "
     gene            <1347199..>1347687
                     /locus_tag="LMJF_30_3560"
                     /db_xref="GeneID:5653907"
     mRNA            <1347199..>1347687
                     /locus_tag="LMJF_30_3560"
                     /product="putative mago nashi-like protein"
                     /transcript_id="XM_001684914.1"
                     /db_xref="GeneID:5653907"
     CDS             1347199..1347687
                     /locus_tag="LMJF_30_3560"
                     /codon_start=1
                     /product="putative mago nashi-like protein"
                     /protein_id="XP_001684966.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653907"
                     /db_xref="GOA:Q4Q6T2"
                     /db_xref="InterPro:IPR004023"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6T2"
                     /translation="MAEQEDLAAVSPAETMESQLYYVRYYSGHTGRYGNEFLEFEISE
                     TGSLKYVNNSNYRNDFIIKKQARVSPAVLEEVKKLIVQYSVCESDDERWPAPDRNGRQ
                     ELEIHLGNTHISLVTNKLTSMADIPKSSETVSLVRFYSFVRDVKALIFALVSIHFKIK
                     PI"
     gene            <1348749..>1349549
                     /locus_tag="LMJF_30_3570"
                     /db_xref="GeneID:5653908"
     mRNA            <1348749..>1349549
                     /locus_tag="LMJF_30_3570"
                     /product="putative zinc finger-domain protein"
                     /transcript_id="XM_001684915.1"
                     /db_xref="GeneID:5653908"
     CDS             1348749..1349549
                     /locus_tag="LMJF_30_3570"
                     /codon_start=1
                     /product="putative zinc finger-domain protein"
                     /protein_id="XP_001684967.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653908"
                     /db_xref="GOA:Q4Q6T1"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6T1"
                     /translation="MTFSVKGGSYSSSHPSPAMHPYVSPSLLPQSHGQQAPPSFSLGD
                     EQYVGVPKRVGVDPTKYKTTICRNWEQTGTCAFRGCTFAHGVEELRAPLRPDGHTPVL
                     RPQHISPGSTPPLRASQPPPPPSSGHYTLEQLLDMLYKEVLHQRELVTVHVEANTTLE
                     GMLRREQAQHDASKKQLEEKTQQCELFARELFARNQQLRKAADSSPEIKELLDQWETQ
                     LASFSEADVKKDDVFHTATATSSTDDGGDSGKEYESARIEELLRALQR"
     gene            <1352023..>1354266
                     /locus_tag="LMJF_30_3580"
                     /db_xref="GeneID:5653909"
     mRNA            <1352023..>1354266
                     /locus_tag="LMJF_30_3580"
                     /product="putative serine/threonine-protein kinase"
                     /transcript_id="XM_001684916.1"
                     /db_xref="GeneID:5653909"
     CDS             1352023..1354266
                     /locus_tag="LMJF_30_3580"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative serine/threonine-protein kinase"
                     /protein_id="XP_001684968.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653909"
                     /db_xref="GOA:Q4Q6T0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6T0"
                     /translation="MGKSKKHGKPVKSASKKGSKNDKNKRKAKFIDPTSSVSRDVRET
                     VAALVEEIEREEPVAEEKLQSLKEKKCQEIAEKEGILVKTGMTKEQAHTIANRLKQQQ
                     STTHRSDGEGDVGSDGGDGDGGGTEEDYSDTANEPSREYRKGGYHHVVIGEVYNDRYR
                     VVKKLGWGYFSTVWLVWDYQKERYQAMKIQKSAASYSEAAYDEIKLLSEIMEADPHKN
                     RCCARLNDYFKHTGPNGTHVCMLFDVYGENLLSLMERYEYRGIPLPIVKCIARQVLIG
                     LDHINSIDIIHTDLKPENVLLSTPKHSIISLMKQFRPPPLHQRPKLTERDPKTMTKSQ
                     RRRYYKKLAKEERKTFLGEDDGDHKSRGDEHGSNENGDADSEGSKTDPEWEVERFHHV
                     ILADFGNSCWTYKQFTDEVQTRQYRCPEVILGEPYSTPIDIWSCACMIFELITGQFLF
                     DPKKGDDYSRDEDHLALMSELLGDLPESMRLGDGKYRSYYYNSKGDLRNIKDLQYWAL
                     EDVLHQRHKFTKKKAKEIADFLLPMLEYAPDTRATPAAMLRDHDAFFDIQDDDYAPLC
                     FVDEDSGDEEGSASDEEEEETDSDDSSQSYSSAPSSELKAKRSRQPDSNADRSETFRY
                     WEEHPILNRTYLEERGLTIADIQSVLAGNFLDDAAAHEAAAEVIRLLSEETDRLSNDH
                     GSDGHEADNENMGTDDDDEEGTTQGSDEPERVVVVCKAAPCDDGVDEDDEEATDEEEE
                     GSSDGEE"
     gene            <1355009..>1355620
                     /locus_tag="LMJF_30_3590"
                     /db_xref="GeneID:5653910"
     mRNA            <1355009..>1355620
                     /locus_tag="LMJF_30_3590"
                     /product="40S ribosomal protein S14"
                     /transcript_id="XM_001684917.1"
                     /db_xref="GeneID:5653910"
     CDS             1355009..1355620
                     /locus_tag="LMJF_30_3590"
                     /codon_start=1
                     /product="40S ribosomal protein S14"
                     /protein_id="XP_001684969.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653910"
                     /db_xref="GOA:Q4Q6S9"
                     /db_xref="InterPro:IPR001971"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6S9"
                     /translation="MLNVVQATRMSKKQEVKAYGPNVKKGDLVYGVVHIFASFNDTFV
                     HVTDMSGRETYVKVTGGMKVKADRDESSPYAAMMAAQDVVARCKECGINALHVKMRAV
                     GGVRTKSPGPGRPGRPPRARPRRDEDWPHRGCHPDPDRLHPPQGFPPWSPPVRSLRPR
                     VLRTAQQSELTLVTICWFPCVCDLLSFYCREEKKHRPQITEAR"
     gene            <1356368..>1356913
                     /locus_tag="LMJF_30_3600"
                     /db_xref="GeneID:5653911"
     mRNA            <1356368..>1356913
                     /locus_tag="LMJF_30_3600"
                     /product="putative ATP synthase, epsilon chain"
                     /transcript_id="XM_001684918.1"
                     /db_xref="GeneID:5653911"
     CDS             1356368..1356913
                     /locus_tag="LMJF_30_3600"
                     /EC_number="3.6.3.14"
                     /codon_start=1
                     /product="putative ATP synthase, epsilon chain"
                     /protein_id="XP_001684970.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653911"
                     /db_xref="GOA:Q4Q6S8"
                     /db_xref="InterPro:IPR001469"
                     /db_xref="InterPro:IPR020546"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6S8"
                     /translation="MFRFCGRRLVARTLPLLADYQELPEAFEFMEHKVADKDIHSAYE
                     NMETLRLTVTRQDEFLFKETPVKCVTIVGVNGECGVYPGHAYEITQLTPAPLTVEMPD
                     GTVKKFFTSGGFAHINNEGSCDINCVECIPLTELDVDAAEKALAQQQSALNSAHDDKA
                     RAVIEIRIGVLESVIQSLKHA"
     gene            <1359114..>1360280
                     /locus_tag="LMJF_30_3610"
                     /db_xref="GeneID:5653912"
     mRNA            <1359114..>1360280
                     /locus_tag="LMJF_30_3610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684919.1"
                     /db_xref="GeneID:5653912"
     CDS             1359114..1360280
                     /locus_tag="LMJF_30_3610"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684971.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653912"
                     /db_xref="InterPro:IPR008491"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6S7"
                     /translation="MASQPISIHYKQMEEWLEDRKSVFSRKHRNEYNALLSVAPRLVQ
                     MAQHDIPALEKQIKKNENAIEECHRVCEEAQRTQLKLGERRCAMLREYGIELAAAVGE
                     VELASAVDQRVREACAQVNAALQEYAVARVGALKEYYNAVLARTAAGWYGTDPFALHF
                     PWLERAFSEAEYQPADALSEATDAGGEAANAAGTQIDWGDDDDSAAGMLAGLGKDAVQ
                     INWDAMEMEARPVEEDSLPEADGLHFSIDLASAKHRVNVMSELEAASCFCRERGTADL
                     LECATETEALRSFLSSGKESELARMKESYRARCSFVDRITRFEQQIIVAKNRSTAHQA
                     KMHDAEDDLEKLKAQQDELLSCLRSMRDEALTHLEHMFPDRRILIVGDLNKYVA"
     gene            <1361198..>1362310
                     /locus_tag="LMJF_30_3620"
                     /db_xref="GeneID:5653913"
     mRNA            <1361198..>1362310
                     /locus_tag="LMJF_30_3620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684920.1"
                     /db_xref="GeneID:5653913"
     CDS             1361198..1362310
                     /locus_tag="LMJF_30_3620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684972.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653913"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6S6"
                     /translation="MEGSKKYEEASLRGITRHHVWKSRTSDLTVINLRDPTELLGIQD
                     PLAVATVAETKQATAASPPPPLRAPLARPVTGKQESLNVLLAKLQLCRPAQEPSSHLS
                     AAAKPLPQSSANATPPAVPSAAAPSALHPTACVASPAAAASPAIGMREVSDPSFPDPK
                     ESSSGPSGQFEFITGTNIPGQGVVKKTEAVDESSSMALFHDPLWGGSLDAFALPTTLK
                     PSPKPQLRASLSELYASAASNSTSAFASPPAPASQPQKVASPPVATVTASPMPTTMTS
                     STIPMMGGIVQPPTPPQLNTPFPMYTVPIQYMAQQPQFPTGMVYNAPNFFPYGATPMM
                     MTQPQHIPQGYAIPAAAMMRPGTNVKAMPFVPGNTM"
     gene            <1364278..>1365021
                     /gene="CYC7"
                     /locus_tag="LMJF_30_3630"
                     /db_xref="GeneID:5653914"
     mRNA            <1364278..>1365021
                     /gene="CYC7"
                     /locus_tag="LMJF_30_3630"
                     /product="putative CYC2-like protein"
                     /transcript_id="XM_001684921.1"
                     /db_xref="GeneID:5653914"
     CDS             1364278..1365021
                     /gene="CYC7"
                     /locus_tag="LMJF_30_3630"
                     /codon_start=1
                     /product="putative CYC2-like protein"
                     /protein_id="XP_001684973.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653914"
                     /db_xref="GOA:Q4Q6S5"
                     /db_xref="InterPro:IPR012389"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR013922"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6S5"
                     /translation="MPLRACVSRTPAQARLVEVVSDYVQHLMDMQASRCAETSLDGHV
                     VPPPNAKYPSHDFFCATHAPAISVKKYTDRLVTYMHCSPEAFVFAVAYLRRLVLSGFP
                     MHLQSIHRLLLTAVLVALKCRDDVYYHMSFYAEVGGVTSKDLRIMEIRFLSDLIRFEG
                     EVSLADYHVVMVDMMRVTERRMITNISGKTEMCNRCGMSAGAFTTSIPGDLGCLHCKG
                     DAFAHSWTSECELFWGPLNSAFSLPSGEV"
     gene            <1369241..>1370908
                     /locus_tag="LMJF_30_3640"
                     /db_xref="GeneID:5653915"
     mRNA            <1369241..>1370908
                     /locus_tag="LMJF_30_3640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684922.1"
                     /db_xref="GeneID:5653915"
     CDS             1369241..1370908
                     /locus_tag="LMJF_30_3640"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684974.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653915"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6S4"
                     /translation="MSKGFEVYPLTGSHKEVVINEALIRSAISFKPSLTTEDDRVRVV
                     GNQEKALCEEKVQKEAAGIALEDVQTLLLSFRGIKRLENLSCLRSLTKLHLDNNRIRC
                     IEHLESLVHLEWLDLSYNAIEVIDGLQALQHLNCLSLYANKITAVDGLTCLPELNTLS
                     LGRNPLENIDETVHYLHHLPRLQVLTLKECPLAGLPNYRSRVLAFVRGLKFFDGHLVR
                     HDEAAKAREAFRENLLTVDEEDEARAAAAKLQADQEIIASSYQQYNCPNEVMLFDELL
                     HLDPEGRHMEAILRSEAVFSVAKEPLDRYQTEFNEQLRQLTAAMKDIRERRDADDAAY
                     REAVTYTLRHSAAASLASMQRFEALAKGHIVKGVAQPVPGPAKRLPSQATRSLHAALD
                     KLKKDLLEEEAHQYDVLEVLHNNTIAKWKSHSVEVVLQSSFEALLRLETDFQATVRHI
                     FDAVFEERRKGDNAERAFRYVGQDDAMLAFLDNKEEYQRTVNEWYELRRKRVEELEMH
                     HLKAEETLLNARANSILAAEQDRHRRRVHEVCQYVKEMSSRIDGCDH"
     gene            <1371850..>1372464
                     /locus_tag="LMJF_30_3650"
                     /db_xref="GeneID:5653916"
     mRNA            <1371850..>1372464
                     /locus_tag="LMJF_30_3650"
                     /product="putative ribosomal protein L15"
                     /transcript_id="XM_001684923.1"
                     /db_xref="GeneID:5653916"
     CDS             1371850..1372464
                     /locus_tag="LMJF_30_3650"
                     /codon_start=1
                     /product="putative ribosomal protein L15"
                     /protein_id="XP_001684975.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653916"
                     /db_xref="GOA:Q4Q6S3"
                     /db_xref="InterPro:IPR000439"
                     /db_xref="InterPro:IPR012678"
                     /db_xref="InterPro:IPR024794"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6S3"
                     /translation="MGAFMYLNELWKKKSSDVMRFIQRIRSWEFRHQHTVVRLRRPTR
                     PEKARMLGYKTKQGFCVFRVRVRRGGRKRPVHKGITYGKPKTSGVLGMKLNKNNQAVA
                     EQRLGKRFGNLRVLNSYWVNMDSTFKWYEVIAVDPMCKTIRRDPRINWIVNSVHKHRE
                     QRGLTSAGRKHRGLRHKGHKASKLRPSYRAAWRRNNRIVFLRKR"
     gene            <1373321..>1373995
                     /locus_tag="LMJF_30_3660"
                     /db_xref="GeneID:5653917"
     mRNA            <1373321..>1373995
                     /locus_tag="LMJF_30_3660"
                     /product="putative V-type ATPase, C subunit"
                     /transcript_id="XM_001684924.1"
                     /db_xref="GeneID:5653917"
     CDS             1373321..1373995
                     /locus_tag="LMJF_30_3660"
                     /EC_number="3.6.3.14"
                     /codon_start=1
                     /product="putative V-type ATPase, C subunit"
                     /protein_id="XP_001684976.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653917"
                     /db_xref="GOA:Q4Q6S2"
                     /db_xref="InterPro:IPR000245"
                     /db_xref="InterPro:IPR002379"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6S2"
                     /translation="MPVEAEVLPTPTRLPPDDAMHVVGGLIRYILIIVIVVFGIIPAL
                     CGTVFPPFSALWSILKAVSPYAWASMGTGIGIALSILGAAWGILTSGASISGAAIRAP
                     EIRSKNLISIIFCEAVAIYGVILSIIMMGKIQASSSSVGSGGVYMYETIIGGYTLFAA
                     GIAVGIGNMACGIAVGIVGSSCAIADAHSSSLFVKVLVIEIFASALGIFAVITGILMA
                     QKVQMK"
     gene            <1375031..>1375465
                     /locus_tag="LMJF_30_3670"
                     /db_xref="GeneID:5653918"
     mRNA            <1375031..>1375465
                     /locus_tag="LMJF_30_3670"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684925.1"
                     /db_xref="GeneID:5653918"
     CDS             1375031..1375465
                     /locus_tag="LMJF_30_3670"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684977.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653918"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6S1"
                     /translation="MAASYLVLQRYTDLINSGDLDAAFNYLSEDIIYVTWLGVIEGKD
                     NVVTFLRDNMRFLHFAKHFNRWRQVQHCLDADLSRHCDDSDVGGSNLFDRDGYDRQGY
                     ASFERDGMIANIVKLSMQKTRVRETVVIRDNKVVLVTLMEQL"
     gene            <1376530..>1377858
                     /locus_tag="LMJF_30_3680"
                     /db_xref="GeneID:5653919"
     mRNA            <1376530..>1377858
                     /locus_tag="LMJF_30_3680"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684926.1"
                     /db_xref="GeneID:5653919"
     CDS             1376530..1377858
                     /locus_tag="LMJF_30_3680"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684978.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653919"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6S0"
                     /translation="MKAIKAAREREIEANIALQEREIAALEQEKTELQSFMTTANPKM
                     RGDPLLASFPVLVYCGRRPRQKVQNVSVEQYGNIMDQLDITKKAIDAQNHKDRVEIQE
                     LNRLIREQEKQQKTLTQKARRLGEDAGIDIKWFTEHQRDKMMKMQNYKTEVSVAELEA
                     RTRLVDHEVKVAKLLAEKKGAAILALTKLVEKRRSTIDDIDSLYNEIRIVDRDTTVAS
                     EELARVNSDIQDADAWLEERLNPADSVACKVIEEDSATLKEEKEQTVNEQRVPQERVI
                     KAQDYRIAQLEKRMKVIEKAIKNNGLSREVDKIVAHGWSQREVEVPEDQEELYDIEKI
                     IPAQEKVHPGIYNLLLTEKEKTARIVSILTITAKEKEEVIAALTTRLEKLAAECLAAI
                     QEMDDYASGMVFSEERQRVQALKWVCEQRRHCATLFYQKSLLESALEKDG"
     gene            <1379523..>1381268
                     /locus_tag="LMJF_30_3690"
                     /db_xref="GeneID:5653920"
     mRNA            <1379523..>1381268
                     /locus_tag="LMJF_30_3690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684927.1"
                     /db_xref="GeneID:5653920"
     CDS             1379523..1381268
                     /locus_tag="LMJF_30_3690"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684979.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653920"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR019412"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6R9"
                     /translation="MSNGVSTDAASMESIISTDGEMPSIHSGVEKAVYMMWNNEYSEA
                     LELLRAKKDKNPRYALEWANVSLVKTLMSSTNEDRERLLDLFKAADSLSTSSKYNDPM
                     FSEDDEDDDREEDKTRKQLKMEKKKNKKVFKARKRDATKGGAYFDQTWKLECDVIYAD
                     ALLIRSIGQLMMNSYLKGGINLRKAWGCYHSLIQQVEQDIENRIPYELKMCIKYGTGT
                     FYAFLALVPANLMKVLSIIGFISDRDLGEQYLTEVFESNTIRSPFAALVLCTLYLFLP
                     TGLGNVDVTLSRARRVLETMNARYPNNTYFNGYANFYFRKKGEVEPAVRSITLAAENA
                     EKAGLVPLLIKYLYADTLFMNQQWAEALEQYRRILDHLTKTKEKFAYTGQVVLSVAAC
                     YAMLDNDKEALVWFKKVDSMYNPKSKNDSNSPRFANRVIANPRLLPLSGVYMLYINRD
                     LAHMNKTQGLRVLAELKRVTKDKDLSGPEAENMYNLFVGVIEKGSENTDAALACMKKI
                     FDNEKTIPSDSMILPFTYYETGEMEYRRGNIERAKELFDKGSKIKGDGNETLSNRYNI
                     AMKQLRRAMADRESK"
     gene            <1386321..>1388894
                     /locus_tag="LMJF_30_3700"
                     /db_xref="GeneID:5653921"
     mRNA            <1386321..>1388894
                     /locus_tag="LMJF_30_3700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001684928.1"
                     /db_xref="GeneID:5653921"
     CDS             1386321..1388894
                     /locus_tag="LMJF_30_3700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001684980.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653921"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6R8"
                     /translation="MNSNWLGAGANGSFYYPDRSKQDEASYEVSMGDGYTTEMVTDPN
                     APATEQTQAENETAATLSNGYDYVNYYDPSLYQNYYYQDDDGNYYYYTDAQQSASNDI
                     PQEINLSVTPTPQNIVRSYEYASYDPPTYNWFVDIVVDTFLSAPFRVYLTILLYCAAA
                     LIGALGLNYTFALLYRLYAPPIPNTNKSLQSFAYFVLFFYVSFVIVAALCALMDMVRN
                     LWTLKRGDVVFWGMSHRYFSKRMPPFLVYLVIILLVVFLPLLWGIVETGIRKQSLVYV
                     AQRYANVAVLAATFVVVVCYLWFYWRALVYKWSAIKKRVERDDFELRRRAYKTHPEKM
                     NKVHWYHASTVLEEFGMDGETLRYNSVVFTVGCVPLFSLYAAQTLSTYTGTPSVAWPA
                     IASISIACVYILSWITLMRRKHQWAIYASWALIVLMLALGLTGGAVGGHPTTAAIVVL
                     FFFAAHGMVSRKRKHSLTKKELRATLKLPYTAQADDDTPQGRRIDTYLFCCRNLILDY
                     MKCCDVKKHFGYRHPDVVEAERRFMISRIALRTDQKALLIWWVVVMLAVAFAMALSNS
                     TQYRFSTPIAVLANTSVPGLTPSLRLCEKVFNADGSAPLKMLDLALLAALSYTYGANG
                     DADFATWFSSKPSLLRMHPVVLPYTLNFNTHGTNISFSHYVDVSSRYHVITLNSNNRG
                     LSFFRDLDDWGESIALQAAGAISPLITIWDEQNRAAFVQRARFLKTWLPPSTALDDVK
                     TYIAALNSSGDCTGILIVGDQFNGGYAKRLSAELNLPFVAFNPPGTKFINAFLTNGTQ
                     LSGVRSLWSYVDSLEDAVSTAYYPCKANFSSNRCGRISTVVEYLLETCGDPSGRAMNQ
                     L"
     gene            <1390756..>1394799
                     /locus_tag="LMJF_30_3710"
                     /db_xref="GeneID:5653922"
     mRNA            <1390756..>1394799
                     /locus_tag="LMJF_30_3710"
                     /product="putative CPSF-domain protein"
                     /transcript_id="XM_001684929.1"
                     /db_xref="GeneID:5653922"
     CDS             1390756..1394799
                     /locus_tag="LMJF_30_3710"
                     /codon_start=1
                     /product="putative CPSF-domain protein"
                     /protein_id="XP_001684981.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653922"
                     /db_xref="GOA:Q4Q6R7"
                     /db_xref="InterPro:IPR004871"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6R7"
                     /translation="MYVLSTSRPSTAAFGAAVGNFCGDETTYVALNRGTLLSLYVCRQ
                     SNSGIDHVQDFRLHCTLKYVRAVLIVDTAAPRKNPRHLLFLCTVKQQIVLAALESCTE
                     LSGGASPLRMTTLFQSAPGDCLYQYDPSEVELCCCSSAVAGAGASPPFVVFALTRGEL
                     ILFDVFAALARDAVKRKQNGNLTRLLSPELMASVVRRAKADIFSHCYMDCTEYDVKDI
                     SFGFPSPWLKGQVHGAAPRPGAAAMRADNASASISLFVLYADPYGKMHVSEYELALSP
                     VTEAEAASESSSVESSIRPPARPPPYPAEFATPARRVRRCGLVQANVDPTASRIVPSR
                     HGLFVVGNHLVTLIQQVRPRKGVFSREIPSRQAILDVSCASVSADASELLIGFSDGVL
                     ARVTVISRGMGGEDPELAFRFLSHPAPTIPTELVTLHADLYLLCSRFDSSFTVRLDEA
                     SCEEVLHNCGPVLDMTTHKNGSHNSVVASTGIHRGGGISVLRSAVMLREQADIPLRCH
                     PQRILCAGELMCITTPAAANRFFLVSARALTLEELAPHVFPEIVSRHLLVELGLDAAL
                     NQLVLISARGIAWLRLSGPRVEAVSQLPRQADDPQILFAVVRHGLTVVCDGIVVTVYR
                     GQDLVYTVPSLAGVAISSVSLVSPTLLVLGQWDGVVALYELGHRQADVVGLLLLDSVP
                     RTIACAVPPLSPSSVVGEAALPMIYIGTLHGFLVGTTVALLRRGEKRLSVFVAPHPLE
                     LLELAGRHAGLLCLGNVPLVVLCVAGGGLQLTGLHLTGVSAAATVDADLQCYAFYSKH
                     DGRLHVGSLEALEKTSRTFLPLGETITQLHETAAWGGYAASVRKVEGDEVLFLPSAVI
                     QFPWAADLALWRSAAVPLLENERCVFLQTVRLDGGEGGGAGERGGEPIDVAASDSAGV
                     SEEEWQHLLLIGSSFTFPDEQRARSGRITWCALREEHQQQRLHLIASKDIGGALQCCA
                     AVPHYKGRIALGVNGCVCLYKWNTEDQTFVAEERCRVGLTVTKLIPLYHTSLAASVLV
                     ALDVRHSAFFIEVDTLQGSLKVLCRDAELRGVMDGHIGSDAENLCLFDDSLNFTALRV
                     VPLPVEAGDGDAAAAASVTAQYRFEVRAQCHLGDLVTCVRQGSFAATSLMEAPASCAS
                     AQNRLLLPGIAGPQLVFATAHGGFGVVTPVHAATYLVLRTLEASLVRTLQPLGGLSHQ
                     AFREVLRSGQERGVSYLASKTGCALTRERLRRYEPLNTVDGDMVEQFVQLSVSDKKQV
                     CRVATDVFLHAFAQCVNESGIFVAPPAKEEQCLLAALGTAMRPFAQYPEETIAQANAF
                     LHQGGLPHVPFAAEAVEQQVMDLQRLH"
     gene            <1395251..>1395571
                     /gene="LIP1"
                     /locus_tag="LMJF_30_3720"
                     /db_xref="GeneID:5653923"
     mRNA            <1395251..>1395571
                     /gene="LIP1"
                     /locus_tag="LMJF_30_3720"
                     /product="putative 60S acidic ribosomal protein P2"
                     /transcript_id="XM_001684930.1"
                     /db_xref="GeneID:5653923"
     CDS             1395251..1395571
                     /gene="LIP1"
                     /locus_tag="LMJF_30_3720"
                     /codon_start=1
                     /product="putative 60S acidic ribosomal protein P2"
                     /protein_id="XP_001684982.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653923"
                     /db_xref="GOA:Q4Q6R6"
                     /db_xref="InterPro:IPR001813"
                     /db_xref="InterPro:IPR001859"
                     /db_xref="InterPro:IPR027534"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6R6"
                     /translation="MQYLAAYALVALSGKTPSKADVQAVLKAAGVAVDASRVDAVFQE
                     MEGKSFDAVVAEGRTKLVGSGSAAPAGAASTAGAAAGAVAEAKKEEPEEEEADDDMGF
                     GLFD"
     gene            <1396081..>1396458
                     /gene="LIP2"
                     /locus_tag="LMJF_30_3730"
                     /db_xref="GeneID:5653924"
     mRNA            <1396081..>1396458
                     /gene="LIP2"
                     /locus_tag="LMJF_30_3730"
                     /product="putative 60S acidic ribosomal protein P2"
                     /transcript_id="XM_001684931.1"
                     /db_xref="GeneID:5653924"
     CDS             1396081..1396458
                     /gene="LIP2"
                     /locus_tag="LMJF_30_3730"
                     /codon_start=1
                     /product="putative 60S acidic ribosomal protein P2"
                     /protein_id="XP_001684983.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653924"
                     /db_xref="GOA:Q4Q6R5"
                     /db_xref="InterPro:IPR001813"
                     /db_xref="InterPro:IPR001859"
                     /db_xref="InterPro:IPR027534"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6R5"
                     /translation="MHFLSYFFFASSRTRGVVNMQYLAAYALVALSGKTPSKADVQAV
                     LKAAGVAVDASRVDAVFQEMEGKSFDAVVAEGRTKLVGSGSAAPAGAASTAGAAAGAV
                     AEAKKEEPEEEEADDDMGFGLFD"
     gene            <1396736..>1397404
                     /locus_tag="LMJF_30_3740"
                     /db_xref="GeneID:5653925"
     mRNA            <1396736..>1397404
                     /locus_tag="LMJF_30_3740"
                     /product="putative ribosomal P protein AGP2beta-1"
                     /transcript_id="XM_001684932.1"
                     /db_xref="GeneID:5653925"
     CDS             1396736..1397404
                     /locus_tag="LMJF_30_3740"
                     /codon_start=1
                     /product="putative ribosomal P protein AGP2beta-1"
                     /protein_id="XP_001684984.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.30.3740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.30.3740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5653925"
                     /db_xref="UniProtKB/TrEMBL:Q4Q6R4"
                     /translation="MALQENRDSYKVKALSLSEFVQQCSDCHQLCLEKTVRVLDNRSR
                     APRGWEALFNSVAEERRSEDLDLCESRCRYMQTTCPSQDKVQQYEQALAAASLKLKKS
                     TPPNPSVLQDASRCEHAVEVFSNVLFALAHKPSKVSFPTKDLKTGGNTDAESHAGAPT
                     EAHRKVLEGAKNMDNDVSCRSSKLRHERFGSKAQDVASSTGSSLAPDTAAASPASSGT
                     TPKW"
CONTIG      join(FR796426.1:1..1403434)
//
DBGET integrated database retrieval system