GenomeNet

Database: RefSeq
Entry: NC_007286
LinkDB: NC_007286
Original site: NC_007286 
LOCUS       NC_007286            1866748 bp    DNA     linear   CON 16-JUN-2017
DEFINITION  Leishmania major strain Friedlin complete genome, chromosome 34.
ACCESSION   NC_007286 CT005271
VERSION     NC_007286.2
DBLINK      BioProject: PRJNA15564
            BioSample: SAMEA3138173
            Assembly: GCF_000002725.2
KEYWORDS    RefSeq; complete genome.
SOURCE      Leishmania major strain Friedlin
  ORGANISM  Leishmania major strain Friedlin
            Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae;
            Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Rogers,M.B., Hilley,J.D., Dickens,N.J., Wilkes,J., Bates,P.A.,
            Depledge,D.P., Harris,D., Her,Y., Herzyk,P., Imamura,H., Otto,T.D.,
            Sanders,M., Seeger,K., Dujardin,J.C., Berriman,M., Smith,D.F.,
            Hertz-Fowler,C. and Mottram,J.C.
  TITLE     Chromosome and gene copy number variation allow major structural
            change between species and strains of Leishmania
  JOURNAL   Genome Res. 21 (12), 2129-2142 (2011)
   PUBMED   22038252
REFERENCE   2
  AUTHORS   Ivens,A.C., Peacock,C.S., Worthey,E.A., Murphy,L., Aggarwal,G.,
            Berriman,M., Sisk,E., Rajandream,M.A., Adlem,E., Aert,R.,
            Anupama,A., Apostolou,Z., Attipoe,P., Bason,N., Bauser,C., Beck,A.,
            Beverley,S.M., Bianchettin,G., Borzym,K., Bothe,G., Bruschi,C.V.,
            Collins,M., Cadag,E., Ciarloni,L., Clayton,C., Coulson,R.M.,
            Cronin,A., Cruz,A.K., Davies,R.M., De Gaudenzi,J., Dobson,D.E.,
            Duesterhoeft,A., Fazelina,G., Fosker,N., Frasch,A.C., Fraser,A.,
            Fuchs,M., Gabel,C., Goble,A., Goffeau,A., Harris,D.,
            Hertz-Fowler,C., Hilbert,H., Horn,D., Huang,Y., Klages,S.,
            Knights,A., Kube,M., Larke,N., Litvin,L., Lord,A., Louie,T.,
            Marra,M., Masuy,D., Matthews,K., Michaeli,S., Mottram,J.C.,
            Muller-Auer,S., Munden,H., Nelson,S., Norbertczak,H., Oliver,K.,
            O'neil,S., Pentony,M., Pohl,T.M., Price,C., Purnelle,B.,
            Quail,M.A., Rabbinowitsch,E., Reinhardt,R., Rieger,M., Rinta,J.,
            Robben,J., Robertson,L., Ruiz,J.C., Rutter,S., Saunders,D.,
            Schafer,M., Schein,J., Schwartz,D.C., Seeger,K., Seyler,A.,
            Sharp,S., Shin,H., Sivam,D., Squares,R., Squares,S., Tosato,V.,
            Vogt,C., Volckaert,G., Wambutt,R., Warren,T., Wedler,H.,
            Woodward,J., Zhou,S., Zimmermann,W., Smith,D.F., Blackwell,J.M.,
            Stuart,K.D., Barrell,B. and Myler,P.J.
  TITLE     The genome of the kinetoplastid parasite, Leishmania major
  JOURNAL   Science 309 (5733), 436-442 (2005)
   PUBMED   16020728
REFERENCE   3  (bases 1 to 1866748)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 1866748)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire, CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR796430.
            On Jun 1, 2012 this sequence version replaced NC_007286.1.
            Data release policy www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1866748
                     /organism="Leishmania major strain Friedlin"
                     /mol_type="genomic DNA"
                     /strain="Friedlin"
                     /db_xref="taxon:347515"
                     /chromosome="34"
     gene            complement(<5180..>6100)
                     /locus_tag="LMJF_34_0010"
                     /db_xref="GeneID:5655248"
     mRNA            complement(<5180..>6100)
                     /locus_tag="LMJF_34_0010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686038.1"
                     /db_xref="GeneID:5655248"
     CDS             complement(5180..6100)
                     /locus_tag="LMJF_34_0010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686090.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655248"
                     /db_xref="GOA:Q4Q3K8"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3K8"
                     /translation="MPCFLSLVGTVALGVVFFKVISFVKVNYLTSLNMKKRYGNAGDW
                     AVVTGASEGIGYAMALDLGRRGFNVCVIARTLSKLENVVEELKQLGVQGKAISFDFAS
                     ATPKQYDDMFAELDKIEIAVLVNNVGVNYTYTNYFDEVDLETDLRLLKVNCESSVRMT
                     KYVVPKMKAKRCGAIVMLGSVSAVTPAPLLCTYAGTKAFNLSFGSGLYYELKQFGIDV
                     LAVSPNMVVSKMTQGLSSRKPRETFLMVNADRMAHQTLDKLGSVPQTPGHCNHAVLEA
                     IVRALPTGYVSNKILETHKSIKRKAERKRE"
     gene            <8002..>9036
                     /locus_tag="LMJF_34_0020"
                     /db_xref="GeneID:5654762"
     mRNA            <8002..>9036
                     /locus_tag="LMJF_34_0020"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686039.1"
                     /db_xref="GeneID:5654762"
     CDS             8002..9036
                     /locus_tag="LMJF_34_0020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686091.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654762"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3K7"
                     /translation="MCRVTRVELTSDDEVDDVVQREILDILCLLQNEVISLRLGKLHM
                     KNAELAPRLPLMNSLSLDSCDGGIEKFISALSTAAEILEISDCFCLSDAMFESMPTTE
                     VHRLVLDNTNVATSWLEHLKCTHSVQTLSLMDCCKIDALRVSAFPELRRLLLCRTPIA
                     SESLKGVEKCSHLRIVNLGGCQEIVDVNAFGALKQLRELFLHETSVTNAGIAALADCE
                     RLEKLNLGGCVHVSNVNHLGSLVNLLELHLWSTKVTNSGIEGLASCCSLMELVLDDCV
                     RITDVLPLGCLQSIRWLSLIGTEVDARGVKGLIHCQKLETLALGGTRIAHPPKLWRHE
                     AIVEYLENLI"
     gene            <9592..>10779
                     /locus_tag="LMJF_34_0030"
                     /db_xref="GeneID:5654755"
     mRNA            <9592..>10779
                     /locus_tag="LMJF_34_0030"
                     /product="putative protein kinase"
                     /transcript_id="XM_001686040.1"
                     /db_xref="GeneID:5654755"
     CDS             9592..10779
                     /locus_tag="LMJF_34_0030"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001686092.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654755"
                     /db_xref="GOA:Q4Q3K6"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3K6"
                     /translation="MCHHCFELFLLFHAILCTDVSPLFAFLVVLVLKYVFRGAFSHFL
                     LESAERVSFAKMGNHFSLCPEPFHGLISSYGRGSISSTHPSGVAVKGEEYSAVKLVGE
                     GGYSFVYEGYSNATGQRVALKRYVFSEMQQQQGAVEEVSIHRDVCPNDYIVTYLDSEV
                     VYRPGVPLPEMWVVMEFCEGPSLQEYINNRLRSPQPFSVREVFEIVDNIVHAIGHLHS
                     QSPPVSHWDIKPDNFLFTDTGRLKLCDFGSATRQFYAPTSAEEVSAAESELGSRMTLL
                     YRPPESLDLWSKDRVDTKADIWALGVIIYVMVFREMPFDANPMEVMAAVPKRYKGKTQ
                     EGCPKEFRALMDIVRTKMLTKKPADRADIFALSEELEGVTHLPPLSRPRPGFQSAQRP
                     RFA"
     gene            <11851..>13890
                     /locus_tag="LMJF_34_0040"
                     /db_xref="GeneID:5654756"
     mRNA            <11851..>13890
                     /locus_tag="LMJF_34_0040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686041.1"
                     /db_xref="GeneID:5654756"
     CDS             11851..13890
                     /locus_tag="LMJF_34_0040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686093.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654756"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3K5"
                     /translation="MKGMGRVFAVKSKSDATLRVMVPPRDDEAAEEDLSREWLDCCLR
                     EYLERKRLFENRFRSRVQLIARILALLVPFLAVLWSIWPMWRVLIDVETDAYYKALEV
                     PSTATPGEITRGYRAMMKRWHPDNNPTCGQYCREKTERIKEAYDMLLSRSNHHLTLAN
                     QYHEGLMALRSLLSFRGFQISGDAAMNAFMILLRLYPASAKKSVALRLACSIVILAFC
                     TVHEALFVSGFSIVTVVELFYYSLSMAKASAQQQSMEEVRRNSYFDVVRDAFVLLGCA
                     SVASIAVRWRENNAMSMEEASRMFYGSVYVLSFLYKFSPNAYDNFLMRKCSLPLTYMD
                     IANARFTWTRFATSELMFLVDDLFVFTCRISSPYRVVVYIAHFVALCQFFMLPWDTPI
                     INGRASAKARAAGIEEPGVPASASARTRVAQSTNSDAMETAEKSTFAQSYITKEEEVV
                     VTDLDSEAVSWMDIASLKYKALVFALGRKHAQQHGQSADAVDIAPSSDLQNVLVVAVS
                     RGAGTGPAASQQRLDVLCQVRDPEMSRLVAMERGPKMMVPARPKSPWNLDVARVEYRK
                     SLGSVAPLTSARVWRKRAPMSRSAAWKALLTMVCVWVVFAVVCAVAGPSPYDALRSSK
                     GIDRSLRPQLFARFLGALPPTHFVNALSGGLLTVAQIPLCTLDWWDAGATFGFVR"
     gene            <14404..>16158
                     /locus_tag="LMJF_34_0050"
                     /db_xref="GeneID:5654757"
     mRNA            <14404..>16158
                     /locus_tag="LMJF_34_0050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686042.1"
                     /db_xref="GeneID:5654757"
     CDS             14404..16158
                     /locus_tag="LMJF_34_0050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686094.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654757"
                     /db_xref="InterPro:IPR008429"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3K4"
                     /translation="MANTDTRQIRDGDNGNHGNLRSFLPKALLYAFLSLVFMNIFGKA
                     PMVSVQNTKSVQPQSPAPPSTLSSLRPLARQGERFNVVVETQPPLFEPLKFENLLFSH
                     DALAAANLSVTIPVDLKPCATANCTVTLRVQWSLRNYTFSLTAPLVRFFRDTAVQKKY
                     LFGNNSEGESANVEATVSTAYKQYFQPEVTLSPVVFFDYPLPDACFEFTPVVESRPGF
                     YGPSLYINNFWMLREHHVQLNASSTSQPLNFTVHLTPLPRWKVLLYTQFEKTMATQAT
                     AGFSKASEAEETKRMLLDVSTRNPVLLVVTAIVTVLHSVFEFLAFSNDVKFWKGRKDF
                     RGLSVRSIIISCYFQSVIFLYLLDSQETSWAVLVPSGMGAFMEFWKLAKTLKIVKVEA
                     EVTTAVEEQGAARESAGKKKKWRIAGYDIGFTDSYDSRTQKHDDVAVRYLIYAMILPL
                     TGYTVYSALYKTHRNWYSFLISTQVQFIYSFGFAQMTPQIFINYKMKSVGQLPWRTFI
                     YKSLNTVIDDLFAFVIKMPWLHRLACFQDDIVFAILLYQRWIYPVDMSRFDGDSGADV
                     AEEGAPAAEAVESDKKNQ"
     gene            <18422..>21547
                     /locus_tag="LMJF_34_0060"
                     /db_xref="GeneID:5654758"
     mRNA            <18422..>21547
                     /locus_tag="LMJF_34_0060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686043.1"
                     /db_xref="GeneID:5654758"
     CDS             18422..21547
                     /locus_tag="LMJF_34_0060"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686095.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654758"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3K3"
                     /translation="MHVEIRLCGVEQACAFDPQSFYRVKQLLTSYNGQGSGAEETARR
                     AWHGGSLLRLRHTTPFTAELKLQVVVESLIEMESRCFSAVMDKKQHEARIKSNWNNSA
                     VGTAYHSADVDEVILAALPVAAANSVVKIRLLQLPPPLDYDTQQVVKRAIGNATVSRQ
                     RHDTPLCIGVAKISLWELMLARRTVSIAMQAKRAVVTTVEAHNLDTLITNAMFGRGER
                     NGSAVLSVQFNGYTFGRVPRGKSIRSHSHRDTTKRITAAMDSDAPLPSASSGEAEEAA
                     ILTEETLDSPAIRFVLLPYVALVDVLLRVVDVTSWRVPRKTGMALAAVVIALYSDLFD
                     MLFVLTVALGVLSVLRNISLFCYAPVSDSTAARVAATPGGGSGVTKFQPFLYSRENAF
                     LNSLLRARIFFSHGLMEDTYYELALAAHIARRNRRQLVGFGLAVCCSFAFLSMGTVVI
                     LLTLGAFTAYPIFLNLPSTRRRTRRRKGSALALIRSAANAIRVPRRYKVVRAIRVAVV
                     RAKSTSLSSRNDSIAGSGAESLQQQFLNCIRQQAESNGARSPTERSEISLKAREKSNL
                     MVGRRTRTVDFDVLPSNSVNFASTLDRFQVTHVMRYFVALCFSPNVMETPEPASTTSG
                     LRKASSNAVLQRRLCYQLRQARMVSDLLPSALPQPTNISTGGGLATISQQGGVVVGDS
                     KPVAVSKEIQETFQSYFNSTLSLLFYLRQQWTFHPYVTQSSTTKCMPDSLRSVSVLAE
                     PQGLIDVGEDDGVTKALMARRNSMSNPPMVGMFNSSNSVEVSGRVMALYAAYLLQGAR
                     LSVYTSSSGCATVLPLRAPGNCMERFPQPNPCPADLLNTLDSVWRGETSHTAGKGEEV
                     YFNADAVLQIITVYKDYWEGGANLATTRSSARLDSSAAGESHFSNTLMRSSIRCALVS
                     APPVPRQQTAPLSATTPLSRSSRQLTTALTVLGGAAGSAGQPRGDISPNPASSTRNIN
                     TRLAPVPLLPAAMAEPYTTNAGCEISLSSSAKVDSISNKVLGDPPVLDATCNRDANGQ
                     QLANHERSDEF"
     gene            <22865..>23776
                     /gene="APX"
                     /locus_tag="LMJF_34_0070"
                     /db_xref="GeneID:5654759"
     mRNA            <22865..>23776
                     /gene="APX"
                     /locus_tag="LMJF_34_0070"
                     /product="ascorbate peroxidase"
                     /transcript_id="XM_001686044.1"
                     /db_xref="GeneID:5654759"
     CDS             22865..23776
                     /gene="APX"
                     /locus_tag="LMJF_34_0070"
                     /EC_number="1.11.1.11"
                     /codon_start=1
                     /product="ascorbate peroxidase"
                     /protein_id="XP_001686096.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654759"
                     /db_xref="GOA:Q4Q3K2"
                     /db_xref="InterPro:IPR002016"
                     /db_xref="InterPro:IPR002207"
                     /db_xref="InterPro:IPR010255"
                     /db_xref="InterPro:IPR019794"
                     /db_xref="PDB:3RIV"
                     /db_xref="PDB:3RIW"
                     /db_xref="PDB:4GED"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3K2"
                     /translation="MSGTSRRAKGLFTGIAVGTFVSGAMFVSCASARVEEPPFDIRAL
                     RADIEDMISEKLELGPSLIRLAWHEAASYDCFKKDGSPNSASMRFKPECLYAGNKGLD
                     IPRKALETLKKKYPQISYADLWVLAAYVAIEYMGGPTIPFCWGRVDAKDGSVCGPDGR
                     LPDGSKTQSHVREVFRRLGFNDQETVALIGAHTCGECHIEFSGYHGPWTHDKNGFDNS
                     FFTQLLDEDWVLNPKVEQMQLMDRATTKLMMLPSDVCLLLDPSYRKYVELYAKDNDRF
                     NKDFANAFKKLTELGTRNLHKAPASES"
     gene            <26290..>27978
                     /gene="G6PD"
                     /locus_tag="LMJF_34_0080"
                     /db_xref="GeneID:5654760"
     mRNA            <26290..>27978
                     /gene="G6PD"
                     /locus_tag="LMJF_34_0080"
                     /product="putative glucose-6-phosphate 1-dehydrogenase"
                     /transcript_id="XM_001686045.1"
                     /db_xref="GeneID:5654760"
     CDS             26290..27978
                     /gene="G6PD"
                     /locus_tag="LMJF_34_0080"
                     /EC_number="1.1.1.49"
                     /codon_start=1
                     /product="putative glucose-6-phosphate 1-dehydrogenase"
                     /protein_id="XP_001686097.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654760"
                     /db_xref="GOA:Q4Q3K1"
                     /db_xref="InterPro:IPR001282"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR019796"
                     /db_xref="InterPro:IPR022674"
                     /db_xref="InterPro:IPR022675"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3K1"
                     /translation="MSEEQSHADQDAYVADVDGILDVLRAEVLERKPDDVFQFISQSA
                     LSLQKDRGAESCDRINCKVTDEQKSRALTIIVFGASGDLAKKKTFPALFDLYCGGLLP
                     PEVNVIGYARTKVDDAERWKRETLMTYFSNVPERACHAEDFLKHISYFCGSYDKVDDF
                     KRLDAVIREKENAFKGPEKGGNRLFYLALPPSVFASVCESIHKGAMPQEVGGWARVII
                     EKPFGRDTKSSAELSRALEPFFDESQLYRIDHYLGKEMVQNIITTRFANRIFSAVWNS
                     NNIACVQITFKETIGTEGRGGYFDGIGIIRDVMQNHLTQILALLAMEKPRSLDAECIR
                     DEKVSVLKCIEPITKENCVLGQYTASADGSIPGYQEDVTVPEGSTCPTFAVMRLNINN
                     DRWAGVPFILKAGKAVEQKYVAIRIQFKDEVHPYGEATQRNELVIRAQPSEAMYVKIT
                     TKVPGLSGDLRQTHQTELDLTYHTRYDVRLPDAYESLINDALLGNSTNFVRKDELDVA
                     WRIFTPLLHQIDCGEIKPIPYQAGTRGPKEADEFITNNGFKHQKGYQWLPSNKL"
     gene            <29948..>30508
                     /locus_tag="LMJF_34_0085"
                     /db_xref="GeneID:5654761"
     mRNA            <29948..>30508
                     /locus_tag="LMJF_34_0085"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686046.1"
                     /db_xref="GeneID:5654761"
     CDS             29948..30508
                     /locus_tag="LMJF_34_0085"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686098.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0085"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0085"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654761"
                     /db_xref="InterPro:IPR007065"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3K0"
                     /translation="MYLRLLKCAGHPDRTWFSTTRNCIVASAFTDVTLMVLAVIETSG
                     RRPCEVGLDSYVPSFGASYCLLTYLLARCAAARTHFLSHTVSAFLGEAGPHSTNSLPK
                     PLSQQPACGFAVGIMAAPLILTGSLQPSASATTCLAAFHTDSRMNDEGLMCISTPATV
                     GLCLIVFLDWAFNDLVPWRHYYPVRV"
     gene            <32488..>34278
                     /locus_tag="LMJF_34_0090"
                     /db_xref="GeneID:5654763"
     mRNA            <32488..>34278
                     /locus_tag="LMJF_34_0090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686047.1"
                     /db_xref="GeneID:5654763"
     CDS             32488..34278
                     /locus_tag="LMJF_34_0090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686099.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654763"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3J9"
                     /translation="MTARAAVMPCLQRYARLSASVLASPDDAETQAALSLLLQYLSLQ
                     SCNTSEVEALEQWCRKKGNEERLKKCGGEATAVVKRRVTQRARVLSEAVASRQDMLVT
                     DARSTGVPAVICTAGAHDSGRVGTATLVQWWHLSDDDPWSFTASASCSQATQGGSDGY
                     RFVCLREALTLVGPYLDVMRQAAATGDWEGVSRLFIEATSYVNRVSFRDDPAAVFGSL
                     ELSRLHLTLTFASRGGVASVEKALQQVRVNDDMRRAAALLDGLGAKERDTAELYSSPD
                     ASAASVSKVQAYWRLILSYSTFFNTVAAYVDGSLGRFESCAKALLGDGTETGACLWGA
                     ARYPSIHFCLPDSTAHVRQPDAHPGGPKTHSGTCTVMPVLFPYSSSHVRASASDHYLG
                     EFAPLVTRVIAPASSFSTLVVLSAVGTLPLHVALTKLRTCVELREVYEGCSELTSFLD
                     ALWRGQLGVAWRCAKEAVTRYLNREPHVQDSVVKKLLQYVRRSVCFHYLRVRRTALMA
                     DAAVDLGFESSEEVAETATALISCNYIDARIDLVKGTICSNELDERSEVMMEVKAEAT
                     ALAKLSFSALKVRLACLSAERNLIAFPDDG"
     gene            <35255..>37336
                     /locus_tag="LMJF_34_0100"
                     /db_xref="GeneID:5654764"
     mRNA            <35255..>37336
                     /locus_tag="LMJF_34_0100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686048.1"
                     /db_xref="GeneID:5654764"
     CDS             35255..37336
                     /locus_tag="LMJF_34_0100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686100.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654764"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3J8"
                     /translation="MNVVDDSVFQVLSDAWAAVGVPADRYWRCSQHLRGGSSAAMLPK
                     KTPSSPHSLLGLRVPNPLRLHSSFYPTRVEALAARGYGAHRGLLPIALDRRSGSGSKL
                     FNVLPRWSTNVVGIGEAGVETSAGIRHGSAVADFVSAIPHTQDRNLYALVDESCPVDP
                     YFDLDFAYDPDQDDPSDALLVQSYGEGKEVASVTAFSAEAVEKVLLTMLTALRREVET
                     ELKTTVAECLVLTSSLQIGRRPDTPSAPASLEQLKLSFHVHFRLADRAVLASVREMHH
                     FVTRLRSRLQNDEAAATTLSLLGSPTREKREEARQASSLLLRCVDFGVYTRWRAFRLP
                     YNVKAFDAARSSALVSGAGDDLLEEQLQQLGIALPDNGVGRAAPSVLQNLFLAADVAT
                     HKAQRYLLKRLEQHFRFLLPVLPGATELRSAALAEFLSPLVPRQVRAAAAELSRPSSP
                     TSSARDVVSAWVMELACIVRDASTLPHSRDDGAVQESTTSSSFRLLLDECTITSAAAK
                     ASAQATSNTFDVPLPPMPRSVRVRVEDAEMKRLLAEVFWCIAPEYGGPGAVVRASPVA
                     DAWNALSAPNSITPERINAHYEDSIRAYYVFQKQNKYCVRLHRNHKATFAQLYLTFGS
                     IKIRCYANDCCDRCCIIPWEAPDNPKSGPQYHAGYPRYERLVAIRNALFPPLSTEELV
                     RRYGTSILHYV"
     gene            <38198..>38854
                     /locus_tag="LMJF_34_0110"
                     /db_xref="GeneID:5654765"
     mRNA            <38198..>38854
                     /locus_tag="LMJF_34_0110"
                     /product="putative adenylate kinase"
                     /transcript_id="XM_001686049.1"
                     /db_xref="GeneID:5654765"
     CDS             38198..38854
                     /locus_tag="LMJF_34_0110"
                     /EC_number="2.7.4.3"
                     /codon_start=1
                     /product="putative adenylate kinase"
                     /protein_id="XP_001686101.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654765"
                     /db_xref="GOA:Q4Q3J7"
                     /db_xref="InterPro:IPR000850"
                     /db_xref="InterPro:IPR006259"
                     /db_xref="InterPro:IPR007862"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3J7"
                     /translation="MKIVLMGAPGCGKGTQSPYIQDRYGLCHLSTGDMLRDAVARKTA
                     NGKLAKDAMDSGKLVSDDIVFGIVKDSIKNPECRYGYILDGYPRTLKQAQMMEDAGEK
                     IDKVIEFSVPDEVILERTSGRWIHKSSGRTYHEVFRPPKTPGKDDITGEDLYQRPDDR
                     REVCEKRLDIYKNETRPLADYFTKEGVYSTINANQAIDEVRKIIAALLDPIGIATGLK
                     "
     gene            <42397..>43086
                     /locus_tag="LMJF_34_0120"
                     /db_xref="GeneID:5654766"
     mRNA            <42397..>43086
                     /locus_tag="LMJF_34_0120"
                     /product="adenylate kinase 2"
                     /transcript_id="XM_001686050.1"
                     /db_xref="GeneID:5654766"
     CDS             42397..43086
                     /locus_tag="LMJF_34_0120"
                     /EC_number="2.7.4.3"
                     /codon_start=1
                     /product="adenylate kinase 2"
                     /protein_id="XP_001686102.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654766"
                     /db_xref="GOA:Q4Q3J6"
                     /db_xref="InterPro:IPR000850"
                     /db_xref="InterPro:IPR007862"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3J6"
                     /translation="MKIVMEGPPQGGKTTVASVVKERYGLCYVSTSEAVRNAVRLGNS
                     AYSSQLKQLIDNDERIPDSLEVKVVSEATRRPDCVNGFVLDGFPRTRKQSKMMQDLEN
                     VKVDIVVELEISNSELQTRFGGRWYHPKSGRIYHTFYDPPLNAGKDDYTGEPLVQHLE
                     DTPERIQERMSQYRQQLSEVRSTFARDAWVTVEASGNVESVRNNVFAVLDPLYFAQAS
                     KKVPKPWWKLW"
     gene            <44244..>45272
                     /locus_tag="LMJF_34_0130"
                     /db_xref="GeneID:5654767"
     mRNA            <44244..>45272
                     /locus_tag="LMJF_34_0130"
                     /product="putative malate dehydrogenase"
                     /transcript_id="XM_001686051.1"
                     /db_xref="GeneID:5654767"
     CDS             44244..45272
                     /locus_tag="LMJF_34_0130"
                     /EC_number="1.1.1.37"
                     /codon_start=1
                     /product="putative malate dehydrogenase"
                     /protein_id="XP_001686103.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654767"
                     /db_xref="GOA:Q4Q3J5"
                     /db_xref="InterPro:IPR001236"
                     /db_xref="InterPro:IPR001252"
                     /db_xref="InterPro:IPR001557"
                     /db_xref="InterPro:IPR015955"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR022383"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3J5"
                     /translation="MGLLFRRSLTALKKGKVVLFGCSNAVGQPLSLLLKMNPHVEELV
                     CCNTAADDDVPGSGIAADLSHIDTLPKVHYATDEGQWPALLRDAQLILVCFGSSFDLL
                     REDRDIALKAAAPTMRRVMAAVASSDTTGNVAVVSSPVNALTPFCAELLKASGKFDPR
                     KLFGVTTLDVIRTRKLVAGTLHMNPYDVNVPVVGGCGGVTACPLIAQTGLRIPLDDIV
                     RISGEVQSYGVLFEAAVGADSHDALSTEVAPPVALGLAYAACDFSTSLLKALRGDVGI
                     VECALVESTMRSETPFFSSRVELGREGVQRVFPMGALTSYEHELIETAVPELMRDVQA
                     GIEAATQF"
     gene            <46032..>46985
                     /locus_tag="LMJF_34_0140"
                     /db_xref="GeneID:5654768"
     mRNA            <46032..>46985
                     /locus_tag="LMJF_34_0140"
                     /product="malate dehydrogenase"
                     /transcript_id="XM_001686052.1"
                     /db_xref="GeneID:5654768"
     CDS             46032..46985
                     /locus_tag="LMJF_34_0140"
                     /EC_number="1.1.1.37"
                     /codon_start=1
                     /product="malate dehydrogenase"
                     /protein_id="XP_001686104.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654768"
                     /db_xref="GOA:Q4Q3J4"
                     /db_xref="InterPro:IPR001236"
                     /db_xref="InterPro:IPR001252"
                     /db_xref="InterPro:IPR001557"
                     /db_xref="InterPro:IPR010097"
                     /db_xref="InterPro:IPR015955"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR022383"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3J4"
                     /translation="MRRSQGCFFRVAVLGAAGGIGQPLSLLLKNNKYVKELKLYDVKG
                     GPGVAADLSHICAPAKVTGYTKDELSRAVENADVVVIPAGIPRKPGMTRDDLFNTNAS
                     IVRDLAIAVGTHAPKAIVGIITNPVNSTVPVAAEALKKVGVYDPARLFGVTTLDVVRA
                     RTFVAEALGASPYDVDVPVIGGHSGETIVPLLSGFPSLSEEQVRQLTHRIQFGGDEVV
                     KAKDGAGSATLSMAFAGNEWTTAVLRALSGEKGVVVCTYVQSTVEPSCAFFSSPVLLG
                     NSGVEKIYPVPMLNAYEEKLMAKCLEGLQSNITKGIAFSNK"
     gene            <50273..>51268
                     /locus_tag="LMJF_34_0150"
                     /db_xref="GeneID:5654769"
     mRNA            <50273..>51268
                     /locus_tag="LMJF_34_0150"
                     /product="putative malate dehydrogenase"
                     /transcript_id="XM_001686053.1"
                     /db_xref="GeneID:5654769"
     CDS             50273..51268
                     /locus_tag="LMJF_34_0150"
                     /EC_number="1.1.1.37"
                     /codon_start=1
                     /product="putative malate dehydrogenase"
                     /protein_id="XP_001686105.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654769"
                     /db_xref="GOA:Q4Q3J3"
                     /db_xref="InterPro:IPR001236"
                     /db_xref="InterPro:IPR001557"
                     /db_xref="InterPro:IPR010097"
                     /db_xref="InterPro:IPR015955"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR022383"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3J3"
                     /translation="MKPSTLSRFKVTVLGASGAIGQPLALALVQNKRVSELALYDIVQ
                     PRGVAVDLSHFPRKVKVTGYPTKWIHKALDGADLVLMSAGMPRRPGMTHDDLFNTNAL
                     TVNELSAAVARYAPKSVLAIISNPLNSMVPVAAETLQRAGVYDPRKLFGIISLNMMRA
                     RKMLGDFTGQDPEMLDVPVIGGHSGQTIVPLFSHSGVELRQEQVEYLTHRVRVGGDEV
                     VKAKEGRGSSSLSMAFAAAEWADGVLRAMDGEKTLLQCSFVESPLFADKCRFFGSTVE
                     VCKEGIERVLPLPPLNEYEEEQLDRCLPDLEKNIRKGLAFVAENAATSTPSTASP"
     gene            <53516..>54493
                     /gene="mMDH"
                     /locus_tag="LMJF_34_0160"
                     /db_xref="GeneID:5654770"
     mRNA            <53516..>54493
                     /gene="mMDH"
                     /locus_tag="LMJF_34_0160"
                     /product="mitochondrial malate dehydrogenase"
                     /transcript_id="XM_001686054.1"
                     /db_xref="GeneID:5654770"
     CDS             53516..54493
                     /gene="mMDH"
                     /locus_tag="LMJF_34_0160"
                     /EC_number="1.1.1.37"
                     /codon_start=1
                     /product="mitochondrial malate dehydrogenase"
                     /protein_id="XP_001686106.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654770"
                     /db_xref="GOA:Q4Q3J2"
                     /db_xref="InterPro:IPR001236"
                     /db_xref="InterPro:IPR001252"
                     /db_xref="InterPro:IPR001557"
                     /db_xref="InterPro:IPR010097"
                     /db_xref="InterPro:IPR015955"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR022383"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3J2"
                     /translation="MRSSATRLFRVAVLGAAGGIGQPLSLLLKCSPLVTSLSLYDIRG
                     GPGVAADLSHIPSPAEVIGFSSGELEKAVKGADLVLVVAGIPRKPGMTRDDLLHTNAS
                     IVRDLAIAVGTHAPKAIVGIITNPVNSTVPVAAEALKKVGVYDPARLFGVTTLDVVRA
                     RTFVAEALGASPYDVDVPVIGGHSGETIVPLLSGFPSLSEEQVRQLTHRIQFGGDEVV
                     KAKDGAGSATLSMAYAASEWSISMLKALRGDRGIVEYALVESDMQQPHSRFFGCAVEL
                     GTHGVERVLPMPKLNAYEQQLLDACVPALSAEFRKGVDLAVKLHLSQDN"
     gene            <56531..>57529
                     /locus_tag="LMJF_34_0170"
                     /db_xref="GeneID:5654771"
     mRNA            <56531..>57529
                     /locus_tag="LMJF_34_0170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686055.1"
                     /db_xref="GeneID:5654771"
     CDS             56531..57529
                     /locus_tag="LMJF_34_0170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686107.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654771"
                     /db_xref="InterPro:IPR019186"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3J1"
                     /translation="MVKYLDTGADTAAGGNKKVRKGFKSDRLENYKRMLAKKNGKTVR
                     DAPTCTPRPKALTFDDSSRRDYLLTLHKKKNERRVQAFVDAKRKQRKDSAKTRREQRE
                     EARRAYNNYARVPILPDYTYRLPRQQDDMFADDEEDEERGGEDGYSSQSAENGAEDAD
                     MPWISVDDPEVATDAAKRSFAAEASQRRRREKRLATLSHSAHAMPGAMLGQEAGIAAD
                     THLPVGPSSSSELESEYVTVDVKPLFSTSSGDAASTCKGGAVSTKALPSNDFDDLPLV
                     VRQELHRLRQQTKGPAKTKPRMRMMKELEKIRKIRKHSRKGHGKRRASGKRKNRKK"
     gene            <58471..>60375
                     /locus_tag="LMJF_34_0175"
                     /db_xref="GeneID:12981301"
     mRNA            <58471..>60375
                     /locus_tag="LMJF_34_0175"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722348.1"
                     /db_xref="GeneID:12981301"
     CDS             58471..60375
                     /locus_tag="LMJF_34_0175"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722396.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0175"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0175"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981301"
                     /db_xref="UniProtKB/TrEMBL:E9AEH6"
                     /translation="MSSPFFGEQRKTRHNRSCSSCDSLPRYAASPPCHPQYAKVDRAA
                     PSVSSPTFSSVPPSPKFPALCMHAMSHTNSTVPSSKLPFSNSVTGNGAALIGTLASFD
                     SEAPRGRPASVAEDGAASGSSSGLSRAAVLMSGRGDASPPFSPQPSGSVLAVFCPLTS
                     KAWQSGTLRDGIAFDVDTTSKVSTISPQTGLQSPLLFSSGWSQQSVSAAAQGTPPSFM
                     GTPGQSLISAGAEGDDAEDTPHSCGAMYSPNHSVSLLPAPKVFVSVYPVQSPEPFATK
                     FTGSPVFEVSLTTPPSIRAPQTGAARGAGATPAPSSRLPSESLEQYSLLRSPILHSLT
                     PLSISPSAPLSPGFGCITGTEPMQSRLSRHRLATSAGSEQLPVRTSNDMRSRNAAVAS
                     PPPAAVPSVNSNHESLSDRLVSPARRSYRCPLPSSNEASLSSFFAVDDAGLHANLSMT
                     QASEEDAAHRAASATLPRVCSSKDTEAEEGVAAALAPDTTDDPFEAFWDISPAAQWGG
                     SVTEMLPRITTSSAPFETGSASRSVTAFASGTHEKDSHSSEEFNQNNRLSCVSMERHR
                     NTILHRPSAAQQRNTILHRPSVVQQRNSVNRSVDTQRTTSKTMTLQQRQRRFSLQQED
                     SIEIKRRSYA"
     gene            <64342..>66654
                     /locus_tag="LMJF_34_0180"
                     /db_xref="GeneID:5654772"
     mRNA            <64342..>66654
                     /locus_tag="LMJF_34_0180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686056.1"
                     /db_xref="GeneID:5654772"
     CDS             64342..66654
                     /locus_tag="LMJF_34_0180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686108.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654772"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3J0"
                     /translation="MHASCLLAQLVSEQMPSSLEALVSLTKEWWGLVEQLVQLPVVAA
                     DLGQLLVETAHAEEAQRDRCSAEFEEKVIAQWEEWVWSSVPRTVPAPAAREAAVSEDA
                     LPVSPPDILSFTEFADLLHSYDRYRLGVRWGASRHSGDWASGGGTAAAAAYYRRRYFL
                     HPWHGMHCPAGAAEQMPYVHVLQWMLARKGSSVEASSTAAELWERHRALEPFQPSSSS
                     FKALDVCCQSGYVSDLLIRAGAGVVVAADADPAALANAESTYHECVHEGGGRSRNAAL
                     YTRRCEGLPRLTATGASCRRRSSSPSAPQRGGAGADAGAGVQSTSASAAERRRRRARE
                     EGRGYSGLTSPSEERSILGAESANADEASAGPFDVLYIHPPSALSIWPVATTERFNLR
                     KTMWWRKLNHSAEAEGLDATLLFPYLPCTAAPALARHNPLATRSGLERALDALRADVT
                     ERSAAASPSGDEAPRSGTLLTDEGYVVLVLPRTYDTDLLLRGEMRGAPSLADWVVSQL
                     DGYYDLILRRRCGARAPPSASNAAQSSKGVDGMLLGVFRDAQRRLEKAESGASAQWAA
                     ELQRISREEMWHDVLVLRKIRTVARRCAARHMADLGQDKPVPAGAVPWEDSFEYNEYY
                     PRGTVPHTSHHWTALVPTYSYLEEDFYKSPSAVRNFLAVGHPVSANSAVTAGYGVPGG
                     ATPRAAAAGEHNPATDGVKEASQLASANFHAVFAQELRTRRRSKLRKLALSPLERQEW
                     YIDEKLVKSSAAKLGLLNELSKWDLKDYDK"
     gene            <67499..>68974
                     /locus_tag="LMJF_34_0190"
                     /db_xref="GeneID:5654773"
     mRNA            <67499..>68974
                     /locus_tag="LMJF_34_0190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686057.1"
                     /db_xref="GeneID:5654773"
     CDS             67499..68974
                     /locus_tag="LMJF_34_0190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686109.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654773"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR015232"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3I9"
                     /translation="MTEEIVAPAVPQFENGEPSFEYDHIFSCFKGKGNGLLFRMVNTK
                     QKKWAFYNDTADTIMQVRARFSPDCKVEKLNRARATRVPIGTEEHPDLFETVVTLEVH
                     PFATEPFIKGDVNGFELEFHTEQIPVNDVKFMNRHRILPRYDKVYKCFKNEGNGLFFR
                     LVDEKDNKWYYYNDTHEFRMTATVSFPSADEVKPLGNTETVPVQDDDSEVAYQITVEP
                     GNAEPFIEGVPASYHQTFNANPIDENCLDPKDVQYINGEPDSSVIDPSQCKVYKCFKE
                     NGNGLLFRLVDEKAGRWAFYNDTHEYLMKPKVRFFGGAAVVPGPDAQVSPDPEEENTV
                     VVTVEIPPCETRLFIEGRPAKYEVSVVADSIHKTAPEESPEFVNGEPDRKVVNYDAVY
                     QCFKDKPEARLFRLVDSNRQQWGFYNDTTDVFFVARFTFDAEGKVRALGDTEKEQNSD
                     NETEYLVSIPPTETVAFVQGDVRGFKSQFTGKRRTSVPTPA"
     gene            <72484..>74037
                     /locus_tag="LMJF_34_0200"
                     /db_xref="GeneID:5654774"
     mRNA            <72484..>74037
                     /locus_tag="LMJF_34_0200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686058.1"
                     /db_xref="GeneID:5654774"
     CDS             72484..74037
                     /locus_tag="LMJF_34_0200"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686110.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654774"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR015232"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3I8"
                     /translation="MTELVPPEAIRFANGEPLCAYHECYRCFDGRDILFRLVNVEKKQ
                     WFFYNDTADTIAHVRAVFYPGSVIRPLQRADMHVIPGPTGVADETCSIEVTLDIQPGF
                     TESFIEGEHKGFHLEFRTETAPTKEVVFEYRRPMVPYDKIYRCFKNGNGLLFRLVDER
                     VRQWFFYNDTRDLMMKVSVTFANSAEVRPLGCTALGAPHADTAPESVVYTLLIAPGCT
                     EPFIEGNPVTYTLEFAAEPVDAPVTPVLEEPVQYLHGSPDVAVIPHQTHVFKCFKEHG
                     NGLLFRVVDDVNTIWAFYNDTPDYVMTANMRYPSTSDIRLAPGVQVIADSEREGGFVA
                     AVEVLPLATVPFLVGSPEQYELAFAATPVAPLTPSPTTSPEPSSPPQLADAADAAATV
                     PPALPVPEEAPVYCNSGPDLTVMPNIDEVYKCFKDYGNGLVFRLVDKVQRRWAFYNDT
                     TDIVALVRVQFSPGAHIQPLGHTVLGCDLESGSVLHELRVNPLETALFVEGDVDIFTT
                     KFVAEEIQT"
     gene            <76568..>77197
                     /locus_tag="LMJF_34_0210"
                     /db_xref="GeneID:5654775"
     mRNA            <76568..>77197
                     /locus_tag="LMJF_34_0210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686059.1"
                     /db_xref="GeneID:5654775"
     CDS             76568..77197
                     /locus_tag="LMJF_34_0210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686111.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654775"
                     /db_xref="InterPro:IPR007052"
                     /db_xref="InterPro:IPR008978"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3I7"
                     /translation="MSSSGPLAPPISWAQRPEYVLITIPLQDTTGVSVEIKDEGRELH
                     FACSSPEHKQYACTIHFYGVISSEESQHVVRPRQIELKLRKKFSKSLEDANDDEVEWP
                     RLTKEKSKYPNITIDWSKWKDENDDECAADDLGNFGLSGGDAMDGQYSEMLSQLMQAQ
                     GQKDAEESADLPPGTIPGFGSARGQEATHGASAETGDDDGDMPPLEEDT"
     gene            <78051..>79058
                     /locus_tag="LMJF_34_0220"
                     /db_xref="GeneID:5654776"
     mRNA            <78051..>79058
                     /locus_tag="LMJF_34_0220"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686060.1"
                     /db_xref="GeneID:5654776"
     CDS             78051..79058
                     /locus_tag="LMJF_34_0220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686112.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654776"
                     /db_xref="GOA:Q4Q3I6"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3I6"
                     /translation="MWCTSTQRLALLASLLWFVSGVQAALSFNLNSVDYPVYADEKMS
                     TKEYAVLPGGGNACLLLSLDNGLGGVVRFAYSSNVSNPHWRSDVLVSTHQPSVSHPSV
                     AVLDKVDAVIQTQRYSAEELERRNRAGEAVQQSRSTAVSIRPAQDGTGPAAKFIDGNY
                     AVCFRLIRSKATAQKPSSMQYEEVKVHLFEVASTRHSTFTYIARLNDAAANPQNGDGA
                     AGGATAEVNREYAKMIRSLFRASSTADLRKLLDEEELVSSEEVKSRLEEIRALQEQLF
                     GLYNNFEYLESRFRRMRATAETTFSRIWVCMLFTLAVMGSTVWFTFHYTKSIIIKKKL
                     I"
     gene            <80025..>82184
                     /locus_tag="LMJF_34_0230"
                     /db_xref="GeneID:5654777"
     mRNA            <80025..>82184
                     /locus_tag="LMJF_34_0230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686061.1"
                     /db_xref="GeneID:5654777"
     CDS             80025..82184
                     /locus_tag="LMJF_34_0230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686113.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654777"
                     /db_xref="GOA:Q4Q3I5"
                     /db_xref="InterPro:IPR029600"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3I5"
                     /translation="MSASPPPPQGGTATSTVAAPPEDASQLSADDLLQHIVELVNKEL
                     ERHYSLVEFDALGRIELLQVVNDIFAKLQPSMKMDMQATPPEEAMPRMLEFLLKILGY
                     RVPVFVQGSFPQSFADGEPLVVYPTMYWILTHMELNEKRVYLARFLQPLDIPDDIRAQ
                     DEDVRTLFMQYQALRGAFIQTHQRVEKLRSACADPVETRRQVGVLEDERDRLQGYVEA
                     ALKKLAAVPEKEMLLAASKSLRMAREESTKLAEREVEQQQAKVSSEARRTEISTRLQN
                     LRRDAADGRVEMMIRRMKDEMDTNRMKLQDQLPHELESVKNENAELQKLVSEPLDMAA
                     LTARDRKLDDELRALHAKIAQRQQPGADGASILRFRDQVQRVMARKQEVLNELSSLQA
                     DNNRAVNDIRERQLRITQLQSATNMLRSDDFRDFSNQVRAKKAATEGMRTRLAELRTE
                     WGTLTFTEATLQEQYNALDAAIGDLESKLGLQGYSRTVEALSKLAHEKDAIEEVKGKT
                     LEELSRVVQEFTLAIREGRTRLAPLINELRAVRQTAAEVDQEWSAKKSQYEYQESLLT
                     EDIQKIDEDVTRLKEETTTSESLYHRVRTQGLLLAAQAKRAEEEQTFRTDRNASLDPQ
                     HKTYGDYLAEVTRTLEARTKEMQGKRRDLEETHDTSVRQVEWFNALRTILQAKLKSIQ
                     AEAPTAGARTRDTTIDDDIQQVMGRAGGTNMLVLNSN"
     gene            <83538..>87551
                     /locus_tag="LMJF_34_0240"
                     /db_xref="GeneID:5654778"
     mRNA            <83538..>87551
                     /locus_tag="LMJF_34_0240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686062.1"
                     /db_xref="GeneID:5654778"
     CDS             83538..87551
                     /locus_tag="LMJF_34_0240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686114.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654778"
                     /db_xref="GOA:Q4Q3I4"
                     /db_xref="InterPro:IPR001315"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3I4"
                     /translation="MDDPFRDDSTMIAGTTTSSTRALSSNLLDQLQREYPAVYEALHA
                     YEKAVRHLKCKYKAKEAELLRCISVGEELLRQMDVLKRRCEALAHERDEAIAASASAA
                     ASPREHAHTAGGAVSSSTSWAEERRSLRRSHETECERYRMEVQKALQDTAAAQTQKRE
                     LELALERTRAQLNEAETKLRTAHNAIADCEVHYAAQQEKEMERHRAALEKQLAEVRQQ
                     ADVDRETVLAEAMIELERLQRALVRTQKELAEQQQASSGAQALQAELTSTAATELASL
                     QKQIRTLAETNHDLRQRLQRREADIQLGCAASSTGARRDDSQRSLTLASDSNRGAVLY
                     GSTLADSLVDARREPRDNAADASGLAAAQERLREENARLRQRLQEVARRAQDDVDNEH
                     AARLLLQQQLQTMEAQSHILRSEVVGRLQRELQQAKDQLEVFQAQGAAAQRAAAELEV
                     QTTALREEKTTLADALRAEKVTTEKLRRELEAAQERQDALGQELKGASAAAQERERVV
                     VQLQREKGQLFNALRAFQAQAADIEVALKTVTAEQSESTAAHEDTVSRLRDRCVLLEH
                     EAEELRTERAALRRRLGDAEEAIDVLKDAQRVSQELMHEAQRCTKTAEDRASFAADQL
                     TLQQQSSAVCLAEAQQNVERMRTQQRDLSRRMEACQQELSRKEEALRKSAEAQEALVA
                     EVQRLREEQASRDESVRERWRQQYAQSNLEREKLIAIKEAHAADLQRQQKELQMSLAE
                     SEDRVAQLHEQRQQLQEALSDSLATAASHKGRIQALEEELARTAAEHRAAQHELQRVT
                     GERERCSSATPGLRPSGECNASAVVRLAQLQGQLTECEAALCAAEQSRQRMQNAVLGC
                     LMPVDASGEVAADVDNMWDTLLDLLREGDQELCSRSTSAAPVQLRQMKAEKENSVPDD
                     KQASDAAFMPIDASRCAAAAVMRAIHDLVRHLHDADRRRWSRVRNKVLAACAIADATS
                     NEVAPVGAAPPATEGPTGASSEKLCADLASALRAWAVALRGTQEHLTDYVAQVAKAAH
                     LVSKEAAQQVQLTQLTVAARTAEEQRDAMQAALEEMTAKYSEAAKRADARESRVETLR
                     HDVAVRDTRVREMEHRLDVLQAEVQAERTEWVSKWQEAQRHREAEKKEAEAERAHLRA
                     QVAAAEEVGHQSTQRAAQESADALQQLRTQLQTLRETSSETEAQLRQQITQLSCEKAD
                     AARALGRLKSIVAQLEERLSSTDATLRSREAQLETAMASMQELKRVQLQRCADGAAAE
                     AFEQRTLTEQVASLQAQLLSLQRDHDMQETLHATEKAEMAALRKVNASLEARLAEVEG
                     DRAPLREQLHSLLSFTE"
     gene            <88620..>89771
                     /locus_tag="LMJF_34_0250"
                     /db_xref="GeneID:5654779"
     mRNA            <88620..>89771
                     /locus_tag="LMJF_34_0250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686063.1"
                     /db_xref="GeneID:5654779"
     CDS             88620..89771
                     /locus_tag="LMJF_34_0250"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686115.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654779"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3I3"
                     /translation="MPSEYHSSLADVSPRLSSRQRCSVRAGLSSTPRHAQGRRHLDPH
                     HFTNLTDDAKRAEGRLGRAHVASSEQQKRADAYYATKQATVAQPPGAECNLYLKSYYY
                     TPLSKQETPSPPPRPTTGFRADAQSTSFQLAEARLRKIKREHPQYEEEVTRALQQQHG
                     DYSIVSTEQKISRRIAVEEYADGTNARMAQIEASTKYRGTPDLGSPAPAIKRSVPYAL
                     SEECPPRADTQLSCTSHVRLYPGCGRSSFPPETPVKPRARHLYDGPVPYDTTAASGEA
                     YPSPPAVGERCNIYAKPTLVHVDERRHRDCVEDADSLAMKRARARSGARASQERPDFI
                     FGPGPAPQPRPPSLRHHTEARWKAQERNAENRRTGRALYPQSHRSTSLW"
     gene            <91225..>91587
                     /locus_tag="LMJF_34_0260"
                     /db_xref="GeneID:5654780"
     mRNA            <91225..>91587
                     /locus_tag="LMJF_34_0260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686064.1"
                     /db_xref="GeneID:5654780"
     CDS             91225..91587
                     /locus_tag="LMJF_34_0260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686116.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654780"
                     /db_xref="InterPro:IPR003117"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3I2"
                     /translation="MPHTRWLLRSAQPISEHTRIESSSCFNVPNMADTTTTTLMAEPT
                     LEEAAAAVFSEEERAALKTNLRSEQIAQAKYLRDHPEIHEAVQEALARVLQTQPEDPV
                     AFLTQYFMSEEFLHQRTQ"
     gene            <92431..>94809
                     /locus_tag="LMJF_34_0270"
                     /db_xref="GeneID:5654781"
     mRNA            <92431..>94809
                     /locus_tag="LMJF_34_0270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686065.1"
                     /db_xref="GeneID:5654781"
     CDS             92431..94809
                     /locus_tag="LMJF_34_0270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686117.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654781"
                     /db_xref="GOA:Q4Q3I1"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3I1"
                     /translation="MRRTRLPRMYLPRAPKKDPNAHPLQVQNSQHFLRTAGIGAILTV
                     VLSVFLALRQVQQRSRLSEKELLRKRNGQRVVIIGGGAGGSALATLLANSAPDLKITV
                     IEKDKQQVFLGHVPLAHVGHRSYDIATSTGVDIVRSPAAWNVTRDANLVAAEVLRVDP
                     DAKKVFVRTTKAMLAAATVPSADNASERHPRWGIDLLRRCWPSLRLQVSTVSVNDNGS
                     TNLSDGTTVFSYDALVVAAGAHRSLGSLAGQVQPGQLDTHRIAVNPGTTRDNLVNLFS
                     GNVLHVKVPPASFVLQMEAARALTTTPHAASGSGVPSLDLGAAISPAVRTPPPKAAPS
                     TRPSSAETRTFSMPTSPASFFDTLRAAVASPEAVAAPLIPDEVAERLRPVSGVATTVS
                     PLDTLAQWCMHYSSRQHDSTFVSSVNTIWKYLHYYNKLGLCHYMVATADPQPIGSAPR
                     AVNEVIEKFWRERQLACQQHSGGVAERFHLLFHSYLATVDTAANVATLYDYRNNAEVR
                     VPYNLLVLDLPLCAPSFVRQSGLHRTRYVDECVMPALRRGIDEVAAQQLRRHPLLRKT
                     KKELEAFFADEASFMDVDHETLQHRCYAEIFALGDVAGVPSLKSYGAVSAQVPVVAHN
                     VQQVLASQRAQAQQDRYLAELPRSDPSAVAPAPVLPKANAKYTGYSSFHVVMTTWRAM
                     WPEMCYDKPQTELRGCSQSSSPADMAEAATKRGLDVVAPLTHCDHHLWNNLAWRDLRG
                     FLNGLFHELALYEVMYFFIFSRGLWHSPSWFYVPTYSPVDGTPRVPTWKDLL"
     gene            <97300..>101967
                     /locus_tag="LMJF_34_0280"
                     /db_xref="GeneID:5654782"
     mRNA            <97300..>101967
                     /locus_tag="LMJF_34_0280"
                     /product="putative calpain-like cysteine peptidase"
                     /transcript_id="XM_001686066.1"
                     /db_xref="GeneID:5654782"
     CDS             97300..101967
                     /locus_tag="LMJF_34_0280"
                     /codon_start=1
                     /product="putative calpain-like cysteine peptidase"
                     /protein_id="XP_001686118.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654782"
                     /db_xref="GOA:Q4Q3I0"
                     /db_xref="InterPro:IPR001300"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3I0"
                     /translation="MKDSKNARHAPEHTNSGDAPIMATEGGAHARIDSTGGLRALSSA
                     MSGGDSEHKPELNVLGATGGDVHRSRSGRREDDVVTKPPASRKKGLLPPVRQCPGDAC
                     DDDSGGADETAKRTAGNAGTSTRPKGSVQEYVRKKLQRQSEQGIRPCSRVRRPLCSIL
                     VKSDASEPKRGEDANDSQRCDAEPRCGLDWDRSTNNRTFWKRTMSKQETDADLRCYTA
                     HEYILAFYYHESKECDDSLELATPDSSQRRQRERVARVVAEATPREEAERSKLKSKGS
                     ISPSTRRAKMTCATVEELYEQLMVCYRKAGVEKGYLDTLFMREVLSGRRQPRVHEMER
                     DDDLGENLSAPSDDEVAEASREVVPVGKPKRSKPAAISKRSTEPPSLYEIMLEQMRAK
                     TTPAFLHHNAIPLSTMRFLQKRGTIKLGDYSYVLHLWDDEEKGYLVTGVFDRKPGFPK
                     QFKDSCTYAIYSLEMGRDWGMRFGELVLMRQHLAPGARKHFPEEGKLIRGHTVIRAAS
                     VLDIFDGRVCGIPSNLRELDYRRTGIHASVQALAHYNHLFPRWSPLRSIVHPQDIFGC
                     PVVNPTGGIYCLSMIVNGATRMVKVDDRVPVEPESGLFRCLTSATFELYPALLEKGLL
                     KANGCGINLALMESAAVLFQLCGWIPEVIRFHSAGGVEEPTVDGLMRPSEMWSVLMEG
                     YNFGRLMMTLTAHWCAGRPPLTASERVMQSTQWFVTPVVYPVIDMITQRLSTTGEPTI
                     RAIMLRDTTKDPSTRKFEPPFKTSLTAEQLLDLGYMNAHREAGVFCVTWEEALSHFDH
                     CSINWSPFTYWDLPGESEPPQDCTRLCCHGIYDMRNAGQHMVRQPQFHICSHLVDRCT
                     HLFLVFCPHTGDQSPLPHDNNMLDKKTVDELSGGGAVVRLRVYEVTTLPSLTQCKMRD
                     SRGRRVTCCFGDCQGRRIVSETEGPRGLQSLAVAQGNRNEFITLGFDCLPGTREYVVV
                     MDVHDRHRPPRGKGTFPYTLTLFTCLDPLLERNPNKFPMSAIHAHHATLEQAKQAAIG
                     GGFSHLDVASADLNVNDLIEEEAQRKPPMQTITIHAIPEHPNIHSRTVQGLWCVRDSG
                     TRTVLLPHDATCEVLHTGTQYYFHLDKPSYFALRICPSTRVGAALSRVKMKVLLVRWT
                     GRDDMCTTEKDPPVERETKTGGGAAGKGDKAYVPRSVQGIVMKGSDIVLSSGVWSVDG
                     AVIDSVSPHTVLLDRNGVLVQNPRRLRQHYHTSFNVALSDRDNKDKTNMSFFLMSHPD
                     PSDQMRAVILQAFADGFLISPHACNIGIKGKLIPHDTEVRAVLTSSNFSYELHGDEGH
                     SVPFTQESAQRSLAAPVPQLDLFIDVDLQNTAPAKSTSFPPGSSASYAVDRLRAVVRS
                     ALTSSPAQRLRLLRTLFSTMTFVRRTVKHENHRAFLMGLGGSIEAWVRWHQTLESPGV
                     QAPVLSLPPLPEGDYIVIPCFKPASDDKATEPGKKRGAVTGNQGALAFEITLSVPGRV
                     VELNATRNPADGQGGTHAVQTQMHCEQNIASAERLCPGVHSRHYGFTSSLSRWISGSK
                     KGV"
     gene            <104272..>106314
                     /locus_tag="LMJF_34_0290"
                     /db_xref="GeneID:5654783"
     mRNA            <104272..>106314
                     /locus_tag="LMJF_34_0290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686067.1"
                     /db_xref="GeneID:5654783"
     CDS             104272..106314
                     /locus_tag="LMJF_34_0290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686119.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654783"
                     /db_xref="InterPro:IPR004353"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3H9"
                     /translation="MSTSRPAAVLHAASDDEKEDDPMAVLWQHERHVLVLTRAGKPIF
                     SQHGHEEQLSPLCALLQVLLCIHEDKGGGDEQSRGPSQPAPRSDGTASSAAVKDELHQ
                     VVYYRSKSASGQACHQGDVNAQVQALTLFFYVQGDLIYLMSVRSVAPSLPAGAVEMSN
                     AEGECEPPPLASYCLAQLRHVHHCILLVLPTVNTLLTRSPGLDVMAMYTSADRAALRE
                     LIESYQTELTYAVGAVATLALSVEKRRVVERALLCCYRSCADAAVGPPAHQLFSFLYF
                     KNYLVAAVGPPETYAADPKVSVSAPLALGPDTALCGCLHVDDALLLYRYARSLVSRQL
                     GEAWVPVCLPRFNSTGYLWCYAVNFTRYARELRKQQGKTEWPKVWEEHTELDIMLLHV
                     SASQDDFAALSRSTRRFAQILCAPAVEDNFYYRLEEELYYRTPAPLTELLPSSHTSVS
                     TCSSRDLSGYTDGVPLWYGVVIQGSDAAFLNAAQGEEAKATTRAAAAATRPLDCPSAS
                     IRLLFESQPSLLLNIATVENAREFRQLVARYQAQLRAAPASSSAPCMSFVRHSSGLAF
                     AAVQPTPATLATLAEQFFSPKNPFHVPTDGIDAGGGAEEFLQDGRCSAAAASHHGASY
                     TAWVEGVRALGVTELTVVFAAATPEAMAWYWVAHILLMALQRRSRFVVRQLIGDRR"
     gene            <107602..>109875
                     /locus_tag="LMJF_34_0300"
                     /db_xref="GeneID:5654784"
     mRNA            <107602..>109875
                     /locus_tag="LMJF_34_0300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686068.1"
                     /db_xref="GeneID:5654784"
     CDS             107602..109875
                     /locus_tag="LMJF_34_0300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686120.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654784"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3H8"
                     /translation="MLSKKKAAKRSAISATVRREHQAHEKLSQQNAQLHTPHKKTAEA
                     SASSRGADNFVNPKKSRTVLSSADAAEAVGSGNGSRAAMIRSLGDHINTRLQEVAFED
                     DLDGDVFHERRAQLMEEARLAAGVKQRDMSTSVRHYLGHQAEMHDLHSVRIAHNCNSV
                     TCVAALGTDRIVYGDKSGKVYLVDISLATSGAGMSVSDKAELQRRRKVLLEPVLPSGI
                     VSIAVSDTTANRPTARDVFEKTTVDMSCPSYVAAGAMDGSISVWETLTKAHKGLLFMH
                     RKPITGLQFRMDTATLYSSCEDGTLRVWAVPQMIAVDKLFGHEGPAHFLDCLRKETAV
                     TVGEDGTMRFWKMDAATQQAYNYAPARLPEKSFTSDAAASPPPPPAVVMDTVAMLNES
                     IIVAGARDGAVVVFDVNRRKPLVVVPAAHGYGFIGDGTGLEKAAAQLAEEDNGDRVAR
                     EHATASSSGTVEAQRRNPNPIIAVAAVPYADVVATGSYDGVVRVWHVVGVGAGATAPG
                     KRTDDGQNGDAAPPSGKWTEPQLVLVTELPVRAIVNSLRFCGNGDVLLIAVAKEPRRG
                     RWVVQSSARNGVLLVPLTESGRKKLQGVRGEVEHIPAQLFGIDDAAAEEDAAGEEAHV
                     NEADASEADLDSSGELDASDGADGAGREDAEDVADMFDVGPDGMMRFREGVSLAGGAA
                     ITSKKRKKGKSGMPKVLRQSKELSDVTVARDSGSAKMKKALSAKKVKRVEAKSKKLHA
                     SNTVVATSKKAMKRAKA"
     gene            <111182..>113287
                     /locus_tag="LMJF_34_0310"
                     /db_xref="GeneID:5654785"
     mRNA            <111182..>113287
                     /locus_tag="LMJF_34_0310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686069.1"
                     /db_xref="GeneID:5654785"
     CDS             111182..113287
                     /locus_tag="LMJF_34_0310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686121.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654785"
                     /db_xref="GOA:Q4Q3H7"
                     /db_xref="InterPro:IPR001406"
                     /db_xref="InterPro:IPR020094"
                     /db_xref="InterPro:IPR020095"
                     /db_xref="InterPro:IPR020097"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3H7"
                     /translation="MPNPSTDAVTLATAEEAKVAGQPTWKAPPLEPIIPGCTPYKYYR
                     VPDGLKRVRRKQKVGIIFGYVGECYCGLQWNHLPEYPTVEEALMKALFETDMISEVNF
                     SNVKVQQLLNFERASRTDKGVHALRNVVSVAVMLPYDPSYTKKRVAVLQEHAEGAAAG
                     EVYNADGDVEDDANSAQTAVFSCEEAKRLLNEALPRDIHVYAVVPVTRSFNAYLNCGG
                     RRYEYYLPTFALMTAAEYSKTYFPTFLAPSQPTLKEVGFVPGKHGKRDPPRAATVTDE
                     EEEARRRKPKSSARKSKGHFPKRKNAKVAARAVAAAATGAAPPDSTPPLEGKGDVSAA
                     ETTAPLHSEPLVLSSETPARPTNTVALNDGEEGKDKSDAESQDSDAEVQAALERASAA
                     RPCEDNYATHFHDGLFESMILFRSIPADAMRHVTNYRLPAEQLQHVRHLFHEYEGTHC
                     YHNFTPGGRSYDASCYRFIRSVVVSDPFVVSPEEELLQHSIDSWSLNHFYSPDERVAA
                     TYEEWMTEGEAAELQGAAVSVSEHGKLQIPKSADAALRERMRQHIRDVYAGGIEVVRI
                     ELDGQSFMLNQIRKMIGAVVCIAAAGLPGSYIRDVLLRKGVRRGIPMAPANGLFLSYL
                     DFSGYNRRLERIQNDGNNGAGKDTLDVEAGVDADEVEAQRRRIIAVVLRNEMAEDIMG
                     KWMRSLRHVLRLAWKHALD"
     gene            <115110..>116186
                     /locus_tag="LMJF_34_0320"
                     /db_xref="GeneID:5654786"
     mRNA            <115110..>116186
                     /locus_tag="LMJF_34_0320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686070.1"
                     /db_xref="GeneID:5654786"
     CDS             115110..116186
                     /locus_tag="LMJF_34_0320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686122.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654786"
                     /db_xref="InterPro:IPR023393"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3H6"
                     /translation="MFKFVSSIGDAAYKAASKTGLAAGSEQPPYPCALPLQVIEDCED
                     TETTERVLNDTYAAVRDLLSDDLPLLHSTISDVQAHKPFKLVDFTDREGDIRLFTRPH
                     VGSYNFARVTLTLDNVSPAKVLTFMHAQSLEARNRYSSNLCQYDVIARNPELPAQYIG
                     NDNDHLEELCRMGIRDWHVEYNRYSAPPPVTARDFVYLVEKRYAPEQRCYYIYGTSVD
                     YRDTAGIAIEKDNCVRGAVVFGWRFQHVGRKTYCTYVSCMSPNGWAPTFIVGWMKTAI
                     AKELQNARRVLYQDVPSCHAAGASSEYAKGALAAYDAPITSCRQNKPTRDHSSSKSSA
                     QKLGNAMEHEERRLLEDEKPIVFE"
     gene            <119475..>121280
                     /gene="DHS34"
                     /locus_tag="LMJF_34_0330"
                     /db_xref="GeneID:5654787"
     mRNA            <119475..>121280
                     /gene="DHS34"
                     /locus_tag="LMJF_34_0330"
                     /product="deoxyhypusine synthase"
                     /transcript_id="XM_001686071.1"
                     /db_xref="GeneID:5654787"
     CDS             119475..121280
                     /gene="DHS34"
                     /locus_tag="LMJF_34_0330"
                     /EC_number="2.5.1.46"
                     /codon_start=1
                     /product="deoxyhypusine synthase"
                     /protein_id="XP_001686123.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654787"
                     /db_xref="GOA:Q4Q3H5"
                     /db_xref="InterPro:IPR002773"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3H5"
                     /translation="MANIAESAVLVSSASSAQAVAKLTQVQGPTSGFDKAQHIIGSYS
                     TMGFQATNYGLARSIAQRMIRKQPPSKVYQIKDGKYVLVPPDVGEDGRTLQQEHVYPN
                     LFMGVSANLMGTGCREAVRFLVQEGVAHRSPEASAAASADGTDDQLMFARLKREYVET
                     YGGPPHPDEEVPRAHSFLCAIVVSGGGVEHDLRRACTAYTLHYYASEAQGHVSSTISS
                     EATAPLEGLQQRAETPLGTGAAAGAAKPARFGNVEYPPQGSPGSALFDRLMRTFAQRL
                     CARQARLRAAAMAKPIPDKYDDVCSWSVTPSEVWALCGLWLVDMLAEALRAVQSCPSH
                     LTSGSGVGTAESVTANGKGQEADRDAHIATSALYRAEALARARTTVVYWAAVQQVSLF
                     SPSFVDGDITSYLLPTPVPAARPAHRKGGSVADESAANSKELKRRRKASSSSPTAATA
                     VEDEPPVVERLQIDLVRDVYSINKLAMLSKKTGMLICGGGVVKHHVCNANLMRNGADF
                     TIILNNGQEFDGSDAGAKPEEALSWGKVRMEGAFVKVYGEVSTYLPLLVADVFVPAVR
                     QRRATDDAQPRRRQSSRGARLPQDVSGHSHLCRGE"
     gene            <122471..>124876
                     /locus_tag="LMJF_34_0340"
                     /db_xref="GeneID:5654788"
     mRNA            <122471..>124876
                     /locus_tag="LMJF_34_0340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686072.1"
                     /db_xref="GeneID:5654788"
     CDS             122471..124876
                     /locus_tag="LMJF_34_0340"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686124.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654788"
                     /db_xref="GOA:Q4Q3H4"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3H4"
                     /translation="MDVPFSPGSGNSLMSLLLAAVVPFLCLRAFTFLFHAWPNFFYRW
                     LTSYFDRQVAMVMARVNPNRVIQDDVMIRSIMGYVSYCYARGVQRGADACDAVATADY
                     EYSFLFDKSDMFEEDWVPYSPRFRSLFGRVIASCMQLSVVPSHGHSIQVEPGLFVRFL
                     PNRYARGGGRDEDGRWSEESQQSSECPNRGKRPGAAAGELNQVDKLNMYMFYSMRRYA
                     QNMDDHPEPCVDGRADALISEERPFDPGAQSNADQGRGGGGGSSNSSTQSESTFFEDP
                     KQPPEEHIVVLEYRRPLPHEHSQALCNSSDTHGGASKYDASQSAEDMIEGFLGRVHRW
                     YLGHVAQRKRAAPLVIYPSLLMAQLKKMGTVAPKMHYIDPHAEFSGKYYVLESAALGS
                     EESMGAAAASSASFSVKAGTKAGDSTIVTAARKLATTPTGGHVGLRGAELSSESRGKT
                     FNSLFFPGKTRVLSMIDDFVEERGRFGVPGVVPRLTFFLYGAPGTGKTSFVKALARHL
                     RRNLVVVSMSEIITVNELQRVLQPFDMELREGGESRSRDAGSLSVCPHQSVYVFEDFD
                     AIGDAWEALIKMQARQRKLAEERQLGKSTKSSGGKVRGSDDGDGGKSQAASPSSSAGS
                     RSGESFDSHEDDGSDSDDGDSECRDTFLLRDSLPEELTRDHLTVERFIDLFNGLNLPD
                     SFIAVFTTNHPERINPLIASSSVMDVTLNMGMLDEECATQMVEHYYAAELDDQTVDGG
                     GRRHLSISQLEALRAALRVFNVGSTGLSGALLEKMCVECDTVAALTARLRSVDSSDSV
                     DVF"
     gene            <126289..>127425
                     /locus_tag="LMJF_34_0350"
                     /db_xref="GeneID:5654789"
     mRNA            <126289..>127425
                     /locus_tag="LMJF_34_0350"
                     /product="putative eukaryotic translation initiation
                     factor 5"
                     /transcript_id="XM_001686073.1"
                     /db_xref="GeneID:5654789"
     CDS             126289..127425
                     /locus_tag="LMJF_34_0350"
                     /codon_start=1
                     /product="putative eukaryotic translation initiation
                     factor 5"
                     /protein_id="XP_001686125.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654789"
                     /db_xref="GOA:Q4Q3H3"
                     /db_xref="InterPro:IPR002735"
                     /db_xref="InterPro:IPR003307"
                     /db_xref="InterPro:IPR016189"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3H3"
                     /translation="MAAQMVPIDPDKKDDVYYRYKMPAVQTKVEGSGNGIKTVLPNIH
                     DICLVINRPEEVLMKYFQFELGAQRTVSTKDDKFLLMGAHPTERMQDKLYDFIRKFVL
                     CKYCRNPETAIHLDAGKKGSASISMVCGACGKRSSFDEHRTKTFMAQYYEKHPVEAKA
                     AKGAAEARKKDDAPAADEVAAPTKPEKESGKSVGKSDLTDDREDPKVVFARVLKESWG
                     KNDELVGRTVRLLSQYNLPEHYGPPMALSAMLLEHRDDLLSTMKTHARLLKRLCTVPE
                     LFSRSEGYDEKELTEFYKREKKIQKTFLRECAKEFATNFTPDKFAVLIFMLFVEGVLR
                     DRSIADWAKDTKPFSDADPKVQEEMRQKVAPVVSWLGMDANADP"
     gene            <128634..>133382
                     /locus_tag="LMJF_34_0360"
                     /db_xref="GeneID:5654790"
     mRNA            <128634..>133382
                     /locus_tag="LMJF_34_0360"
                     /product="putative DNA-directed RNA polymerase III largest
                     subunit"
                     /transcript_id="XM_001686074.1"
                     /db_xref="GeneID:5654790"
     CDS             128634..133382
                     /locus_tag="LMJF_34_0360"
                     /EC_number="2.7.7.6"
                     /codon_start=1
                     /product="putative DNA-directed RNA polymerase III largest
                     subunit"
                     /protein_id="XP_001686126.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654790"
                     /db_xref="GOA:Q4Q3H2"
                     /db_xref="InterPro:IPR000722"
                     /db_xref="InterPro:IPR001497"
                     /db_xref="InterPro:IPR006592"
                     /db_xref="InterPro:IPR007066"
                     /db_xref="InterPro:IPR007080"
                     /db_xref="InterPro:IPR007081"
                     /db_xref="InterPro:IPR007083"
                     /db_xref="InterPro:IPR015700"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3H2"
                     /translation="MSQTATTAAQFVQPLLDKPVEVTSIKYSLLSEDTIHRLSVLPCH
                     RVIGTEKNFGVNDGRLGPSDRLSVCNTCGQRSIECTGHAGHIDLEVPVFHLGYFSAVI
                     RVCRTICKRCSNVLLTREEMEYYLHRLRSTTHEPQQRAAIIKGIQEDAYKTRVCLMCG
                     GLNGTVRRVRPMRIVHEKYLVDLRRGEQANEDPTAFFQEELRSAVMHNSEVGAHKEFV
                     HEFLHPQRVKKLFEAIPQEQVPLLGLQPGTSPCSLLISTLLVPPVCVRPRGMSTTSHI
                     REDDLTTQYNEILICSDMMSDGTNDAARSVETWELLQTRVARLLDAALPGFPSHLRTV
                     ECKSYAQRMKGKQGRFRGNLSGKRVDFSGRSVISPDPNLRIDELAVPLRVARVLTYPQ
                     RVFAGNIQLMRRLVRNGPHVHPGALTVYLSKECSRKSLRNARDREAIAARLSIGDVVE
                     RHVMNGDYILFNRQPSLHRISLMAHRARVLPFRTFRFNECCCAPYNADFDGDEMNIHV
                     VQTEEARAEAKELMLTSHNIITAKNGEPIIACTQDFLTAAYLVTSRDALFDRASFTQM
                     VSHWLGNETQYALPIPAILKPAELWTGKQLFELILRPTPETQLLLNLEAKARFYSGAG
                     RHDDPAEGYVAFLDSVFLSGRLDKKLLGGGAKDGLFARLYALGGGEQTATCMSRIAQF
                     TARYLQNYGFSLGLGDVSPTPSLNEKKAAVLAVSFDKCDRLISLAKTGRLIPKPGMSV
                     KQSLEAMLNAELSQVRDACGSAAVQALDAKSNAPLIMVNSGSKGSALNTAQMMACVGQ
                     QTVSGKRIMNAFQDRALPHFPRFAEDPASRGFVASSFYSGLSPTEFFFHGMAGREGIV
                     DTAVKTAETGYIYRRLSKAMENLSVGYDASVRSVQGNIVQLRYGEDGMDPWLMEGAHG
                     TPLNLDQEWLSNRAAYARFRKHIDSVISEGWGSGGLAASADPLLQTYRRLYDEWHAVS
                     MLPGELDTFVHHLLHADEATLASCARLMEVEAAIRGATPSSAAASQQLLQQLAQQHGS
                     DRLRSDIQAFFRKKRDELVQLRQKLKLPLDAHAPAAASAKAVRGGEKRKPGPHGDVPP
                     SVTADASTSAAAVQAFAESLQAELLPLTKGMLLHFLEASARKVHRKLCEPGTPCGAIA
                     AQSVGEPSTQMTLRTFHFAGVASMSITQGVPRLVEIINANKSIATPVITAPIVLEDEF
                     TSIDLASASRTQYQAARAVKGLMERVLLKEITREMVEVVTPRAYYIHIFLNMELIERL
                     LLPIDAAVVCQRLYAAAARPMSPLRHLSEACADVVSRDSLVIKSYEKDPARVHFNVQH
                     LLTLLPDLVVGGVPGVNRVMIADRSEKLLAEGAELLSVMSLPYVDGVRTTCNHVAVIE
                     RALGIEAARETIVKEITSILQAYSLNIDIRHIYLLADVMTSRGVVLGITRYGIQKMNN
                     NVLTMASFERTTEHLYNAAMTEREDVNLSVSESIIIGKPIPLGTSSFNILLNKGSVAP
                     PGSNTGRMPSPQRSAHAAAAALKSSGKAAAVGKHSKKVEPTPKEVFLRSSFMAYAAAH
                     GAATHRGLRGCFSSRSLSAEGVFRLDLFAS"
     gene            <134122..>137541
                     /locus_tag="LMJF_34_0370"
                     /db_xref="GeneID:5654791"
     mRNA            <134122..>137541
                     /locus_tag="LMJF_34_0370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686075.1"
                     /db_xref="GeneID:5654791"
     CDS             134122..137541
                     /locus_tag="LMJF_34_0370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686127.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654791"
                     /db_xref="GOA:Q4Q3H1"
                     /db_xref="InterPro:IPR010490"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3H1"
                     /translation="MPLSVPSSWGGSFPSPQEAANVRPSLAAPEKQPAAAGVTDGVAP
                     AAAARTSHAPPSLPTPSALAQPQPPSAAARPTDAEPPSSAAPASAFSTSAKSNATQRK
                     VARLLDITTSSEIKDLASYVDNILPGYFYSLGDSAKDESSSADVAAASGHRSTPAPSS
                     AASSHSNNNKTITSTALRSALDHRTIDVHKSFLQEFKAVYQSYQRVAAQVNELQSKCS
                     SLEDTLNTTAGCPSREVEDFFYQIQAYQAELQLVQSHDKEVDEFRKQHHFGAAEQKVL
                     EEGAVDMNFLNALERARQVHQRSSELMQSQEYHQGALAVMESTYGAITRATEKIARHL
                     LSTAGSGEGRRAGVVASAAAGSARSIAADVPEVTGFQLRCVRLLYEESPSLHDKFLDE
                     VARLRRASVLRRYFHLLTTGSANTSTGLYQSGVQPSAHDGGVGRRHDSSEAGMGARPL
                     EVELNNPTYFFSSLCAWLHQTIAEEQDFIHNFFGSDEPEVGRRGRRSHAATAAPSPSC
                     LQSGSDAARTAHDKTRQQALLDGVFGGVCKHIRAALDSVLERLERTAAVLGAATGGLE
                     GEGRAGGCGSIAIAGSADALAPRKGPRGLTGGLTRLFMAATGRSPIAAFRGAGQDESN
                     ALLQRYAGVTTRAQQEAVASSMLRPLLQGIQTCVTLVQLFEYYTATTFAPLLGEASAL
                     TQLIHKAAPEKTRELFQRLLHVLAVHLLDSTAGIIGRTATLRRLASSHALKQAADGDD
                     AQGVSPLATEHRAVTKTGPSTFVLDFLVAFTYGIDANGLGGAPNGSESALLNDTESGV
                     HMSFPSHSAAATTTRFRQANDGQLLHHSAHDLRRVLSQLILPPSPEVAAYCAVVHSVL
                     QDTARQVELLGAIAEQQRAAVAQGHRSSGPTAASDPGAAALATHTEVTFFVQEMLQSL
                     LKAARSVETDGPLRTNLDDPCRAIVEYNVLYKLRDVLEQHAAVLSVLFKGSDAQGPEA
                     EQTLDSIRMECAATMTTLRRRLVSAWTTAVKLFYFPVSAEAVVAAMSSAAAAEANEKQ
                     LITVKKDVRRVLKQFVNVYNTIASLGHLPEPVPLLSALAGSDDVCEEVRRKVTLSIVE
                     DVYTAEFKMLSAVPPTEELVAVQTEMAPQNLLKLVDFSSPAPAATLQPLSS"
     gene            <138715..>140433
                     /locus_tag="LMJF_34_0380"
                     /db_xref="GeneID:5654792"
     mRNA            <138715..>140433
                     /locus_tag="LMJF_34_0380"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686076.1"
                     /db_xref="GeneID:5654792"
     CDS             138715..140433
                     /locus_tag="LMJF_34_0380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686128.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654792"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3H0"
                     /translation="MCRSPSRPVRLAPLSLMMLILLACASVLPRAIAQSVVDPDAGAD
                     ANGRNNPASASAVAGEHVTVFMCADSGDFSGAHELGSLMRAMEETQVLSLKYCQTAHL
                     GYIRRADGHAVRSLVVTTGINYISSTLCTRSVLKLRRQRGYAYDAMVFIGTSSFSPMV
                     GGWDPTNTSSYAASKASEQEAMMKGEAATAGVNAAPPALLFKTLQQVREEQAEEARLR
                     QAAVDGGQLFALSTASQLNFENARTGEQVDWDGCSPRVPTAITPLSLGSVCVTSTAYL
                     METGSCTERVRHSQCSRPHCTSFRSELGSVTKVFFASDALARKIEAASHHKAWPEMPE
                     IVKKGQMRFWAANEAVEPVGEGAERHRAAPSGPSFVTCAEATGNTINTGAERDYLCRE
                     HTTQALDMAQHRLAERQDGKEAPQEPPLTTQNVTCVRAMESMGFLHSVAEDSTARDIP
                     VAVVRGASDYNMYPMKKVYVPPAVWRSALAAGQLKVSPRVVAALKAEEAAAADGEDAL
                     RKSAIAAYTWHQDAHFMSEAEHQAFVNASFHYAVETATFVLSNYFFGGRSFASASGAR
                     HARSTE"
     gene            <140959..>142665
                     /locus_tag="LMJF_34_0390"
                     /db_xref="GeneID:5654793"
     mRNA            <140959..>142665
                     /locus_tag="LMJF_34_0390"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686077.1"
                     /db_xref="GeneID:5654793"
     CDS             140959..142665
                     /locus_tag="LMJF_34_0390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686129.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654793"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3G9"
                     /translation="MPAQSLLKAVGALLVAYLLFVYTNRDGIEPPRRAKGYYYVTNET
                     QQLLDEARKEAARVMAAQRTGGQAAAGALLRYGVALKDGDEGLASTIEYVHQYQHLAA
                     ASQLQGDAHAAPAQPEATEHPPVRVHVFLAADNGTYSGMHELFYITAAMRYSTRLHIE
                     GCRSALFGFLEKPVRDPLTHGVRDQQRTANESVAREVHMVPVLAVTTGIYVTRSATCT
                     AAVMELPMFSIQSVTLIGTAGVSPVVGGGGWNPHVPPAELAGESVEATEAVANPACQR
                     HWAPESEKVAIGSVCVTYASLVQECGFCVEDNDLPSLCSRPRCRMQNATAFFGPCAFR
                     HPVSSFAEQMKSAMRGKPFPSPSATVREAMQVFWEANEAATDYVAVAEDTKTHQGKHA
                     HASPPRSDSPTTASEVVLSYNRLAPTTPILLNCAEVTTSQILAGPRSDVLCRQYTEEV
                     FQGLYAAKDLSCVQAMEGMGVLHVLTSEYPTMPVAIVRGSSNYDMFPLSRHVYRLNST
                     DTRRRREEGDWYVAWDQKEHYVSEDEFHRYTKASYRYSIETASAVVLNYFLSAETVLP
                     GM"
     gene            <143317..>143796
                     /locus_tag="LMJF_34_0400"
                     /db_xref="GeneID:5654794"
     mRNA            <143317..>143796
                     /locus_tag="LMJF_34_0400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686078.1"
                     /db_xref="GeneID:5654794"
     CDS             143317..143796
                     /locus_tag="LMJF_34_0400"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686130.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654794"
                     /db_xref="GOA:Q4Q3G8"
                     /db_xref="InterPro:IPR000529"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3G8"
                     /translation="MVFYSLVLVMKPRPRKYTSQALREIAVNIYNHGGLIRKLSNEGI
                     LRPYSRFRDADNTAITYARYVTLQLDMGEEQMNKVEKIIREHADVNITLRLNNLERPT
                     GVKHNQQSAAAYFPLDTFTRLEEEINWPPQVSGDVYEQLDMNWKEFSRTRWSNYLRN"
     gene            <144451..>145713
                     /locus_tag="LMJF_34_0410"
                     /db_xref="GeneID:5654795"
     mRNA            <144451..>145713
                     /locus_tag="LMJF_34_0410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686079.1"
                     /db_xref="GeneID:5654795"
     CDS             144451..145713
                     /locus_tag="LMJF_34_0410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686131.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654795"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3G7"
                     /translation="MSARPSDELARLHEELEQEEKDLAELEDNVEAHAAQLGYLHTEY
                     TLNKTRVCQHYEPRLEPLRVITYAAAQKESLIAFQIEWLERKIVEQERRSQGGQFIET
                     RDMKPAAVEYQKKAHQSLLHCYEHISNCPDEALHIISQYVCPPEEAIATMELVMKVRG
                     EPPEACTWEASQVLFSHTYFHEFFATRSEALLKTCDLLSDALMTEVERFCADPHHSVS
                     ALYRISIPIGCMGEWLHSVRNYYRVKLVTAPVLLSQSADTARMAKQAQAWLAVVTLGE
                     VSNETPPQQQTTAAKHAVTGDAELGALVAAYEASKENLQLSTEPVSVTAATVQKLLHR
                     LHKLRESVRAAEEERIAIEGELQEKLAEVRGNYDETMVPLEDQLEEMTECFVQRATRK
                     VDVAAAPPSPVTTAANIADNAAAVAAAG"
     gene            <147740..>148993
                     /locus_tag="LMJF_34_0420"
                     /db_xref="GeneID:5654796"
     mRNA            <147740..>148993
                     /locus_tag="LMJF_34_0420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686080.1"
                     /db_xref="GeneID:5654796"
     CDS             147740..148993
                     /locus_tag="LMJF_34_0420"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686132.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654796"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3G6"
                     /translation="MAGVSSFEVRLSPYVPPLQWCRAVDGVFGSHHFVCSSYTCGIGE
                     PRDNDDDSTDAAHTREAWEERDTLRTPPEAAADAAATNVAPHTPSAGPPVRMPRREGA
                     LTAVWAGTPAAEETPCCSFPLSSGHLPLRVAGVLNGNVPLDSATSSVPGTRVLCLVAL
                     DGSLLTGRTCPDSPSPSWSRDLFDTVCDFISRDVMPRVSLRLIDGTWARAEASEHLLD
                     DVCQVRQVLGTSYVVQYPSDAAAPSAARARSIVMVLDLSVPLQKLLSTLRSIRTSSPS
                     PATDAKSERRRRLAAQLAEAVQDTIGQLVSQHPDVFAFTREAARATESALAAQLSRGP
                     THFTREMLCRSIAASVSQIVSLSSNTAFVEEVVRLLWGCETDVEVTDVTTTAERSRES
                     LRISQQQPVQIQRRIEERLMSAIPP"
     gene            <149802..>150611
                     /locus_tag="LMJF_34_0430"
                     /db_xref="GeneID:5654797"
     mRNA            <149802..>150611
                     /locus_tag="LMJF_34_0430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686081.1"
                     /db_xref="GeneID:5654797"
     CDS             149802..150611
                     /locus_tag="LMJF_34_0430"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686133.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654797"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3G5"
                     /translation="MQSRVRLLYLEFMYLLPQLKGFYSPQGAAVAPKAPASGMATSKP
                     FYLRLPADHPACESLRSGHVTELSSHRQGKRPAGASPAHTTATDAEAPPPLVDVSTAV
                     NSESCVVFKLQGDSERALVAPFMPANWDNSIARKPSPSPAGQRAPAAERAAEAEYRAR
                     VQRLFYANALVPAGSPEWKRCLARGRYEVRSVHNVLHVRKYRALHKRYSWASQLSRTE
                     LEAAWGGNVEDVEQALLGLSNRDVYGYSGSEAEASEEAKDNEKQEEHAGRP"
     gene            <151870..>152235
                     /gene="S25"
                     /locus_tag="LMJF_34_0440"
                     /db_xref="GeneID:5654798"
     mRNA            <151870..>152235
                     /gene="S25"
                     /locus_tag="LMJF_34_0440"
                     /product="ribosomal protein S25"
                     /transcript_id="XM_001686082.1"
                     /db_xref="GeneID:5654798"
     CDS             151870..152235
                     /gene="S25"
                     /locus_tag="LMJF_34_0440"
                     /codon_start=1
                     /product="ribosomal protein S25"
                     /protein_id="XP_001686134.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654798"
                     /db_xref="GOA:Q4Q3G4"
                     /db_xref="InterPro:IPR004977"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3G4"
                     /translation="MPPKAGQTKKAKMEAANKGAKKTTKKWSKGQSREALQNAVMFDK
                     ETYDKLRSEVPKYKLITPSIISDRLKIAVSIAAAGLKQLCREKLIRLVSCSSKTRVYT
                     RIVQAAPTEAAAAAAPAAE"
     gene            <154669..>157479
                     /locus_tag="LMJF_34_0450"
                     /db_xref="GeneID:5654799"
     mRNA            <154669..>157479
                     /locus_tag="LMJF_34_0450"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686083.1"
                     /db_xref="GeneID:5654799"
     CDS             154669..157479
                     /locus_tag="LMJF_34_0450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686135.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654799"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3G3"
                     /translation="MAGDSCSSPVVTATAVTTTASFVSPRTPTSTPPPTTSRCFVRPL
                     LVQRLHSRSDGPQQQQQQSNCASNLSLANLCESEREGAGGVEILLAKQHRPMRAIASS
                     RYPGTAAGQQERRQRQEDAAETAMDGDAAVEKLASVAAKENDGAGHSSSSTTATITGG
                     TAGGARCITIQPRSDHHTAAAPNGASRGQEDKRQVATCSIPINSACPCGNALVAPSPA
                     SYPSNLSASTARSSSASSSFYNAPASGPRAAGAGKGHAAVASLSPPALPDGAPTCNGD
                     GNPSGSSTEAKVVPLLLRTWLSAHTIGEELGSPATSRSTPQNLVSGPSLTMPQAPLAT
                     LPPSGATSMGSVTPLSSNRSSTHPSFMRPPSVAYAGGEQGSIKVPGGLRQISGGGKSK
                     GSPTDGIAHAVNGRVLCSPHGARRPDRGARRTTFQRSTSNLSLPETCSSGGAPPPSDL
                     GEWPSGAAVRKSTASARPPPSSMPKEMHSFILSQYRTFQRDVLSLPPPPQSVDADATL
                     VDFQHVKRATCSKHSKAAKKVLKAQEEVRLRALQQQHHDMEVIRNGGREHVGQNMKSS
                     VVLAGSLSKLRARTRSSLGISGATALGASPATSLIIGSPEECSVTALYPGDGSGSATP
                     EKHDAAQSQTPEPEREAWHASKAFMASNAPADAQRHGRQSRSVNKNRMKGEEIVVAIA
                     LDSEDEEDVDASTTSNAETWRRSRVDQPHRSAHVSPTGLRTLSSDTAAKCAGERLVSQ
                     PQRRRGAAASKGCAERRAHSSSSSSNNEEGGFPCNQQRGSRVRGASSPSSALPPGLCS
                     PSVASRSGSQASLSTHALDSSHHHSNATMALLAHSSSESDDEEDAAEACCHCCPCKRP
                     KNFFALCRTSSQSAASLVWRGEKRNVAASAIQEEKPSSTAISCTNPDGSQFVVEDLED
                     SDEDEPTLSMQSFRRANIQRIR"
     gene            <159488..>166531
                     /locus_tag="LMJF_34_0460"
                     /db_xref="GeneID:5654800"
     mRNA            <159488..>166531
                     /locus_tag="LMJF_34_0460"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686084.1"
                     /db_xref="GeneID:5654800"
     CDS             159488..166531
                     /locus_tag="LMJF_34_0460"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686136.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654800"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3G2"
                     /translation="MGSRLFASSDARCTKSVTTTCSVKSEVSGSSFRNGTCVFTVSSA
                     ALGVTLDTPRASVPLAHWCVGNPGSAQPVATLQMHKMEVTPEYVLNGEESALVFSSAV
                     PVGTMLGFYADSQCQLLLTGAGPFVITNERMVRLTVKPSSTPLFMCASTITVNGSKTP
                     IQLVNAVVLATPYTVDPATGVRHQTVVVSSSTKPYPQFYLSTMAHCTDSHPEYQSTAA
                     SEMAMKISVPRGTYFFCGSRDFGENGLYIPASNTFTVLEYNVVPHTLYVDKATVMSFA
                     LDAASVQSTLEAVLSTSDDCSAASSWQSSWSNPMRWTAKQLGVHHACVRRKYSAATVG
                     YANIIIATNLPTTTFSPAAPVRGVSMRATLNHVNATNAFFVVGLFDSQDCTTLLVRGL
                     ASPSTSATASLAVPLSAQDMLYFCVSNPLDAEPTAQDLSVRFHKLRALTPQPFALEYA
                     PLRVGALSTITLDGTVFLAKGTTVALVRADARKEQCGVTDIPTFDVLGAAFALGPVTF
                     PEAGDWDVCVREPGANYVAVHRVTVYGKATVEPPGIVAGVEGTIAVSGLPPNAVVFVT
                     NAAECGDEAAVLGRATASGEGAAKITLMYDSVGTLLLCSYYPATAPQPVLQAAGSVRT
                     ANPRVAPAVVALTAQTDGTQALHFVAPGAAVLKGHAAYLLPGESACPSGSHVPGAATA
                     LPALQVAAGSDTPHATLELRAAMVGKRYLACVNTNGRFVAAGDVTVVLSAPWLVSDPA
                     PLAAGLPASIRLPSTYTSAAHVDTYAIVGGDADCTADFSTLSVLARGTIDSRTGAATP
                     FLVPRDAASPGRLRVCVAPRYSLLDGAGEIGYAAAGELDVAAFTPLSTYAQLRRPASG
                     VAGRPVHTAAVQYLVRCGTAPDDCKASTACVAASKRYSVGGVTQGDLDAPRGNYLLCQ
                     SVTVDGVTGTVAANAIVSVVDAFVMSVDADVAQIRAYVPFGATIKGGPVGTSFYSVAV
                     QPATVPCTVAVSESQTFVSSEGSVVINISATEPQTDVHFCVGPTTTSSRTEVTRATLH
                     HYMSPACIFADTPTTIILPTRSAGTSALLSSSRSAPVAVKGGEKKPLSGSRVTFTIDG
                     CGDNEAVTELFYHEFNDGWSVVRGRMLLIRNGTCKGGASPPSIRTVYAAPGAPISDAG
                     VDTRFLAVAGVGTSSGDMSLPGIDVLATGYVPAVEEAAAFRVWAHPIGDPDSLFTTAA
                     ATLRVRNWVVTPTHALSRYNATIGAVPLTLLRISDATPSKDTFFSQSQRCDGSLGDAA
                     DMGTPTQAAIYSATGVSGKVYVCTLHPQTGAPLAVAKFTSLLLPQVLHASPAVVRGAT
                     YAATLQTEGYALQQTSTFLSSNLCAGPLPLQSNAVSTASVLWVSFVAENIAQDVKSVS
                     LCVLTPAGTGAAIADVPVAPGTMWPTQFAVGAAAATIFVPLSPHTTFQLSATATTCTD
                     VGGMPTFTTDADGYAALSLLRASGDALPLGRYAVCAVPPTRAAVAAASPLETIEVVPA
                     AHFSVHGTVFVVDVPSRMELQQDLRATDLIAGFSTTTACSPVTTDHGTWAALSSTAIE
                     VRATVARKSGVFLCAQVPGNGSVVALPHALASPSRIEFLQLAMKLPAGSWDTCTDYLV
                     DQCHPPGSAGSAAADMLTVVHGDCCSYAAQAQAVGSASMASGTCRLRLDAAKVAAYAA
                     GTKFSVCAWNPDNSSTCATLHRVTVTNNCKPTNVGGGSRLSSGTVAGIAVGCMICGAA
                     LLVLVVWLVWCQRYACAKSSSVQSDEERPSFSELADTDSAREERQRHELLWKLLENTA
                     KDAMLSAQGGGEEVAPAKGHTATSLLLSSAMSTQGMEVFQDWTPNCMDGWPDVISKYY
                     SFLDGSDFDYETVSQIPGEGEPSGMDEELEAMLAVPRASALSEELEAKRQAELRAVVD
                     RNAKLLAVWEERHRMKEEDPIKLKMVVLQEREEWTRTALEGRRRRAHYNLTVLFKSSL
                     DYYNALSKKRRSERSESPTDESELLSVGSWDVAPLEPLDYRFDSCVGAPFVSTELSAS
                     VFSLTAGGERSVGVSSALRRPRPPPTETQALACLRDDLYRRRRFLEFPFVTNSPETLI
                     AYDKNVPVPAFVRGLTLVDLQAFHPAHRWLVDPPKPSSSADHLHDKKGTWAFMAPDST
                     MPFVRRYLILFKKEFGAREWILEADAAFWSHLFWEKRNVPVFSAVEEVEPVYDSDSSR
                     SFCTSSLEHRNLSSYESDSDHGGVADHGKRRLQPAEDFWAKEQAAPESIVERRRVEQE
                     LAALTAAKDMSKEEKKKIAAVQAALQAAQSAERKARAAQEKAEAARRKAEAANRDAKA
                     AKAGFESRSLSRTRPTSSTTVEEVMGQELQHIEELRRLGLL"
     gene            <171239..>173389
                     /locus_tag="LMJF_34_0470"
                     /db_xref="GeneID:5654801"
     mRNA            <171239..>173389
                     /locus_tag="LMJF_34_0470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686085.1"
                     /db_xref="GeneID:5654801"
     CDS             171239..173389
                     /locus_tag="LMJF_34_0470"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686137.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654801"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3G1"
                     /translation="MSYSAYQVAGPADPFRPTLEMCFRGHRQGVCSVDFQPTLSPSPL
                     IPKVVSGGADGAVMLWDAKATTRTMRFMGHRGPVLDVACSPRANLLASGGHDGYVRLW
                     IPNTRRTTATYGLHAELADDRNSCGWRGHTGATRAVVFAQDGSDYLYTAGNDKTVKCW
                     DLNYASSSQHIGAGPGNKFVGSFAALSSTGQHGTGHMNWVRTVAVQSAYTSSSFFHYI
                     ASGGDDHAICVWDTRTRAPVHALFDCSASVHSLSFHPDGYVLASGDASGAVNLFDLRH
                     TSSSLSAANGWDGAPAPRRFSSLLQHYTGAHAGGVQCVDFAPNGGWLFSAGNDSTAKL
                     WDVKQVYLYCTLQGHEGPVKSCNFSEDGRWLATGGGTDKTILVWRSGLAERAATRGST
                     AETTLTTVGNEDAALPEMTPPPKVSISAEAPAVRFSSPMAQASRNVAPRCKLRDNSFR
                     MQNGAEHSSKTSASQAVSSGTTNGCRGSSSDPHVSNRAAAGAANVSAGVAAAASLGRP
                     PLSSPTRKEQAGTPSASSSRDVAYVADAKVWNREDAGKSSVAAHERSFERSEERLDYL
                     VASVAGSRGEVGNGHSRQQPVVEGDTARGGTNTPHEQESPLDSVDSSARSAVVAAEER
                     EQEALVAQERAYQRLQEDRITQQRLANLEEALASLAAYMQTQYLQQAKEMRETRVKSR
                     VQADKYDADLEDLKRLMARIAAPAADQASAKGIA"
     gene            <177991..>185658
                     /locus_tag="LMJF_34_0480"
                     /db_xref="GeneID:5654802"
     mRNA            <177991..>185658
                     /locus_tag="LMJF_34_0480"
                     /product="putative calcium channel protein"
                     /transcript_id="XM_001686086.1"
                     /db_xref="GeneID:5654802"
     CDS             177991..185658
                     /locus_tag="LMJF_34_0480"
                     /codon_start=1
                     /product="putative calcium channel protein"
                     /protein_id="XP_001686138.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654802"
                     /db_xref="GOA:Q4Q3G0"
                     /db_xref="InterPro:IPR005821"
                     /db_xref="InterPro:IPR027359"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3G0"
                     /translation="MEIPLARTQPIEKFFVEYNSAAAEREDDGQPRNDNEVLLMQFAE
                     YTDDDSFFSSSDTVIECDPQRLRSDPLRRRAVVSVHNTLQLRALTNGRVPEDMVWNNV
                     TRTSWLYQIHNRAIALQHSSFFIFPARWTPRVIVYNVMHHWLMEMFIFLMILSYAIFQ
                     ATWGRHTAPPGGMHKPDHIIWADVFYTCLLGFEIIARLFASGGILHKRAFFRSPWRWL
                     DTAVLVLSIMECTWWQDLWNFTAWRLIRTIKCLTYVPAPVRMKLLAKSLLRSTNRLIY
                     VTILLTYFIFFFGLLGLQLFAGTLHSRCVNTLTGAVTSQVCRSVSTGEYGFYWGHHCG
                     VFYTCQADAFPNPHYDFRSFDDIGHAMLSVFQIMTFQGWSGLLQETNDGLAMMAFLYY
                     FFTILVCTWIVPSLYLGVFLEKMDKTSRLFVLKQLDFFDHMLTEQRQRMSSMVRLNDY
                     VERDENGFVSHYPAYTLQQQDDKRLTSDDTASGSADDKNMNAHRIKSHHRAIQATKWT
                     DEQRIQLQLALTRQRHVAEEAERKRQLQQTALGDLIVEEGGAGKRQGTVRQGACPAGA
                     ASGWATQTEASPHSTKERSDFALGGRVGAVQHHPAAYAIGDSHQSDLPFAVRQEVQAE
                     QLRFLDPYTNGASTAKNDMYNAAAAAALHTSMDKSRAAVPGGGAESATVLHSRPASNA
                     RPSTRAPSAPSTSVMVAREAAGVVPHRRSMSVRGGTLSRASSMNGRSSLSRLHASMTQ
                     VQQAPTQQEQTAYVINDPEGGDFDYAKTLGQKIDIIRNIAHMFTEGYPRIISQYLWEH
                     RMMQHRYGLTPLSYTNKYEEEALRRLRQRRAQERREEREELRRSGMGHLIDDDDDDDD
                     DSVAEKPWMRQEGLVPGSMSPIRMARNIRENAPITVFNYIMYSFIIANAVFNASRFDT
                     MPDYWETGTFIAGVCFSVLFMLELLIRLLALGPGPFFTDILILIEATFMVTSLFQLGY
                     SRTNTTSLFNWVRFLRLFRVIPCRPLRRVSRVLIHGFPDMVYALVLFTLYMFMWLLLG
                     MSFFGSRIGWIDYNTSDYTTRGTFETFSHAAYAVAQAFSVNRDQWLYLSWSGMRVRGG
                     YTVLYFIATVCVAFVFRFFFIAVMTYAWQAQQEKEDYYFMSGSSHGRRSRFARLPFFD
                     FSVWRSFKHIHGGFDRRDVAPDEIYFLNEDMARQLRLVEAKDRYYRENYGQERSEWGD
                     IGEGSQMGDSDVYRSDGALVNGPQYVNIGGRLYRQPSLPATEMGFSVGGTPQHRGQLR
                     FARHYRAVPATTYAAAQQQRLAGAHDALPDEVEGSRSLSRHSRRSMVNPLLADRHSLS
                     PAHQGTSVGGPSVARVSDSLAEERAKNANIGLVPRLTKLGNARAVVAGDNDEATADYS
                     TPEGGVSDEDLEHLLLPGPRLRYKSTMDEGRRVFETCLDCNTHMQMPLRAPPGVAQRT
                     AEELHAEHCHMAAVRSSQQLVLNALIGYARMQADHDVTPTKRMVEVVLGQAWSCGMLL
                     FDTIENLSCMDLPEQERTWDRMLEALEMQQWLLGLHVGEEQVGRATLAYILANQQRQE
                     AQVREKSYKNTWEDRVFFVLSPSNPVRRVVSAVVGSMWFEIAVLCVVYAASIFLAVYA
                     PDEGNRDFGGSYNSAKYKALHILDDIFSIIFAVEMLLKWISMGVVLPVGRAYFWHRWN
                     IFDFFIVIISLVSWGKPDIFLRYLKVMRCFRILGPLRYWKWGSSSMSHVARTIWDSIP
                     TLANVCLLMLMNYIVWAIIFVSLFMDKFNYCSNASIVNGTQCVEEGYTWAPTQRNFRN
                     FYESLLTTFEISTGAEWIDVIYSAVDSRSALLSPLRNQRPYLGLVFIAYYYVSHFIFF
                     TLFISAVIYCYMLAKSATEDATGTTIEHQVWLRMQGMIFRLKPKVQLLPLNTRVSRLV
                     HFLISNRWFEAFMGLILVFNMLTMSLEWYQMSSTQKTTLDAFQYIWVVIFTLEVVLRF
                     VAHGLRFFTRRAYCWDLLIVVLSYIQIGLSTTATNHVPFNVNVLRMLRVGRVLHLVHL
                     ALPFSTHLTLFHEVLKASVPGLISVTFVYMIAVYVFAILGLHFLGYIVPFSGYIDDKY
                     NNFGTFVNALIMVFRLSTLQNWATMLRGSLDRGYYCTRASKRCGPTDWAPVYYIPIVI
                     CFFLLLSTLYMAVVLDKYVTAVRIYSAVTRLDELRRFCRLWSTRDPNGTMWLPSAVLP
                     ELLEELRLPLGVSDRRNRVEVMQLLREYNIPDHNGRVYYYEVLLPLARRVMAIAFLET
                     ADAHTAGSQAPRDVAWYLSERSLGALPASYGTVQPSGVTVAEHYAAALLQAAFRRDRA
                     MRNYYIAKSELWRRGRAVCAERGLPYDNFGFGKTPLAGPDPREEGMRRGFDIPKDATL
                     ANAAGGRIYLDPVAARIAAMREAMGSQKRTTDQEPPTLLPAVYRSAIYPEEKRFGPNA
                     PGAIRRHERRDEKLERKRVQEEYERQMYERSTRSCPARAAGEHKDNETVTAESAGDVD
                     AGLAYSRGTMEPHAAARGNQYNLDPMDVNYQPPLGTSPEELRQEKVDRRLNAAATAAT
                     VSATLGGISPSTTPEQY"
     gene            <187520..>190132
                     /locus_tag="LMJF_34_0490"
                     /db_xref="GeneID:5654803"
     mRNA            <187520..>190132
                     /locus_tag="LMJF_34_0490"
                     /product="putative importin beta-1 subunit"
                     /transcript_id="XM_001686087.1"
                     /db_xref="GeneID:5654803"
     CDS             187520..190132
                     /locus_tag="LMJF_34_0490"
                     /codon_start=1
                     /product="putative importin beta-1 subunit"
                     /protein_id="XP_001686139.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654803"
                     /db_xref="GOA:Q4Q3F9"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR027140"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3F9"
                     /translation="MANITDLLMALGNPEPSIRVPAETAVNNAKETDLATFMTTMLQE
                     FRDESKPTFARNMAGTLLKNAVAPSFREVAARHALEERWRALPADVRLHVKNEVLSTL
                     GSPNRDVRTVAANIVGSLARSELPSGEWPQLMGILVGAAQSASEQHQEAALTAIGYIC
                     EEGKDHEEVEEALKPSTTDVLSVIVQCMASTNEDVKLSATNALCNAMEYIHDNMDVPE
                     QRSYLVTALCETAKSCTTARTRERAMESLVKVAELYYSTLPDYIARLHEITTNAIFHD
                     EEAVGLQAIQFWISICELERDMKEGGDVQSSLNYSAQGLTFLVDICKQLLVRQEEDQT
                     EDDWNLSVAGGKLLQSLAEAVGIPVQRPVMDFVYANINSTEWRKREASVMAFGCIIGI
                     QETAAQEAIQDTVAQAVPGLMEYLRDSNEMVADTSAWVLALVCENFVDIFLQTPDLLQ
                     RLMNDVGPMIGGDNARMGVRACHIINNIALAYEEEEDQQTNEISRYYGDLVVVLLHAI
                     DHGATNDFKSAAQETLNALVDAAATDCCSAYLIQLPQELLARMGPQLNALRQSSGDNI
                     EAEAMMGLLCGALSALARKLGQSFMPFLDASMQALIQVIELPTDYVQQEALVAIGSIA
                     YVAKEQLAPYLAKVIPHVLKYLQAFDEPDSIYGVVAAVGDLSLSCRLSLLPFESDIMN
                     TLYVNLMNTEVNRELKCSFLSCFSDFILNVLGSERFKPYMAALLPLVDRLFRASCEID
                     IRGDPEGEEYVMSLWETTASFYSSVTQCFKSSDVDALAPYLANILGFALHAATNAGEF
                     EETQMAALMVIGDMASVLRHVPDPQMRAQAKQALLADAVNGALNQALCSSTSEDNKKQ
                     VKWIRNQLSHLQRS"
     gene            <194844..>195617
                     /locus_tag="LMJF_34_0495"
                     /db_xref="GeneID:5654804"
     mRNA            <194844..>195617
                     /locus_tag="LMJF_34_0495"
                     /product="putative splicing factor ptsr1 interacting
                     protein"
                     /transcript_id="XM_001686088.1"
                     /db_xref="GeneID:5654804"
     CDS             194844..195617
                     /locus_tag="LMJF_34_0495"
                     /codon_start=1
                     /product="putative splicing factor ptsr1 interacting
                     protein"
                     /protein_id="XP_001686140.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0495"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0495"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654804"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3F8"
                     /translation="MDVIPPEYDPVTRERVYRQEWLEYFHYIGFETAIRDYPAEYRAL
                     FPRGHHKPPVMPPPLPVGGTKSQTASTSATAANMFIADDDDKEVGKGGDTEDDWSSLI
                     SSSLSSAASTPRDAPREDARAENVERTARDERSSRRQTSSRHDDRHHSSRRHCDRDSD
                     ERRRRHHSDDEERRHRHRHHSSRGSDYHHSTSSGMSRRRRRSDDRDNRDERRSSRVHS
                     SEESSRRYRRETTSGSSRTHAYEDRREDALRRRNNTYRR"
     gene            <200331..>200969
                     /locus_tag="LMJF_34_0500"
                     /db_xref="GeneID:5654805"
     mRNA            <200331..>200969
                     /locus_tag="LMJF_34_0500"
                     /product="amastin-like protein"
                     /transcript_id="XM_001686089.1"
                     /db_xref="GeneID:5654805"
     CDS             200331..200969
                     /locus_tag="LMJF_34_0500"
                     /codon_start=1
                     /product="amastin-like protein"
                     /protein_id="XP_001686141.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654805"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3F7"
                     /translation="MALRISMIVYVVLQFIAFFFVLVGTPLDMFRGNDPVAAYRSVCI
                     TLWGWKSRCTSSVYEAGVDELWRDCGGRRKRFRAAQVLAVISIFVYGAAFVLGVLLLC
                     CCSIFRLLCLALNIVGVFTLSVVWVVMVVTYYKHEALTCPNLKGFFNYGAGFALFLVA
                     WCLDIINIAVLLLPCQNRGLSVSEKLEEEDELQPAPEAEPMQESAQHGEKVQ"
     gene            <206890..>209595
                     /gene="SCAL"
                     /locus_tag="LMJF_34_0510"
                     /db_xref="GeneID:5654806"
     mRNA            <206890..>209595
                     /gene="SCAL"
                     /locus_tag="LMJF_34_0510"
                     /product="phosphoglycan beta 1,2
                     arabinosyltransferase,(SCA like)"
                     /transcript_id="XM_001686090.1"
                     /db_xref="GeneID:5654806"
     CDS             206890..209595
                     /gene="SCAL"
                     /locus_tag="LMJF_34_0510"
                     /codon_start=1
                     /product="phosphoglycan beta 1,2
                     arabinosyltransferase,(SCA like)"
                     /protein_id="XP_001686142.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654806"
                     /db_xref="GOA:Q4Q3F6"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3F6"
                     /translation="MQDIASTLPHHRTPAKYQAGLHYHQANGRESAAPLLTSSAGNGA
                     NDKRPNHWGRSLLRGFCHVKWHQRTQWAVVASLLSFLVLFVLLHELLQVSGLSQSIYA
                     VFSRPASERQTLLEDELVIRGPVVPPNGAFCGLCTEGLVVFRPASAATSLTTAPAQTE
                     VVVCMETMEEARLAASKSEPLSTVRDCVARLYNLGLLQPPRTTITAVNDTCAAVRVTA
                     QVLSGEAEEADRSKCSSGFVAELQVSSTEREKVKVHTQRFPSWPLCPAASRDAIDAED
                     GHQDGSGSNDYIVPAYFATAAVRDTDVDCDVPPPWRIDTIEDLDGVVMRFARDAAQTT
                     ESSLPLTSDLRCPTYFLTVNIGRFGRHHNQLQEILNGISLARRSNRTFILPSFVPALY
                     MTYLKLNPELLYGWNSLRRNGRYCVLSYAEARPILQHLRERDGVVSMERVSFAATADL
                     HVLFNTTEEHDSYAWGSMPRMPATDGAFVYDADEWLSMGLQRRDMTAHTASNTSSVPS
                     PLTFHEARPPSAEECSGFAGPALNKNRTQWERIRSCTTAFLRTYGDGDGRRGSSLASR
                     RQPRVVVISSVTAFHLRPTLTEMTTLLGLLRPSPTLTVEIGRYYRLYATQLQWPANTD
                     PKRSFLNVLQPCRYKSTIGVHVRRREFTCREEAEHPSATIVAMSEARYQFDGTGENDR
                     TAAGRPLTTVERLASDCGWNAQSLLHIYDTYAGWTRSRRARGLRRSRCFAPVQPSSKQ
                     VLRSYVAFDEQVGPIGSQLQAALQQRYNPLKKQRAANGYPPIYAAFYDRRPRKDLFQM
                     YREILAKWEHSSTDKQHADGGAVFNVSDVPRTTESLVEILYPIAEQEALALGLDFFLL
                     GNTGVFRGNIISSVSINVCLRRLGRGLPCHGVLAGYYEMLYKGYM"
     gene            <211741..>216072
                     /locus_tag="LMJF_34_0520"
                     /db_xref="GeneID:5654807"
     mRNA            <211741..>216072
                     /locus_tag="LMJF_34_0520"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686091.1"
                     /db_xref="GeneID:5654807"
     CDS             211741..216072
                     /locus_tag="LMJF_34_0520"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686143.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654807"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3F5"
                     /translation="MMNRGMMARPEAQSAYTDALPSAATVFSENTQQRRVETPPTRYV
                     VVHRPATTHVLPHASEASTRMDATTVAPESAARHSVELTSRCCSATSSHGNAEGMFDV
                     CSASVASNNTSLSRPASRGPRASPRRRRPSGSDSAEAVAGRKQAVGPVAAPVAATRKS
                     LVEASKEAPSTASEQPPPPRIMPSSSMNSTSDVTQQRASPSRMRGLFDFVLSSSGNSG
                     AGVEHTSLDASCEWAKTSPGCVEGVPARVADLPPPEQKRSHTITSPFLLLKPMGGVFE
                     PSHGALSRDESVAPADPFAAAVQEAGGPLVLRHTIDYLLSKARRLERENQHLWWQAHS
                     WDPHRAVEPHEAHPVAVPPAHRRVRKSFSPAEAVTRTPCDIPSPTAAFTQTQHPPESQ
                     PRVFVKRQPRLSQATGRSASCTSTSFLSRESPRRSGSGTGADAAEEHVRANPGAHLCT
                     AAADTPIPPSTESTETAATSAVSRTEVGTQCRPAARDAATDAREHRSPVHFGLASMAE
                     ASGASTAALQRGPSSSHADASAQTELVIPSQSALLRTPEARCQALHHRLQGTASADGR
                     GVAAGTPIASTVRSRHSMCSERSLDVMSTDATPLLSFPVQKQQARSLSSCSSQAHLRG
                     TSQASGSSVPRGHYPTCSKQVQTASMQSPSLGEVEDAGGGGGGGDALMLSTTDGTTST
                     LSPERTAVIELHTSASYARDTVHRLREYCNSLEATRQQLRRRLSSVPNSHNVSAVALS
                     RARSPSSLSHLHGQAPLPPLAAAAPTLSRPFFTSEYIDPEVDATLQDVDETTALETMI
                     VLHEDGAGTITKRMIDGSQSCISSLAVHSSSPQSQRPAATTASLLAIHSPTPVAENGT
                     SWARQYSPLALRRMKPQQLLSHYLRDTHNAMVIADEPRAHRHSSSLCTNASSSCCVPV
                     VRLGKPMRSASASLWNASDVNMHFPHAVPLAPSLSESPPKQAPSTGRFVVPPATPLDE
                     SDAEQLPPQSLPPRPNNHKTTAGASVFVSLAGCTAPGQFAGLQTGVTSSTMGASSRVN
                     SQRFAMKGLRESVSPKEHGTRSRSKSSRSSAGSEALVSGKQTTSSASAAAASAPLWDP
                     TRHSLQSPSPVMLSTSTETSAASALVVSDRLGTPVTTSGCEVGVPGASNDSVHRPRPI
                     GTSLITAVASTSFSPLSAPAPDSEEPQPPAETAVQPHIRSPLRRLHLEAHAVRCDHAS
                     SGNRRDLYTDSLHVSGSASPAPSTPRNSEENSGDRCKRSNTTAFLDEEKREASAVSTA
                     GACRVSAQLPVLESDVVSPDGADSFHSKDAAVSPRRSSERTVNFLSPDQVEGSLLPQP
                     QRPTSQRLISPSPPRGVAADSNEQNPRDGNTDLKAVSAESIPKDADIDSTSPRRHLVL
                     PQHRSPVAPPRVVIISKDDESPSPARSSLSRSLHSLPSTLSDGHCDDASDDGDDEDGS
                     LWYSEQF"
     gene            <217918..>219393
                     /locus_tag="LMJF_34_0530"
                     /db_xref="GeneID:5654808"
     mRNA            <217918..>219393
                     /locus_tag="LMJF_34_0530"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686092.1"
                     /db_xref="GeneID:5654808"
     CDS             217918..219393
                     /locus_tag="LMJF_34_0530"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686144.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654808"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3F4"
                     /translation="MVTQSEEGRTRCPSTAQVDEVPPTPKDESGKTLPADDARVLQRV
                     PPPPPPPAASTDSVTRKEPNLKSEQRGVDEAHQAQHEAPDNVEQKGSVAAANEDEAAE
                     EEKEPSLLVDILGSQQEDQQRYPTALSIDAAKDAPMEIGMDKDGSPSAAAAETHTNER
                     PKSSSPPPPEVFTDMNGKADDVDEASSAPKMPMVTTVAPEQVDGPVSSSVYKTPQHHT
                     SQAVHTTEALHGISSAEADGFISLIKPEQQPQEAQEMDSNRIQLSPLVCPVQELSQVE
                     PISWSKASLLEGSPLHWETSHGADVSPRLYRPLRLGTDVLRQKERANASNVADTIGAA
                     AALSEFASEEAEVEEQGVACGLGDDAEKPIAFTATSEVELEPEAAEESNAEESTLSMD
                     KDRVYTMGNTDAEDRSQPRKSVESSVAPVAPIEAADKHIASSEQHATFAMLTAEKSAW
                     TGSEAPRRMPPPPPYHHSDEAHDTPLPSRSAPPSILFPPPA"
     gene            <222451..>223620
                     /locus_tag="LMJF_34_0540"
                     /db_xref="GeneID:5654809"
     mRNA            <222451..>223620
                     /locus_tag="LMJF_34_0540"
                     /product="putative Gamma-soluble NSF attachment protein
                     (SNAP-gamma) (N-ethylmaleimide-sensitive factor attachment
                     protein, gamma)"
                     /transcript_id="XM_001686093.1"
                     /db_xref="GeneID:5654809"
     CDS             222451..223620
                     /locus_tag="LMJF_34_0540"
                     /codon_start=1
                     /product="putative Gamma-soluble NSF attachment protein
                     (SNAP-gamma) (N-ethylmaleimide-sensitive factor attachment
                     protein, gamma)"
                     /protein_id="XP_001686145.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654809"
                     /db_xref="GOA:Q4Q3F3"
                     /db_xref="InterPro:IPR000744"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3F3"
                     /translation="MHSTPAKEAEAEGYMRSGKKHLQKKLLQFKANYGGAAEDFDKAA
                     RIYTNLRNYPKAREAWTQACEAHSKAHNDFNAANSMEKLGDLASQCICESQSTMSSGS
                     TAGMTAQLSEHLFQDAIHAYEEASKLYGVATNGSKQAAVLKKAADLISRSLATVHYRR
                     PGTSGATTVDTAYLQKEYKRIIPELIELMERNWAATESKPFGLPDIYRSHVLLHLRSG
                     DVEGAVHAEKRMIGIVSTSPADGTYDDSKNLFRILNQPSNAAKVGLEIVVLCLSTSVD
                     DGYTWANIEMGRLGAVFGFCGSSEERAAAALLAAYAERDEDALQEALKTNTCFNFLAA
                     DVSRIAKKLTLGSKGHSKETGASVAAAGGPERSAAPPSSSQAPVDASETDSEDLR"
     gene            <225827..>227698
                     /locus_tag="LMJF_34_0550"
                     /db_xref="GeneID:5654810"
     mRNA            <225827..>227698
                     /locus_tag="LMJF_34_0550"
                     /product="putative leucine-rich repeat protein"
                     /transcript_id="XM_001686094.1"
                     /db_xref="GeneID:5654810"
     CDS             225827..227698
                     /locus_tag="LMJF_34_0550"
                     /codon_start=1
                     /product="putative leucine-rich repeat protein"
                     /protein_id="XP_001686146.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654810"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3F2"
                     /translation="MADPAHTRDGFWEQQQQSVQMTQGVFEAMNNNSMQLLQMRVDTL
                     ERQVAMLSAQVMAAALPASFQAYPGVTYGMSPATSNITPMSAMPTQMPANMYFYQPPG
                     MPAAAPANGAAADDGKASKQLEDELQRMGVLAYGGAAAGSATNPEAAAAAATMTLMQN
                     SFVVSPTSGIPTFPGVIAGVGNSNGAGPGIPFMPGAHEVTLASSMMPGPPASPSSTKM
                     SNALFQKAFGFSDPAMNGAGGDGMNANMSSLQRSCAVTLDPLQSTNEKLEQICQQTKI
                     RVLCLKGCKGITSLNAISRLQNLWLLNLQGCSPCVDDNAVRMIATHNTRLSRLNLCGC
                     DRVTDAQPLAQLSLMFDLNLSGTMIGTASLEAISHGCSQLSRLAINSCQQLTDVSSLK
                     NLSELKLLYCRYSENIDPATIANVLAGIGQNLLTLNVDGIRFRQLDLSNLPHVTALKN
                     FNCKDNTQLRDLDWLLSIPNAARAFESLEMLDVEGCGALVSFGLHITSLKRLKTMRLT
                     NTGITNEELSRISACPALAAIHLEDCANITNVECLANVPGLTKVVLSMRMQHEDTKAN
                     GVAALRKTGAEIIFAAASNHHGQGGSAHYMSMTPTSRFAPSIPTTSPNTAAEAHAFP"
     gene            <236044..>241290
                     /locus_tag="LMJF_34_0560"
                     /db_xref="GeneID:5654811"
     mRNA            <236044..>241290
                     /locus_tag="LMJF_34_0560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686095.1"
                     /db_xref="GeneID:5654811"
     CDS             236044..241290
                     /locus_tag="LMJF_34_0560"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686147.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654811"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3F1"
                     /translation="MHACVAAIAMGEVGVYDDQRSSGQEISLAAAAAAGVQYARSSRT
                     AFSCTSKSARQGGGGAVPIENLLPPLIEQPEKSLRAARGDTGAAITEDERAAIAMETW
                     EHYMATAREATSAEGASMMPSATAAATMMSSASCANAAHSCTSAVAAEAPLVPIRSFP
                     DALCALIERCTATPLVCLTLSDQQCQTTAVRDLLRALLTIMQRIEDSAVAAIDCEIAL
                     ASHSSSSGHHTPVAATAALDLQAVRLAAVKGISRVLTTYLDGADGSAQPPTKASETFT
                     AGLGHLDILSVFEDVVHQWAHVLTVLERGKELIGASAGVGKGSDVKAEDDLSGVPESP
                     QGHRSGKDGTGAAAQLHWVLRIAYQIIAAEQREASRGSAEAAPRVRLLPPLLVPVALR
                     TLSLITTVIPLVCRPASYVQLCVDVLWGASLLTPSESSRQLMYGSMGVAGLAGASNGS
                     CEGEADVSRGAEASPPAMDLFLALLHQFNEGHSAAHCELRDDLVCLFAFLLRCDIQYV
                     EDELVAHRVAQNGAPLTSSESLSCLSASPPSLEAHATPLNLSVATVEAINAVAALLFE
                     TTCGAELTTTVYSATATAPAAFQSTDVDRGESAPVTLLSLDAACRHALRFQSIASSVA
                     RRRELLDFKIYGWQLLDAHYCWQLAHLTYREYVHYHATTGPVKQVTGTDGGDRAVTAA
                     LWGIQLSRLGFLDVLLLYVDTRTDEAAVVAWTQEELLKLEVEAWQLLTSMILFTQHLG
                     AKLDGLQVRCHSPCSEKPSAAQYQQQGEDSPLLSVSVEAVDKHHFGEEAEYRDSDMDS
                     TDNKPGMRYGADVHFIAAGGVEVALHYLRTAPPEAEAVKRCALVTVAAIARASRSSEA
                     HGRSVSYTDEEVALVQTALTQHAPSLVPFLVQLIQEIDLYVDASGVPAALPPLISSVT
                     ASVAATSPQRVWGHRAAREDSGIELTAAMPTQRGVRWNWLPQSAAHAAFVAWGLLRCI
                     GDVPLAEVGTVRELALPMMSANGIEEDDHDDEAKATKTRQSHSNVSVATAEITAGASR
                     RKSVGRDRAPLQSFESADCQPHEEVDLSFSNMSFSGSSMGPLEVDDDDAAVSDHRRPA
                     ASSRAAGDGESAARSINCVSAPSHTRVLLRSVHSQVLRIPDLFAEHGGVHLLTSWMRH
                     VMRLCLSARPEQQQLLQRRSSEGASPQLTTEEMANLEHYGDVFLLLLDVLRAIVMGCK
                     ASEMQFVESGGVRGMLDLMEAYALAHGLIDQAARHVRLTAGESCGSAAAGTEDYKEQE
                     GVLTYAATLLSDLLESCPRAIDAFATWRSCRIAFSPLTPDVRECRMPSDDGIEAVQLL
                     LCLWASEMPARKGGGAAQATPSGLRLLRLHLRPALRTALREEYVCRLLHRRAKLGVLE
                     AEAVRNYYHYLHSEAVPATTSQTPEEGVPDSVVLAYMEKLMSLSSRRPAVEPEQQIAL
                     LIYGALGLCMKVYGCLSTVGFDLLRTAETEALGVPSIGARLSSLERSLLVQIAALPAL
                     CVDEISLAMAEVALEYDSLPAGADSESSDASCRASDDAATWRPTSPDRRLLCAAAQEA
                     AVRAGELNQLIEVGEQVQQARESQLYSRFLVTQLRQPVGRLADGRPGAVKGSWKTQRC
                     LSTTRESFLARHRSACALSAAELAARLSTRLAAEQLQRQQCNGTQTGASVGEEQSWAG
                     PPSTAPSVLGRSRTPYAALMDSVNAATHERLSATLFSIVGPPQRPSVPLTQRHQQRQA
                     MIARSLRKLPLDQSTPKGPHKP"
     gene            <242934..>245438
                     /locus_tag="LMJF_34_0570"
                     /db_xref="GeneID:5654812"
     mRNA            <242934..>245438
                     /locus_tag="LMJF_34_0570"
                     /product="putative GTP-binding protein"
                     /transcript_id="XM_001686096.1"
                     /db_xref="GeneID:5654812"
     CDS             242934..245438
                     /locus_tag="LMJF_34_0570"
                     /codon_start=1
                     /product="putative GTP-binding protein"
                     /protein_id="XP_001686148.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654812"
                     /db_xref="GOA:Q4Q3F0"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006297"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR013842"
                     /db_xref="InterPro:IPR027417"
                     /translation="MKLCGVRGSGVSLMRSSNFPCFRAAHNGGAPTATRHQSLCGRCL
                     DSHMGAGKRWCFRPLLAEPRRYGSASSASTTDAATAPVHGEDLYVSHYAIPEDARRLV
                     GTPQLLPRNPAEEVAFKKNLIRSFPQACIRNVSVVAHVDHGKTTLSDAMLRFSNLLPA
                     DGATGTFTDRLKVEKERGITIKAQTCSVLLTVRETGTQYLVNLIDTPGHVDFQYEVSR
                     SLCASEGAALLVDVRQGVEAQTMAQFYAALEQNLTILPVLTKMDNVMSDAEVEKTLLQ
                     LEDSTGLLSREVILTSAKSKQGIEQLFQQIIDKVPPPRGREGFSDMKQLPAMHPDSAD
                     RKKVEKELVPLRALLFDCWTSESSGMTDGAASAPVSTVSSVSSGTTAASGGQSVAKDG
                     IYGLIRVMDGTVTPGTTVTFFHSGKKHEVREVGIIHPTLHPTAALTAGMVGFVFFPGL
                     LKKDVFIGDTLCTLPTRKHTMRVVATGPPETASRTKPATAAETASSDDASGSSGSSVV
                     EPIPGFKTVQPVVFAGFYPDEGVYITQLREAVDLLCVNDPSVTVEQLQCPALGPGLQL
                     GFLGFLHMQVFKERLLMEFGQTVLVTPPQVQYMYVEQHGDPDDPAQRKPVSVSNWRWP
                     HEGVGAYLEPFITATVLTPSEYLNEINSAALSAFRGEMQEMRVIDGARTLVRYRMPLA
                     DLARGFFSTVKSSSHGYATLEYDDPTYMTADLVKMDIVINKAHISALSTICLRHEATT
                     HARRIIGSLKENLLRSSVDLPLQALVGSKIIARETVKAYRKDVTAKIHAGDISRKQKK
                     WNDQKKGKERMARRSVGTVTLDQSVLAAALGATTAR"
     gene            <246320..>246688
                     /locus_tag="LMJF_34_0580"
                     /db_xref="GeneID:5654813"
     mRNA            <246320..>246688
                     /locus_tag="LMJF_34_0580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686097.1"
                     /db_xref="GeneID:5654813"
     CDS             246320..246688
                     /locus_tag="LMJF_34_0580"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686149.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654813"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3E9"
                     /translation="MQRLACVRFVRRMATASLVSAAACEAPVRFSSDYVNKAAKKKLE
                     EGDDERWLEAEMDKNISTPEERYAHAREIEALKRMVSQLKEEHKDNLEEVKRDRSNEL
                     DSLKKEMSALQQKISKLTEK"
     gene            <247825..>251592
                     /locus_tag="LMJF_34_0590"
                     /db_xref="GeneID:5654814"
     mRNA            <247825..>251592
                     /locus_tag="LMJF_34_0590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686098.1"
                     /db_xref="GeneID:5654814"
     CDS             247825..251592
                     /locus_tag="LMJF_34_0590"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686150.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654814"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3E8"
                     /translation="MSSHNSFHDADGGYEHSLLLVLQATVKNSLWHLAFFPALRPSSH
                     TVSAVKANSSTSSTAADNSVVVSALHSLALLEAVGYTEAGHTARRLWRTHAFGSTFSL
                     SQHLVSAEQWSWVDKLRVTALRHAEALSSTLGSGGGVLATVLAETQQLNKQDKQTTAS
                     DALFSELAHDYLEHIATATSAASTADASKPAASTESKLGVPRRRTTSIFQYEALPPPA
                     AALAPSELSAAAARQQRQWYEARLYAAVACSTSISTPGPLARLLVAYAHQGDRRLQVA
                     AGTNLECYIGEDHNGEKTKEGGKAASVTSVVTDTAAAALARVRLSGVVAGVVEYALCA
                     ARVRTAVAVAELRASASSVNASPEQPPPCTATASCTVAHVPHSAALLLSLLAEECSYY
                     QQTAPDGTGCGEVGVTAAVLHAVQELLFTVVLGSGTQHMRNRPEPPAPPKRPGADGGG
                     GASLTPVVMAVSTTRGVTLPEADAIAQEFFPALVQQLGMEWVWSPLLRHLSSLDKSQV
                     STEAVDARAGSTPASSLSVRWSSHVLMDTILLSLSRKTYPQRLLNVLPGSYERLLSNL
                     DLLPRMPPQGDDADDAGKDDAAHRANGPLLFDMPAYYAEPASALVAYFQRAGVSGLRI
                     EETERILTTATSIHAMIVRLRAQAPSKHDADGREDGADDRSGEELDGNGNSRVASLYC
                     HNETRATPHAYALTRERVEHLITRYQGEVLLAAVVVHTQLRVPSQVQQLMRVLAPLFL
                     KIHLAWRTHHDGSSASWLLQPRTVPSVTGTTPSAARFSAEAAVLLDEVGYEFYPLEWL
                     PAALAASTAANDSSVERLAFPYSLLTAVGHQFQLQLRGTPLGNSGDVTLRHPAGPRTS
                     AVMPSVGEAALIASCRGGDKEETKATAAAWRRTERLVTGLMQLCYLDPKTSSTELEGT
                     LAVSSTRRVLTTSVGNATLRSSGGGNSALGARGSRANVIAAADVASHRLRSLLLQPAV
                     MDAMWGSMENTAIARGNGASQRYGERHEKRSQSAAASAEAQEHLRSMQQLLQEYGAAS
                     FDTTVEAADFALMIAQAFLPLSVGTSASLSSASGKSGPAASAGKKSEALLHAGLGWGS
                     AVVGHAATKARVHMQLQQQQKGGVSSFSAALAHVYNSATVDTAWLARSALRYVPQRIW
                     EKMCAHRAERLALVHRHSKWVSRLLGNSPTASEAKQCDLGNAHRVDPLLVAQWTQWER
                     VLEQLGLSEHLEGGSAAAASAMPHLSSFSAEDITCAQWLWYSPYFAAEMGP"
     gene            <252655..>255216
                     /locus_tag="LMJF_34_0600"
                     /db_xref="GeneID:5654815"
     mRNA            <252655..>255216
                     /locus_tag="LMJF_34_0600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686099.1"
                     /db_xref="GeneID:5654815"
     CDS             252655..255216
                     /locus_tag="LMJF_34_0600"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686151.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654815"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3E7"
                     /translation="MSSSHTEIVVSRTQGMQGSTPTNARSSKLGTLSVSELRTAMQQH
                     LRSTGALRELKMQLRGMVLAELLQQPKTARMLVHGTSQSVPPSLGEGQRKLDDSKASA
                     TGSPGTPAIAIVSGRTDHTLQTWSCGLADALVENHLRRTRRAMSLSIFSTEAEVPPFS
                     VSGAPSEEEQYLAHLFRQIDAGASANPEDDILAPSPSRSMKSVLQRLVEDYVMRQGPA
                     STAEAARHLHSCSTQTEAADSADSAMNPLNSLECRLAAVDAKYALTFAQLKRTGGSGE
                     QPFFLRSEVERRLQQHKNDMHAQLRSEYEQKYNSFTRVKLQEARDEAEGRYRLLAQNK
                     TEELAEMERSLLVKLEQERLRLKMAWEDVHQQRAELERRQRDTIKQLADYDAAKQQSD
                     AELHSWKEKTRALQLQCTKWEELCGTRLMELDGARSREERRVEDIRRLQAEHAAELQL
                     KEEEIGRLRYRLRLVSRESDYSHSAAAAAATASTNRSGKMDTSTVPQAPPRTSTAPVD
                     TQQLYGLLLRTEEMHRNAAVQQQQQQQKRWDAAWVAAAAAAAVSPAPATAAAAAATPE
                     RVFAVCSSSPPAPAPQAAVYPSPSSEGQVAQRSPHHSESSDHQVAAASAPAAAIMPAS
                     TSAATPAASSPSSPKVSAPAPTATATAVKSPSNSADKPRESSASSKKSLSTRASVAPP
                     SSSVSSTHPTPQKPTSVPAVEAQATESLTSSSTRMSTSSSSALSSASAKPVQPSVHNA
                     DDDSKNKSAATALLNAVAEEEQSGRGEVQSEEASARDSIAWLEGNRRELLAEDSKRAR
                     SEDGGVVSPWKHFGGGSSGPQFGGGAAAADVGFNESFSSDDAALIHDSDEDDVEF"
     gene            <256957..>257910
                     /locus_tag="LMJF_34_0610"
                     /db_xref="GeneID:5654816"
     mRNA            <256957..>257910
                     /locus_tag="LMJF_34_0610"
                     /product="putative enoyl-[acyl-carrier-protein] reductase"
                     /transcript_id="XM_001686100.1"
                     /db_xref="GeneID:5654816"
     CDS             256957..257910
                     /locus_tag="LMJF_34_0610"
                     /codon_start=1
                     /product="putative enoyl-[acyl-carrier-protein] reductase"
                     /protein_id="XP_001686152.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654816"
                     /db_xref="GOA:Q4Q3E6"
                     /db_xref="InterPro:IPR004136"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3E6"
                     /translation="MQANRVTSLFGVQYPIVQGGMVWCSGWRLASAVSNAGGLGLVGA
                     GSMNFDIFQHHVRRCKEASKKPFGVNVPLSRDMAQYMDFIIEEKVPIVFTSAGSPKLW
                     TQKLQSHGIKVVHVVPSCKLALKCEAAGVNAVVAEGFEAGGHNGLEEITTMALIPQVR
                     KALAPEIPLLAAGGIASGEAMLATMALGAEGVQVGTRFAVTQESSAAEEFKKRCTAAG
                     EGDTYLTLKQSMPTRVMLNDYGKEARRLSESGATKAQLEEFRGKGRTKKGIFDGDVTN
                     GELEIGQIVSACKDVPTAAEVVERMVKEFHTRKAQLAKMNL"
     gene            <265646..>272842
                     /locus_tag="LMJF_34_0620"
                     /db_xref="GeneID:5654817"
     mRNA            <265646..>272842
                     /locus_tag="LMJF_34_0620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686101.1"
                     /db_xref="GeneID:5654817"
     CDS             265646..272842
                     /locus_tag="LMJF_34_0620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686153.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654817"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3E5"
                     /translation="MESPPAQAVSGVQCARLLELEERQRQLKRLCEEALREEEQHQQI
                     LQQLEEHNTAASTSVGSLAGGSAGSFTGAAALHARPLSPSAAAEPLDDLLTGEVQSFR
                     DPNSIVRDSSTGSVAAAPLLRGGSSSNPRNPSMDRPRTRLDSSYRPPTYPLPTASATQ
                     PPPPPRAMLYTASCRPREEGSRAAAAAINGSTQPSISAPAMYSSLPVPKTWWHGEKGA
                     AEKRSGSNAAAAACTPAERVGASYGACAACSPPAAHAPLSPPPPPPPPERSRSHSASY
                     SGPLLDRLWRSDIRPHHGIPPPPPPPPPPPPAPNAVETTVSPFSVRYSRTLGARAELS
                     PPLSRPSRSSAPPLVSPDDVTDNLPPPPPRAHSHAAASHNVQPSMADKYRRSRSFLNA
                     DPPLPPPPPPPPPPPTAHRDLDDDSILSTTSTERVIERWRQRLSRSDALGQRDGHYTS
                     SGYGRSGAAGQQPSITLPGTRVSVTLAERRTPQASAAPLLSVPYRESATREGVKVASR
                     APPPPPPPPVSGTALLSSPARYSEGINEDELLPNRWETASLTPSLRSAEERRLRSYFA
                     KPDGEADSSAPAHKDYVSYSRQRVPESRDGVKNARAALLETGGTTSSTSAPAAARSEG
                     SVSAWQQTSRAAEPPLHRRSTAAPFTSSAPSVTEVPPPTPAKAKPKKTVLHPYGFQQS
                     QSSSLSPQPEPSLRSAAAKNGCGASRHRSGTPAPLFSTLSAKHQRSTLSALNGSNLDS
                     AWGSSGTSLPARSDVNAAATVPAPHTSVAASDSNYFDIGPEKEVLLRLLQKSTRGASG
                     SSAGVALPATSRSSSIQPWTSSSVVANVAGGGQQAEKALPYPPSTHLSDSKQTQSFGA
                     PPTMTMLPPHSKDSARQHSNFDLSVGTQLPLGGSGKAAAGGAQHGNEVAAAQLQQKYD
                     AAQTKAEALARHLVKAISDRKLLQGSVEQLEMLVEECNAEVGRLQQIVEQQHQDSAAS
                     LGVQAALRAKEREVAVYEDEIRRLNVVLNGHLARTATAERVAQDSVQHGLVVKEAEVE
                     AAMAEVGMAHLAQREAEERASRLVKELDTAVEQIQFLDERLAEMERAAAAARFQAMPG
                     RITEENDVNLDGGNVALSHLSAPAHITIPPDEETRHWPPEARRAMAQLAAQAEGLLFK
                     NAEGERHASMRLQHVENTCNELQQHLRQRSEEVERAREACEQLRQEKSALQTVGGLWY
                     QQLREVKEDAQLVSEMVRTSREDAEDVYLSSRMAEERAAVHCAAAAAASPLQRLPSSV
                     PMDPATLKKSAQFAQQVMRDFHAVARFLSSLRTMNIGDRNGYQILQAIASGRNPAEAL
                     YTADDTATPERLRKLLRPNEASEARRRVQEKKARVLCAVEQALMVEPVSAAAYVSVDT
                     PPSRPSSGATITLGLPPRAGGQPPTAEADECEVPDALEDDLANDDEVEMEVVSLSLHP
                     TRMGSHSLRDGSNGMVHSDVRQRPASDSVTSLPCNRVPPTASASEVSCAPSAFRASPP
                     PAPLASDGRPFCSTSFMGGNEAPSTASTSRPTVAKAAPAPPTPLRSVSRPLRLSTTPL
                     QPQLDGKEENEEEAVALSDKQSNPTRALLHTVLRADSMPIRGNGAGADFEMSSITLVS
                     SLSMSQPTSHQQTATVQQPSPPSTLAVTATTPADLTEGAPAACPNASVPLQVQQQHKS
                     MPATQESLSPPSRLRSPTPNRVPAVWAEMHAEEDLITSPVERPKPSQSLADEPPPRVV
                     CDRNTQQVHLGSRPKDRSTTARPSSTPHPGSLSGTRHGFEAGDGETTVAPPRHTGRAR
                     RGASDESNGNEATLFFREPPRGEVQEVAAEPTSIPLQQQHSGVAVDLLNDGFAMSSRR
                     ASAAAVAPAQAISVSPEHTSVIEEEEADLEERVPSAGAAATRLSLHLESPLKGVHSAT
                     SSVPIVTRGPLKDSTMKKPSSSRTRSVIEDDEPSLSFSAPPPPLPPPPPVQPQVRPSP
                     SQEHAHGAPEADASAHTSPAEASVRGASHSRAMEGNDGSAASIGNAPLSPSSLSGSFS
                     GAPHRMLHQPRRPSASDVGPSLSSVGGAVAPPRLQRSTGSSSSVEAQPLLCTVTPGPA
                     AAVGATASVGQHSRSGGRPPTASLPREHPCPEVTPALVEPRRPSPSARPVSAAMHTNP
                     VTPGDPLDSTAAMTAGPPPLQEQTSLVPEKAEASRARSEGVTHADDSLRSNSKFSANT
                     MPGTPGSRLPSIASTAAPESPMHVLEEPSAALRLPGEMRSDTPGNAGSAVSPLAEPLQ
                     EAPVHARELPARAGNSAAPRGSPHEGAAPAPLPGVNVDAPESNTLNLERAPPRSAPPV
                     EAQALSSTISTPRSSSGGREGPARVRNSIPTEPSVSDEAAARRRADVANILKRIKAKK
                     EQEQKKSSEVGTPTSPTWSESTSSGTKDVDSAFM"
     gene            <274926..>277274
                     /locus_tag="LMJF_34_0630"
                     /db_xref="GeneID:5654818"
     mRNA            <274926..>277274
                     /locus_tag="LMJF_34_0630"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686102.1"
                     /db_xref="GeneID:5654818"
     CDS             274926..277274
                     /locus_tag="LMJF_34_0630"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686154.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654818"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3E4"
                     /translation="MQTKEKEFDEKIHQIHHTFQNAGEQLVVRDNIIAHLKEELAGLR
                     AEVARIPREYQEREEKLLLRVEAMMTELSEEQKRAHHSRRAAEEEVRAVRDSLQAAEQ
                     QLAQQQHMSDDLLRQLRASDKALQEEKQRHATALAESRCAYEAKLNELQRTLRSMEKQ
                     VAKSQSRLEDMEKDRCQQQAKLLELQLSGRRRIASETGKAKELLAESDALRDEVEAVR
                     FSMARLLRLMSEVPTLSDYLQWNELSSEFVFLGYPTRYFDTSYRGRGTSSLSPSRRTG
                     SHGASPARRRAAAVAAGEDISFDKPGPSSHSSGYYQDTNVSGISAGDTGVEDGVYAGV
                     AASLSKNVWLNGRWAQEMISIISAENDFTRLKRIKLLELEEAAQLSEQLPSARDVLEC
                     RKPEHHYWIPYAVFIEAQKFKNKYYPKLPAMSHFSPFLIQLNKIWRAKLQDRLRIMQQ
                     QNYNQPQQLSQARRSATGESRFASRARTREGDVADQRNSAVSRLTSRGSVAPLPKPGE
                     LFSEWARQEARMDEIHAEHHRLRREVRLHVSSQKGLQLFRLYDELVRDAHQTLGEVLR
                     LAEDLYDSATAQRVSESEDRKRAASSALHETKQQAQASAEMADLAEARDRLLCVVDHT
                     CQQVCDVGDSLSTRMMSYYSDLHQLIHMLHHHIRQARERSCHKTREQASSDGTRSASS
                     ASSSTAPCSGRVSNTVLSTEELQQRLRELLHDQYGTARGPGADTDHAAAPGAISSDVL
                     LKLAASMLDFGEEVRREVTHATAALRVVAEQGMREAAQCQGA"
     gene            <279714..>281474
                     /locus_tag="LMJF_34_0640"
                     /db_xref="GeneID:5654819"
     mRNA            <279714..>281474
                     /locus_tag="LMJF_34_0640"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686103.1"
                     /db_xref="GeneID:5654819"
     CDS             279714..281474
                     /locus_tag="LMJF_34_0640"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686155.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654819"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3E3"
                     /translation="MVVHHRLSQWTARAPWVPKLFLLMWMVLVVFVETVLHGVQQIAP
                     PLCASDEQHSGSGNGTSHRCPVPPVDLISAFHKMGRAYGRHQLAALDVSHTEVRGTHL
                     LACVLGSVMAPATTSEGEAPVVHRKGLWALDVAGCTQLRHRRGELYALSDMLDQLCSH
                     AASRVAELSLREPSGTLAVADLLLSLSLRDGSQLASQAATGLALALFTHHGHLTWVCA
                     AGSDVDSASLRELGQYALLVEAAAATRQPQPPHSPMCTLRALDLTSALRVDDVNPMGY
                     LTQLEQLLLPFTYVDDVGIGSLDGHTYAHDLSAMLALFTAAIAKEAPELPDDAQKSLQ
                     STLDALQHLILIDDDGSGQADVHRGNPRKDLVEALHQKFRSHLYHLDLTYCLCVSSVK
                     GLVRQQQLELLSLSQTRVNKFGLFGDTDSHDSSGSSASAAQPRRTPPLRLFIAEMCEH
                     LSDLSGLAHISTLECVIVRSGSLGDDGLRALCTPDMQRLQLMDLSYCDRLHHVGCLAQ
                     LPALETLILDSTDVTPAEVKQLRSSRSLRTLSLRFCTEFAFIGMGLEKLEAVVGTFAA
                     LNRYLYEDLAGDDELRKKMN"
     gene            <283548..>284477
                     /locus_tag="LMJF_34_0650"
                     /db_xref="GeneID:5654820"
     mRNA            <283548..>284477
                     /locus_tag="LMJF_34_0650"
                     /product="19S proteasome regulatory
                     subunit,Metallo-peptidase, Clan MP, Family M67"
                     /transcript_id="XM_001686104.1"
                     /db_xref="GeneID:5654820"
     CDS             283548..284477
                     /locus_tag="LMJF_34_0650"
                     /codon_start=1
                     /product="19S proteasome regulatory
                     subunit,Metallo-peptidase, Clan MP, Family M67"
                     /protein_id="XP_001686156.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654820"
                     /db_xref="GOA:Q4Q3E2"
                     /db_xref="InterPro:IPR000555"
                     /db_xref="InterPro:IPR024969"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3E2"
                     /translation="MDPSAFGMMAGRGMGRQTEVRDARDTAETIQISSIALLKMLIHG
                     RAGVPLEVMGLMIGEEIDDYTIRVADVFSMPQTATGQSVEAVDPEYQVHMLDKLKLVG
                     RHENVVGWYHSHPGFGCWLSSEDVMTAAGYENLTPRSVSVVVDPIQSVRGKVVIDAFR
                     TIPQEIMAMRAMGEYVEPRQVTSNIGFLSKPSAVALSHNLNRQYYNLPVTFRKKNHEL
                     RLLLNVYRKGWQEGFKLEKAKVYQRETRTSIRELISLSKQAEKYITQGRDEDDLGNVG
                     QINAMSHLQMEAENVIHRNLNQSIGAMINAVVF"
     gene            <286588..>289878
                     /locus_tag="LMJF_34_0660"
                     /db_xref="GeneID:5654821"
     mRNA            <286588..>289878
                     /locus_tag="LMJF_34_0660"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686105.1"
                     /db_xref="GeneID:5654821"
     CDS             286588..289878
                     /locus_tag="LMJF_34_0660"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686157.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654821"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3E1"
                     /translation="MPPPLRKPSLGPQGQRTLRRSSSPAPPSSRSRSPSTSSNNSDND
                     FVYVLGHVKSTEEAVECIRAVQQPKEKHQGRSLGGLGSSAKSLTELVTTSENRYPASR
                     KMKGELPATMEEFYESPRYTVSLTAARGALFSDALSGFHSYVACEEEQCDQLCTYATQ
                     GGAVRTSAVPSPSPAMTQEWNTTLAASSALPAKPASMAVKATGVVEEGHAQVATPASA
                     LPPNQRTESAGAPSTAADPSIPSPSAVPGPAHTFLQTKAAFPPSIVAAEAVTAAVAEG
                     TESGSPRVPASYMFLVRSRDSEVMNPGSSSAPAATPHSVALESPVFPSSRDSRASGRT
                     TIFSEPTPGSATNLHVDAAGPAAAVGKGAKPVPAPLTPAQETERAAKLEAMQPHVLLQ
                     KANHYRESVPVVFRYRYSPDFEETIDENKKRQQQLDRALRKHHWLAGSSGLTHAERQE
                     ISRRFADPNALAHEWLYVWEQFERDIPRETLLVEDTPYHDANIALAAILSYVEYSYDR
                     SQQHMKKLAAALAAEQKGDAATTPAATAAASLGAGNSSSGPASRRKTTLLEHFFSAGT
                     AALKGAVVKMRASLPDFVGDPLLSVSGYNPALYHASLLFPTDPKARSEKIFSAVREVV
                     LASQQSFMGFPYQLLCEQVGMERLGLALEALERDEAEVGDLDEETEAEKTARVTPVDA
                     THEEGKLQTSGSGATASIPLKKTAEAEPAVKEITTSMHSSLHGSRVLRIYHSFPSSTS
                     VTNRSGNDHRHRQHTVHAVDEWNVSSSSSRSSDAAPSSLSLNISPATTAPLPPPGASV
                     ESTEEKEQPAAVLDVLPAHCLSEEARRRKETVARLRRERRRRRPKQLPLLVGEPRLHE
                     FAAFLDILRSRLIAKQVKEERKEMEQRQRERVQQAVKRQCEQWGSAPASRQGSHPGSR
                     QAPSASRDMMKQAEDPLAPTAQPADTAMAPRKLFHEDVDGSAYLIPTRSASATMEPPS
                     RSPRSLLSSTSMREVSVSPEMHGMRIRLFFDDKRNVPVVVVNKLFRLFTMPGLRGFTS
                     SDDDITEALNDKTAAKAATAHPSASARKSGAGRTGSSEKSLLLLIQVQFSLFLQEDAE
                     VRWKWWKL"
     gene            <291978..>298241
                     /gene="ABCC8"
                     /locus_tag="LMJF_34_0670"
                     /db_xref="GeneID:5654822"
     mRNA            <291978..>298241
                     /gene="ABCC8"
                     /locus_tag="LMJF_34_0670"
                     /product="putative ATP-binding cassette protein subfamily
                     C,member 8"
                     /transcript_id="XM_001686106.1"
                     /db_xref="GeneID:5654822"
     CDS             291978..298241
                     /gene="ABCC8"
                     /locus_tag="LMJF_34_0670"
                     /codon_start=1
                     /product="putative ATP-binding cassette protein subfamily
                     C,member 8"
                     /protein_id="XP_001686158.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654822"
                     /db_xref="GOA:Q4Q3E0"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3E0"
                     /translation="MGKAPAMSSSTLTGVEGKASRSRSTFLVHGVLRRIPGYAFFLIH
                     LCFLHILWGQLVDQFFNATITFTSANVTKTDMAKEAFIRVCNRICRSVDQTLLHGLVD
                     VLKTKGGTGAMGALAASREFVAFLWKSPSSMVLFFGLAFICLNSVLAALRLFTGFLSS
                     LTALCRSRRQLERGGSRKPVPLHITVRYGNGYDSMLRFALAAVELAWFMSYPVLNSTE
                     AAKSATGKTRRVPGATEPTYASLRQLQVRHQAIASFQIEASLLLPPQLFDSTADAIAA
                     GAFVIIFVKVVLGVVVALDAQRLFHALVGVRPLFIPNGWERCPVCGALWKRSRKATNA
                     VHLCPNIFTATPLLSGCSPGTAASDTEEEEDMRGQVPGTVRRGVGDPRRVGPPTEATH
                     RPGDAFPNPNTASFASLVTDSWLSPLMNFTLLSPLNTFSPPPLSSIIDDGRGHWRALL
                     RVVDRLPRLPRSLRTRDAIDEPAWTLWQRRHEPGARGEVRWLERSFMFITEPIRRVLL
                     HAFAVFFLPPSARGADTRQGEWGLARSGSSLFRAFLRHPSGRQFVFVCVPLKLTQDLL
                     SLLAPRVVKSLVAFLKEVSASNISVRQSYLGRGLLICLSLILVVSLQALFFQLYLTHL
                     YASCLKSASALKTLLLRQSLATPLAYTGGGRGGGGKRASMSPSASDIPHSPTRPSEKN
                     DGRVKDALPLPTVIPTAEEVTTTATLSREGEVMSLLTVDVTNCADCLIFLHNVWGHPF
                     VIISSLMSMYTYVGLFSTTATFAALIALIPLNRSSAARVRTAQQQAKNNESRLSDLTA
                     ALSSMRTVKSMALEKCLVGRVEEARVRESDGTKLVGQAESVAAAQTEVTTLLVALVCC
                     GSYLLTGGVMDAAVLVPTMAALQVMRFPVWTLPHLYSQVSRGYTSMQRIERFLSELEA
                     GENASTAYVEHRLRQQTDEGAAREVQPSVAVAVRAGEVRCERGTFAWNTQAAVADQIA
                     FDNALSCNSPKGLRGYTRSPNAASKESDRRGEEDAPSSSMLSAYSSPRESGSRAVVLH
                     GITLNIFPGEFVVVHGPTGCGKSALLLSMLGELYVMPNDSRATSTRSTTASSETRGSS
                     DSQGFQVGGRVVYCAEVPWLRQGTMRENIRLVSDDIPESATEREWYNRVLEACGLKND
                     IKALAKGDRTMVGEGGSKLSGGQRARVALARAVYRYSETDVFIFDDVLSALDVEVQKH
                     IIANLFHGLLCAGAGSSSVAQRRTKTIVLATHAAVSLLMPDRVLHLWPDGTLHEDMTH
                     QAPTEDQVHQQKSAWRNATAAAATKEQRRSIHYQAASAAVADSSTRQNDSTLPLSTKS
                     KPVAEASPKSSSVPSVRRPATGTDSLLPRAADLHRLFIEYIGGGRLLWFFVLSVSMQL
                     FRTLMDNWLGVYISLYDKRNAAYETILRSTKSQRARKFMLDMLSLVVLRGDKATPAPP
                     PPPVVPVFTILGVPVVWRNPFVLDTVVAQFLGTYAFIGFSAALLSMIRTDYFFRSYQR
                     MADALQLHAVRKLFKAPVSYFDRIPSSRLLQILSRDQEVVDRALGESAQLIFLTILQL
                     FGMVCFNAIHFGPFIAVLPISALLFYHLTVRFLSFTKQVRALEGVLQSRSVAVMKDAV
                     NGAITIRAFGSVLQDQLLQEMNEALDAVHVAANAGLTADRWVALRLEFVALALTSALA
                     LLSVLTVCLSATTSAGSAAFAGLGITSSMTASRSLSMLCRRFGMFQNQFVSAEQLLRL
                     EEEIPEEDTPAAAEGCSDDDSSASEQRAATEPDTCLLLDVRHLCAKYQPQLPWVLSDI
                     CFTLRPGECVGLIGRTGNGKSSLFNALLGLMDVVEGEIRVPGALFSSSPRPKARQLNA
                     IHLPQHELRKNYFQLVSQEPLLLQGTCRSNLMLGLDDNSAASREASGEPRVTVDAEAL
                     DARLSAVLRKVALDELLEPSHAVPVSGQPAVTGGDGEVASSTTRDAAESASDSTASPT
                     STVDVATRTLDHVVTAGGSNLSAGQRQLLCLARAILHRPHVVLLDEVSSRVDRRTDDL
                     IQRVIKEEMLCRGSEGDGDSSAVKSGVLLIAHRLETIMSLCDSVIVIEKGRCVAHLSK
                     EEVNCLEDLESYL"
     gene            complement(<304335..>308168)
                     /locus_tag="LMJF_34_0680"
                     /db_xref="GeneID:5654823"
     mRNA            complement(<304335..>308168)
                     /locus_tag="LMJF_34_0680"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686107.1"
                     /db_xref="GeneID:5654823"
     CDS             complement(304335..308168)
                     /locus_tag="LMJF_34_0680"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686159.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654823"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3D9"
                     /translation="MLASYVDPSVHPLRVGQVVAYDYLHAAKTWQWTLGTVREIKDYT
                     AVVQQWGLHTGDIDTLRSILLKEVDTENGRMKNYHDMLAIAREKLASIRRSNEDRVSH
                     VRGHFDKAREKVELIDEVDLRKVTAQAAPSPVAVAVLKAVWAVAKCNPTAVEFYEWAD
                     VQLEYRKTAALDEIAKTDVLAKLYPSAESLQQSLEQDPKLNYKAAARDSTVVASLHAW
                     VTTALAYQQAYNLLAHDKRIQEQNDAIAAAIAGMKACRAKIAKLKDELSSKDTAALPG
                     QVTSFTRTSVLVTIPLSAVISTVNVASDMKGCVLTKDEVEQIPVDAKLTRYAQKQKLA
                     ITASHLLDQYAAATSTHIYATELEDRLFFFQHHMASALRDAQAAAVEAHQRLAVSLQE
                     LEAFRQKRHDAQQARAAEPELADVDGVEPSSGPSSSRSPAGRATPRGQSAAPRGTASQ
                     QHKLLDPAYQSIDPATIANEPLYAVTIEEYKAKDAAGERAMDEAERMADEVQRLAVEL
                     EDAKAEADKLAEELAARDEELAAHRRKRHAAQQVRASDPTLAAADAVAPCSGKGAAPP
                     HVGAVQRQAVDPATVPVAPGVIAEEPLYVATAEELQHVRDFADQLAEELEAFRQKRHD
                     AKKARAAEPELADVDGVEPSSGPSSSRSPAGRATPRGQSAAPRGTASQQHKLLDPAYQ
                     SIDPATIANEPLYAVTIEEYKAKDAAGERAMDEAERMADEVQRLAVELEDAKAEADKL
                     AEELAARDEELAAHRRKRHAAQQVRASDPTLAAADAVAPCSGKGAAPPHVGAVQRQAV
                     DPATVPVAPGVIAEEPLYVATAEELQHVRDFADQLAEELEAFRQKRHDAKKARAAEPE
                     LADVDGVEPSSGPSSSRSPAGRATPRGQSAAPRGTASQQHKLLDPAYQSIDPATIANE
                     PLYAVTIEEYKAKDAAGERAMDEAERMADEVQRLAVELEDAKAEADKLAEELAARDEE
                     LAAHRRKRHAAQQVRASDPTLAAADAVAPCSGKGAAPPHVGAVQRQAVDPATVPVAPG
                     VIAEEPLYVATAEELQHVRDFADQVAHDVAAREAEVADTMLNLRRELDEVRELNGKLE
                     GEVFALKKQLWDAEDAYKKLAGDLEVAEDERQQLCDDLEAALDELEQKKDEYDELLGN
                     LEEVQGLLEAADIAGRTAVEALEQRNQDMTDLQGELANALDASKENENLRVLLDAKEK
                     EIDRLKEYNSFWTDTVGTGKQKVTHRLTKIFDGDWTRLMRHRPEALKAAFVIDSSNAC
                     HVPGDQIGQVDFDHD"
     gene            complement(<310440..>319943)
                     /locus_tag="LMJF_34_0690"
                     /db_xref="GeneID:5654824"
     mRNA            complement(<310440..>319943)
                     /locus_tag="LMJF_34_0690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686108.1"
                     /db_xref="GeneID:5654824"
     CDS             complement(310440..319943)
                     /locus_tag="LMJF_34_0690"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686160.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654824"
                     /db_xref="GOA:Q4Q3D8"
                     /db_xref="InterPro:IPR004089"
                     /db_xref="InterPro:IPR019323"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3D8"
                     /translation="MSFFSSINPTFPQLQAGQVVAYDYLHAAKTWQWTLGTVREIKDY
                     TAVVQQWGLHTGDIDTLRSILLKEVDTENGRMKNYHDMLAIAREKLASIRRSNEDRVS
                     HVRGHFDKAREKVELIDEVDLRKVTAQAAPSPVAVAVLKAVWAVAKCNPTAVEFYEWA
                     DVQLEYRKTAALDEIAKTDVLAKLYPSAESLQQSLEQDPKLNYKAAARDSTVVASLHA
                     WVTTALAYQQAYNLLAHDKRIQEQNDAIAAAIAGMKACRAKIAKLKDELSSKDTAALP
                     GQVTSFTRTSVLVTIPLSAVISTVNVASDMKGCVLTKDEVEQILVEAKAMRFQLNSRM
                     NSIASRYVEAAAELHTLSLYTAELEKKRLYLQEHYLSSIIRSGEAEAKWERTEDTQKE
                     MDRLNALVAELQRHDERWEPDYEAVSVATSHVKKYPGAEWAYLVAERFEEVRVAFASD
                     TALAVHVDPNFVQHIKFTPERDQLCVRCEITHPATMTRTEVDERISQMPTRLMNYIYK
                     NREAPKTGLDRAVADICHALGIDDHKFAGLGFDEFVTQLAGFDYLGDKDAYESEIGDL
                     LMLLDKINNENRSLQYTLEKSAERFKKQAVVLQRDQDALTLRNADLADEIDRLQNLVE
                     KLKDLADRQGAQLEHYHMQQQQAQQLRAHRNLSPIPPTAEEPLYAVTIDELNTQKSLC
                     DEATQRAGVLQKQLDEKEAAFTQLQSHLREARCRNNDIDQQLQLAAELIEKQKQLLAA
                     FHQKRRAAQDARANEPQLAADARTSTRNARTGRRGRSAAHVHAAEESVDPATIAEEPL
                     YAVTIDEYKAQHYALHHAEEEAGTLARQLQEAQQDAERQKADNRRLAADNERLAAELE
                     RAQEEAEKLAAELDRAQEEAEKLAADLEKAEEEAEKQKAHNERLAAELERAQEEAERL
                     AAELDRALEEAEKLAADLEKAEEEAERQKAENRRLAADNERLAAELDRAQEEAEKLAA
                     DLEKAEEEAERQKAENRRLAAELERAQEEAERLAAELDRAQEEAEKLAADLEKAEEKA
                     ERQKAENRRLAAELERAQEEAERLAAELDRAQEEAEKLAADLEKAEEEAERQKAENRR
                     LAAELERAQEEAERLAAELDRAQEEAEKLAADLEKAEEEAERQKAENRRLAAELERAQ
                     EEAERLAAELERAQEEAERLAAELDRAQEEAEKLAAELERAQEEAEKLAAELDRAQEE
                     AERLAAELEKAQEEAERLAAELEKTQEEAERLAAELEKAQEEAERLAADLEKAEEDAE
                     RQKAEKERLAAEVDRAQEEAEKLAADLEKAEEDAERQKADNERLAAELNRAQEEAERL
                     AADLEKAEEDAERQKADNRRLAADNERLAAELERAQEEAERLAAELDRAQEEAERLAA
                     DLEKAEEDAERQKADNERLAAELDRAQEEAEKLAADLEKAEEDAERQKADNERLAADN
                     ERLAAELDRAQEEAERLAADLEKAEEDAERQKADNERLAAELDRAQEEAERLAAELEK
                     AQEEAERLAAELEKAQEEAERQKADKERLAAELDRAQEEAEKLAADLEKAEEDAERQK
                     ADNERLAAELNRAQEEAERLAADLEKAEEDAERQKADNRRLAADNERLAAELERAQEE
                     AERLAAELEKAQEEAERQKADKERLAAELDRAQEEAEKLAADLEKAEEEAERQKAENR
                     RLAAELERAQEEAERLAAELDRAQEEAEKLAADLEKAEEDAERQKADNRRLAADNERL
                     AAELDRAQEEAERLAADLEKAEEDAERQKADNERLAAELDRAQEEAERLAAELEKAQE
                     EAERLAAELEKAQEEAERQKADKERLAAELDRAQEEAEKLAADLEKAEEEAERQKADN
                     RRLAADNERLAAELERAQEEAERLAAELERAQEEAERLAAEVDRAQEEAEQLAADLEK
                     AEEEAERQKADNRRLAADNERLAAELDRAQEEAERLAAELEKAEEEAERLAAELEKAQ
                     EEAERLAADLEKAEEDAERQKADNEQLAAELNRAQEEAKRLAADLERAQEEAEKLAAE
                     LERAQEEAEKLAADLEKAEEDAERQKADNERLAADNERLAAELERTQEEAEKLAADLE
                     KAEEDAERQKADNEQLAAELNRAQEEAKRLAADLERAQEEAEKLAAELERAQEEAEKL
                     AADLEKAEEDAERQKADNRRLAADNERLAAELERTQEEAEKLAADLEKAEEEAERQKA
                     DNERLAAELDRAQEEAEKLAADLEKAEEDAERQKADNERLAAELNRAQEEAEKLAADL
                     EKAEEDAERQKADNERLAAELNRAQEEAERLAAELERAQEEAEKLAADLEKAEEEAER
                     QKADNEQLAAELNRAQEEAEKLAAELEKAQEEAEKLAADLEKAEEEAERQKADNERLA
                     AELNRAQEEAEKLAAELEKAQEEAERLAAELEKAQEEAERLAAELNRAQEEAERLAAE
                     LERAQEEAERLAAELDRAQEEAERLAAELERAQEEAERLAAELNRAQEEAEKLAANLE
                     KAQEEAERQKAHNERLAAELERAREEAERLAAELEKAQEEAERLAAELEKAREEAERL
                     AAELERAREEAERLAAELEKAQEEAERLAAELDRAQEEAEKLAADLEKAEEEAERQKA
                     DNERLAAELDRAQEEAERLAAELERAQEEAERLAAELDRAQEEAERLAAELDRAQEEA
                     EKLAADLEKAEEEAERQKADNERLAAELNRAQEEAERLAAELEKAQEEAEKLAADLEK
                     AEEDAERQKADNRRLAADNERLAAELDRAQEEAERLAAELDRAQEEAERLAAELDRAQ
                     EEAEKLAADLEKAEEDAERQKADNRRLAADNERLAAELDRAQEEAERLAAELDRAQEE
                     AEKLAADLEKAEEDAERQKADNRRLAADNERLAAELDRAQEEAERLAAELDRAQEEAE
                     RLAAELDRAQEDAERQKADNRRLAAELDRAQEDAERQKADNRRLTGELADKERELAAF
                     REKRRAAQDARADEPELALADGISRRDARARSRGLPAAQSHPAAEAVDPHTIAAEPLY
                     AVTLNEYKAKQAAVDNAVVVACAAEEAVKEKLRENAELMVELEKVRDQAYEMDRRRQE
                     DGAAMEGELLVVLMELKKLKGINDALLALLRDKEYEVKELRYHNELWVDPPGDKKQIV
                     TRHTKIFDGNWKRIVSERPEALFAAFVIDAGNACHVPGDNIKQVNFDHD"
     gene            <323345..>324034
                     /locus_tag="LMJF_34_0700"
                     /db_xref="GeneID:5654825"
     mRNA            <323345..>324034
                     /locus_tag="LMJF_34_0700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686109.1"
                     /db_xref="GeneID:5654825"
     CDS             323345..324034
                     /locus_tag="LMJF_34_0700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686161.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654825"
                     /db_xref="InterPro:IPR019351"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3D7"
                     /translation="MWRTWHVSFFPHSFLFFTLRMKRVIKNGTPGPRQAYMNKTKYNP
                     NRYKQEKDCISRQTEFVMASLCCRRCCEIIQWKVDYGKYTSQEQSRRCNLCRDNKVIH
                     AYHRICQQCAEREAVCAKCQKHPAASAASTKADVPNTDSDQESSEGRVEHFEKLREPS
                     KYAFVDIAPDEEELQRLTGLNTRVLQQKLRKRREAENRESLGSLRERERRTALRKATT
                     QTDASDSDENL"
     gene            <324401..>324883
                     /locus_tag="LMJF_34_0705"
                     /db_xref="GeneID:5654826"
     mRNA            <324401..>324883
                     /locus_tag="LMJF_34_0705"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686110.1"
                     /db_xref="GeneID:5654826"
     CDS             324401..324883
                     /locus_tag="LMJF_34_0705"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686162.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0705"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0705"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654826"
                     /db_xref="InterPro:IPR019184"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3D6"
                     /translation="MPASGGTTGGASFPFHLQLLTSIGWAAIWWIVTLGLLIFKALHL
                     PFPPAALPMEVVASFLVLLVNAFGVLIGMRGNKMESTSAIVISAVLLSIAAVGAIYYM
                     WLQTYVLMMDLAFSATYLGINGVAILLGFWATQSVARLARVPGFKLEVESVRGEKKKN
                     "
     gene            <325410..>327719
                     /locus_tag="LMJF_34_0710"
                     /db_xref="GeneID:5654827"
     mRNA            <325410..>327719
                     /locus_tag="LMJF_34_0710"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686111.1"
                     /db_xref="GeneID:5654827"
     CDS             325410..327719
                     /locus_tag="LMJF_34_0710"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686163.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654827"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3D5"
                     /translation="MGSVLQTFEDGLELTSILPAIKYPLGTHTISKLSAHLEASAGEV
                     SAKELRQLASSISLSPENLEYYDAALSTPSVVAAIRCCLQLADNSELVAFARPFWRGC
                     ERALQVSRGLSSQVTQIAADELAFRLSTSSNKATFFDLTLMESLPLEQKEMEGLVKQL
                     QSATEELKEADLLGLLKRIAAPRNPQRYAAWGAAVQKALIEKDGVNDSNCFDVFVRLM
                     LTGTIIEDSICRQMCKASGYLGPERTAELLNARRDSDSASCSSSSSLEDVEAALQRCI
                     RTRLEQSQSETPTDEYMEWVLCLSFFSREEASSLLSRAVTSGRLAGELSAKETAIVCN
                     VMISTGVVLISLLPAIRRSVEKNELSQLTSVHALYILQRSGIKAPPALLKKAIGRAGA
                     RLVTACAPKGNADDELSPRDRALLIAGLCFVEDEQQTVLLRRIVKSQELSLSAAMYFL
                     RHAGQTTSSNRWVRKVVLGRVLRSVSSCHAEDLCLVLSALSDLGVRDAVAFQRVLEEL
                     KRKTPRTLDVVAAAKAARNLRLTPLLEQSELIESLGHIANVSSDDILALLSCSTAKQR
                     QSLLLFPDVVAALNRISLADSTTSDLILLFTFLPSRGGKRAEVVVELQAREPIERGAL
                     SAGDVIAAFESVASSQEMESLGRVLIRAAQNCEESHLMRLLRCASRYSKVPKAFFRIA
                     GKPIISAANEKRLSLVNATAWLNFYVDNQIRDDSVGRSLLSLLSSSQSRSPSPFHQAY
                     CRGARFYGVSVKKSRTKKRLSDFSLLTPQ"
     gene            <328241..>329698
                     /locus_tag="LMJF_34_0720"
                     /db_xref="GeneID:5654828"
     mRNA            <328241..>329698
                     /locus_tag="LMJF_34_0720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686112.1"
                     /db_xref="GeneID:5654828"
     CDS             328241..329698
                     /locus_tag="LMJF_34_0720"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686164.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654828"
                     /db_xref="GOA:Q4Q3D4"
                     /db_xref="InterPro:IPR019832"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3D4"
                     /translation="MRPEAAAAELRRLLPLLSFAGRRTGAATHSVASLIVSTAYSATA
                     ARSVTNHSRDCPVLSKKLPLPLIGKESSFAARPCLNCVRERVHYVSSLSFCDYFEKKC
                     AEAQHYRNGASSNGVVGTAALPKLLLEAIERSYGSVAAFKDSVMLHSTGAMSPGRLWI
                     VYTPPISGSEHGAVRLLNLPACKVPLVHGLWPLAVINMTEKRLCEQIACRSGKGGDAV
                     DADDAPAWRHAARTRKTLGALATTEEGNDRAGNVAQVKLSSIQSAIAEEALCAMNWKF
                     VETQLTSALAYYSSKERTQTQREHRKEKEHVAAVRAMSQLKNSGAVIHATDSVTITSS
                     NSFVASSASEPNLSAAAAVTSSSAKAENSALGEANTQTAAVAAPSAEATAANTASNSA
                     QPADNTATGAAAAEPRAVQQADGTWEYHYNNGSVTKALPDGTKVFQTESLTTTVFVNG
                     DTLFEYPNNTSILDRADGVRVITYADGTKKEERLK"
     gene            <331338..>331970
                     /locus_tag="LMJF_34_0730"
                     /db_xref="GeneID:5654829"
     mRNA            <331338..>331970
                     /locus_tag="LMJF_34_0730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686113.1"
                     /db_xref="GeneID:5654829"
     CDS             331338..331970
                     /locus_tag="LMJF_34_0730"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686165.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654829"
                     /db_xref="GOA:Q4Q3D3"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3D3"
                     /translation="MRFALEYVEREASRSKRATALAALNYGYKKANDARQPGGCPVAL
                     ATIVDNTHASLLNLGDCGLVILRQGKLLYRTEIQQHSFNCPYQLPEDPPSAGEQAKIE
                     VRAGDIFLCVSDGVLDNVELDRLLEHLGEVPATGCRNVAETIGQEAFRNGQDRRYFSP
                     FARHAEEAGYRYTGGKLDDITALVAQVTADSEEGTANCPPLITMLLNLDK"
     gene            <333024..>334430
                     /locus_tag="LMJF_34_0740"
                     /db_xref="GeneID:5654830"
     mRNA            <333024..>334430
                     /locus_tag="LMJF_34_0740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686114.1"
                     /db_xref="GeneID:5654830"
     CDS             333024..334430
                     /locus_tag="LMJF_34_0740"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686166.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654830"
                     /db_xref="GOA:Q4Q3D2"
                     /db_xref="InterPro:IPR005612"
                     /db_xref="InterPro:IPR027193"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3D2"
                     /translation="MEAKLSSALRTCDKCRTYADLCRTFEAKVSPIVEQALQSPLVKA
                     PRDHTTPDECSPRVAELREALCTRLGADKATPAEDDVWFLIYRTVSNFVERQQRKRSR
                     DQDGTSLSTLVTNCFVLLCTRTLPQLDHMKLRWGFLKKERAALESSDAYVHSNASERR
                     KLQLNATSVLSVFSERAHKHSFTFVWMLCVEKAGEAALHVHLLHRVGSVVLPYLTNPL
                     VLADYLTGCFSSGGIISILSLQGLFLLMLDHGLEYPNYYEQLYSLLTPDVFASRYRYE
                     LFRLLDLSMTSLRVPSYIAASVIKRVAQVSLMAPAPTLYFSLPFLRKVLQSHPNCLAL
                     IHRSSREAVIPDDMADQDTDTVTAQSAKAQAMRDTAALFDGRDPFDDRAKLLETHALS
                     STLWELTALERHFMPVVPLMVSAFSSTAEDKTPLRYEKSYGRLFTAEVTRAIDCHNLP
                     TIAYEAPSEADPTDLLSL"
     gene            <335603..>337012
                     /locus_tag="LMJF_34_0750"
                     /db_xref="GeneID:5654831"
     mRNA            <335603..>337012
                     /locus_tag="LMJF_34_0750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686115.1"
                     /db_xref="GeneID:5654831"
     CDS             335603..337012
                     /locus_tag="LMJF_34_0750"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686167.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654831"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3D1"
                     /translation="MQPPAWIEQLRQDAKTTEKSVSYDIKVYDELSWRRKRFTFDKEL
                     WDPMRMSSILRNRLCLGNEDTEYTVIGEAFVFPDREDSPIVNEPQRACTLLWDHNSPT
                     EKVMIQLSEHFPPLLWHTVKPTLEALKKVFSEFLDVDAEHMKKYLPYYEEVQNRIETQ
                     MDEKLIGTLSPSHMKNKFIEDMRKRDPRSVELDYPNEHSIFLGLTPHFRVTEDQLMKK
                     NPFVFGWPMLLSDGNEYLEDTPLRMAAFRTVYSKSLLMFHTRLDLQVDHRQSHLPGDD
                     VDDILLEMPIFCTINYPTNTRLCGGRPLAQRFNQVMGTSYPLDMPVDVLATFARENTV
                     KGERELLEELKFLTAASQKAPELERVFRVSEDQLSSNKIIGQLAYTIVYLALVNYPKF
                     AEDIFKVYWKHPSDLVRVACAKGAHIVERQDLVEQLIQAEPEGRCKTMLTATMHLSTH
                     THPAKVAYSERKRIERSLQ"
     gene            <339150..>340562
                     /locus_tag="LMJF_34_0760"
                     /db_xref="GeneID:5654832"
     mRNA            <339150..>340562
                     /locus_tag="LMJF_34_0760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686116.1"
                     /db_xref="GeneID:5654832"
     CDS             339150..340562
                     /locus_tag="LMJF_34_0760"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686168.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654832"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3D0"
                     /translation="MSQLERPHTPYDWGTGVRVRVQRACQAPYFSVFREENTRQADTV
                     YEGRLGRAGAGTYPAIQDDGLRLLYFPYRNAAPVHCTTAEASGVASETVTLVGATGTM
                     GKFVAEQYLRRGVSVTVLARDIAKAKSLFLPIADGQREQNRLASMGYRQLSSAAEKRE
                     MTASLHYRDFRRGDRHVLRYEFRNPRSVGGPSAGSANASCDQRFALELVEGDVGSTQD
                     LEFSMRHASIVFYLTAALEEASGPALRADDRLRSSAAWWSLGSWFCGGRRFGGFLHAL
                     DACRRVDAHFVALTPLWVHGSCLSPFYWYRRLLTHPRGYCKAVQLQEQTLLSQSGSPG
                     ARCSLGADELEARQPGGDWGCWWRSRLSTEPPDDILIKSRSPVRFSLFRLSDVVFPSF
                     NERIVASKNNRVDDDLHVTFIQQGDLDARLLANVLVKSIGLCNSVVESRIDIGGSLRG
                     GTDMRDANAIFDLFEQLRNE"
     gene            <341514..>342152
                     /locus_tag="LMJF_34_0770"
                     /db_xref="GeneID:5654833"
     mRNA            <341514..>342152
                     /locus_tag="LMJF_34_0770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686117.1"
                     /db_xref="GeneID:5654833"
     CDS             341514..342152
                     /locus_tag="LMJF_34_0770"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686169.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654833"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3C9"
                     /translation="MSFLTSRRLNRYDDEANNAAYMEHEPFHVLPRERSTTGNSSLSN
                     SSTYSSHRTAGDGSGKCDLLSMQHVMSMTESLQKEQEDREAREKVDKASEAERMRQAR
                     NAQWEAVKKRMSQRAMPLYTVRAYESEDDEEEVELKSVHTALNALVPSLTEERATQRG
                     GFQAAETMPERFCHFVYNWLMYFVYAFSASALPGMDASKGADSREYFDRRVR"
     gene            <346433..>347329
                     /locus_tag="LMJF_34_0780"
                     /db_xref="GeneID:5654834"
     mRNA            <346433..>347329
                     /locus_tag="LMJF_34_0780"
                     /product="putative serine/threonine-protein phosphatase
                     PP1"
                     /transcript_id="XM_001686118.1"
                     /db_xref="GeneID:5654834"
     CDS             346433..347329
                     /locus_tag="LMJF_34_0780"
                     /EC_number="3.1.3.16"
                     /codon_start=1
                     /product="putative serine/threonine-protein phosphatase
                     PP1"
                     /protein_id="XP_001686170.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654834"
                     /db_xref="GOA:Q4Q3C8"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3C8"
                     /translation="MSSVSTAPQLIERLIMVQRNRAPPQLLVREEEIRAVLTEVREIF
                     MSQPMLLEIRPPVRVCGDTHGQYYDLLRIYEKCGFPPYSNYLFLGDYVDRGKQSVETI
                     VLQFCYKIVYPENFFLLRGNHECASVNRMYGFFDDVKRRYNIKLFKAFTDVFNTMPVC
                     CVISEKIICMHGGLSPDLTSVASVMDIERPCDVPDRGILCDLLWADPEDDVQGFLESD
                     RGVSYLFGEDIVNDFLDMVDMDLIVRAHQVMERGYGFFASRQLVTVFSAPNYCGEFDN
                     DAAVMNIDDKLQCSFLIIPAFR"
     gene            <351687..>352601
                     /locus_tag="LMJF_34_0790"
                     /db_xref="GeneID:5654835"
     mRNA            <351687..>352601
                     /locus_tag="LMJF_34_0790"
                     /product="putative serine/threonine-protein phosphatase
                     PP1"
                     /transcript_id="XM_001686119.1"
                     /db_xref="GeneID:5654835"
     CDS             351687..352601
                     /locus_tag="LMJF_34_0790"
                     /EC_number="3.1.3.16"
                     /codon_start=1
                     /product="putative serine/threonine-protein phosphatase
                     PP1"
                     /protein_id="XP_001686171.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654835"
                     /db_xref="GOA:Q4Q3C7"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3C7"
                     /translation="MASSTSPSSSAVPQTLIEKLLTVRGASTQRQVLIKEEDIRVVLE
                     NVREIFMSQPMLLEIRPPVRVCGDTHGQYYDLLRIYEKCGFPPYSNYLFLGDYVDRGK
                     QSVETIVLQFCYKIVYPENFFLLRGNHECASINKMYGFFDDVKRRYNIKLFKAFTDVF
                     NTMPVCCVISEKIICMHGGLSPDLTDLTAINEILRPCDVPDRGILCDLLWADPENEVR
                     GFLESDRGVSYLFGEDIVNDFLDMVDMDLIVRAHQVVQRGYEFFASRQLVTVFSAPNY
                     CGEFDNDAAVMTIDDKLQCSFLIIPAAK"
     gene            <355930..>356832
                     /locus_tag="LMJF_34_0800"
                     /db_xref="GeneID:5654836"
     mRNA            <355930..>356832
                     /locus_tag="LMJF_34_0800"
                     /product="putative serine/threonine-protein phosphatase
                     PP1"
                     /transcript_id="XM_001686120.1"
                     /db_xref="GeneID:5654836"
     CDS             355930..356832
                     /locus_tag="LMJF_34_0800"
                     /EC_number="3.1.3.16"
                     /codon_start=1
                     /product="putative serine/threonine-protein phosphatase
                     PP1"
                     /protein_id="XP_001686172.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654836"
                     /db_xref="GOA:Q4Q3C6"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3C6"
                     /translation="MSESVFPLVQSIVEKMLTGGDNRFQRQILIKEEEIRAVLRAVRE
                     VFMSQPMLLEIRPPVRVCGDTHGQYYDLLRIYEKCGFPPYSNYLFLGDYVDRGKQSVE
                     TIVLQFCYKIVYPENFFLLRGNHECASINKMYGFFDDVKRRYNIKLFKAFTDVFNTMP
                     VCCVISEKIICMHGGLSPDLTSVASVMDIERPCDVPDRGILCDLLWADPEDDVQGFLE
                     SDRGVSYLFGEDIVNDFLDMVDMDLIVRAHQVMERGYGFFASRQLVTVFSAPNYCGEF
                     DNDAAVMNIDDKLQCSFLIIPASR"
     gene            <360080..>360985
                     /locus_tag="LMJF_34_0810"
                     /db_xref="GeneID:5654837"
     mRNA            <360080..>360985
                     /locus_tag="LMJF_34_0810"
                     /product="putative serine/threonine-protein phosphatase
                     PP1"
                     /transcript_id="XM_001686121.1"
                     /db_xref="GeneID:5654837"
     CDS             360080..360985
                     /locus_tag="LMJF_34_0810"
                     /EC_number="3.1.3.16"
                     /codon_start=1
                     /product="putative serine/threonine-protein phosphatase
                     PP1"
                     /protein_id="XP_001686173.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654837"
                     /db_xref="GOA:Q4Q3C5"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3C5"
                     /translation="MSNAAILPMVQTLIEKMLTVKGNRMQRQILIKEEEIRAVLTEVR
                     EIFMSQPMLLEIRPPVRVCGDTHGQYYDLLRIFEKCGFPPYSNYLFLGDYVDRGKHSV
                     ENIILLYCYKIVYRENFFLLRGNHECASINKMYGFFDDVKRRYNIKLFKAFTDVFNTM
                     PVCCVISEKIICMHGGLSPDLTSVASVMDIERPCDVPDRGILCDLLWADPEDDVQGFL
                     ESDRGVSYLFGEDIVNDFLDMVDMDLIVRAHQVMERGYGFFASRQLVTVFSAPNYCGE
                     FDNDAAVMTIDDKLQCSFLIIPASK"
     gene            <366608..>366985
                     /locus_tag="LMJF_34_0815"
                     /db_xref="GeneID:5654838"
     mRNA            <366608..>366985
                     /locus_tag="LMJF_34_0815"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686122.1"
                     /db_xref="GeneID:5654838"
     CDS             366608..366985
                     /locus_tag="LMJF_34_0815"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686174.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0815"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0815"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654838"
                     /db_xref="InterPro:IPR015419"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3C4"
                     /translation="MPAQPTASSSSTTREKRSGSHKKNDLSIECSLRLPLPDTASASV
                     LWRVLKTDPSLAGTVKEVYWWSEDPSQRTVAVTIQASSKRDLRSAVGSLLDQAKLVVR
                     TLRVYPPTTAATTTAADPGLSTV"
     gene            <367763..>368476
                     /gene="eEF1B beta 1"
                     /locus_tag="LMJF_34_0820"
                     /db_xref="GeneID:5654839"
     mRNA            <367763..>368476
                     /gene="eEF1B beta 1"
                     /locus_tag="LMJF_34_0820"
                     /product="elongation factor 1-beta"
                     /transcript_id="XM_001686123.1"
                     /db_xref="GeneID:5654839"
     CDS             367763..368476
                     /gene="eEF1B beta 1"
                     /locus_tag="LMJF_34_0820"
                     /codon_start=1
                     /product="elongation factor 1-beta"
                     /protein_id="XP_001686175.1"
                     /db_xref="GeneID:5654839"
                     /db_xref="GOA:Q4Q3C1"
                     /db_xref="InterPro:IPR001326"
                     /db_xref="InterPro:IPR014038"
                     /db_xref="InterPro:IPR014717"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3C1"
                     /translation="MSLKDVSKKAAELESKLSGKLFLGGAKPTAEDVKAFNDLLGANH
                     VNLYRWAKNMATYAEGERKAWGAPVRVAAPELRMPAPAAKAAGSDAAAEKRAAPKAAA
                     VAPPPAAAAEEEDDIDLFGETTEEEKAALEAKKAKDAEKKKAKKEVIAKSSILFDIKA
                     WDDTIDLEALAQKLHAIQRDGLIWGDHKLVPVAFGVKKLQQLIVIEDDKVSGDDLEEM
                     IMGFEEEVQSMDIVAWNKI"
     gene            <370637..>370870
                     /locus_tag="LMJF_34_0830"
                     /db_xref="GeneID:5654840"
     mRNA            <370637..>370870
                     /locus_tag="LMJF_34_0830"
                     /product="putative 25 Kd elongation factor 1-beta"
                     /transcript_id="XM_001686124.1"
                     /db_xref="GeneID:5654840"
     CDS             370637..370870
                     /locus_tag="LMJF_34_0830"
                     /codon_start=1
                     /product="putative 25 Kd elongation factor 1-beta"
                     /protein_id="XP_001686176.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654840"
                     /db_xref="GOA:Q4Q3C2"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3C2"
                     /translation="MPPANVKDIKQARAAADELEKVLAGHLFLGGAKPAKEDVDKFYD
                     MFGEHNIAFYRWVRNMASFTESERKSWGLPETQ"
     gene            <374108..>374821
                     /gene="eEF1B beta 2"
                     /locus_tag="LMJF_34_0840"
                     /db_xref="GeneID:5654841"
     mRNA            <374108..>374821
                     /gene="eEF1B beta 2"
                     /locus_tag="LMJF_34_0840"
                     /product="putative translation elongation factor 1-beta"
                     /transcript_id="XM_001686125.1"
                     /db_xref="GeneID:5654841"
     CDS             374108..374821
                     /gene="eEF1B beta 2"
                     /locus_tag="LMJF_34_0840"
                     /codon_start=1
                     /product="putative translation elongation factor 1-beta"
                     /protein_id="XP_001686177.1"
                     /db_xref="GeneID:5654841"
                     /db_xref="GOA:Q4Q3C1"
                     /db_xref="InterPro:IPR001326"
                     /db_xref="InterPro:IPR014038"
                     /db_xref="InterPro:IPR014717"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3C1"
                     /translation="MSLKDVSKKAAELESKLSGKLFLGGAKPTAEDVKAFNDLLGANH
                     VNLYRWAKNMATYAEGERKAWGAPVRVAAPELRMPAPAAKAAGSDAAAEKRAAPKAAA
                     VAPPPAAAAEEEDDIDLFGETTEEEKAALEAKKAKDAEKKKAKKEVIAKSSILFDIKA
                     WDDTIDLEALAQKLHAIQRDGLIWGDHKLVPVAFGVKKLQQLIVIEDDKVSGDDLEEM
                     IMGFEEEVQSMDIVAWNKI"
     gene            <377895..>378785
                     /locus_tag="LMJF_34_0850"
                     /db_xref="GeneID:5654842"
     mRNA            <377895..>378785
                     /locus_tag="LMJF_34_0850"
                     /product="putative serine/threonine-protein phosphatase
                     PP1"
                     /transcript_id="XM_001686126.1"
                     /db_xref="GeneID:5654842"
     CDS             377895..378785
                     /locus_tag="LMJF_34_0850"
                     /EC_number="3.1.3.16"
                     /codon_start=1
                     /product="putative serine/threonine-protein phosphatase
                     PP1"
                     /protein_id="XP_001686178.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654842"
                     /db_xref="GOA:Q4Q3C0"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3C0"
                     /translation="MTPEDASIYTLVTSILAEWRSGVTLLKEDIIRLILRRVRPILMS
                     QPMLVRTEAPINVCGDIHGQITDLVEIFKAGGLPPHSRYLFLGDYVDRGKYGTEVITV
                     LLGLKVLYPKRIYVLRGNHETDSICRIYGFFDEVKRRFNVRLFKEFTDVFNCLPVAAL
                     VEEIALCMHGGLSPELRHLRQIEQIYRPLVVPDEGLACDLLWSDPEEGSSGWQPSERG
                     VSFTFGEDVVKRMCDSLGIDIVLRAHQVVDEGYSFFAGRRLVTIFSASNYCGEFTNSG
                     AMMLMDENCMCSFQIFKPEY"
     gene            <380419..>381087
                     /locus_tag="LMJF_34_0860"
                     /db_xref="GeneID:5654843"
     mRNA            <380419..>381087
                     /locus_tag="LMJF_34_0860"
                     /product="putative 60S ribosomal protein L13a"
                     /transcript_id="XM_001686127.1"
                     /db_xref="GeneID:5654843"
     CDS             380419..381087
                     /locus_tag="LMJF_34_0860"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L13a"
                     /protein_id="XP_001686179.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654843"
                     /db_xref="GOA:Q4Q3B9"
                     /db_xref="InterPro:IPR005755"
                     /db_xref="InterPro:IPR005822"
                     /db_xref="InterPro:IPR023564"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3B9"
                     /translation="MAFPSRKDACRAQRKSAKKHRPEIIVIDLKDHVLGRAAAVVAKQ
                     LLLGKKITVVRCEQLNIAGTEIRNKIKYLQYLRKRKLTNPTKGPFHHRAPSDVFVRTV
                     RSMLPRYTKRGMKALNSLVAYEGIPPNVVRTGGRVVIPRAQRHVCYRSERPYTVLGNM
                     CKHVGWKYSDVVANLEKARVEKASRHHEKQAKLRDAWKSARKEALAKMPKHNVEVLKK
                     FGYA"
     gene            <382017..>383705
                     /locus_tag="LMJF_34_0870"
                     /db_xref="GeneID:5654844"
     mRNA            <382017..>383705
                     /locus_tag="LMJF_34_0870"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686128.1"
                     /db_xref="GeneID:5654844"
     CDS             382017..383705
                     /locus_tag="LMJF_34_0870"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686180.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654844"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3B8"
                     /translation="MHRIIIIFHGSAVQLQRMPKEPQPSRPYVVPLSAPYAKPSGSLV
                     PTASSSTAATAVARAAAANAAGGGAAPAAGGHRLARLTINNFSSFRARVKKLPPDANV
                     KAALHTQLFQFPERVCFGCVKCRRDNVESDSVAIDLKNRIMLCAACFTRIIRPRTYTP
                     SRVVPFPSLLSWLNYKPSHVMEMPDDVLERPAEAVAPSGERMATPMLAGGDRATNLGK
                     LPAIAMNIAAGDRSRGGDAAGGRRGGPTIDEALAQGSASTPAGTHPCLRVWGVCQHGE
                     TCLFRNAPADLCVAYLMGLCRGRSSPIGGAPVGGGGGGGRPNANRNNNRHGHGGQHQQ
                     HHKHSYYHSQGGRNARRDRGAITAGGVQTCRLLHQDVYDLPDVSDPPPRERFEGDLED
                     KDGAWAAWVCRRRDSPNSAEWQLWHNGPLEQLFRAYVPARRRPVLRQPKKKLEVAPAA
                     EASTAVAELAEEEGERNEGEEGAQTAEDELTTPLADEEDVMNDEEDGEEEGDGDADAN
                     DDTVSEGVAGKEAEDEPAPAPVPAPTTKLNLIDIMAALKGIKKDPPEKADDAEK"
     gene            <385018..>387795
                     /locus_tag="LMJF_34_0880"
                     /db_xref="GeneID:5654845"
     mRNA            <385018..>387795
                     /locus_tag="LMJF_34_0880"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686129.1"
                     /db_xref="GeneID:5654845"
     CDS             385018..387795
                     /locus_tag="LMJF_34_0880"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686181.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654845"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3B7"
                     /translation="MMPPLVRIADAEPTSSRSSCPASYGAREDIGDGGKAVISGAVSP
                     ALARELSLLSNDDLIQRIHRFSRSNFVPAQRPLLYAHLKEFMKPQRLAYASTKTVQDH
                     LQVANAADMHETCIELYHAAREHMSAAALMLRTPCAPLTNGSATGVGQPDAGGHVGLS
                     TASGSGTNLAADGAVLVSAFVVDSAYATQRTSELTRLASYCVTQLLAPLHAEGHDATT
                     GDASPATPKVLRSLAVRTPREVATELSLVRCLWRALCLAEYYKCAEATSTQAVKGCKE
                     QALADALAILDACRQVASVRREAAVAVLAAVANGHSSSSTTTPALSERQSSELLAEAL
                     NFVRYASLDDDGEFAFYQFCKEEGILWSPQPLSWSVRRETSDAASSLSSAAGVGRANT
                     FAHSEDEVQVFYAALIDTCAAGRLVPEALLYFTEARRLLGCPPLVDGEDIGAETVLLL
                     GAEGGRGPRVSSVAAATTLKTSLEAVDAVPRALPPAASAATAESSDPGMSAPLSPLSH
                     PATVSSGAHGGKLGFSTATAGFALTELLLHRLLSVLQAAKKNHHVVRLARALIAAGAV
                     SQIKAHMWTVLLISAGAVRAADVVLAVYGYALERLASPAGSEGSSGRGYTTAEVCTLE
                     YLLQTSLNALSKCQLPRYEQDYLQPARDAQVLHCTDEFYYSCLLQEAHNSMCPAQRAA
                     EVLARMEEAKVPMTTPIVSRLLKLYLRVEAPEFIRVYRHAVDDLGLPLRSVWADQLLL
                     WADRRRYFLSADDREYVVQQLLRSRRVATVADLQPLLGGLRTHFALLYYDHTHAAREQ
                     FLRDGSVPVEQPTVTDSRAHFLMTRPMSVQRGVMARAGTSWVCNGVGGEELVEEETRR
                     HGILPRMLGDAPRRTLHAGIAELSETPLLFPIADGTAGAGDSERLHDRALRVYLADVL
                     DGLQRSSNWVI"
     gene            <389013..>389492
                     /locus_tag="LMJF_34_0890"
                     /db_xref="GeneID:5654846"
     mRNA            <389013..>389492
                     /locus_tag="LMJF_34_0890"
                     /product="putative DNA-directed RNA polymerase subunit"
                     /transcript_id="XM_001686130.1"
                     /db_xref="GeneID:5654846"
     CDS             389013..389492
                     /locus_tag="LMJF_34_0890"
                     /EC_number="2.7.7.6"
                     /codon_start=1
                     /product="putative DNA-directed RNA polymerase subunit"
                     /protein_id="XP_001686182.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654846"
                     /db_xref="GOA:Q4Q3B6"
                     /db_xref="InterPro:IPR006110"
                     /db_xref="InterPro:IPR006111"
                     /db_xref="InterPro:IPR012293"
                     /db_xref="InterPro:IPR020708"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3B6"
                     /translation="MSDHDDEDDLLSLNLGDDRDEGDSGSDIRHSGADEEDEEGGEQL
                     PEDVAANVILSGNAQAAKGARARGINERVTSAVMTKYERARVLGTRALQISMNAPVAV
                     ALEGETDPLTIAVKELRERRTPLIIRRVLPDNTYEDWSVSELLVDFDRPADERYTNI"
     gene            <394068..>394937
                     /locus_tag="LMJF_34_0900"
                     /db_xref="GeneID:5654847"
     mRNA            <394068..>394937
                     /locus_tag="LMJF_34_0900"
                     /product="putative ubiquitin-conjugating enzyme e2"
                     /transcript_id="XM_001686131.1"
                     /db_xref="GeneID:5654847"
     CDS             394068..394937
                     /locus_tag="LMJF_34_0900"
                     /EC_number="6.3.2.19"
                     /codon_start=1
                     /product="putative ubiquitin-conjugating enzyme e2"
                     /protein_id="XP_001686183.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654847"
                     /db_xref="GOA:Q4Q3B5"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3B5"
                     /translation="MTAPTVQCLKRLQIELRKLNMEWELPFKVGADPQNMLRCYFVMD
                     GPADTPYEGGRYVGLIEIPSDYPFKPPSVQMCTPSGRLKTGMQICLSNSSYHPENWSP
                     MWGLRTILIALVSFFVSEEPTTGSMSATAEERRRYAANSRKYNVKRLHAVYKRVLPEA
                     FAADTAFIENGGTSPKDEGSSGSSASDEDATEAEAAPAGAEPEVAAQEPSTSHETVAA
                     PARKTPGSGKAGAADTEAATGAAASKRSRHHQHKKSSTGAVAQRGGQLQWRRYASLIV
                     LIAIGLGLLRQLM"
     gene            <395848..>396351
                     /locus_tag="LMJF_34_0910"
                     /db_xref="GeneID:5654848"
     mRNA            <395848..>396351
                     /locus_tag="LMJF_34_0910"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686132.1"
                     /db_xref="GeneID:5654848"
     CDS             395848..396351
                     /locus_tag="LMJF_34_0910"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686184.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654848"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3B4"
                     /translation="MILLVPMQFAYTFGSSCVWIHPLPFLCSLPPSLTTEEESVIGKN
                     EKMMRRVCSNTVRRNGGSMAKLVESKAVVQPSLLESRRHLEPMSVWYLASWTCVWWYS
                     FFFWLPVLWADMIVPSFVYNKLPVIHFIQEKRAEQKLRRVLDETYTQWSTELEASHIT
                     DAIARTF"
     gene            <398339..>400417
                     /locus_tag="LMJF_34_0920"
                     /db_xref="GeneID:5654849"
     mRNA            <398339..>400417
                     /locus_tag="LMJF_34_0920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686133.1"
                     /db_xref="GeneID:5654849"
     CDS             398339..400417
                     /locus_tag="LMJF_34_0920"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686185.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654849"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3B3"
                     /translation="MASFNSLGSGAGDSAEAVTRLQEVLRDICATERRQEKTWLNVQP
                     CVLNAVKLLATTAQVYAERVRQLEDVLQRLQQYTTVLVRDREVKEERYRLDAAAHREE
                     ADELWKRLLRLEAQQQEPSLQIDQRASEAFKASCKVAVEARVAPLQQELQGLRHRLKA
                     LTLSRPYSSHYNRHVRSSSVASNSSALTMRDHYYAGSDGVAASQHHHHSAASSSSTSS
                     LLSLASSTASSLDRHEQYPRRGRIETTSAPAFTPRALASATAAASPSTQRMMREVQRL
                     RRQWQHFLQSVPAALAQGKGSCRAGLRRRDISGSPSRRLSRLTSKGGRRDLTGGLSDV
                     TRANGEGMESIRGSSPQPFYVPAHHPPSSSPTDAVLPKYSSGPTRARSGARATESSTA
                     LPASGRRVRWYWLGDAHSHFSTAVRRAENDFAAAKPLSERPQPALSGVSPALPWTECH
                     AFDGRTDCWYSLGTWPTHRRHLREVERAVEEGASRNSGDVSLGWLKWTLSLVSWPDTS
                     TMLVHRAGIYMVRVCLVRHCASASLCSGAGRAESAGHDCGSGGALALCMNGVAVAGLR
                     EVVTHALLYTHPATSPADSAAPWWVTRGRSRSTCAYAGNYCSAVDGAAHSPACASPGG
                     SPSRRRFHRDIADATQRQRPCCEPAQLHTNTLTACLFLPAGATLQVRCRGLHNTKTIH
                     EAFCELEYVV"
     gene            <401463..>401786
                     /locus_tag="LMJF_34_0930"
                     /db_xref="GeneID:5654850"
     mRNA            <401463..>401786
                     /locus_tag="LMJF_34_0930"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686134.1"
                     /db_xref="GeneID:5654850"
     CDS             401463..401786
                     /locus_tag="LMJF_34_0930"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686186.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654850"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3B2"
                     /translation="MGQSNGAALAKDTIASEQFLKYQEARHRIVHRAFVKCVVPSSKG
                     KDDGYDLTPEERVCVEEFAILYAGFAKKEFLHFSSLYEQYQRDQYEKMRLEVMQQQAR
                     KDIQH"
     gene            <403381..>406386
                     /locus_tag="LMJF_34_0940"
                     /db_xref="GeneID:5654851"
     mRNA            <403381..>406386
                     /locus_tag="LMJF_34_0940"
                     /product="putative serine/threonine-protein kinase"
                     /transcript_id="XM_001686135.1"
                     /db_xref="GeneID:5654851"
     CDS             403381..406386
                     /locus_tag="LMJF_34_0940"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative serine/threonine-protein kinase"
                     /protein_id="XP_001686187.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654851"
                     /db_xref="GOA:Q4Q3B1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3B1"
                     /translation="MRAKIDDENSSVAVTLLPSAQVELLASSQPPTRTGAVGTMVNTD
                     VADASGNDPGSSGGGSAPSSMATTTTTNTVFYNPSAQLPAPPPLHRNSSSPAPMQHPQ
                     HEEPQRLRAVPYFPASCESDSNEEPLFQHPPPATPRAPLRQVPLSGRLWGAASATPSS
                     AGFVSGGTAPYASLLHTSVTPTVPDTETSSTTTGHGLVVGCETSNRCLPASIKAHPPA
                     SATSPASIHGGYSDSGSDSMAMTTVGNHSSGGRGLRRLPLMTGPNGAAVPLASPMLSG
                     PQGRWVRSSGEERSSGFATPAVPAASANLGDTVLVAEPPTPTKQRRTIHTGMGSTGSL
                     PRGGIGAAPRLSTSAAASTGTCASAAAATSAAAVVGGVSPKPSLRIAAPLRGLGHSPA
                     ASSASVSASRATTSSMSTVPPPQSFKCYRREGSRKRSADVLSQFSALDLDETPATPFA
                     QTGTGRFTSIIHNGNGHNAFPSQPSPSTAVYRGAGGGSNAIGIVSPLVIDYATPVALS
                     QQIGGSNTFSQVLLHPSQDVLDMSQAETECSNFLARRILNEYNEVRLLGSGSFGTVSL
                     FKEISSGEYVAVKMSPPLRTPEMERRYRRERSVMGMVRGLPHVVQLSAAWEEGRVPRM
                     YLQLEYCPGGSVASVASARQSRNEPWAEAEVKVFLAHMSIALDALHRANIAHVDFKPD
                     NVLVDKDGAYKLSDFGCSVLLDERGRPRPETRNGYGSPVRGQRAGGVGGIPCGNPNGG
                     PVVHTGAGAGGLGTSLDFNSWNEGNELSTMSIDEGDCRYLCADMLNEKQHFKAGDMFS
                     LGMSLFELMSGQPLPRNGDQFLALRRRVPVEVLRRRGYSADLVELVVALLRSDPPQRP
                     TARQVLQYLRPSSEELQLLSSASAMQRWTESAESFCQLQEEERQQPPLGKDGVLAATV
                     DALRCVSALMEASMWLFTTTQQDVHRLAGPANAGKGEEEDEDERRRQQTQQPQPQPLL
                     QLPRGQQLEDLPLSLIQRDEACTPTALNY"
     gene            <408788..>411493
                     /locus_tag="LMJF_34_0950"
                     /db_xref="GeneID:5654852"
     mRNA            <408788..>411493
                     /locus_tag="LMJF_34_0950"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686136.1"
                     /db_xref="GeneID:5654852"
     CDS             408788..411493
                     /locus_tag="LMJF_34_0950"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686188.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654852"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3B0"
                     /translation="MLDSPPALYASQAPVSAGLQAEAAETMGSTPARHAMPFYPVLIE
                     VAGSMDDAIVRDVTQRLRRYRNRYQPLLRCMFTLVATTVPEARLFGDDSAAALEAQPH
                     PTTAAAGQLFTAPKNAVTVNKTYPLVSRFYPRQPVCAQQKSCSDNTAGVEPAMLPGAS
                     TGALQPCWVDDPATAVLSGVTTAAGYHDRAVRRLEDFMAYHFLPFAMTHNCSPVEAIS
                     ASAKAFVLRHYVNEASRTSSFLLADPFYTSASVPADAVAGAAIIDPRAEQLEAYAADL
                     SRFGVTLSCIIFTHCYVDGASGLAELIDSFPAARVVSGIPLEPAGTTEDVQLSPRLRL
                     RTVRVPAFSPECLLAEIYFCGVLKGLCTGVLWSTDAAPRCDLLQWSAFPRETGHVPTP
                     PSFSINGGSGDRDAALAHTHEMLKKYLFDAYFSPLCASVRGPSWPSGRAAKSARTDEA
                     LANQEEQMEEATPESEALVQVVLLPTHGGYNNVTSQLDLYWAAHLGDLTRMKHSRSVI
                     DALETTAEAFARYNRRLLPLPHPPSFDTSRVVHLRQLLALLRPEQRATCLAQLSADMQ
                     HALRYSFDPSAAHSAFGDPSNASRRQFASFSSYVNLVDVRDANDYHALHLCGAVNVPM
                     SFPSVAYGARRAELWLQCVIVPFQPIVALCATEEQRVEVSRRLSALSPESRVHVFTLA
                     DLSDALEFPAEHSTRGGQAATTELPWREVSCDVPTSVSVDVPLPRNLLWIQRDDALAN
                     LTSYEDLKAAEPTDTRVVLDVRTPYEFKNGSHQHSVHVGLAQLCAMMVEDAVEASRSL
                     SQWHCSCSRRLADAYVKSIHTAALMARLPVVRQEASLSDVVIYCAGGYRSLIALSLLQ
                     RAIEASATPAWRTLHISNVSGGAFQIMTQRPDLWQVKDRSVVCIS"
     gene            <415424..>416020
                     /locus_tag="LMJF_34_0960"
                     /db_xref="GeneID:5654853"
     mRNA            <415424..>416020
                     /locus_tag="LMJF_34_0960"
                     /product="putative amastin-like surface protein"
                     /transcript_id="XM_001686137.1"
                     /db_xref="GeneID:5654853"
     CDS             415424..416020
                     /locus_tag="LMJF_34_0960"
                     /codon_start=1
                     /product="putative amastin-like surface protein"
                     /protein_id="XP_001686189.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654853"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3A9"
                     /translation="MALRISIIVYVVLQFIAFFFVLVGTPLDMFRAAVEEFNFSHVCV
                     TLWGAKLGCYNSSYLVTSDELWVNCTARRDRFRAAQALAVISIFVYGAAFVLGVLLLC
                     CCSILRWVCLAVNIVGVFTLVVVWVAMVVTYYASENTYCPNLNLFFNYGAGFALFLVA
                     WCLDIINIFLLVIRGEDEKACANENPEFYTRGGQEEMK"
     gene            <420158..>420769
                     /locus_tag="LMJF_34_0970"
                     /db_xref="GeneID:5654854"
     mRNA            <420158..>420769
                     /locus_tag="LMJF_34_0970"
                     /product="amastin-like protein"
                     /transcript_id="XM_001686138.1"
                     /db_xref="GeneID:5654854"
     CDS             420158..420769
                     /locus_tag="LMJF_34_0970"
                     /codon_start=1
                     /product="amastin-like protein"
                     /protein_id="XP_001686190.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654854"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3A8"
                     /translation="MSHSFCRVGIAIYCLLQLIAFIFILVGTLIDQFRVQNVDALSND
                     PCLTIWGFKDKCISLKWSVRTKDLWKGCPQRLQRFNAAEALSIAAVLISALACLIGFV
                     MLCCCRCLRWLCLILNILATFCGCAVTALMTDAFYNNHEEGLQQYNNSCYALRQNGSV
                     IHPSAIADGNPVATHYKYGAGFAIYIVGWGLCFINIFFLMLPC"
     gene            <427279..>427860
                     /locus_tag="LMJF_34_0980"
                     /db_xref="GeneID:5654855"
     mRNA            <427279..>427860
                     /locus_tag="LMJF_34_0980"
                     /product="amastin-like protein"
                     /transcript_id="XM_001686139.1"
                     /db_xref="GeneID:5654855"
     CDS             427279..427860
                     /locus_tag="LMJF_34_0980"
                     /codon_start=1
                     /product="amastin-like protein"
                     /protein_id="XP_001686191.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654855"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3A7"
                     /translation="MGCISGIVFGVLQFVAILFVAVGTPLAMYMPLNDSVLHVYNGYC
                     VSLWGIRDRCLILLYSVSPNDVWSECHGRVGRFKIAQVCAIAGAVILAASLLGSFLDA
                     CCCCCIKWVCILLNLLAAALLAISWGCMLDCYLHNQGSHIVNNVDVCTQMRNFTGVDN
                     AHPEGMQLGVGFGLLVTACIVSFVNIFVMLIPC"
     gene            <437292..>441317
                     /gene="MDR1"
                     /locus_tag="LMJF_34_0990"
                     /db_xref="GeneID:5654856"
     mRNA            <437292..>441317
                     /gene="MDR1"
                     /locus_tag="LMJF_34_0990"
                     /product="p-glycoprotein"
                     /transcript_id="XM_001686140.1"
                     /db_xref="GeneID:5654856"
     CDS             437292..441317
                     /gene="MDR1"
                     /locus_tag="LMJF_34_0990"
                     /EC_number="3.6.3.44"
                     /codon_start=1
                     /product="p-glycoprotein"
                     /protein_id="XP_001686192.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.0990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.0990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654856"
                     /db_xref="GOA:Q4Q3A6"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3A6"
                     /translation="MPEGSERGASAKGGSVFEWEDRQGSFSPHQPIAEGLVERGDCCE
                     HNDYRYGPAPQSRELIDMSHTYDVYVDEGKLALVNKPADQSDSTHGGSGYDSRNPLFS
                     AEEEVKRAAVNESVSPIAIFRYADTTDRALMIIGTIFAICSGAGMPFFSFIFGRIAMD
                     LMSGVGSVELSAAKMSLIMVYVGIGMFVTCGGHVLCWTVTASRQEGRIRLNFFRAVLR
                     QDIGWHDEHSPGELTARMTGDTHVIQNGINDKLSQGIMNGAMGIIGYIAGFAFSWELT
                     LVMVGMMPFIIVMTAIIGNIVSKMTESSLKHFAKAGSLATEVMENIRTVQVFGREDYE
                     LQRFAEAVLHAQDRGIRKEFAGNLSAAVIMALVYLSYTIAFFFGSYLVEWGRRDMADI
                     ISTFLAVLMGSLGLGFVAPSVTAFTESRAAAYAIFKAIDRVPPVDIDADGVPVTGFEQ
                     SIEFRNVRFSYPTRPDMILFRDLNLTIRCGQKIAFSGSSGCGKSSMLGLIQRFYDPAG
                     GTVLCDGVDMRELCLRDWRDQIGIVSQEPNLFAGTMMENVRVGKPNATEEEVIEACRQ
                     ANVHDTIMSLPDQYNTPVGAVGSQLSGGQKQRIAIARALVKRPPILLLDEATSALDRK
                     SEMEVQRSLDRLMEKGGMTVIVIAHRLATIRNVDCIYYVKYDGAEGSKITESGTFDEL
                     MELGGEFAAMARIQGVSTGDVRSGARGQDCGKANDFLNVILDEAALAHLDEEAPRTAR
                     QKVPIEELAKWEVNDVNVGFRRLMGMNKDKSWAVALGILGSAVGGAARPTSSILMGYM
                     LRVLGEYSVNKNVEQLRSGTNLYAPLFILFSFATFLGWVLHGFYGYAGEHLTTKIRVL
                     LFRQIMRQDMNFFDIPGRDAGTLAGMLSGDCEAVHQLWGPSIGLKVQTVCIVASGVVV
                     SFIYQWKLALVALACMPLLIGCSLAERTMMNGYTKSKEGDTSDTIVTEALSSVRTVTS
                     FNMKADRVEAFEATLRVETPRSVKKGIIAGSIYGATQFIYYSAYALCFWYGSKLIDRG
                     EAQFTDVMIASMSILLGAQNAGEAGAFATKLADAERSAKRVFSVIDRVPDVDIEQPGD
                     KDLGKGCDVDFRKVQFIYSARPKQVVLASVNLRFGDGTANGLMGQTGCGKSTIIQMLA
                     RFYDRRSGLICVNGKDLSSLDIAEWRRNISVVLQEPNLFSGTVRENIRYAREDATDDE
                     VEEAARLAQIHWEIVKWPDGYNTEVGYKGSALSGGQKQRVAIARGLLRRPKLLLLDEA
                     TSALDNVTEAKVQEGINAYQAKYGVTSVSIAHRLTTIRHCDQIILLDSGHIIEQGSHE
                     ELMALGGEYMMRYDLYTGASS"
     gene            <445059..>449180
                     /locus_tag="LMJF_34_1000"
                     /db_xref="GeneID:5654857"
     mRNA            <445059..>449180
                     /locus_tag="LMJF_34_1000"
                     /product="putative myosin IB heavy chain"
                     /transcript_id="XM_001686141.1"
                     /db_xref="GeneID:5654857"
     CDS             445059..449180
                     /locus_tag="LMJF_34_1000"
                     /codon_start=1
                     /product="putative myosin IB heavy chain"
                     /protein_id="XP_001686193.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654857"
                     /db_xref="GOA:Q4Q3A5"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="InterPro:IPR001609"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017455"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3A5"
                     /translation="MASDYKQRETVGVEDLVLLPQISEKAITDNLSVRHREDLIYTNI
                     GSVLLVVNPFKEIQGLYNDAHMQFYRHSGRLSGARYALLEGQEPGDAALGGPHIFALA
                     EETYRSMVSEEENQCVIISGESGAGKTEASKHIMQYISAVSGNTKDMQRVKRIILESN
                     PLLEAFGNAKTLRNDNSSRFGKFLEIYFDIRGGPVGGHLSHFLLEKSRVSSQQAGECN
                     FHIFYQVCAGAAAELHGGGSGLQPLREGKGGNRKGAAAAWDDYDNDGGGHAPIAWREV
                     FEEMRMHRGGSSTNIGQSQSFASSSPSSAHYPWKFLRPSLGPGQHAEEFTSRVGIDDL
                     RGWRETLIAMDAMGMVAQDQVSVVKVLCLVLHLGELEFVAPEEGGALAAGQNPCTVAN
                     PKELAFVAQQLGVDASALLKALTWRKLQMGATEVVFSPLDVQQCRSTRDAVAKVLYEG
                     VFEFIVSSVNTAFGDAPHALMLGVLDIYGFEIFAKNGFEQFCINYVNEKLQQIFIELT
                     LRVEQEEYVREHIPWEDIKYFDNQVVCDLIENDRPPGLFALMDDVCITMAKEEESVAD
                     RKLLDKLGMTYSSHPNFLRSERGFIVKHYAGDVEYSTDGFVGRNKDRLGADVVDVLSK
                     SQARFLLEILTEVLADGLTAAASSPTGAGGARRAYTTAGFKIRQQAADLVRTLKQCTP
                     HYVRTIKSNDVKRANFFDEARVLHQVKYLGLLENVRVRRAGYSYRQYFDKFLNRFKYT
                     CPSTYPRPFRGTDRAACEAILACLQEEQGVLPPDSFAIGTSKVFIRQPEHLLALEQSR
                     EAAFHALSVTIQRAWRRYTQCKQLLCLKAKLDRTYTRHRKTRRADSVFRAYEGIYVET
                     DAVVAVPSPAAVGGTSAVPRALSNRLTVALDAILQFDPIASAWHSFWTPGEAGRPRKK
                     FFFNALTREMVWERPRELDPPRVVFSCAVDRVVNWATAKTVKEFIFLTTHDVLYMVRE
                     TPTSTEALPPSSQPPSSSAKHSNRAAAAVKEKQSVAMTLTPCFTLQKRIDLRLLTQVA
                     VTTMADTVLVVRVLPVQAPYRTVTDTVKTKAGPSKCETCNRAATPALRRANCPSCGRL
                     CCVRHCLTYARPLPTITGQAAPVRVCPACVVGEPLEPVEDMVLLTSYRTELAGTLCAR
                     YQERMGNPLPLFVSDSIPFSKWTPAPSPPKVKRTRRPAKPSAGRGGEAGEEAQPLVIG
                     GSYEVKLTSTVTDDPLANDTVLVGAAPPAPMTAAASADGRAGAKGKKKGKEAFDDEVA
                     YTVPPGTPPVLRVVAPRGITGEQIRRMEAVREERRKAAAARRRWEEEEEREREAQRER
                     EREAEHRRVVQERKKAKAAEAARMEAERATRERAAAERREEAARVVAERARRW"
     gene            <449996..>451762
                     /locus_tag="LMJF_34_1010"
                     /db_xref="GeneID:5654858"
     mRNA            <449996..>451762
                     /locus_tag="LMJF_34_1010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686142.1"
                     /db_xref="GeneID:5654858"
     CDS             449996..451762
                     /locus_tag="LMJF_34_1010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686194.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654858"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3A4"
                     /translation="MTQGRRGGVTAYLATELPHNQQSSKDDCQVRTGHACASVEPPGM
                     YAVFEDARSCCRWTVELVMAKAIGDGDTGDAWWANPEHLAAIDATAAAEAVVSVPHQP
                     EKNTGTGCSSRITAMRYYMKPDTWTQTLLSDEGETARENRTDGEVPHSGSASTGAVTS
                     SDPRGCNSDAHVHHQATSSLLSTASSVVTTTATEEASSLPAASSPLHGLPLHQLIEQH
                     AALVRRLVQVLAPQRQTIPHVIRELCTTRVTSPSSAVASRVCVLPSMDASNAEPMQYT
                     ERDVAAAVEQLTSSHPRQPRLRELKSDGYLLMNLEGFADGKTRHKAVNRAYPALALHW
                     PASVQQMDAMERYVDRDVVLDTRKRHPELSGEGSDKKQGQKRDRSRSSTSSNASGADE
                     DGAHKARAPGYTSSPPSPPLGMAASPKRTAPTTSSRRFFQSLREYPRSLEHGDLHAWA
                     RGTAAQQARDCLQAATTLTQSSTSTVDGSSDAATLGPLPITNEEDVAVLRCQYDALAA
                     AESVVEKQLRAYSDTVQELRGWYRGELCTQQFRYELEAWLRTQEESRAVLTDLYAQMH
                     AMRYSLQRDLSNYLHLHALGVL"
     gene            <452656..>454026
                     /locus_tag="LMJF_34_1020"
                     /db_xref="GeneID:5654859"
     mRNA            <452656..>454026
                     /locus_tag="LMJF_34_1020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686143.1"
                     /db_xref="GeneID:5654859"
     CDS             452656..454026
                     /locus_tag="LMJF_34_1020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686195.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654859"
                     /db_xref="InterPro:IPR012901"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3A3"
                     /translation="MSADQRVAGCDGSSGASTALPPLTPHTIGGKSNEAPYDEHQDAA
                     PPQYSMESAIGLSVPLYQPHAPAPGAVIDPDMVEDHVSFLRTVRAFHDYKRQALAARE
                     MRCTNFRKLQDQHRHLLCIDLDKILEKYLECIKVNSAFFDAICEASEELFDSYWPEGT
                     TVFMKEVPPPTPLDMNKVFSTLRQFVRDWSAEGVAERDCVYKPILDTLDRCFPNRSER
                     ENVRVLIPGAGLCRLSVELALHGFFAQANEFSYHMLIAGHYIQNHVFESCQHKIYPYS
                     DSTCNLVNRADQFAEVQIPDLCASEAIDALRDKGLSFGQLSMVAGDFTEVYAKPHQHK
                     TWSVVATCFFIDTAHNIIEYLVIIYNLLVPGGYWVNVGPLLYHFADSADDMSIELSLG
                     EVLTVAQRIGFVLNGPPSFIDTTYTNNQRSMKQLVYRCAFFVLQRPLADRQTEQMDRN
                     VEAKVT"
     gene            <456262..>457017
                     /locus_tag="LMJF_34_1030"
                     /db_xref="GeneID:5654860"
     mRNA            <456262..>457017
                     /locus_tag="LMJF_34_1030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686144.1"
                     /db_xref="GeneID:5654860"
     CDS             456262..457017
                     /locus_tag="LMJF_34_1030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686196.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654860"
                     /db_xref="GOA:Q4Q3A2"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3A2"
                     /translation="MGNLKHRLSAFYPHLTSKEYKFLVEDPSGSTGGGGTASSAARSA
                     VAARHGGAADGCGGSTGGPTTSSLAQAASSARPSNLSFDDGGDAVHANGALSGEGVAS
                     GVGGSNATSARAGLDVDQLWDLINSFQQLQRTFGAAQAGQAEGQNAQNTRSAFNSSFD
                     AYLVGTHGTQGIRSADIGFDAVGEAFRIYDPHNTHYVEEEVLSCIMARVGFGELTEEE
                     LAVLVSTADFDGDGRISLEDFRRLVSMKGRFEK"
     gene            <458502..>459230
                     /locus_tag="LMJF_34_1040"
                     /db_xref="GeneID:5654861"
     mRNA            <458502..>459230
                     /locus_tag="LMJF_34_1040"
                     /product="putative uracil phosphoribosyltransferase"
                     /transcript_id="XM_001686145.1"
                     /db_xref="GeneID:5654861"
     CDS             458502..459230
                     /locus_tag="LMJF_34_1040"
                     /EC_number="2.4.2.9"
                     /codon_start=1
                     /product="putative uracil phosphoribosyltransferase"
                     /protein_id="XP_001686197.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654861"
                     /db_xref="GOA:Q4Q3A1"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3A1"
                     /translation="MSQQEGTSPTDRESTMQILNMFPGHLHLLPQTPQLHFLFTVIRD
                     VETQRTDFIFYSERIIRLIFEAALCLIPVKPFNVITPVGAVYRGVRPDDRGIIGVSIM
                     RAGESMERVLREMCPGVRIGKILVQRDETSTDKTPDARFTYSKLPTDVASRRVLLLDP
                     MCATGGSVIKATEILINEYGVLEEDIIFLNLISAPAGIRKYLGRFPKIQIVTAAIDDD
                     LDENRYIVPGLGDFGDRYFGTISE"
     gene            <461596..>463698
                     /locus_tag="LMJF_34_1050"
                     /db_xref="GeneID:5654862"
     mRNA            <461596..>463698
                     /locus_tag="LMJF_34_1050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686146.1"
                     /db_xref="GeneID:5654862"
     CDS             461596..463698
                     /locus_tag="LMJF_34_1050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686198.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654862"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3A0"
                     /translation="MSSSSALTAAPVSGTDGAESKKPMTDQNSGDLYPFLQELQEDFP
                     ANGGELPIGELLMLLNAKKPDVFARLDRFFETARRVSGLDETMALKWKEKGNAEYKRR
                     LHQQAVLSYTNGLLCAEAPETLAVLLNNRSTVYFDEHRYADACVDADRAVEYQPTYWK
                     ALQRRGRSLVELGFTELGQKDIEASKQESIDAANSPATMAKVFGEATSGMSAACLPPR
                     AHVNGEVRIERSAKGRGLVAASRLTEGPVLEEAPYAIVARTEALLSVCSYCLQHSACL
                     YHGDEYRQRHLKSRGFFCSPACAKAAWEHYGQHESHHPFFLCCPNDALLAYRMVLGMR
                     AYPDLAELSASPELDPVTENDFGAHHIRTLEGSFSRELQSNAAVGGCESIVATIGFYV
                     GALTEPEAEQLRKAQRQILLNAVDVTCMMRTTAAPSEANSSTLLQTNTVVARLGKAVY
                     AIGALFNHACDPNCYVSFEGNPQGSCARLIVRAIRPIMEGEELTVSYGGISCFSFHSM
                     RHRLQTLRDRYGFFCGCRSCRNQVDEPVPTAEKDKYIQASDYYQKGRRLVRERNYAAA
                     VTVLLQSYEIVMRHICPPPHPPQWMLIKTHDALAQAYFHLEQRDKCVEHLQEALRLNI
                     EIHKNDNRAELINEHTRLAFLAVSPAEKKVHVDKAVELLRRFYAPSSMLDLQIAYVES
                     SLKAEPNTPEAVAAATKT"
     gene            <467885..>469756
                     /locus_tag="LMJF_34_1060"
                     /db_xref="GeneID:5654863"
     mRNA            <467885..>469756
                     /locus_tag="LMJF_34_1060"
                     /product="metallo-peptidase, Clan MA(E), Family M41"
                     /transcript_id="XM_001686147.1"
                     /db_xref="GeneID:5654863"
     CDS             467885..469756
                     /locus_tag="LMJF_34_1060"
                     /codon_start=1
                     /product="metallo-peptidase, Clan MA(E), Family M41"
                     /protein_id="XP_001686199.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654863"
                     /db_xref="GOA:Q4Q399"
                     /db_xref="InterPro:IPR000642"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005936"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q399"
                     /translation="MLPKRSPTDAVQRAYTMSPQERVLIAQIAARARLQRTWRHLGIL
                     SVLLSALIGYRWYTAQARLDADVSNYKAVVVDVPGHTAVYVDDNGKFIGVRNFIDFAT
                     FEKTCDPEKDVLIQFSSYYPWIPMLLLCLLPVLAVVNAGFNGSARMITMAAQAEKSRF
                     TFKREMSVSTRLKDVAGLTEAKHEVVEVIDFLKHPERYQTLGAKLPKGVLLDGPPGVG
                     KTLLAKAVAGEAMVPFVSCSGSEFEEVYVGVGAQRVRELFREAHNCKPCVVFIDEIDA
                     FGRKRRSDGNGSSRGTLNAFLAALDGFKDASGIMVLAATNRADILDNALTRSGRFDRK
                     ISLEKPSYKDRVAIALVHLQPLHLDPSSSLQNYAEMVAALTPGCSGADIFNVCNEAAI
                     QAAREDKEYVGAPHFHLAVERVLVGLEKSAVKYTPHEKERLAYHEAGIVVLNWFQSDT
                     DPVIKSTILPRGRHRTGVTQKLPQNIYISTQERLLQRIVGRLGGYVSEEHFFSDVSTS
                     AAEDLQMATSMARDMVCVYGMDPVHIGHMGFELDRDDTLQKPFGPEKENAVDIAVETI
                     VQSCLKRARALMLEHLNHTCIIAGLLLKQETLNAHEMWFALGDRPVMTKEFRTYLES"
     gene            complement(470125..470198)
                     /locus_tag="LMJF_34_TRNAVAL_01"
                     /db_xref="GeneID:12981307"
     tRNA            complement(470125..470198)
                     /locus_tag="LMJF_34_TRNAVAL_01"
                     /product="tRNA-Val"
                     /db_xref="GeneID:12981307"
     gene            470432..470505
                     /locus_tag="LMJF_34_TRNAILE_01"
                     /db_xref="GeneID:12982062"
     tRNA            470432..470505
                     /locus_tag="LMJF_34_TRNAILE_01"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:12982062"
     gene            470567..470639
                     /locus_tag="LMJF_34_TRNAMET_01"
                     /db_xref="GeneID:12982056"
     tRNA            470567..470639
                     /locus_tag="LMJF_34_TRNAMET_01"
                     /product="tRNA-Met"
                     /db_xref="GeneID:12982056"
     gene            complement(470675..470754)
                     /locus_tag="LMJF_34_TRNALEU_01"
                     /db_xref="GeneID:12982058"
     tRNA            complement(470675..470754)
                     /locus_tag="LMJF_34_TRNALEU_01"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:12982058"
     gene            470829..470909
                     /locus_tag="LMJF_34_TRNASER_01"
                     /db_xref="GeneID:12982057"
     tRNA            470829..470909
                     /locus_tag="LMJF_34_TRNASER_01"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:12982057"
     gene            complement(<471822..>474899)
                     /locus_tag="LMJF_34_1070"
                     /db_xref="GeneID:5654869"
     mRNA            complement(<471822..>474899)
                     /locus_tag="LMJF_34_1070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686148.1"
                     /db_xref="GeneID:5654869"
     CDS             complement(471822..474899)
                     /locus_tag="LMJF_34_1070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686200.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654869"
                     /db_xref="GOA:Q4Q398"
                     /db_xref="InterPro:IPR002921"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q4Q398"
                     /translation="MKYDQGTASGSASPSSNAANSSDRTKLLQVLRVVAQHSRVFATA
                     QYVYVRRRVTAIGKLIHITVRSVYFPDEFSFYLDTVVRFLFSVYYIPFLAMVVALTHA
                     AIERIVWVLVIPVTQEMERRPFSTSRVSTLVYGLGSIASRMTPFATLAVAVATVGHKV
                     MNCVAEAMVDAYTTQRGMDYPLLRARLCFTVKKKLRLVICGVVSANLAVVLALLCHTN
                     AFVEWSGREPWVTAAVWTVFVIQICFVLTTVLREAPLENTTLNRSGVFRLIDRRRCQV
                     QTQLRNDVEVLPGACPPPFPQPVENTFSSSSSSISVASPRLARCGGGGEATAVGGSGN
                     VPPLHSLSDAKPLAATQASVSATAENVCNLIDASASQAFVTYVEDDWWRHHIHTMRYI
                     GFFMVIFFTIGFAVARGPVFGLTSGVMILTCLNAPHLFGCMALSISAAVTRILRSYAW
                     LLRHPDALLPILIIATPYQLLLISAFLYFRQHPLLCLMLVWVNMLLAARAIDLAREFD
                     VTVNGSVLWKYADSGAPLPPALASVLEDVHEKQYHCPDVMSLDMLIDIRRMKILYAGG
                     AEVRLKRQVVIPPGALRRYVFEYHFYAYTLPRLLSLQSPGYFSGSKFRTVRVVLRFIS
                     VTLLLLYALLMSGLLVQAAFPQLRPLPVRVTAAPDNSYLTFDHIVVRLHLLSQNASRR
                     AAEVNTSNMALEGYLSGVPVAASSAFMWHNITSAENEDFYPQLCTRQYGETSVWELAL
                     LALAPYLFNVEEFNTMLRFLNVHMGSDWVIQPRHGASCVPGDSNHQPTGWSDFYEVYS
                     AKRDTSVIAVRGTDMFSFTDFLFNTNVFFEVVLYQLMTTMIPGTVVVPKDLIVDLLRT
                     ASLPADSYGDVYETWTELTRSGNHSLRRCQQNNFRRDFFADLYNHIAYVGSRPTHPRH
                     LLLTGHSLGGAVAAIVAAQMRVKAVAFSAPGIALARKKFNLPLRSINENIMTVVSSND
                     IVPAVGEHGGELHHVECLAATRELCHAMEFMIGSLWRSCSSVRSRFPSIKDVV"
     gene            complement(<483523..>484311)
                     /locus_tag="LMJF_34_1080"
                     /db_xref="GeneID:5654870"
     mRNA            complement(<483523..>484311)
                     /locus_tag="LMJF_34_1080"
                     /product="putative amastin-like surface protein"
                     /transcript_id="XM_001686149.1"
                     /db_xref="GeneID:5654870"
     CDS             complement(483523..484311)
                     /locus_tag="LMJF_34_1080"
                     /codon_start=1
                     /product="putative amastin-like surface protein"
                     /protein_id="XP_001686201.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654870"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4Q397"
                     /translation="MNGTVCVHVQQQRQQTSPCQALTHFRSRLTPRQLCRAVSTALPL
                     FLPCTSALPLPAVGVVDLPKMALRISIIVYVVLQFIAFFFVLVGTPLDMFRAAVEEFN
                     FSHVCVTLWGAKLGCYNSSYLVTSDELWVNCTARRDRFRAAQALAVISIFVYGAAFVL
                     GVLLLCCCSILRWVCLAVNIVGVFTLVVVWVAMVVTYYASENTYCPNLKRFFNYGAGF
                     ALFLVAWCLDIINIFLLVIRGEDEKACANENPEFYTRGGQEEMK"
     gene            complement(<489069..>493379)
                     /gene="DAT"
                     /locus_tag="LMJF_34_1090"
                     /db_xref="GeneID:5654871"
     mRNA            complement(<489069..>493379)
                     /gene="DAT"
                     /locus_tag="LMJF_34_1090"
                     /product="dihydroxyacetonephosphate acyltransferase"
                     /transcript_id="XM_001686150.1"
                     /db_xref="GeneID:5654871"
     CDS             complement(489069..493379)
                     /gene="DAT"
                     /locus_tag="LMJF_34_1090"
                     /EC_number="2.3.1.42"
                     /codon_start=1
                     /product="dihydroxyacetonephosphate acyltransferase"
                     /protein_id="XP_001686202.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654871"
                     /db_xref="GOA:Q4Q396"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="InterPro:IPR022284"
                     /db_xref="UniProtKB/TrEMBL:Q4Q396"
                     /translation="MSFPPPRLALPEECKQVVLVAPIDGFTAACACAIATSPLVPLNC
                     RVLVDGIAVKSSSPSSGNDSPHMACSSAESAATARDFMNTVQRVEAKLRASRATRRDV
                     SVTHITQFYYGGVSPKAEEIGPMLHRIHLLGSGALGETNFTASSTDVTAGSGGSSGVP
                     RVADSVFVLVLSAQSLSPDTESGLKAYDILLRRLWSAAGPSQAAETASQQTRVRGSLV
                     ILADDVYRTAACAMLSSIAKEVATAVDWVVLLAYAYAMDPPALEFGATEVAVQAASGI
                     SLGGTLPVLCAANALGVLRHFPVSRGEPATITPVDVALNAALLGYVWLCHGELPECVE
                     CAAEMQYCGLSPAPSHAAAAAETATAMPTQPAQCVTRHRMGSFAVAESRKPGEVSLVW
                     GMVGEYLMSYYGRFADQISAAFPVAGVLTQAPILQFPFSVADWVNFGPEPRAAAYALE
                     GWRAYQQRQRLMEEKVGNAEAAQALKAYVAQMDSVVRYIERTARAAAARDKISAAFAA
                     SRRRTASSSFSVPPYRLDDFNVALYHSLLRRLTSHHTLMPYHQCVALVEVDWEAYVSV
                     IARAVLEHLARCVLRSSSGLQHVRSRFHALPVADSANIGSVVRSPPVVSAPDELAPAS
                     AAVPSSTKPEAAASAAEAPFAFPEPRRYFTNDFVYRGAERIPPFPSLLHKYFDCFVFL
                     HRVGMTANGWRGDMTPGMTPQVLTSIIAQPNIQRLMTALAAKDGASKKDVEARAKRLL
                     LECGDALNHVHCRTLGLMIRTIFHSIYGRVDVNNGSYERLHRYFAMPRVAVVFAPLHR
                     SYIDFLILSEVLALMRLPLPHIVAGENFLSMGVLATLMRGSGALFMRRSFRDDPLYAA
                     LLKEYVRHLVRARRPLEFFIEGARSRTGKTMAPKLGLLKFVCDTFYEPGQQELDDVLI
                     VPVSLSYDEVLEATTHAKELLGVPKPKENPTNMLKARSLLERMHGNIHIHVGEPVSLR
                     SLKQHPRQCPLPLQPKDEQLRDPAAPAAATTSVCKTLDTTPSIAKGSSITPIPLLGTV
                     AWHLVYKLQRNTVITPASMVAAVVECLGPYYCTATTMLKEGIDTTAAAPTAAAAMPLE
                     KVHQGVEWLRGRLRERGAQLSAEASKLNPAGVVTLALTNLYRYIHITDEMSGVTYHPD
                     NVVTRLAVNISTNQLIHVCMNEALVAVVAQAFGFVTTPHRPPSGADGAMLCGVRSVKA
                     DVLSNQTQLLQRLLSAEFPNYAEAAPVSFASWLECTVSQLQQCVEEHTVSSQLSGADT
                     HGGTIVHLPVTQYYYFLLQLICPHVEALYTVLAAASALLAAYPGKPFGAAEVVTATQR
                     ACYILYAERKLRYIVAANKETLQHYYESLIALSLLQIKRVPITTTPGQSKVNGGVVAY
                     TVGLLGQEAALARLEVLSTQIKALWWHPSAAEGVTIDKAAIQERVLAVYRELTQPSKM
                     "
     gene            complement(<497581..>498738)
                     /locus_tag="LMJF_34_1100"
                     /db_xref="GeneID:5654872"
     mRNA            complement(<497581..>498738)
                     /locus_tag="LMJF_34_1100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686151.1"
                     /db_xref="GeneID:5654872"
     CDS             complement(497581..498738)
                     /locus_tag="LMJF_34_1100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686203.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654872"
                     /db_xref="UniProtKB/TrEMBL:Q4Q395"
                     /translation="MVQLETWNTYWEAYSTCCADELEGLSKQLEAPPSTAGYRRVLLT
                     VSAPAFPSLSTPPTIATSSAATASSAHDHFPVLKDGPPLSVFPSWREDSKVAEPQMHS
                     SLSPLSSPSVLPSRPPPHSRETSVSSYSYSYTSHSPSSSDAVSAAKAARADDCIAALS
                     FLPCVLDDLLYHYAHRFGAVEHLETRETGASAGAPSITTARVIVSVQFTTAEAAGVFL
                     RWADGVSVADIIASYRRDTQASATLSEGHLSPARRENAVGTPATEGATGLAREETTKP
                     QGELDRDDAAWWDTLEEASRRQQLCLIAKLAPHDPRRITARLLLGPNVMVSTPLVKSL
                     FTGLFDTTYMEYRAELRAFCIEFANKKECRLALHALQCSLWRVFGVSLIFT"
     gene            complement(<500431..>502038)
                     /locus_tag="LMJF_34_1110"
                     /db_xref="GeneID:5654873"
     mRNA            complement(<500431..>502038)
                     /locus_tag="LMJF_34_1110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686152.1"
                     /db_xref="GeneID:5654873"
     CDS             complement(500431..502038)
                     /locus_tag="LMJF_34_1110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686204.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654873"
                     /db_xref="GOA:Q4Q394"
                     /db_xref="InterPro:IPR002140"
                     /db_xref="InterPro:IPR018978"
                     /db_xref="InterPro:IPR019783"
                     /db_xref="UniProtKB/TrEMBL:Q4Q394"
                     /translation="MSARMQFPLSQRRHTNIAVVRYSKNGVKLEIACYKNKVISYRSG
                     TENRLDEVLQVERIFANVARGYLASEKEIQTVFGGEMTEAEAIRYMLDHGELQVAQQE
                     RAAEVDEMFKDIAVIISQKCINTKTQRPFPPQVVEQALRSIGAAVKLDQSVKKQALGL
                     IHLLIDSDILPIARANMKIRCTTTSEAALEKLRGWCRDNDADVVSDSVTGKTSDGGSG
                     NFGHALLLLMQPNLFRDLDHFVKEALPSGSTIHMVEAAVTEVGDSDVLLDANAVSLAN
                     AQPGRAEEEATMAGSRRAAAAPSSSSAGEVNRGCSDGRGGETGMSSNLGQGADNASNG
                     QHQSDGEGKRGRTGKAKGTTRRGHRGRQSNNSDGDDLLDGSTDGAAEGGLGVDHDIAA
                     GLQRLGLDPSHDLQDDSDDDGGRGRGSRGKKKKNASGTGGGPYQSQGAGGRKAGGGAA
                     AVDDDDNAGKGKKGRKNAKSKKVAAAEKAKPGAEGAFSDSDEELMGNRKQRAKKQQET
                     RMQQGGNDWHEEDFDYGEDEEAEVQLS"
     gene            complement(<503428..>504225)
                     /locus_tag="LMJF_34_1120"
                     /db_xref="GeneID:5654874"
     mRNA            complement(<503428..>504225)
                     /locus_tag="LMJF_34_1120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686153.1"
                     /db_xref="GeneID:5654874"
     CDS             complement(503428..504225)
                     /locus_tag="LMJF_34_1120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686205.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654874"
                     /db_xref="InterPro:IPR001715"
                     /db_xref="InterPro:IPR010441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q393"
                     /translation="MASVPFTEEDLHELYTWVDEIPISRQKRNIARDFADGCSVAEIL
                     KFFFPKLVDLHNYVPAMSHAKKLDNWNTLNAKVLRKLYFEVPPEEVEDIVAAVPGAIE
                     RFLRALRVKVAQIKARRDEMLRMGEIQAHVNAHHVDPSPSQPQPREGGHVRDGGASAA
                     TAHRGSGRPSSPAAPAGPVASSRGSSSAGPQAPPRQTQPQRQPTPPLVNEAASLTQAL
                     REKDYTIQELRETVAILSEKIVKLEELVRVKDEKLNQYRQKVGRVPA"
     gene            complement(<505381..>512697)
                     /locus_tag="LMJF_34_1130"
                     /db_xref="GeneID:5654875"
     mRNA            complement(<505381..>512697)
                     /locus_tag="LMJF_34_1130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686154.2"
                     /db_xref="GeneID:5654875"
     CDS             complement(505381..512697)
                     /locus_tag="LMJF_34_1130"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686206.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654875"
                     /db_xref="UniProtKB/TrEMBL:Q4Q392"
                     /translation="MGAGLSQQPTPSSKLASAHPSSSAPADAWKSSMRDEVLCGKPLR
                     QSSPETSAAVPRENLYSIVEEEDIDIDYADEESVQACKGSGSGSGTTHPQHRYPVMMP
                     GAGLARVAVPPIPVMSAIAAPASPVSACSSTATDTPRSILRQSGTGGGRTPRSNSRRI
                     SFVGVSSPRPDEHRCCRDGDEESGDDSDDYESAEPSLRYDIVTLAMSATSTPPRHSRK
                     VHSHDPSLHNGHYHSHEHGEDDSNGALSPVPASQHQQKRTSPSLSPERPRLSSRSPTH
                     SPPRDSGSGYTISAGAPLSAAVTAPSAPPPPEEETDVITLDAAPQHRALDEQDLLKSP
                     KRGGNQRRAKSPSMGTNGRDEDVLTQPHNRSEPSGSSHGAVVVRRLPPRQRWPSEAYQ
                     DEPQTEVSKTQRARRSRRERLDPEADMGSSSSRCSSDMGSSCTGSDDSLSARYASPLK
                     LHQEGYRGSSYQSTSSSPPALACAAAVGSAGAPPIGHPSPHRRSTSARKDRDGTSSER
                     SREKSLTPRSPPSLTQRDDTDEPIRGSSDHDHHHRHSSRGAETRSGLPAEAGAALPTS
                     HNRGRGTRVGVETRGPYTHAVAAAFHLCREASYSPSTITDRSSGQSVAGDLSGSVSEA
                     AAQEARRAPRNYQQQHEVVPSALSATTAAAPLRLSKDRKVKKAVVAEEPQVYVDPLLL
                     ERRHRHELTRQESPSHVERHSGLHARRRRPGSRTAAQQQPTTFQSVSLRDIMMRHDSP
                     ETKSRRGTPSSQSTAPAILRLPSDVRQLQLQHNGDGDDDDAAHTLTPGAVALEASVAS
                     SSLLSSGGVPADELFWDEPTPTSRASSRSPPPVSPRSSSTLAPNTPDRHKVLRKKLVV
                     VVRRKKNGSAQSENDPVVQMSLLPFKEETAALLKANASLQGSPQQRRAHSSGTSAAAT
                     VPTLEKLINKVERGESASVFSRCLSRASEHQGQRPRELSERRDGGDDHAGENEISEEN
                     RRRFRHALSVLSSRSVSPRASVSPSTTSKAGRSQRSRTRSPDSQINASYACARPLRCS
                     GSASEESVSHTGDAALRRSSGRRHISHVAAVSETAAASIGATSPPQRRSARGGSRHSD
                     EKSARRSEGGHRHKSRRRHSHESIAHSTAGHQRRSLSGASMPGAPYCAAQNDEFYGAA
                     DMAKDVATLFPSPFQERIGITPMSMPLLPRLVLRAELGALPQGQYAHHPHSNIDAAQR
                     TNGSWSASDDEDEHAMGRITDSESGGRRSRPLMLQFSSGTQTDRATGVNHAFGSARSG
                     MPLLAATPVQRAAAIGPIGGTLSSAHPGKPVGTSVPTIGAGLAASLLAPTHNAAGDAV
                     FNEEMALAVEKRAANSPLVAEASATESPASFVKRAASPAAAAKPFTDSNSRILSGSGS
                     GAAKGRGEAAVFGGNVGASRAAYAPLFSATSAHVAASSSRPAAQDLSTAARAMMDATT
                     SVPLFFPPLTVDNVSQLSHDWQSTLRERSSKAKRSVMESFLIASAEAGAATTAAAVAA
                     AAPSPPLYLADPAATDVNPSDMCAGGCGGLTVPAVGAEAPSEWQQRARPAQAHQGLAV
                     EEFYGRSVTSAAIANAPRSAHSLPPRSGPQSFSEIKCDVWQRSGSPQLAAQREPEQQQ
                     ATRSPPFSAPSENKSVQGKSAMPVGSVSKSCAASKSRDGVEERSTSARKHSRRRRRRA
                     SPERRANSNGDQLTDALNAETLSTVAADSPCKSSSSAEKINMVGDVTALAGVSPQPLS
                     RESLPVPATLGEAKQKAQQGDQTSDSSSRPCSAVGNGTAANAAVATATDGVGARSAPP
                     PPPPFFSIVEAAAESRASRSVEKAAEKGRGNHQRDERREHLSRHSPSPFSSEASQSPS
                     SKRRKTSSKHKTKHDGDDKHKKRKHGHGRHGRYSRSGTRSLSGQTCDTAAAEIDSDSD
                     VDSNLTTSIEFQLSRLLLLREAAVFTKPPLSAAVDASRRNTRKKDKADGKAARKAAAA
                     KDEHHRHRNRSSKEKRKRSSKRAAKQRSKSPAATTESRLSDGADRKKKKREKAYHCST
                     SPSKPGPLPPPPPHQRSRALYGEEAAASAAASLSDVASRYRLGAPGCSPRDDGAAFAS
                     TRPYFRVGRIYRGGQGEDAEAPYAHHRAAAHTGADSETPYERYRRPSHTSPLRGQRSY
                     VAPTASGWADGFRPACRPAPRPAATAEDPSLWHRSYSSASRPSTRWNDYVRDAERGAA
                     GRSSSSPYMRAHHSRSLGQRRRGSDAGIPTAGECGRGSSAEGGSPSSEQPGSGTYSAT
                     YASRRRQTDEFDDINVAPIRQYFNDHGQVGADERGGGVQYGTTSAFERHPSRSAASNR
                     APTARPWLSNNYERSRAVATQKHANVDDLLVSTPPNDGDEGCVPDNANDLSHARQRQR
                     RSTLVPPLPPPPSPPQASTTPSAAPTDTVFAAIPRSGALPILSEHTVTDAQTAEDFVQ
                     GVRGIISSLQQYRNSV"
     gene            complement(<513836..>515317)
                     /locus_tag="LMJF_34_1140"
                     /db_xref="GeneID:5654876"
     mRNA            complement(<513836..>515317)
                     /locus_tag="LMJF_34_1140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686155.1"
                     /db_xref="GeneID:5654876"
     CDS             complement(513836..515317)
                     /locus_tag="LMJF_34_1140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686207.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654876"
                     /db_xref="GOA:Q4Q391"
                     /db_xref="InterPro:IPR001269"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018517"
                     /db_xref="UniProtKB/TrEMBL:Q4Q391"
                     /translation="MSDHWASYERAWAQDPHHLPRSVCLPALIAGADRAVAAALVNLS
                     RDYDATISCGSHRTPAEQHVTSAEEEGKCHQRCVDSPDSNASHDWRQLYCSLCLIQAP
                     MVRCSRPAFRQVCRAWGTRVSYTHMLMAESFVKSPHARHAEFARYEGENRLVAQLAAK
                     SGPAAAQAALLLRPYCDGIDLNCGCPQRWAMKEGIGAALLDQPERVADMVRSIRNAMP
                     DGSTAPMIVGNGGEYSSCTSAVPPFLPCVVKMRIKDDLRRSVDFARQCEAAGVSWLTV
                     HGRTPTCHSSTAVQFEAVKLIRENLSVPVVLNGGVTDVSTAMEAALRTGCGGLMSANG
                     LLDNPAMFYCGASRAAMEAEMSFVTSCWGRPPRTCDPVSPPAETAAPDVFSEVFSPVR
                     PVSFLWAPDRSNAEAVLLRYTVADMWQAAVTPREVISDFMRAAMRTDLVVPTTVQQVL
                     RMARLYVSPAERNHLALLRSNLSVLNALQEIDVYVESGRIACE"
     gene            complement(<516074..>517231)
                     /locus_tag="LMJF_34_1150"
                     /db_xref="GeneID:5654877"
     mRNA            complement(<516074..>517231)
                     /locus_tag="LMJF_34_1150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686156.1"
                     /db_xref="GeneID:5654877"
     CDS             complement(516074..517231)
                     /locus_tag="LMJF_34_1150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686208.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654877"
                     /db_xref="UniProtKB/TrEMBL:Q4Q390"
                     /translation="MSSFWGRYPATMQNQQPTQNQSQQQDASFRLATGATAAAFPGSL
                     DASPETSARSLTLAEAAELAALQRQHEQPFVVPVTQVLHKLGGVHITVRETHNPTITI
                     AYNRVMEEIEALVSEHEQRLARLPLSSSLSFSSQALIAGQGTLTSATVLINSGIVEGG
                     TAVAGSRGENTAERLARSSNTASLPASQQLPRALLQSVDLRQALPSPGSPMSPLRSVS
                     GVGSPTSDATAATWGRSGAGCNSDCGDAWTAGRDEVGMVLSVRLLSKEVTRWRMAHER
                     PLAEWRFPIIRTSNERMIRPRTQSSVATGAAGSAAADGTEANRHDHRGEGGARSVPAE
                     LTLVNDPTQVHHVLEFILKSSYQTTSMETFTDFTSGELVFDAHVQEKRRFT"
     gene            complement(<518781..>519395)
                     /locus_tag="LMJF_34_1155"
                     /db_xref="GeneID:5654878"
     mRNA            complement(<518781..>519395)
                     /locus_tag="LMJF_34_1155"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686157.1"
                     /db_xref="GeneID:5654878"
     CDS             complement(518781..519395)
                     /locus_tag="LMJF_34_1155"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686209.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1155"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1155"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654878"
                     /db_xref="InterPro:IPR003746"
                     /db_xref="UniProtKB/TrEMBL:Q4Q389"
                     /translation="MHATRVCVHRMFPCLVQVQPGKYLLTVHAKPSARASAFAAPLTP
                     VLTEADLRIAAPPVEGQANAELLRYLDELIERGFRAMTADHAGYVKGTSYATVLAADA
                     AASATAAQSAKSRSGGDKKSGKKGKSRNVAATSSASSSMPHSGAGSSQQPEESNTPPP
                     AAAFPDRIEVSLVRGGTSREKTVLVMFPGTRAQLTAVLEKESRE"
     gene            complement(<520789..>522141)
                     /locus_tag="LMJF_34_1160"
                     /db_xref="GeneID:5654879"
     mRNA            complement(<520789..>522141)
                     /locus_tag="LMJF_34_1160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686158.1"
                     /db_xref="GeneID:5654879"
     CDS             complement(520789..522141)
                     /locus_tag="LMJF_34_1160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686210.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654879"
                     /db_xref="UniProtKB/TrEMBL:Q4Q388"
                     /translation="MRRTLLRLLLNVSGESPDFRAKPGIRNLLLDVQQSPYKEQFKDY
                     WSTPVPFADREYGEKPKLGEPIPTRRAATTILVGHNKHIDPAKVAAGEDNDYKVLMMY
                     RESKGQYVKDQFVLPSFPVSMEDTSEDWDKVLRRRGVTTQWADLHHRLAAMRALFVQT
                     NLLLIPEEGGVVAEVEGPPGPRRWFLICNQYPKAMRQLMDVLELPMESTLSQLMPFRT
                     IVTPTTETFRFANLSYVVTLNKIPDVQYTLSTVGEKLVWVSPMEALARFNAGIMNMPT
                     PNVIALSELHNECPTFADVTKKTNRDVPRTVVPVLFHHGQEKVATVLLPGDMFHPETT
                     PEDRTSKYVRRFAYEKDFPFGVRAVFDERPATAEEEAQVLEPEKPALLEEANDMDMVY
                     SSIPYPKWQRAPQEGKTAYPVPQYNFQEGRENDEGLIPLRRDHMGRKPVDLYSSLHEK
                     "
     gene            complement(<527699..>529696)
                     /locus_tag="LMJF_34_1170"
                     /db_xref="GeneID:5654880"
     mRNA            complement(<527699..>529696)
                     /locus_tag="LMJF_34_1170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686159.1"
                     /db_xref="GeneID:5654880"
     CDS             complement(527699..529696)
                     /locus_tag="LMJF_34_1170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686211.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654880"
                     /db_xref="UniProtKB/TrEMBL:Q4Q387"
                     /translation="MQTPTGSVLNRDSVDSSFISQVVYENEVLKIELESLREKLESTG
                     LLTLDDLRCENESLKAEVAKLRVQLTEKANQLDLHRTSNDRFSNINESLHELLTQVQK
                     QRTELAEMKDTTREKEERIENLTAELKQSEEALKEATQRASLASEEAKKSSAEAADRE
                     RLQSQLNQAKAEMETLLLKSTQEATELQSRLREAEERLLSAKEDAVAKSALWERQVSL
                     QQQEIKECRETEARAQQQLRDLQAKMEVLRAECSQLRETNADLLQREQVSATMESQRI
                     NLNAPEVKAHVEKMVMHATEGMERRLREQVDQNTSLISRLALMQQESQATAKPKDTSS
                     ENIQLMKERVSMLGCHNDTRTTMQRRMAELLSNDELNKKDIERLLEEMLDFQEETVQE
                     NRTLLLIKDIESEERERKLEQELKRVKNENASLMKQLQELAVEGFQRERSNMLNASGG
                     GGTSEPSGSEAGPSTAPGAPTGGMKLSATPENERGSYQLLGSSPPVLKMEEVRGPAHP
                     ASLNTSYNALHQDFRTPPAMHPTVNYAPVPSQQMPVYQRPPAASPYQQPPQQREPKHS
                     PRHYTGDLWSNTSARPTTAPASNPQRAATTMAAGCAEPYRYPSDTPPNKPGAQPAWVP
                     RVSGTEPDRSRSIRVQCPACTFEQQGTNRQCEICQATLQLN"
     gene            complement(<532379..>533155)
                     /locus_tag="LMJF_34_1175"
                     /db_xref="GeneID:5654881"
     mRNA            complement(<532379..>533155)
                     /locus_tag="LMJF_34_1175"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686160.1"
                     /db_xref="GeneID:5654881"
     CDS             complement(532379..533155)
                     /locus_tag="LMJF_34_1175"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686212.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1175"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1175"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654881"
                     /db_xref="UniProtKB/TrEMBL:Q4Q386"
                     /translation="MSADHLRVMRRCRRTTTTAALLFFLSVLLFHHRPVNGSNGSTDL
                     KAYRVSRPTFSAASQLRQCTQLQDLGNYGVNLNLFAPKSVYLNGEYFCAESAPAQYRC
                     RCGVATTCKPMLDPWERNIGSCDCCSSWMISCFVILGVFSAISVFGAVYVVGCQGKWW
                     CDGYTPLKTALIPRRGPAVRCPPSRPLPQNLFRGYASADFTNAEAFPEMRVSAVTAPT
                     SPPVNTPGVDDPNHGGVFGSDAEDGEARAVPPATSGVAPP"
     gene            complement(<533615..>535390)
                     /locus_tag="LMJF_34_1180"
                     /db_xref="GeneID:5654882"
     mRNA            complement(<533615..>535390)
                     /locus_tag="LMJF_34_1180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686161.1"
                     /db_xref="GeneID:5654882"
     CDS             complement(533615..535390)
                     /locus_tag="LMJF_34_1180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686213.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654882"
                     /db_xref="UniProtKB/TrEMBL:Q4Q385"
                     /translation="MPGVGERTISSDTAAPCKRVGNDVDPLLPHVCISAQALHPFPSI
                     ECFEAARRAALVQAERRVKAHRWSSTAPAMGSGEGAATASALLNGLVPSGSLLAQHTY
                     RHDYEDHRCKEHMDPTAAAPPGDAAEQTVGSLLKDSPRTPPPSPQLIFPSPVLLRTVA
                     QLVLTLQASASTSAARFTLVQYRDVQLLPWRRSLHEAKEPAAPSAPRLFREAVVVSVL
                     PQVVAHCVASRVQATPGQTKSLPSASVEDESSATLYALTPSAGPPALMGTGGAKRARE
                     EAQGGTTRGGKAVSSASAAIVAGAVLCERLSTTTEAARAQTAPVRYAAVSVDAFEGWI
                     HPIGKRDASPLPTPSTASCVSETFLYEEESAWMTDGVFHPLFSLPLTPLAEPAAVAGA
                     NASAGESGSSGQRTAHATFLKTSAFLFLSFLVHRSWCAHVHSAVTQAMAAHPLPSKTK
                     QRAGSPGLTFTGTHVTRLPPVQEVRRSPQYEWRSALVYCAHGERAAERAASNALCGIE
                     GDEGVRGAALAIGIAGESILCGPVLWQLTVLVVNRNAQLQWCMHRTSLATCVEADSAA
                     TSLPHDAHKDILEGSGTLDDLLQRL"
     gene            complement(<536467..>541062)
                     /locus_tag="LMJF_34_1190"
                     /db_xref="GeneID:5654883"
     mRNA            complement(<536467..>541062)
                     /locus_tag="LMJF_34_1190"
                     /product="ATP-dependent RNA helicase-like protein"
                     /transcript_id="XM_001686162.1"
                     /db_xref="GeneID:5654883"
     CDS             complement(536467..541062)
                     /locus_tag="LMJF_34_1190"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase-like protein"
                     /protein_id="XP_001686214.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654883"
                     /db_xref="GOA:Q4Q384"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q384"
                     /translation="MLRSDHQQADPDAEFVMPEPSMHHVPHSQRLRCVLELPLNGRCH
                     GEAAAEKEVFAIGQSKKAKVARALCFMHAEQLLDHYMSTRETPLSSKAGASPVPPPLE
                     ERALPPRPKTPKPHDYRSWDEYVDASAAYVQTVAARVRQEACTREEVPRSGHPVADRA
                     TELLRRHPKLYCRPTALHELNGSIRDASSLMTVAHLEKTVFVATLALDPQTGLTATGV
                     AKSTKTAKRQCAAHALCILRLLREDLEGRQGADGTGRSRRRCAQKGTHSKKDVSHHPS
                     APLESVLRQMQPAYRKLVQYHHLLFGKASLTPQTTFTKQSSATSGSTSTTMYRCRLTL
                     NGLSCDGTGINRFEAERAAMETAMADLMLYDKRIQAVQAFVNAHPSISPESIPSAALP
                     AELVVELQTQLRPVTEQQAAAAANAATEGETGRSGCDDGSDSAGDCGDRARGMNERTL
                     LRLSERAFAMDPSYAAQMLHDMLELRRDPVYLTQFHPRRSTLAMATVKAQVLDAVQRH
                     RVAVVCGTTGCGKTTQVPQYILDYEIEHGRGGSCNILVTQPRRLSAFNVAERIAQERL
                     STVGKDVGYAVRLDSRPGRHITVCTTGVLLQIFSTNPDLAHVSHLIIDEVHERDINCD
                     VILALVKQLLTRNPRLRVVLMSATMQADVFARYFDADTPVVQVEGAVYPVAIRYLEDI
                     ASEAATAQFYSPAFDAVSSGKQGREDEQQEKTPTKSVSLAMSPTTASRCVSRRKFLKI
                     DYNLVAYLVHRAVQVDLQNNTEGKSILVFLPGWKELTSAMAAIKEYHGPYALPAAESR
                     FHIILLHSTVDSGKQRECFMPAPSGTVKVVLATNIAESGITIDDAAVVIDTGLIKTTT
                     WESRPTATYHHHVTTGTGASSSSGSPTFAHVPLDKVAVNCWSGGGSGGNAVVTTPVFS
                     TQLTLGYASQANCTQRKGRAGRTQGGVCYRLFTKELWDSLAPFPEADIRRVPLMQVLL
                     KLLSLGHANPKETLQTFLEPPSNTNVDASMEVLRGIGAVGKKDRLTPLGEYLALLPCD
                     PRIGKMILVGTVLCCLDSVLTVAACTDVCPYATSRDVAAEARKKRYLLSCGSQSDHIS
                     FLNAYNAFCANGEKDDFAALNLLHSGNLRVISKYKAQYRDILRHAGLISPQDEFGENP
                     ERVDGADAVSCPEHGHLGNDGGTAKDTATHLEGGTATVSAVDASAPGAPVSESAPLSY
                     PGTLCVDTNALSRHSFDVALVKACVCAALFPNVALLRPPSKALSSMQRLRAARKVELR
                     TKHFASIKPAKDSVCRRVDGSRGDAVPDRDEVLSQLRRDSRAATADSATSSTSPDRPV
                     PALFYVFQDVFGLREPRQDFLTNLSAVSLWALLLFGASESTTEYNAELSICVVDGWIA
                     LHIDRATYALVTQLRQSLFECLRGKYNDPQDPRNNSALETVTAVCRRLLKAPVLEMAA
                     AKSPDTAGSAAAGRQQSPWQLVDMGSIVDPLVHLRRGNIGDSRAVAVAGEDALLGLDS
                     GDDGGDDEDALPASNPLDGDDDDDDDQSATAHGGRIR"
     gene            complement(<543046..>543423)
                     /locus_tag="LMJF_34_1200"
                     /db_xref="GeneID:5654884"
     mRNA            complement(<543046..>543423)
                     /locus_tag="LMJF_34_1200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686163.1"
                     /db_xref="GeneID:5654884"
     CDS             complement(543046..543423)
                     /locus_tag="LMJF_34_1200"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686215.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654884"
                     /db_xref="UniProtKB/TrEMBL:Q4Q383"
                     /translation="MLRVEHNQARVLKDQEDRGMYYEQNSNVHTFDTISVGLYSQRST
                     LYHTMSAERLRNLKVFLMVFSTVVTCAYLYYRYMINPDWAYVERPMNMLGSRVMAVRE
                     QRWKHLTEAQRFDALCKEKGEAA"
     gene            complement(<544704..>546131)
                     /locus_tag="LMJF_34_1210"
                     /db_xref="GeneID:5654885"
     mRNA            complement(<544704..>546131)
                     /locus_tag="LMJF_34_1210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686164.1"
                     /db_xref="GeneID:5654885"
     CDS             complement(544704..546131)
                     /locus_tag="LMJF_34_1210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686216.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654885"
                     /db_xref="UniProtKB/TrEMBL:Q4Q382"
                     /translation="MANVRLATIGDSASSRPTIVVERSTAILPKLPRRGPPAILRLPP
                     QLVIYCFCFCNLQTLGVLCRVSVRINVLVARQGAELWLAAAQRRQIPISDSACAREEL
                     RKALVHRARERHAEEAYYKAEIARMEERLSARAQHIYAQNIDVDRTLQTNGGTSTPAA
                     ANPEPFWLRQQRTLQAKAGATVGSVDTTHTALSQSADMCAKLKTEIEALEEVKRACEC
                     RLNLQEELLLQHDAQIRQWQSLLLPCKLSAPKSSLASASAGAAAASSNTKNESAAAVA
                     SSPVLISAVQVDEFERRMARLVLNGPVSTSSASITHTSSGESSLPVVLRRGVENFGSL
                     ELVLRAVKCGEPITDLDPAHQVTVTTGNNKGTATAATAAEAASFEGAARAAAKRWSAF
                     QKICPINEEYENARLFLKAQASRAVPAPTAHLRTDTNERSPANSDEQLQQQPSPKPTP
                     ALLRLSGFVRRAEAMSDAQVLQKWM"
     gene            complement(<548765..>551059)
                     /locus_tag="LMJF_34_1220"
                     /db_xref="GeneID:5654886"
     mRNA            complement(<548765..>551059)
                     /locus_tag="LMJF_34_1220"
                     /product="inositol 5-phosphatase-like protein"
                     /transcript_id="XM_001686165.1"
                     /db_xref="GeneID:5654886"
     CDS             complement(548765..551059)
                     /locus_tag="LMJF_34_1220"
                     /codon_start=1
                     /product="inositol 5-phosphatase-like protein"
                     /protein_id="XP_001686217.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654886"
                     /db_xref="GOA:Q4Q381"
                     /db_xref="InterPro:IPR000300"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:Q4Q381"
                     /translation="MQGTNLPPEQRWKKEEAPRAPLWARAAVIIIEVIIWLVTFGTVK
                     RVKALEVLFHYSPHWRKRDRAEASIKGALRTGMGAARRLARPLLRIETEFSTESRSCN
                     SGGALTPLTATAYKETLKRRQQVNARIRSCLRDVPVDDLQAPFLVNACTWNVDQQAPP
                     LYEDTFLSWLIGQELTDEVKRYQEHKQAVLAYGGSLSKPHYPTGPSTMRSRKASASAG
                     SSEDARSPKRTTAEDFRLADQQRAAAILEREWQWIEAKFPDLFLISLQEVEMTGTALM
                     RESTQRSWEWADAIIETLAAASDRTIDYKKVQVVQLVGLVLIVLIQAKHVDYVSHVRL
                     SLTRTGALSVLGNKGSVAMRVTIYGKRFLFISAHFVAHKHNEKRRTSNYQAALKDICF
                     DMPVWSDDESEVLQTFLSAKEVLNHSIEHSSVQGNSAWDRLFSFGHSAFRTSFTTAAE
                     TRVLDEHDYVFFLGDLNSRLHALPSPLIKESVERGEYDNLLCHDELRQLMVSGEAFDG
                     FQEQWISFPPTYRYDRGTDVFDTSRKRRDPAWCDRVLFRVLENDTVTATSQEETSAET
                     PESSGSFEPPLHNVQSSLLLPCDSLTSGVWMSLEELESKQLFPSAAALTRAASAGSSS
                     VTSSDDLACERSLLHDVQNTADAPQNDFDSADKPFQCPPASLSCRAPTHAVWEQKRCA
                     PTFCAARRPRGLLESSSSGEVLAMPTRFPMITNHIHPLEYTCVSSLRQSDHRPVRARF
                     EVKVIAIEPALVSKVVKEVQQVIS"
     gene            complement(<554385..>559157)
                     /locus_tag="LMJF_34_1230"
                     /db_xref="GeneID:5654887"
     mRNA            complement(<554385..>559157)
                     /locus_tag="LMJF_34_1230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686166.1"
                     /db_xref="GeneID:5654887"
     CDS             complement(554385..559157)
                     /locus_tag="LMJF_34_1230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686218.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654887"
                     /db_xref="GOA:Q4Q380"
                     /db_xref="InterPro:IPR001054"
                     /db_xref="InterPro:IPR029787"
                     /db_xref="UniProtKB/TrEMBL:Q4Q380"
                     /translation="MEGFAVMSDAAADARMKEKDTHLANLIIEKRAAAKEIEGLKAEI
                     ADLRAQLQRATSRGLLPYAEGLSPTLAEEKTAPNNAPIEEISIWNEELIHTVEQLQRS
                     LIQLEANSKAQLITLTDRLNQMREENERLLRENDSLKARIGDDVLRQRQTNRIEVAFE
                     RSRIAARVRAAGLQRLEAAEANLMEAHDDVYHVQRWDAMLLPQRDVSFVFHFVSNVTY
                     PLGDVEELIMKVYQQFLFHSSSCCRGYRVGFYKSMEVFVFQAPSDALLFAKECHEQLV
                     RLSWFSCIENMPSFSTITENNKVLYKGPRIHTCIFTCSPESYVDPVSGKYAFFGPEVV
                     EAVQAAIEQCPIGEIVVNEKWSQLMCMQSRMREDRSALTESNVAELRECLGPMWNVVG
                     LPGAHHIIASILPSGLRGRRGVEASVLYPSRKYPCLEMKDSASVVCMVVNRMKGMLPD
                     TFEAPEEGRQKSNGGDDVILQQMRRRPNFWHDAVAKAPLHTSTQQPSTEFSDSAAKLL
                     ELFVVQKENSNLVTLYRKAEAVSAVLERNIMESEDRFEIRKHKTLHPSETAYICTIDT
                     GDESIWKRLLLKSISDEQFESIQNTIRGDVHNAAKVHFGFLMSGNYSDVFTYVFREVE
                     QALAFVSEMYIKVNRTGTKYAHTSLGKGRDIFLFRAGVVSGSMTSIYRNLENGVLKCT
                     GPAIRLSGTLCDLAESGEILAMEDVIRSFYSKKENLLDTQYTVKQRPQFIGSHDAPAV
                     VHSILPKPFAYRHKQLRSFGKAAVQNKNLYLPYRSVLAALTLRRDELPRQGVLDMMEQ
                     QQRRLEFGEMARMSAEDNYERGWQVSTATTSPLRSPWLLLCQPQAEEQSENVPARRRS
                     VRFRTMEEVDAGLMYVRRSTKPRAFLYCDVAGAGAITRSVAPPLLTLVWAHYNYIVQS
                     AVRNFSGYVAKTNSTTSYLVVFEEPTMALEAARQIQLEMVESMWPEELRVLESTLHVK
                     DIKSRTVLFNGPRPQIAVHVSDQYTWCFISPSSSPAALRSDASSKAKSEDGADGGSAT
                     AEPLSVVHISGVGVDETFVLGLHAHGGEIRLSRSLLNAVGAHPSGKLLLAQLKMELVV
                     TPSVIHSVEGTKEKSSTTTAEAQKTQGNSEPKAVKANVFAEECVAAVPRRLEGRLALI
                     LPSTSTAFGAAKRTEAALAMATASATEDNAESTSGEDDGAVSADDTGKLESVTPAAVT
                     TETTGLASATLPRAIVLPAAMMAQHAWLVEPEESFNPLPAALHSDWSTVTLQPANGLK
                     DLGFLEETSRIQTALQELLKMFPSAQLLAQAVEGVSDESASELPAEHQADSSTNAAAG
                     GAAGKKTSTENRSSTKIPAPPTVMSAARGSVNLTRRSKDAALSKACATSSAARVATRA
                     AAVRQYALFMDFSKYLITVLLNALEIGADQRSPPALPLPHCGQSSKITAVGPPPISSD
                     SGPSGPPGGSAGSASQKNSRSAVSGRVHGTSFRAIECSSSGSARESCVSSLPGIPPPN
                     GRLLNKSPAGARASLTPSPLSRDAEPQERGASDSLCEGFKVSSERPFLSALDYLDGAC
                     RTLAQLSGTELGKLAKIPAAPLSKSKAFPFRSNSARRH"
     gene            complement(<559558..>561174)
                     /locus_tag="LMJF_34_1240"
                     /db_xref="GeneID:5654888"
     mRNA            complement(<559558..>561174)
                     /locus_tag="LMJF_34_1240"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686167.1"
                     /db_xref="GeneID:5654888"
     CDS             complement(559558..561174)
                     /locus_tag="LMJF_34_1240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686219.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654888"
                     /db_xref="GOA:Q4Q379"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR002562"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:Q4Q379"
                     /translation="MMQTLRQQPAHLKIMGMDSEWCRNLPLAVVQFATSSHCFVLHIS
                     FFDGRTLPAAVKEALCDPSIIKCGVGVSGDVSRLQKEQNITIQSVLDVAQYSALFGLH
                     QGAQSNLKVLAKSVANLSIEKDKMITRSNWELPLSDSRVNYAAEDALASYLVGRAVML
                     KASEVTDMSADTFDAVQWLQRTSSKAAMELKKLQRETSKSEAEKRKKACPASKISGGD
                     ALLAQFRSGTKVRVLDRNGNFIFECSSGRGKFYVMEKNLAVITKHAKSDPRKALEIQL
                     LFDPKVKVRLCMYQALGFCELQDQCPFAHGASELQADAAALVDSQIPSCACCLGTKGL
                     LRHAITPPSFRKFMPPPQRQALDDDYLPVCKQCNSTLRLYYDEEMKRCYTQAEESSTM
                     VCDVKVAAKCTLYARLLLDADKLAKIPANRREELQQFVKQNWKSTLFEEFNSGFEIHE
                     PVVREAAFLERLGKIVPGDMRAKVTMAVLVGDDEEKAQQFNKRWRDYCFSTCGLMEKK
                     SNHMSYNAWKAYRAHNGEPQADDEEDGTPQ"
     gene            complement(<562602..>562880)
                     /locus_tag="LMJF_34_1245"
                     /db_xref="GeneID:5654889"
     mRNA            complement(<562602..>562880)
                     /locus_tag="LMJF_34_1245"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686168.1"
                     /db_xref="GeneID:5654889"
     CDS             complement(562602..562880)
                     /locus_tag="LMJF_34_1245"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686220.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1245"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1245"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654889"
                     /db_xref="UniProtKB/TrEMBL:Q4Q378"
                     /translation="MELQEIDHLLEELTALLASQESGRDDAAIEPAILNAVADYVEGV
                     DSTGAGLDHLRKALEAAVGEDDRSAKQRMKAAGCSRAIRLLHDAAWLA"
     gene            complement(<563355..>564431)
                     /locus_tag="LMJF_34_1250"
                     /db_xref="GeneID:5654890"
     mRNA            complement(<563355..>564431)
                     /locus_tag="LMJF_34_1250"
                     /product="putative NLI-interacting factor"
                     /transcript_id="XM_001686169.1"
                     /db_xref="GeneID:5654890"
     CDS             complement(563355..564431)
                     /locus_tag="LMJF_34_1250"
                     /codon_start=1
                     /product="putative NLI-interacting factor"
                     /protein_id="XP_001686221.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654890"
                     /db_xref="GOA:Q4Q377"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q4Q377"
                     /translation="MRARSLLRQQASAATLQPLRSVVAIGLRQEFDPHWPLPLPPPLP
                     MNKQKHTLVLDIDETLIHTYAMGLHDDSKDHTRDPALQGVSLIDYNVLLRPHLKEFLE
                     EVNQLFEVVFWTAGTASYCCAVLDALEQQVMQLPRSFYSYVELAKESRKMKSSTSHTN
                     FYALSRTQTLEQQGYMKYLPMLGRKMSSVVMLDDNVRSFPLTPRNGIRIDAFDPDDHV
                     LQRYIFALRRVQKEKPHEMEAALVQCLQQGQQEIARLEKDRALLDVLPVLRAVAQVPA
                     GQDVTKELDHWRDLDYVRCDDFMETMNVRSAVRQQILGVTLPERRSTPIPAQKLGFMN
                     SGFLESANAEMTLHHTRSVRHSKL"
     gene            complement(<565167..>567962)
                     /gene="POL1A"
                     /locus_tag="LMJF_34_1260"
                     /db_xref="GeneID:5654891"
     mRNA            complement(<565167..>567962)
                     /gene="POL1A"
                     /locus_tag="LMJF_34_1260"
                     /product="putative mitochondrial DNA polymerase I protein
                     A"
                     /transcript_id="XM_001686170.1"
                     /db_xref="GeneID:5654891"
     CDS             complement(565167..567962)
                     /gene="POL1A"
                     /locus_tag="LMJF_34_1260"
                     /EC_number="2.7.7.7"
                     /codon_start=1
                     /product="putative mitochondrial DNA polymerase I protein
                     A"
                     /protein_id="XP_001686222.1"
                     /db_xref="GeneID:5654891"
                     /db_xref="GOA:Q8IS90"
                     /db_xref="InterPro:IPR001098"
                     /db_xref="InterPro:IPR002298"
                     /db_xref="InterPro:IPR019760"
                     /db_xref="UniProtKB/TrEMBL:Q8IS90"
                     /translation="MQNQSASSSGARSKPTPLRRDCAGTKAAADASGAKRKPKTRKRG
                     GGDAILPGALGPSVCATPAPRTLFSLASSEAGGGAMAELQGGPTAAATVSVPYIYLQE
                     SAEELFSDVHRALNDPDRIQAPPLFVGVSALSSNVNAAAALASVESRTNFTYYSSGAK
                     TAKRRVSCCFSSLDPVRSHQHVELVLIRWKDDMYALPAQTVGLALLCRVLTELPGVEL
                     ITFNAQVLLVALLAYYKGTLWSNCVSDVRVMAWMAQLHVASTLSKAPSAVRAWAGGGT
                     AAAADGASDADTSVLYDYNQLLLHVCGGKLPPTVQLESMSNAGCFSHSTIIFAEGIGT
                     AAAAAAAAAPAPPLTSAQCQLAHQVYYLATVYRSLYGLLGSKGLLQAFLRQEKRIALL
                     LALLKYNGMRVDLHEVHRYQKSCEAEMARQRQLANKLVPELGEDFNIQSHDQCRKALY
                     EVLQLGKYLLKSGNGEDVGATGLTITKGGRLSTAEDTLRALARHHKFPACLLRYRKVS
                     KLMQTYIEGMMSYAVVRSSAQASPAPCLGSVNAETGTSESTKGRQQAHGDDEGAKAVS
                     LLFTSEAVDMNDDSPFVDRRLHTSSSGYSASGAEPMPARNQRSSREEASATPVGEVIL
                     PARGYATLHPNFLQEGTDTGRLSCVEPNLQNLPRNGITAAVAGNDAEEDGEEDLLGFR
                     RCFVATDGCVLLSIDYEQIELRVLAHLCGDAALVEALTTSADIHRAIAEVVFKKKPVS
                     TEERRLAKRVVFGLLYGAGPKTLATHMGVTVDRALHITSLLANAFPGIDAYQRRVIEE
                     ARTNGFVRTLSGRLRYLPDIRSTVLSRRSYAERQAFNSVVQGSAADVMKMAMLAVSKE
                     VLQRYDRSDVSLLSQIHDEMVFMVRKELLPMVVPLVSSAMSHAMQLLVPLSVTAKFGD
                     SLGNLQEWSVEHDLGVV"
     gene            complement(<570885..>576437)
                     /locus_tag="LMJF_34_1270"
                     /db_xref="GeneID:5654892"
     mRNA            complement(<570885..>576437)
                     /locus_tag="LMJF_34_1270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686171.1"
                     /db_xref="GeneID:5654892"
     CDS             complement(570885..576437)
                     /locus_tag="LMJF_34_1270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686223.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654892"
                     /db_xref="GOA:Q4Q375"
                     /db_xref="InterPro:IPR027272"
                     /db_xref="UniProtKB/TrEMBL:Q4Q375"
                     /translation="MPELPYAVVNGAYLFLVLQLLFLLAVVWQSVVAASLLFSFVSLS
                     CLESVRWGALDSGKQQNQSLHAEVVVVRPSTAEVSRKQNDGGTEVSVSALHATHKPPA
                     PDGCRASCYRCTPPPPREERSSVTIASCMKCDGDLASPDMGPPSTSREREPCRDAGNV
                     SAGLYSPIPNGADNTLIYFSSASNGPNTERLIAENVCTQGDQDDAQAEMQHRRRGAPV
                     SKSQMHVQSFYLAPRSGWVFATAVISLATVCASVVLFGLLYSSMQVDASPAGAVLPGW
                     ATTPVAKSLLTVCVGIQVHSSNPKLCFCGATACLSVVSLTSWCLLLSRALGGCVQGAH
                     KAASLVVAGSRVTATSRWSRVRVGWNTALRLFTGAVTSAPYSLGWVGAAGVGQGTALG
                     LLSLAVVMVVLLLSSSVGRLQRQRVGHPRQRLWVLYTCMLLCLWEVQMVVLLPPVQHS
                     LKVASVWARHGRWLAAVGAVPAASPDSMLRWRIVQAIGLWWAGTEFVCYHAAAPATSQ
                     VASLKGGQKLRALLLRELAQRDENQWSRAVNQQRAAHGKLQQLRLERDIYLYRPSRAG
                     SNDWWRHAQRGRSDRSAHAPFGSNVSHCCWLCRDDPQHLPTSVGGGRRDGHECNPTLF
                     HNGPAPSSAAGVHAHDTCWTAAAVGSSSLYSNASVYDCLAGIRAPWQHSENASAQPSP
                     ASAEGDSAAVLVTATAAVVLSESAAEPLKLHNLEVERPLYMWQGWARAPTRSPCKDGG
                     DGDEDDTGVRHSSCGSYSNGEHRAYRWSPPPSHSSAHSPYTFSVTTSIPLPGHSRLHG
                     AGCSSARWPSMIHGTSVDISAVGHASSFAEEAAHQRPPLSPEASAHPEEVRAEHAPVS
                     LSMVSAEETRRAADARPPLSSLLARLRGRAESVAHKAVELLRGYLWRHTILLPAEVEN
                     SATECPAGPRADVVHPQRQPRRQPVEKVAEHTQPAFASATSLTAAEGITPPPGIRVGA
                     PSSTVSRREVVHLPSLWRLLELYAVQYWSSLCALLMLSQFAVCGTVVNLAPSFVSIVY
                     ALLQRPWPPLWYWRVQLLFTALAFLAKGAARVYLLTMGPSVSLTTCRWLSLLLLRVGV
                     GAPSAPVASLSSPSSSTMFGSESHRDMWVDLALSGCVVTAVAIQWAVVYPDHCVFWNC
                     KGERDATANVSAAAFASLEPIGPPTREARQGKPHRGVAELWRSCKRHLQCWSAHRCGA
                     GADYYAAQLFFDSLSLALFGWAYYAIVPEDIATSEGNFLHAVQQNHLPGIFVATALGL
                     VVVLFLERILYVLHALFAKYLLHFFLAAVYHVLYVLWRAAQESKGGSGATPSAATTAS
                     VSLLLSAKFASLWCGALQLRHGYALHHLHDPFTIKTDLLHWLGHVSFRAVPFLMELRV
                     MLDWSFSATTLKVQHWMLLEDIHHTVYRRYVDMHDLYHTSRHHGRHFPYLVRLYQGVL
                     GFTVILFVLFFPLFWYSTFSPQVRASHVTAWATEVALARMSSVPLFSADAAVRPFSFH
                     AAATISLGGASVGAAGLLRFAAVTGTWQTAHVASCSTRMWSYTPAALQELVDRLGKRT
                     EVVTLLVRHRVTRNRASEAAMITVGLEESYALPPTSQALLAEALNAWRTMDDADSAGT
                     AEYSASAWDPIEVPLPLLYSPYVLSYGTGVSFLSGATMRRANCSLTLHRTGRYRGFSC
                     VKCAEGGQSSPATATFAAATTANPAGSSQIASGAEIREMSSPLTFVVASNNVAIVQSS
                     FSLIPNVGIIALYTSFVLVMSSYIRNYFAGDAHRVVLLQLANPEPVTELLRYLYLARS
                     SANDGQVGDLALEQLLFVELLDLLRSPERLLRLSGRRVDDYAYSTYRQVLYDATRRPF
                     APPGEGRG"
     gene            complement(<577095..>578135)
                     /locus_tag="LMJF_34_1280"
                     /db_xref="GeneID:5654893"
     mRNA            complement(<577095..>578135)
                     /locus_tag="LMJF_34_1280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686172.1"
                     /db_xref="GeneID:5654893"
     CDS             complement(577095..578135)
                     /locus_tag="LMJF_34_1280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686224.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654893"
                     /db_xref="UniProtKB/TrEMBL:Q4Q374"
                     /translation="MWGFEAYAEGLSATLNIHGAPLTGVAPQAGESAPLAPPRCLWKK
                     NRNNYLFDAQGKLLSAAEAHSPTIWRTHHAFSGRCALVNPTAPATGGAAAQSFGAPGW
                     AEQAWTAYQSWSVGFRLSSTTTDEPHILLSVAPAYFPNLVSATGEIRKADAATLASLP
                     CAPSAEEEVIYNKRMLETPLIWEEPYALSVECTTHGVFLWSDHWGIFGRKIADRCLEV
                     RQGEVRQSGIATLPSPGPSPSSAAADEELALVAYDAALRLRWSAAGPGSRSSTDGGSA
                     RAVAPTLSVELKTGGDAAAGGAAPTCEEKVGEELWQHLVDLPLSLDEVACKAAFRPYV
                     TLMEGGDAVELL"
     gene            complement(<579666..>581813)
                     /locus_tag="LMJF_34_1290"
                     /db_xref="GeneID:5654894"
     mRNA            complement(<579666..>581813)
                     /locus_tag="LMJF_34_1290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686173.1"
                     /db_xref="GeneID:5654894"
     CDS             complement(579666..581813)
                     /locus_tag="LMJF_34_1290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686225.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654894"
                     /db_xref="UniProtKB/TrEMBL:Q4Q373"
                     /translation="MRARARRRALQALVESLCAGESTIPTMKWRRQYLKTPGIGPAAA
                     SVIANHIQGLPVVVSGSVAPVPQPLEKRPQHHIRTLDMRALHAGDDGFAEMMSALLDD
                     TLVENAIFAGNSITDDGVRRLVSHIHMYNNTPTVNSGTSAAAAAGAAGGSVSQKTLPC
                     KLKLLALTDNFITSEGIATFATVAPLFLSLEQLEVGRGQSAGGGDVDDVRDTLSAQHI
                     AALSTYIQRTPKLVTFLYKGNGNYYARNGFTPDGMTAFVDAVVGNSALKELYLQECFS
                     TKPGMVGPLTVQAPRGEKEAVTAEPDDSWAPEKLQQPIQALATALNAASSNLSTLILR
                     FPLSDEAVQALSIGLAQAPHLLYLSLRSCDLSSKALGVIGDALCTNKVLRILDVSYQS
                     NTIAHPAFLAELRSSSKRWMSFISTAGYTAAEMARQDLSSGGSEVLSGEERQHPLLPI
                     IRSLHKNRSLSQLVMLGVNISTDDIEELCACIERSSNRTLTEVWYTRVGSDALHMKLE
                     DFLASNRQCGAGGSAAAGGGAFGCSSLGSTYGALALPVSRSSGTLFPDAAVLSDSSES
                     PTKSTKERYSPVRNRKTDIPHGLTPSLVSIPHRPPHNGGNSTISDRGGLADVMNGNRR
                     TLPSSLESTQTALKAVTVNAEPFAAESASPSQVAVSLLCNGLDASVVRLSSTQRVNGG
                     DKSCLSLHSGDNTDDAGTAPYSSQMPPERRKKQ"
     gene            complement(<583509..>584579)
                     /locus_tag="LMJF_34_1300"
                     /db_xref="GeneID:5654895"
     mRNA            complement(<583509..>584579)
                     /locus_tag="LMJF_34_1300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686174.1"
                     /db_xref="GeneID:5654895"
     CDS             complement(583509..584579)
                     /locus_tag="LMJF_34_1300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686226.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654895"
                     /db_xref="GOA:Q4Q372"
                     /db_xref="InterPro:IPR003718"
                     /db_xref="InterPro:IPR015946"
                     /db_xref="UniProtKB/TrEMBL:Q4Q372"
                     /translation="MYRCTRVHCGVLAVLVGELKKVPAYVFYKAREGAKTYVDSASKA
                     IEFLKGEDPNEDPVMRGKRRQHRELYQAVLREQAAKAQEDAAQRRARLSWKEKLQLSF
                     QEARESVTQLTSAKAGVMALLQHCTASHTAEVALEQGIDVKNVQMVFEKAAASNSVGV
                     EEIVVGYIDAPGASHEEVMAFAEKLHKVCPVAKSMHIEWRQGSADSRRHEDGAVRRAD
                     GLHREMEQAASGVEWAESRTGSNLGGRSSAADAASTTSVESMPAGMPGSRRVQSSMSS
                     RATRGGSLRDDEDKLHFPGVEKRDTAWDSTRHGSSRAKEPSTETSTASHRPPPPESAS
                     AATTQPGACSSDPASASPFPKP"
     gene            complement(<586762..>589335)
                     /locus_tag="LMJF_34_1310"
                     /db_xref="GeneID:5654896"
     mRNA            complement(<586762..>589335)
                     /locus_tag="LMJF_34_1310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686175.1"
                     /db_xref="GeneID:5654896"
     CDS             complement(586762..589335)
                     /locus_tag="LMJF_34_1310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686227.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654896"
                     /db_xref="UniProtKB/TrEMBL:Q4Q371"
                     /translation="MSSSLPPVRVRGTKGSGRAKMEMSKITAEALASINHSLFMKANL
                     SAKQMSSRVMKEYLQAHRAGAHNIESQSAEERKIIWQSFVDASYLPHSHEIQRLVSYV
                     QLMESRCQQKLQHAKTVTSCALNGIQQLLQRVTDVGTQIRKDTNVLAGKPDMLLSSAG
                     AEEWSQSGVKAGSAASAAMHALGSPVRDVCGLDVMLSDPHPPAFRISQADHDERERLN
                     RVFISVLESIGADENERRVSGSSPSTSPTTQAANGSGTQSTTECPPLVMGSRDDEGSA
                     PSTQSSSPVSPSTRLQSRQADLQCVDEKRNDTALSDLQAERMQYVLELQQKLDAVGAA
                     FVQLMNRVQVQHQQYQHTIAAQKSVLDAQATRLKLADDVLRDTVAQGAIEALSAVALA
                     QQLSLELRERMEISERNMNVALKTLIGQSAEVCFDNGILQEYSSLATKKENCISAFML
                     QMERQVVEQADVLWKAQQGVEKIWRLRLQWQLPHSRVAASEAGASEREPEGAVGNLAP
                     LPPPYKARLEECDRATLLTFLERLTMHCPDATTHVITALDERDAFCATHPQEAAASRE
                     ELARTTAVLQLIRKLDEEGRLHCSAQHTGEALSVRLRRLVEQHDAFIDFNEAYARALV
                     RQEDAVRRKYLPDAVAFFDSRTPVPGQESSATSRRLAPVKAQAMLEGRSNTVASCSEA
                     APTSAAESTKNSPSRPAMPYLSLWTRKQRELRTRQCETGAINAGVGSSTVGAIVGYLE
                     RRTPHLAAATSAALLESAPSSPPLRLHTEMSASAPTCVSTGLPLPPVPPRKGLASYVL
                     STYGSTAESTEDDAGTKRQQHTQQAERTAQAEKNKAAMPFCDNHHQFIHREREIFMQL
                     D"
     gene            complement(<591779..>594130)
                     /locus_tag="LMJF_34_1320"
                     /db_xref="GeneID:5654897"
     mRNA            complement(<591779..>594130)
                     /locus_tag="LMJF_34_1320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686176.1"
                     /db_xref="GeneID:5654897"
     CDS             complement(591779..594130)
                     /locus_tag="LMJF_34_1320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686228.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654897"
                     /db_xref="UniProtKB/TrEMBL:Q4Q370"
                     /translation="MRSLICHHAVVDFGVGVGASPMAQSRGIYSFHRLTRAHALGWGS
                     SSIFRGFLIEQGGRRGYGTTALLLKQHQPTNTGASAASSRTSGQASRKQPRQKAVADY
                     GAAEAVVEPELDTVTAAASLPLAASSSEAVVEAETHTASSVPRHVSGQGAAGRPKAVK
                     RGRRKQETAATSATRCPSTPLANSVSSPSTVSSRKGPDDAATTIAPLDPPASPLVAGE
                     DGIIVAASSSRGKKPGRRRSTGSFLPSDAASSAAAGLEPTVKVAANAEDTAALTPSSL
                     FGSPQPVYYTHMMGTTPRTEEQRVAERCSITKLIMVSGSVSFLSTTLPRSEGPLKMYV
                     KDLNRAQAPTYDSVRALGQDATHSQSNAAPSTGHEGGGSDHVAAGTHTLPAISEKQFL
                     ELCQRLCAEQLATNTVFIHVREMEQLVPPLHLQLPAVTDADKSESVDAPAAPSGETTA
                     STQREGKTRGGRGRRRGSARAANSFTAPASTLTPPTPPLPALSPVERILALQAWKKEA
                     ARRAEETQARYLVPAHYHAITRVRFHDPHQTDLTVAMGSGWCKSIASVLRAIVRSMPQ
                     DRRGADLGSSDTDSSTSWLAAEGEEDDGDNTVPPFPMPDPSVYTSEVVTQAADDAPAP
                     EQPGFLTSPYTVKPLLTVCASCVPRREAWIGTCAPGPSAAPASGAESGWNPYSVRAVP
                     TVPRYSTRITIMLEHDDMDPSDLVSLAEISTTRKSSSSSGAEMHQSRDRQHDASVSGR
                     SVDATGLQSAAPNRKSVSPDEKVHPAPKKPLHLYCLVQDAGEY"
     gene            complement(<596461..>597681)
                     /locus_tag="LMJF_34_1330"
                     /db_xref="GeneID:5654898"
     mRNA            complement(<596461..>597681)
                     /locus_tag="LMJF_34_1330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686177.1"
                     /db_xref="GeneID:5654898"
     CDS             complement(596461..597681)
                     /locus_tag="LMJF_34_1330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686229.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654898"
                     /db_xref="GOA:Q4Q369"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR014851"
                     /db_xref="InterPro:IPR027243"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q369"
                     /translation="MFQALMRRKFVVSLEVSNRDSAYEWMLRWLSHQKSFKVQQMSVL
                     TRTASFDHSSSDRTRAECLFGPCPNQRHYFFYEGRPLTLTRRRRDNVSPGYSDDIFET
                     LEFTTIGTSAMVLQKIVKDAQQFAEQEDSDHTVVYMNGGSSWTRQSRPRSRRAIQSVV
                     LPEGMSEFILADVKKFLNSSSFYRQLGVPYRRGYLLHGPPGCGKTSFVMALAGELRLS
                     ISLLNLSNRNLNDESLTSLLNEARVDTIVLLEDIDRAFSNECNVTMSGLLNALDGVGA
                     QEGRLVFMTTNHVERLDAALIRPGRADVKIEVGLLDVNQSQRMYRKFFPKATEDMVEA
                     FGREFPPHVISAAQLQSHLFFHRDDAVAATAALPAFISSCRAFEASIEQMRSEKARLQ
                     RSLPRAPLLDIDTE"
     gene            complement(<598417..>602382)
                     /locus_tag="LMJF_34_1340"
                     /db_xref="GeneID:5654899"
     mRNA            complement(<598417..>602382)
                     /locus_tag="LMJF_34_1340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686178.1"
                     /db_xref="GeneID:5654899"
     CDS             complement(598417..602382)
                     /locus_tag="LMJF_34_1340"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686230.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654899"
                     /db_xref="UniProtKB/TrEMBL:Q4Q368"
                     /translation="MSSRVDESDLTISTTKELVTAHPEACAVVYQAVCAEAIRVVFAL
                     FTLSQSGVGELGNELRCCRTAMSERWRSPVEAVHHFAPQCHVRSSSLFQHTSSHDGTP
                     ARPQSQGSGEQLRVLSSSTEARGCITHASLYGLLTAAHLLRCSTWTAAFLVQGVWVEG
                     HSALAQAPQLLAQARAAEELCTREPGWCATALVQFTEWLLFSLSPHFPSSLVSTLPSR
                     ALSVAEVEQTATDCRDVGLGSWPPVRSAADGALRDASMSAAHQRTVFVADPLPLYFPF
                     LPNGKERSRAFASAPWHLSRVADALESGCAHRWLLNDLPRWCAQVALEEQSKRWHRTS
                     LLRSSLERWRARRGLRVVAHLSHAAASAPVEDPHSPAMAADSFSPLPQTRTPLYAGVR
                     KVVEGVLSSPSVPGDALETAPLSHTIATQTMAGTPRIDKVDSGGNGEPPAWSFREVLA
                     ADVSTIADDTAPPPSIPSQDTQRTSLPAAEVFAYTGRADAAASASNTRRLDSVLRGEL
                     TMQELPSRNTGVEEHTSSRNEECGQNQPARQRKTPPQQVRGGAEDALATSTPASTSSS
                     KRGPSADASHFPAASNLTASSAPALSAREAKQEELARFMAQRRENTVLRQAFLHWRDR
                     RLYESLAVRLMRIQRRESTRARCWAQWRRRRGAIVQRDKEMRDVARCDVYTEQKALQY
                     FRALLQRWKTAALVRRFRISTAGHRVLRAWKCSTRFAQAQRAIQQQLIGARRVKWQAW
                     TRWQERRQECVADRHRGLKHGAATLLLMRDACVRRQKSRVATSQCNIVVLKRALQRWA
                     LQCAIATRLRSFIESRQPRTTLVRQAWKTWRSRWLARQLQREQEHRLRAFRVARLAEV
                     CFARWVQRWRRETHIRTCVARQQCRHVLRPLFLQWQQRMQVCFIVRQAQEELALKVSE
                     QLCGRRILRTWRRRAAQHAAGRRGLLEALMDADADRLLRLNRLARTFYHWRAHGFVLR
                     RYHLDRRRGLPVAAYGAAGMGSGRGHEAVFSIAGRTGVGHHSEADVDTEDCENFADPA
                     TTLPLPPPPSSAASPPVLPGRSRRGRLEYARRVPTRSAVSARSPKRLPACRSSATSVR
                     QSTAAAAAARHEPTSTWRGSRDDEGRAAALSAPHGGPRVILCKQLAVPPRRRALALQR
                     QLLATQLQQRPLFSRDACVRAASTGSRSTPPPRPVFSEPPYSTSAAPRRTTRPRTPPP
                     SSTPGQHWHSNLSGSDAESPASRRSRTATPLFTARDAQCALRSPRSAALVESPHSSPP
                     QLRQSHSGAHVRGYDDCATLGSSSASSTPAHRLLGQMERLLRRIRNLEAGYPAQATAA
                     V"
     gene            complement(<603790..>605511)
                     /locus_tag="LMJF_34_1350"
                     /db_xref="GeneID:5654900"
     mRNA            complement(<603790..>605511)
                     /locus_tag="LMJF_34_1350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686179.1"
                     /db_xref="GeneID:5654900"
     CDS             complement(603790..605511)
                     /locus_tag="LMJF_34_1350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686231.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654900"
                     /db_xref="UniProtKB/TrEMBL:Q4Q367"
                     /translation="MAAARQEMADLLREVQKLQKELQPVRSAVTALQKREADTPNAAA
                     AGASLKKVATRLESVKQKYKPYLTRLQELLLDEVPSYLQQTPLLAADAESLEHRPGGA
                     SRGTRNATNERLTAGSSSSVTKNTSDDAAHLLQQVCPPSTPHLLQPENLRFTHQQLRL
                     RAEMVEYLIETNRIDIAEHLVREYGLPLQWFPRLVLLHRERIFGAAADEMESSQIPPP
                     TGAAVGATVAPVAAGHSRPLPASSASPPVTPATRSRVAAVPPKSPIQLSLTASPKSSV
                     TGMPTPSLPRSPAPQPTPASSAGASTPVGQHLNRSAPSPASSAHSPPTPQQQQRESGV
                     ASVLPSQAPSNAGTAGAATAPVTMPDLVARVVSTAMYLKDEYLDRMVLERTLEQHLGT
                     APSSESASATLTRGNSTPPPCSATPLERYKACVLSRIANIPRHHLHTQSGDDVFDSAI
                     MNIIEDLLVYGLQKWAEVDAVTTADAEEASAESRKKVELQRTLTTDTLLTPQEMLLAE
                     KVWSEEILLLKRPTRFYCVESGLTTEDGAASALAMPRARTSGEVVSKCVAISHDALDA
                     TVGIFIT"
     gene            complement(<606601..>614436)
                     /locus_tag="LMJF_34_1360"
                     /db_xref="GeneID:5654901"
     mRNA            complement(<606601..>614436)
                     /locus_tag="LMJF_34_1360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686180.1"
                     /db_xref="GeneID:5654901"
     CDS             complement(606601..614436)
                     /locus_tag="LMJF_34_1360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686232.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654901"
                     /db_xref="UniProtKB/TrEMBL:Q4Q366"
                     /translation="MALLAKVCRDGVVSDAFTHEVKKRFSAPMEVTVAPPAAALGPAT
                     APAIVPQAITTALHTGAQWQTAVAPQATLAGFSITSAAPAAAASAAYSTLARAGEPKQ
                     QQEQRRLQVEQASEFLQTLLLCDSGYNNSEAPPVDNPASSQWTESVEEVKGLHAAVAT
                     VAVSAASNLISFLKTSITANNQAGDSEASSSSLFIDNRCKRPDKSPLLLAAQCLYVLS
                     RHFQLTTSVVKEALDLMDALYVLLKNSLQNRVVSLSAFSDNVDTCCLNTLIWLCVFSI
                     VNMAAVWKKLRSSTGELRLNELIQSSVAASIEATVAALRGKLRESVQPPSTGVGGGLY
                     RDALTDARRRGGGERLLAGSGGSRAASSASAAAYTWQVLVDSYLSILTLAEGCLLRAK
                     GSEQGYDKALDAFLGARMASLSSPHAAETPASVAVHRGKVTKRMVKLAPVPRTLSIPI
                     GLLYIAPYEMMSYLFDEMLPLLRHLSELEVATHRRYCEQLEELPRLPSFVRSGSAVNR
                     GGSAAALEAYYGYQQRGAVQHGRPEETNGEEARLLKVTRTGAAGEVVGEPFTSEMAHL
                     LEALAICLQHLPPEVLNPDLDSDCAATFFIFKNFVKHMRQVFATQRSSATSAAVGAGG
                     GGSSSAIGGFGAVWENYTLKLMTKFLEVMAMIGRNPQYTQRVVVLLTDAQTECGEMQW
                     HSLVSQTLECAGLNSGVIGAPGAVGSDGGAASATALAAAAQKSSAGSVTSGAADGDDM
                     YTLLSTAPGVNGVPRALHRQFTRAYAHKCQRHYIASFFLLLRQLFGHPTLRPIVSAHM
                     NLALALTFLSAPQQSQLMLGSTLSLISALITNAADAQLVWSFLEQRRLLQQSSVCTQQ
                     HTHAGGGSARLAAYERFAASSSASATGQREPAAHEEALSIIGHCQCECTQGTYDITIG
                     FLNLVTALFQHDQPSMAALPVYNTVTHFISHEILRGVLKRMFARPHERYTVMALASAA
                     LRQALLVRFRSNESARTAVLPFATIMAINKAPTDVVGEVLKVILDASDAPYELLSHHR
                     ASVRQAMRLLITAIQAAREQTIELLLFDNRTTLNTDLAVRVLGLCSLHDTVMTKTTLQ
                     LLVLFPFETANQAAHYWAGLTHKYTTVLDSFTQLLHPLNTAPVVVQAPPELAQLDFEP
                     LELVPGWSAALLTETKSLLLDLLMQHADVTEPSLTAWMGGFYGEEFSRRGRWGQPSVS
                     AAAHAVSTHGGTADGDGTAGEPRWWRTTLLTSVVEGACDCEVERAHPALAVKYVKLLY
                     LLRANRLYGSLVIRPFLESVCQTLFLRLQHYRASQCTPVALSKYAYVLKLLALEACYT
                     YRTAPESLRLAQSTTITSIAVEVLLSLLHSVGNSNGALADGGAAAPSDCEYTAIEDSG
                     VRSLHEVDGYDSDTHASVLSKRDTDEDKDRQWNGDVAVMSRDAAVDITSWLPQALQVL
                     PTFPEKLPAVAGGLSHLVPAATDGVVQYDMTSLYSAIQAEQARTNKPPMTMSELRDRL
                     RPFIAANDCFFSYAAGVSFVEGWCQLVSVSCSVVKGLSVSRLRSFALCILRGLDATTR
                     LTAAAQEQVAVRLCHCLSTVMAHLRQTVCASVALSLTVPQNAEAEAAWYNQCSGDYPG
                     VQGGSCAPRDAARATSHLHGRYERRTVPRVSAQPMTVATVPGHGCGGEREVIIGKRRP
                     RDESRHVTRQHRSGQGGATVGSASVGIGKPFATHAGELSNFFSAANRSQLAQTLLQQR
                     GAERSGAESVSVAGEQTTTRTPWSRLGVTGATVLLEPLVRALVHWGTRISTIRAELYL
                     SLLCLAETSGVNLDDVAVWRFQRALLDVVCTDICSNSGSSAGGRGESCRSANAAAVQR
                     HNGVNGAAPANGSDSGAAALPSQAQQAVALLVALLQASAPIRDEFCNPDPGSGDGLGK
                     WALRCATALLESADHAVCNFFAGNGAQVGTLLWHLRSAFDVVSVISLSHSSQVLHSNL
                     LHSCLSMRVWQYSTLVVLGYSQANPSFDEVPRRSLVEQNKEVLQHLLLGVVRWVNLLL
                     SSLGDAAPLLYDVQKFIRDNRQLIDHVFIAPAAISSTIAGSARLSASHLTLCAELSDC
                     LRALSCSVLAVDCRSLVDGMALTELLSMLSSDDVWRRGPTELYGFAGVDNGEGGLGGA
                     AAGASVASPAAAGAAVSDRNDDNGREDMKGALAKLAEATGTAAAHAVSAAERGRDVVA
                     LTVRNLAHLLLNTEYGQRSSEDAGVFIPYADSTPMLRHSAGKRQLVAKIVRHVAQSLV
                     QTSTSAVREFRLECYLYALHAMVCLLHSFVLPLTSAVPSQKQSSYPNNLPEDFVRYLS
                     ELPLGEFADTLRQAQEAVYQLREFNTDYRGGLRASRVGANAWAIGAASAGPHTLSNSA
                     RVANASGAASTADQRAAVSPTPSNAPSSPPATAHGGGGISAAFNVPLTPGLLPAADGR
                     LGGRDTETGPQSSAAAELAPALSARHESHSGGPLSSTAASHSGGTGQDPNATVAFDLD
                     GSSSRPPHAQGQNDASARPCAVSAASNTQTLLLPVTADGEKLDPDITLWELLPERGGA
                     YEGEWTRLYDSATAHDVRGTVVGGDLDPAGIHSAPLQWKDVLNVENEVRQVKIAIANA
                     LRATNGAMCIVRKHA"
     gene            complement(<616568..>617542)
                     /locus_tag="LMJF_34_1370"
                     /db_xref="GeneID:5654902"
     mRNA            complement(<616568..>617542)
                     /locus_tag="LMJF_34_1370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686181.1"
                     /db_xref="GeneID:5654902"
     CDS             complement(616568..617542)
                     /locus_tag="LMJF_34_1370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686233.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654902"
                     /db_xref="UniProtKB/TrEMBL:Q4Q365"
                     /translation="MFRVHRPAGPSCGHLSDPSLSSESLCRAVKLEGQPKRGRTPCED
                     EVDFKKLQARKLDAQSRLRQQIEVLSGLESNVLDFYYTHMVRFEPLLELASQTSPSEA
                     MESVSARDAVLGGNFAELFPELKSTTTLTDTCDESATLSTHEPAPSPSAAVPAKTRYY
                     YDSALMRLYREAAFHEKNLAHRYACEKARVAATELSVQRDIVDGSLAEQLRTEHEEQE
                     ALNKLIGSLAEVTAQCAAHQQSLQVTDERIREIGKAREACLARKTVLEAKKQEQMDNA
                     EHIKEEVAAFRRCVEGAAHELERRRRINRSLEDEIGRRRAALKRRKKE"
     gene            complement(<618568..>622479)
                     /locus_tag="LMJF_34_1380"
                     /db_xref="GeneID:5654903"
     mRNA            complement(<618568..>622479)
                     /locus_tag="LMJF_34_1380"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686182.1"
                     /db_xref="GeneID:5654903"
     CDS             complement(618568..622479)
                     /locus_tag="LMJF_34_1380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686234.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654903"
                     /db_xref="UniProtKB/TrEMBL:Q4Q364"
                     /translation="MEPETCEASAAAAAGSETSPQAHIIRDPIDPRQELTSPSSNSDS
                     HYHSLRAEEQNRGILSSLPSSANASASTYGPGQVDFGVSKGHTAAFQQPQGRAEHTVK
                     ASSNHANPKAPQQRMQASTPLTPPPPTSTVKTVNCIYTPLRLDSQLLASPWSGYGWPA
                     VQAPSPTRAGGASAPVPLASSYWNANLSPMPHPSGSPTAYNSGCRIISPSIQSLRLVP
                     PHQQHGNDGASPAQLSFSNLGHDNSFLAASSSFASPSSLGVVHSTILDAPLQVSLMPP
                     PYRGDRPFFSFGNSIMQSAPLTHTLSPSTSRGRSIYLDAMMELAHHKSEVDHPLAAVD
                     SGASYGHDTNRLRGSGITSSLGDVAAAGGPSDAHLCNFAVSASSEDVSVSNTEIVVGM
                     GNVDWRRLEQPSPGNSFLLDQLTARSGILRTGSLGSHANTLDNESDDIDFGEEGEEGT
                     EKARQSSNRTPEALASTGRGTQAAAAVATAADLGEASSQTFGEASVPAPLEHTARSDG
                     VKGEEDGFSLPASALAYSDGSNTMAAAASVTALSRGRAGEIATPLVNLPFRPSIGPTP
                     PAGASAVATAGRAVHDLHLFTPSPVDRGVHVLGAMRDSATRNSPSEQSTSTLSLIPAV
                     EVWQASPTIMSAWHSSNLTPTTALSTAHTLRDLLEMLRLLQSDIDNVGNQLSVYEQMV
                     RRWIRNTLSMLLLLTTELARSVALAVMEAPEGAADQAAAYTRLQVDIAAAAASCDEPL
                     RATIDAVKREQANLEPVLLTTMLARGAIASLLQFLEKPYVTARAQSGATTATARMLNG
                     MCAPSKQCSGRVAYGPSAPAVTPLTPERIEELMDNKILQEELNSNWPHFTSTYNRQVL
                     RYLCLRVLYVALSRDDNSVGDVATEQQGCRTTTDTDAPATASTALESVVSAWVEEQVL
                     QWTAQRPAITLQHRHATPTNPTLDDAEGAAIREGLCGELPSFERIAEVFSVFCDSDGW
                     RWWYNLLGDAMSCNLHVRDSKRIYDYVEKQLMDSPAAPAVAVRTALSLHEVKVEDVEV
                     ELEKVECRLSAMEERGKAQRVNILQHILRRIFVLSLVSSVQRTLGKDTPVSGAQLATY
                     VQLQRKSLEDVEAQLRTHHTECTAHAKHIRTFVSLFPDTASAAQTQSQSRPWALSKSA
                     AMSGMRTHTNQLQHGPFSRSSPDLQADETPLQWNCPTVASLAVLLARPRLDSDAMERS
                     EGLLAATAADANMEGSEEDRTRAAAALARDVATRSVATVQSLCALLQSDVHVTESHQA
                     YCASPTKMSAPSTRALRRLQASLSEANHCIRACITSLRIVD"
     gene            complement(<626027..>640417)
                     /locus_tag="LMJF_34_1390"
                     /db_xref="GeneID:5654904"
     mRNA            complement(<626027..>640417)
                     /locus_tag="LMJF_34_1390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686183.1"
                     /db_xref="GeneID:5654904"
     CDS             complement(626027..640417)
                     /locus_tag="LMJF_34_1390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686235.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654904"
                     /db_xref="InterPro:IPR009543"
                     /db_xref="InterPro:IPR026847"
                     /db_xref="InterPro:IPR026854"
                     /db_xref="UniProtKB/TrEMBL:Q4Q363"
                     /translation="MFNKLVADLLTSHLGEYFENIDREHVKVSVWNGLVHMRNLKVRQ
                     DALRFLDVPICVLMGTIEELTVVIPWTHLRSESVVVQIRKAQLILADKQTAGYSIDQD
                     VREARARKIRELAATDEALLMAFREGLWQASSSASAPTSVPPPTADAVDSSDSNFTAR
                     LKASILNNIRIEVEEVWVHYTSCVAGAAPGGDDVLSGGVVGEASTLEPPQGRPQHSMR
                     SRPSPSAHIDASVQLSTQQASLSVQIKEIKTCGCNERFEPAFVTPGERMARQLISLRG
                     LAASLRISASSEREVSLLKPFDMAVELAYQPVYTDVSTPQYMAAVRMDDACSCTVTSE
                     RCATCYGLVQYLVHVRQRQALRRLRPIGERVKVNPRAWWRYTLDAVRQQVQNNRTAAL
                     ASARKLTPFSWRAYTSMKQKRDRYMRLYLRQQRISLRATGWLEPLTVDEHVELVTLED
                     ELSIDVLKLGKRLAMRRVGVERVEYEKLLREKRAAAGAGETDTPSPVHPSAPPAQMLA
                     PVVKGGWFSFWRSESQPTASASVSASGAANDGLSEEARAELRELVQLMTAEQWTDAQR
                     AVIAQEFGMSPEEAKALSRSGTSLPASIPDPATADLSKKPIRHRSVPSCAVFLHAKEL
                     RVELQSRTLSAPSTPSLIRDKVSTSTTAPDTLAQVALHTVQAGVEWGGVSAASGSALQ
                     AAYYWGAMERLSITAASLAAPETRQSTHTSTEEVILAIRRAGVPQDCSQSDSSCFLRS
                     TSGAGSPRTPAVNMAEREASVYQSRLHTFSPLESCWSIVPDECRRHAAVKVEWTVRSA
                     QQLTSRTSALHYVRVGLALVHVVIDVVPLRHLSHFLFTVMWPETALSHSAASGSVGDA
                     QVYTSPPIDANVDGDFTALTMPVSPRMTYAEQRCATDEDARLVVLRRRVEQQRSIDWS
                     VAVDAMHISLSEVPQVQGCELALTQLCLRNDAVHRLQLQGRLRREASEDHSSASTSPT
                     TTTTAAAALGSLDTDWIDCTHVRMAAARLSVFFPRNNPSADGPLSIERGVLLPDTAIV
                     AVVERSLLGRCHPNLPQWNLRISSSDTVNLAWSRTSLSVLTTACTMLTDLAASVQSTI
                     QECGARQIGAAQSPEGEAVYTCRVRVLPHATGKRFWHGAHGHQGAAGDVDDDAPPHAA
                     DELASFYKKLHPFSAARQHSTVVATVSLPQRVSVRRGVCVVYHAQRSTFPAQYYTLQD
                     GCTHVLLDGERDSGVTTAASVPAGPCVHLYVSQGGRNHEEALARGYRDAKRFLLDKLK
                     VPPALLENAFWLKQTVNTWLEKGKAVEGDHNASSQQQARTALSRVLAGTQTVPCRYIA
                     FQCASDAEARAFAAALRRCCVAAATPPLLLRPSVQARYNTAVSAPELRKQPLYGLTVS
                     FPSLRMTCEGSEPAVCSDALETNSDSADACRSPRRDSVVSFTPFLLRHDCYRDKQSYE
                     LSVADSVALCARFGGNAAHHRDVKLFNVSVPLSSSATDISGSRTARESSAFSMRFVRY
                     RCPLPLPSSWRCATRVGPSARMCLRAGPTLLECGEAFWDTMGLLTNRLFGAEVIAGYP
                     WWRPLGSDEDTRKEEVGEGADVISRITTDVEVGWGRTNECGGNALCNHVDVTVPALQV
                     NVDLEGAANEPMVSRDIPVLRFTALGAVLECRMTEACNHVRMTAESPQLQWCCPSATG
                     AVPGKANWVTLMQPDGASTPSESRVDSAKLSVDWKQNKPLPMLSFSDWLCGRDGGGEG
                     IEGACFMGIRDQQEFKVEVRRVRLLFVYPLLMHLLGSAREGLVVRASAVVMREPCWFC
                     AGALLCPPLSWRAPEKATAAVSWTHVRKSVTLQSVVLQTPRSVDWLAQAATSAPLPSP
                     APHLLLSVAHLLFTDRVQAPASSSASDQSPAATAIDIVYDLHSSDMVISHAQPSSGAP
                     FQSRFPRWHVNIAHSAFDARCLWASGGPRRKFFGVVLPSLTESCVLRCSSTDLAHVMD
                     VIHANFFRPTEFGKDMESDAVDASSPASLLKAVAEESTWTLSVKGEATLCISTSRSDS
                     SHSGSQSMQCLLRLNGAAASAVRSASGELSCSFAAQQVWLGCGAPSTAASDLSESDGL
                     CILQVAPLHSAAATPAASLTAQCSWRWLATPKVDSTGATDTVAPPERAVFLSVDSFGL
                     VTATVNGEAALLLRAMVVDDRQLRESLLRYMEQAPLSASRAGTPTPSRESSGGNASDG
                     RAKQVGRIRLQHLECRIPCFAAPACSPSSAAPTPSTPVLVLSCAVSRVQVDLCKNPNA
                     SYAMVRVAQLVRCVLEDTRSDGSVVTAIPLALEQPTEWQVPVAASPRPRRHASPHARV
                     ASGLSMEPPKPKDASLLDEVFGQLQASQQDSALPTKATSPESDVLYVALEDAPMECKV
                     ILDLQPLWLLAPSMMHAAAMLDGVCMQVKLCAAALLRDSAAPASPQSITTTTASELHR
                     SYALQLRSGSIALLVGETEVAVSATPLYASVSLEAAIRQAVDEQEMLVVVTEAATVAW
                     NSEIQERKCFDGAQTVLHLQSISISAIQGMQKGTVLLERFGIRVQRQLMQSGESFESS
                     AAAATGGIEEWCLGMDALQLTLTQLHYTALIRVALQQTSFLAAIMKYFSSASQSIAAA
                     ATAPDLSATAAPQKQQQHRSKQTNSPAKARRFLLHLSSLRLRVHADNGADGSGPPTAV
                     YFELSELDATYYAGQHNWSGIAGAGDDLNERGVSLRLVVTLASCLLGTENVIPTLALT
                     AASCQAATQAARKSCSLRVAQEEQTKAYRGVLQAGQVTVTVEAVPMMAWVDLLYTPYL
                     QVAVPGYQSPKELVVQQDLWLSEDLLLSERTPLRVTNKLYSLVYLYGNGHTIHMNASR
                     HGQLIFLEEGVTLRIMNATVCMTALSIEAYVSAGNGSYVVIDPETCSAVPPPSALERD
                     AAGVVRAAVLQMDHQRRTAAQESAKVVGEVASPRWQRFIGEVQVELRIPEPRSVAGAA
                     SILYAGTGHAATTWAQRTLVLYADMSLCLVNSRSAATDEDELTGAFDLAHAGVRSEYC
                     TQHGGTAVDTSDLVSDWAMKVLMTDEKRRRTDRPAGLPVRLSTIHVSASTGVEVRVRY
                     SDAVFVARAVRHAQVAASRWHAAVRRDVWSGLSSLHCGWDAVGTDSEASEGSLVRARH
                     SRSGGEAGNALAASAGADTTMVTVLLQIPYVSLFIIDDSQDNDTPLFCVYANEIHTPQ
                     CALESLHTSAELHFVLQLEYYELSRSQWAPVLEPVEVKVSFSSRKNASVMDLYDRKGH
                     ARLSTRMSSVKVCFSSEMLRNVRQLLLLRAMFESAGVDALAMRGTSDGGVASASVFHA
                     FKMVQTIGLDVVVQLPEYVENPQGVQRRASDSHDDDAASTRARVLHVGQEWEFNLPRY
                     RGKELPLEHQKIIVQQQQQQEEEERPSTAPTSKACGAVISLASVGVQRVTMATSGPLQ
                     RYILADVSVPLERQGQKQVLLHTLVTFTNRLSMPLLQVAVNASGTYDAVGVVPPASSQ
                     CVPVQVLRRRVALALGNFAEVSASSPALTQMQLSADSIVSLGMSYDSLPCLAGTVLLC
                     VCNSVHGSRSSASRGSGAGGVARIAVGKNFVVLSGQPGKTYFLLRMQAAARQPADVLH
                     HPSLSPLRSVIVTAEAVVTIRNAVGVPLTVTLLTRRTQPGRRISLLDTSPDTAVYTRV
                     SSVVVGVDGSYGATEMDPLEDVCLGVSLQQPNGVTLAQWSTVPAGGIPIAQYPPACVH
                     APLQKTRRDTKLVLVDPVTNATLVLAIKYAQRQVTLYCPHWIFNETDVPVQLADTTRP
                     HHGDTERCIAPIAGLSGRMERTATVSPWKFNVRGGGTQLAAPHAGPFLYHSLRAESCN
                     NDKNHAGSNGLFLRLLEPTRAGTSDGAAQALWSDWSSQPLLIHEAAEVQVIVCASRRK
                     HGAVWVLSCRVEMGHQASVRAYSNTRVVSIHPRWVLVNKSPYALRFSQHSSSGGYHPP
                     APTAQMAPFTKTVVSTLVAPAMADGRVEPLFSFAMCDDKAHNIEQCLWSPPFAIHTVE
                     EQYVNLVYQTRGSLAENWPLASARTGQRTAQGVVDRLPPVHPEDILEVGGELFVRREE
                     AKVFSVRTYKRKGCMMCVQVEEAVQPPLVLENRTSFTVCFRQRGARRVSTVFPRRRKA
                     WTWDVPPAAGRLPAEVELWVLTDGVDESANSAQTATPAAAASCVLDLDPQQIGCRSST
                     VDAFQCELDVGDSATGASSLLFVRVRGVHGISYAVSITMEPTIDVYRTLPFPQLSLTL
                     HLPSMYVLCRTTGKREGQLQDMLLLAIQPVDFSFTQGARVSNDASRPSATGSYEDVNE
                     GDVQQIQLRFRSLQVDDERPSAKQRVVAQLVDDRESGFQIERKLLRITPILYCSVVAA
                     WLTPVELHIEDGFVSAMMGYVEEVESSWETLRSSSSCKRIGSSSAAQGGQALLLPWQV
                     HLDRELIAAKQHFAAAQEDSDQTLRHQRRSSVPLWSRVVAIQRLRVDPLLVSLSLYRS
                     PGAADDPLWKLAGAASLLIGSTQDSRLQWDAVQRRNVCDTIWHLAFLYRDSYVKQMKG
                     QYMSLVNVMGLDTVRSFVSDLLNPFGDEHTNRHGGGNGGRGAVRRQKQRVPCRRAANL
                     LLDHGAGGTRSFSSGAATSLRRASVASASASRVSDDMREMEEASSGTTSWLLRVPERV
                     VQVSSQRTATVAEVARNYAWHYFMAVAQTPEIRAFGGCALAHALAEMRWTPRYSLQST
                     EGSGRRQSASDFVCVTLDPRRRGAEGCALPQVDCSRCAELEALREARLRSRERTPLPH
                     PVHDGFLTWEEFAHHINWYEFVDMCSDEEVRTYAPLVCQGASEASCNVCILTAL"
     gene            complement(<642873..>643853)
                     /locus_tag="LMJF_34_1400"
                     /db_xref="GeneID:5654905"
     mRNA            complement(<642873..>643853)
                     /locus_tag="LMJF_34_1400"
                     /product="d-isomer specific 2-hydroxyacid
                     dehydrogenase-protein"
                     /transcript_id="XM_001686184.1"
                     /db_xref="GeneID:5654905"
     CDS             complement(642873..643853)
                     /locus_tag="LMJF_34_1400"
                     /codon_start=1
                     /product="d-isomer specific 2-hydroxyacid
                     dehydrogenase-protein"
                     /protein_id="XP_001686236.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654905"
                     /db_xref="GOA:Q4Q362"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q4Q362"
                     /translation="MAPTICVCVDDDFCSAVCEALKQLERRVSAVVCGTDVSCFASVK
                     ADNDGILMVVSGSCAHAVIKDLCDDYDKEERRVKLIYSLSAGVDAYKLSELKQELSGI
                     LFCNAQGCCSNVLAEYVVFSMLYFNRLPWRLVAAKNERKWEPFNSIELRRQKVVIIGY
                     GDIGEACGAKAVALGMQVTGIRRSGDKKTDKFGVMVRGNDALDESVREADFVVSVLPG
                     TEPTRHFFDKAFFAKMAPSAVFINIGRGMSVCEADIIEALKNGTIRAAALDVFDVEPQ
                     PAVSPVPCVHDDILSVNSLSGDMALNFLCRKQRFFCSFAEGSLSTRKVAG"
     gene            complement(<645653..>646660)
                     /locus_tag="LMJF_34_1410"
                     /db_xref="GeneID:5654906"
     mRNA            complement(<645653..>646660)
                     /locus_tag="LMJF_34_1410"
                     /product="d-isomer specific 2-hydroxyacid
                     dehydrogenase-like protein"
                     /transcript_id="XM_001686185.1"
                     /db_xref="GeneID:5654906"
     CDS             complement(645653..646660)
                     /locus_tag="LMJF_34_1410"
                     /codon_start=1
                     /product="d-isomer specific 2-hydroxyacid
                     dehydrogenase-like protein"
                     /protein_id="XP_001686237.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654906"
                     /db_xref="GOA:Q4Q361"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q4Q361"
                     /translation="MAPTICVCVDDDFCSAVCEALKQLERRVSAVVCGTDVSCFASVK
                     ADNDGILMVVSGSCAHAVIKDLCDDYDKEERRVKLIYSLSAGVDAYKLSELKQELSGI
                     LFCNAQGCCSNVLAEYVVFSMLYFNRLPWRLVAAKNERKWEPFNSIELRRQKVVIIGY
                     GDIGEACGAKAVALGMQVTGIRRSGDKKTDKFGVMVRGNDALDESVREADFVVSVLPG
                     TEHTRRFFDKAFFAKMAPSAVFINIGRGMSVCEADIIEALKNGTIRAAALDVFDVEPL
                     PKDSPLWDLPDSKLLLSAHSANLTEDVIERTMQVFMNTFDELSTHRRVSAHTVCMDKG
                     Y"
     gene            complement(<648026..>648859)
                     /locus_tag="LMJF_34_1420"
                     /db_xref="GeneID:5654907"
     mRNA            complement(<648026..>648859)
                     /locus_tag="LMJF_34_1420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686186.1"
                     /db_xref="GeneID:5654907"
     CDS             complement(648026..648859)
                     /locus_tag="LMJF_34_1420"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686238.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654907"
                     /db_xref="UniProtKB/TrEMBL:Q4Q360"
                     /translation="MPVFATGEQSVKSAYHCATLLDNWDEDRRQFGQPVPTTSGTGDF
                     DPSTTYNASFKSLTAAQTAEAKPPGCFAAEAPRMLLFHHGDIGNIQTYCYATSELALP
                     DRKKQVYTNDEVLDMPGVSTRRNKTATLQRSTRGVTVGRSGHAGALRSGFCADEVSEA
                     VQREAAYLQSMASTMLSTRYSTADAQTPASDSGVEKAATTSGSDYAPPRLLPMGRVAE
                     RERLLTTKNVSIDATGVYLFENLDAYPLASSQCVGQMTKSCDNPMHKTNLRVHYMEDD
                     Y"
     gene            complement(<649829..>651559)
                     /locus_tag="LMJF_34_1430"
                     /db_xref="GeneID:5654908"
     mRNA            complement(<649829..>651559)
                     /locus_tag="LMJF_34_1430"
                     /product="putative tyrosine phosphatase isoform"
                     /transcript_id="XM_001686187.1"
                     /db_xref="GeneID:5654908"
     CDS             complement(649829..651559)
                     /locus_tag="LMJF_34_1430"
                     /EC_number="3.1.3.48"
                     /codon_start=1
                     /product="putative tyrosine phosphatase isoform"
                     /protein_id="XP_001686239.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654908"
                     /db_xref="GOA:Q4Q359"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR014020"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="InterPro:IPR029023"
                     /db_xref="UniProtKB/TrEMBL:Q4Q359"
                     /translation="MNSEFVDMTPPVPTTLCEKVEYYLRDRTRYLHVQSEIPQEATNE
                     LAMVDNYYVSVANPQDMRFTTPGETTVDNVCRIVYNFFLSLYVQAALLVPTLLFLLFI
                     AVRTHHSPMFLLVYSTVFDIEVLSMWAYERDARFAARLWWELAWLIVGLIVTSIHALS
                     PANVLCVLLLVVHWVFMARITVIQVSRALRVFCASERRCYIAEGVVLDMAYITRNVIA
                     MGWPARGTEAFYRNPWNEVVHFLRRKYARLSTHIITLCSERCTAPFPRQSTYPLDDHN
                     PAEVPLMISFCCEVADYVMADPYNRAVAVHCKGGKGRTGTMICAYLMYCGQCRSADAA
                     MRHFSLLRSRIGAQKLQGVQTPSQERYVRYFESLINEQPGMIIPSHPRRVRQLVLHNI
                     PPLWVRRGVEHLWMTVIVKPCTERRVVYLTNRTVTFNAAVPDPRTYNWRTQIKDLFQN
                     DEEVVYQEANEMDATESGSTGYLPDARSFRVIGAAGVTLELAYPDEIPVLDGDVCFKF
                     FYYKNNPNPLRPPVQFWIHTGLETHSTIRLERRDLDGPFKDTKGDRYPAEFAVELVLE
                     DAPGVYTARE"
     gene            complement(<655129..>658116)
                     /locus_tag="LMJF_34_1440"
                     /db_xref="GeneID:5654909"
     mRNA            complement(<655129..>658116)
                     /locus_tag="LMJF_34_1440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686188.1"
                     /db_xref="GeneID:5654909"
     CDS             complement(655129..658116)
                     /locus_tag="LMJF_34_1440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686240.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654909"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="UniProtKB/TrEMBL:Q4Q358"
                     /translation="MRVLYGTPLPPGLVAPTTGELRLRIDQLILDDEVINHSPLVQLF
                     ETPDSASAVAAADVDGAETATASFSRSPNHFVVPVDYCSVGPIFWGETRPSAQGQPAT
                     PQLRRGPVTMAYPIKMAAPQFGAYLERMTESPQQGVQLDVFVPSSYSGRPPVTVGRCR
                     IALDTLQPGHPVKGWFPVMHRRARLSAAEADLSKYVELAVGKVKLTATVEYYPSSRQP
                     SAEPTAATKHKRHEGKDGGHQPLPRAKTRRSHRHLGRTGEDAAHPPTETSSTSTETAA
                     AESPVASLLSPAARETAHRRGLHRRHVGHHGTALLQDKSAVTHQLLQQGLRLRAQMEA
                     AARGVSLDNFDSSTDLTANRHRGVGHGHVSFEDVGAGVFADDADEDVSDGSDAAYTSE
                     DSDEEKFALQMQKDAEARDRRGFQQQQQSTVPSSSPAAPAAVWQHLGRSSAVGAASET
                     AVEVLPIANGGSVYGTRAAVELCFSNFSFAQTSLTADLHKIRINVRLSSDIATLEPSS
                     GPLSSFVHPVPVQQPFIRLLFDVCSFFEDHSKLVIEAYKVMSELELENENDGWDVQGP
                     RHVAKEELLGLSVIGLYRQSRTVVFRDPVADTSNVFAQLDVRVRPHGVSHSTATSTVL
                     DAPPQQQQHQHQASWNAGRGATNSSLHAPASDAVPPSSIAACASDARPAKENAVSVSK
                     HKSPAGGGHVQDTSAGKEASSIAGTYPLHLSQAPVDTSSSSATTERRRLRVVVYSAAE
                     LPRVAVAQGRGHGTLTGSGGGHFPVVSARPRSIPEAGVEGVTSYAEPNSFVTIEEVYR
                     VAEAWCTKSKTAASTSRGASAPSSSRQSIHDWYVDEARGGFYDRSAVAKESSNPSYNY
                     EVTLQLPEMTVPTGNGTAAAAVTHGLADVLDELQLAVWHSDLTRHTSAPSGTTVTSGD
                     AGGGHSRSRGTSVRQQEEHFWECAAYMGTCRVDLRPLRYLKTLDGYYRVVYERTPGSA
                     VGPTSTDVESNTIGYVRLSVSLQ"
     gene            complement(<661097..>662659)
                     /locus_tag="LMJF_34_1450"
                     /db_xref="GeneID:5654910"
     mRNA            complement(<661097..>662659)
                     /locus_tag="LMJF_34_1450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686189.1"
                     /db_xref="GeneID:5654910"
     CDS             complement(661097..662659)
                     /locus_tag="LMJF_34_1450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686241.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654910"
                     /db_xref="GOA:Q4Q357"
                     /db_xref="InterPro:IPR001374"
                     /db_xref="InterPro:IPR025952"
                     /db_xref="UniProtKB/TrEMBL:Q4Q357"
                     /translation="MCVTDSFPTQQTPSGALQQEATERMTIHNGPMQYDQEMHFHTYD
                     VYRHGKRQIHTRSVGYSSDGDLVMMREDYSEPSDVDNGFVLKRTEISDPTVLDPRARR
                     PLTDKEMHSKKIHLNRPRYKKYPGIRAPKNRKVRNRLLNDFFAHELAREVLVKAQKRR
                     TLNADEPETSVGPSFADLPKAVMHAFDLEGEEQLLEFERLRVHPDMLGPQLRNVRAPP
                     DPDSPEGRFQGLNTRLRGELQHALNSEFLTQQIEDLEVHFSEFIKDSSKSPESLVFHF
                     RDGYGRLICHGVAAYYLLVSESHTVMNGSGTKLTYVSLPKTRRQGVRAVNPPRVPLML
                     VLKRNHRNLPAKHRLSTQTTPQIAPTPDMVALPPALRLGGDSTGKEAGVDDAKVMSPL
                     DLNVPAMPNVRAQPTSDSDLVGRGKATHGHATGAQQMDSGGKNPTVFRTVHLKLPTAD
                     PLPFYIPMLRLTLSVEQQEDAVEQLDAASAGVSPDLGPFTPPLTATQRKKLRKAERVR
                     SADASKDYSTRR"
     gene            complement(<664275..>666392)
                     /locus_tag="LMJF_34_1460"
                     /db_xref="GeneID:5654911"
     mRNA            complement(<664275..>666392)
                     /locus_tag="LMJF_34_1460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686190.1"
                     /db_xref="GeneID:5654911"
     CDS             complement(664275..666392)
                     /locus_tag="LMJF_34_1460"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686242.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654911"
                     /db_xref="UniProtKB/TrEMBL:Q4Q356"
                     /translation="MPACAGAALRCARRCSSTPSPNSVPNKEEALSSLQTCLSAESVQ
                     SSTPHSDDETAKLATSIAELLQYRRQITSVYTSLLADRRVQYRDELLLSSLGSTQAAM
                     QVLLRRLLASHPEAAASATQEAHEAPPQMTTDAVRRLKETWKRISGVATRSRDAATRH
                     AYFSEVRDCYATLICSGLLRTESEVRLILSEMRDTDLIEPDASFYEVLFVALWSLDDV
                     RESTVATGEHRAAGLRQTPEIVAGEVRQLRRSVVGDLAGYYMGHALAQLSTSCAPIAS
                     AAPMRTAVRPETWEVFFTTLANTQPAPKLMDLWWKRLLEWLDEQAPLMPGKTSIGALD
                     KRASAAKGAPVPYQAAHAVLAWCAQSREMEKALNYFNAVNQRGVTLHVTTMPHISLPA
                     ELAEDFARAGCLTAPSTHTPVQQLQLALLVKLMVSTKSVKMDGGLRALVVRDVQRQVS
                     PDVLYTAPWAVINDFIAGLSVPSAMQLLRRCSSSPAAATASSMLSEKRSRSDDGACDN
                     EATVGSAKKGEGRREIPFFVWASLLRRCCREHLQDEAESLFVFLRKKFLVTATEKREL
                     IEIMMRMYTTMHPADFPSAMDVFLQHVLRTPEGEPTVKPDAVLYELLVKGADSRNAAM
                     MVFLEACAAGVALTEELFEALMGSTQYKTVASLSRKLPHDYTASSLDAQLKIPANADA
                     HLRREEALRARGKPLYDSTGDAG"
     gene            complement(<667260..>668444)
                     /locus_tag="LMJF_34_1470"
                     /db_xref="GeneID:5654912"
     mRNA            complement(<667260..>668444)
                     /locus_tag="LMJF_34_1470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686191.1"
                     /db_xref="GeneID:5654912"
     CDS             complement(667260..668444)
                     /locus_tag="LMJF_34_1470"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686243.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654912"
                     /db_xref="InterPro:IPR007286"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:Q4Q355"
                     /translation="MRRRVGVGHVLQERQQQQRMADLGAQITAERVGQIEDQLEELQA
                     QLKALAQNHKSDITEDPVVRARFRQLADSLGVDLISSKKNLFADALGLGDFYYQLASR
                     TVEACMRERKFCGAYVPLQRVQFFVQKAYDASSLLGSNARNCHHVVPHGSGSGSSKCD
                     RRDEGKRIVISEADMLTALSKLSVLGAGYNVVKLGGVSYIQTTPDGARGGDHVLLLNY
                     VLGLQKEQIERAKQAAVEEQGKSAPMAPEGSAQATAGDRSGHRSGVGAAYALGAHPFD
                     LGKDRGSEASVSLPFSQQCVAVRESQIASGLHWETHRARAALKRMVQEGTVWVEESQD
                     KSGGRVTTAGARGGSPAKSKATLSSTEEVKEVWKRKHTRTVEAADKKDVVYWFVSLTS
                     HG"
     gene            complement(<669286..>672306)
                     /locus_tag="LMJF_34_1480"
                     /db_xref="GeneID:5654913"
     mRNA            complement(<669286..>672306)
                     /locus_tag="LMJF_34_1480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686192.1"
                     /db_xref="GeneID:5654913"
     CDS             complement(669286..672306)
                     /locus_tag="LMJF_34_1480"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686244.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654913"
                     /db_xref="UniProtKB/TrEMBL:Q4Q354"
                     /translation="MLPLRSTPVRKAPVIVLEEANRAHTMETTASTYSELEASPAPVT
                     WGSESVSASPSPASGANHHSFHPVRKTFARSVAPTTKSVKHSVQASTTASSPASGTQL
                     LSASTRESSPPPASPSPLRGIIDFHRGSSPSPHRPTRYAGGDPREREQAEPKSAADSR
                     AGPESPSLSSSRASEMFCRSPAPARSYIEEFLAMSDEDGNGVLPHVETTPAIRDSGGV
                     GHDSTSPSPHVIGVALDNSPVVREMWEETSSSASNSSTGVSDGFEKAEASQPRHRSAS
                     VARIHFSSASPNSPLPAQLTASPMKWRRGVENSPPSQGDASNVPQRPAAMIQEKHASS
                     PMADTKAAWSASMFATKARVGINWSSSCLSSRSGDFQHCEAVERVLRFPPDTTQEEVA
                     RIDYVNNEKDGKGAKIASALFQAAPVVSDDVAGHCSGQSRVQQSPFVAPPLSSWRPSD
                     FPASPPVGTERHVTIPSFGSSEASARRGAWFDELGGGLVAAPRATRTDSESPAVHRFL
                     GGSAPSFPTNRWNVAPPLLRRVDEGVSASEPHLPPNSSAQKSSMRTLLARLYPFPSAS
                     TRRGAGSGTVSHDKRYASQMSERTADAPPPRWNASTKLHCDPLTGGIELPRANERHSS
                     VRHGGQSGSSDDYVSERPVPSHGRRSRSAPAQAPLHTRASLLRLEATQARKAADAALH
                     EKVASPSFHPTVAPHSARICREKLRELKNSHGAGVAAGAAAAAAAPRTQLEQASRTEN
                     CKSEAKAWQGTSAQSIVGDAEVVADVSVSSSDEVDAETIAQVTSPSCPLVATLPARQL
                     PLPQVAELWGASSIDGARVYADAAALRERRQATQQRWLQERKPEEQPHMQMHPRRGAS
                     SSATRQPTEDLGCPKPPRPQVSAATDRISTSIQCNLLPSERTVGPEKMTAPGLDLQLG
                     AAPVSVGAQHAPLIAGLPMAAHTALQRVDLYSTTPTGALETRATSLERQHRVEDRLLK
                     LETDRRRRLGMLRHLASMRDSLTDKPLFKPFTGR"
     gene            complement(<674442..>675500)
                     /locus_tag="LMJF_34_1490"
                     /db_xref="GeneID:5654914"
     mRNA            complement(<674442..>675500)
                     /locus_tag="LMJF_34_1490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686193.1"
                     /db_xref="GeneID:5654914"
     CDS             complement(674442..675500)
                     /locus_tag="LMJF_34_1490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686245.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654914"
                     /db_xref="GOA:Q4Q353"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /db_xref="UniProtKB/TrEMBL:Q4Q353"
                     /translation="MTSLPKKVPPPPKEPGTHTNAEVKEALHARALRRTVLVTAVVFL
                     LLACLTVVSNTARTTVGDARKPKMVIIVAKGLSPMTVGRAFRSNKSPFMRLLSKAGGQ
                     FASIAAKKTANPLVNLLTGSATISADTLLNTTSILRWLKSQGKHTIVAAPSTYWSLGA
                     AGTSPCPQVGLLDTECSGQKCPETKESAYCNAFRKYITCDDCAQLYHDEILLGFEKMI
                     NHSADALYFQLSKITEAEVNNPELAVQERSEVNLLDSAVGRIALALSRRTSKEAENWL
                     VIVTSDGANAEMAAPLLVVVYTKGELAQLSDIAEDANTADVANTIKYWFKGSNVNTSR
                     LLGICTDGEKVENCKRTI"
     gene            complement(<681256..>683667)
                     /locus_tag="LMJF_34_1500"
                     /db_xref="GeneID:5654915"
     mRNA            complement(<681256..>683667)
                     /locus_tag="LMJF_34_1500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686194.1"
                     /db_xref="GeneID:5654915"
     CDS             complement(681256..683667)
                     /locus_tag="LMJF_34_1500"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686246.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654915"
                     /db_xref="InterPro:IPR019412"
                     /db_xref="UniProtKB/TrEMBL:Q4Q352"
                     /translation="MSQSAETSAPLAERHADPMDMEAVEEELDIVKLEQLDDEANLKV
                     LSHSRAEVERLRNLTPEMIRDMDSHIEYAVDAFFANRIADSEAALRSRMSEDPLAVCG
                     AGLIAFVRCGLSMEQAQADIALELLTRSSALATQVISSEKSMISRGFSKVFQRNKETK
                     GNWLSAAEFRAKTMHAESQALRCFVFVFQQSVSALVKAGLALNRANTSYKSLYMELEH
                     RYKAKYGSKETVKTSQHKPAAGEEGDSDVNSPVRSPSWLAARDASLEQSTALETLGLD
                     RNSVHCVEFGLGAMKLALSILPDNVRAVLRFIGVEGNRQEGLKLVRQCFKSDTLLSPF
                     AGALLLALYGMLPATSAFLVDSYLPIAHEVRTEALKKEKIRESILHLWLDGRIERLTR
                     SVDLSISKLNNCLAITSNPQLLAAMPQLRDFVLYDQWFNYAIVHQWKRASRCLEILSN
                     TSKWANAVYQYAQACCLEMLEIEWAEGIENPDGVLDFPLEDLNRILGSSEAKVELIFS
                     DVSTREAIAETITQLYWAAAQRKPVTLGGKPNHNDQFVLKRMEEILVSCGITPSTVVA
                     KKKLGEPLEPVPEGLIIRNIVPLPAYEKCLIAGIAHQYPAERKDKMVTLIDAYLLREP
                     VHRNTPLSDYVASLQKGSNRETASRSLASSSNTTSVGSHVSREVGSPAASPSSHEPRA
                     SLPENYRLLSLCVCKSMLLANSESKKDRQAALEVIKAIQDTPQYKDRQWSLSYAQAFA
                     LYEKAYIAYRDKSLEAAESIMNQLHKQYDSAHYYMHAKMDLKAHLASYHLREERQARA
                     AKLTK"
     gene            complement(<686426..>687955)
                     /locus_tag="LMJF_34_1510"
                     /db_xref="GeneID:5654916"
     mRNA            complement(<686426..>687955)
                     /locus_tag="LMJF_34_1510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686195.1"
                     /db_xref="GeneID:5654916"
     CDS             complement(686426..687955)
                     /locus_tag="LMJF_34_1510"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686247.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654916"
                     /db_xref="UniProtKB/TrEMBL:Q4Q351"
                     /translation="MSVDAMTTSFEGSAIKVYHEPPQQLALSNHNLHGFTRRVEVGDV
                     PLRLDVIPDDAYVDYGTNLPKLNIETKEVGDHREASVLTAAGRTRDPGDLSSEVADSV
                     TQYSNTSLHGGELSIEGNGWNVEDASVDPQVGSPTRHHTDPLSSANLDQHLHELSRGP
                     APLRMENIVASGVPYLQRQRNASTTTVLPETTAASLMVESSEIDAMSISEVASLSRIR
                     PAKLASVGDMMDDMWSTTSTRGFDTMYFGTGGTKDETLHALSKENLRQLRHQLESGET
                     PLRPEVLAGLSTMVQAMAQTKSAMSASTAVEPTMTEGRSKLVDSAACLGSSLQSFADA
                     RAPFLLASANLTKDGDASATAGMSFRRTLVDMPAREACDGRAHDSSDYPNEEFLRSPH
                     VDVSDRDVDEEGAVDEVEAENEDEDEDALHEKASTSDDSCEGQNESVFNMTEDDGVDD
                     MSDPAAMSRHMRELFKLVQEGRQDQSHLRQLVLEQRSVIQYLQSTVKDLEAELSALKK
                     H"
     gene            complement(<690471..>690932)
                     /locus_tag="LMJF_34_1520"
                     /db_xref="GeneID:5654917"
     mRNA            complement(<690471..>690932)
                     /locus_tag="LMJF_34_1520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686196.1"
                     /db_xref="GeneID:5654917"
     CDS             complement(690471..690932)
                     /locus_tag="LMJF_34_1520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686248.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654917"
                     /db_xref="InterPro:IPR008907"
                     /db_xref="UniProtKB/TrEMBL:Q4Q350"
                     /translation="MDNFQATFEAFASFGSAPSKEMDNSHFSKMLKECKIIGKSFTST
                     DADLLFSKVKAKEARKISFTEFKEKAIPEIAAKMKKTPADIEAMIANAAPKSSGTKAD
                     TVRFHDDKSTYTGAAKQGGPTNVDRNAGSLAGVVDRRQETIDNRGTTAKQI"
     gene            complement(<692402..>692791)
                     /locus_tag="LMJF_34_1530"
                     /db_xref="GeneID:5654918"
     mRNA            complement(<692402..>692791)
                     /locus_tag="LMJF_34_1530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686197.1"
                     /db_xref="GeneID:5654918"
     CDS             complement(692402..692791)
                     /locus_tag="LMJF_34_1530"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686249.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654918"
                     /db_xref="InterPro:IPR008907"
                     /db_xref="UniProtKB/TrEMBL:Q4Q349"
                     /translation="MDNSHFSKMLKECKIIGKSFTSTDADLLFSKVKAKEARKISFTE
                     FKEKAIPEIAAKMKKTPADIEAMIANAAPKSSGTKADTVRFHDDKSTYTGAAKQGGPT
                     NVDRNAGSLAGVVDRRQETINNRGFTA"
     gene            complement(<693615..>696446)
                     /locus_tag="LMJF_34_1540"
                     /db_xref="GeneID:5654919"
     mRNA            complement(<693615..>696446)
                     /locus_tag="LMJF_34_1540"
                     /product="putative kinesin"
                     /transcript_id="XM_001686198.1"
                     /db_xref="GeneID:5654919"
     CDS             complement(693615..696446)
                     /locus_tag="LMJF_34_1540"
                     /EC_number="3.6.4.4"
                     /codon_start=1
                     /product="putative kinesin"
                     /protein_id="XP_001686250.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654919"
                     /db_xref="GOA:Q4Q348"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q4Q348"
                     /translation="MTFAEIAPLVEHVLDGFHATVFAYGQTGSGKTHTMDGLRYASNS
                     QQRKAIVPDVDGTEVQQHGIMPRVIQLLFDRARERQCAAVFESTDAQHDAETLDDGVE
                     YTFRCSFYQIYNEKITDLLRGTSVPGDVGEVAASSLSSSLALTKLKMGARSKRGVGEG
                     DLRVRWHKGDVFKVENLFICTCDSPAEMREMLFSGIQQKVVSTHLLNHHSSRSHCVFT
                     IYVESRARQKGDLLSRSELSLVDLAGSEKIGLLSHNPSARLVKESIDINTSLLALGKV
                     ITALSSGPAPAAAELKRKNLGLAPRARGGAEQQAATRHIPYRDSKLTMLLKHALGGNS
                     LTTMIACISPSDRYVDETTSTLLYAGRAKNIRNAPHVNEDATTVLIRQLREEISQLKA
                     ELGYYREMAANSLVEREGRVNACECCCGGVYKDPLRSVDPSSLPARGTTEDIVTVHEV
                     DQLADSLVAACGMLTNLMQVNAQLRELYDAVRDRQDAAERRETELNAENLALRERLAV
                     LEDIVLQNEDLGEVKENSMIGSDDASDADEKLNSSEPLARASKSDKRRGCSRAQEETL
                     AVAKESSAAPALGRLADDSARGGKLADNSAAGTSSSQRLTSSSTAVGQPASATKEDCK
                     SNRPALVSPDSEAVASPVRKIAPGSSTMVEQLAIALRGVPNGSSPFDAATLENPADRE
                     SSRKCATDDEDRRRLHGRTKKKRNGLANRLKDYEALYRTPHTIETYADYYKQPARSQS
                     LAVVVPGVPAIRASEAVAPHVTVTLQDMKMTVSKLPKAVVQEYVPSSLLRPGLFGCLA
                     FGGGDSEKVLFEQNRSSREARLRALQQRQQELYRQVHLAVHGLRSEDPASAVSPPPSG
                     SATSSAASAPQRPNSTSDIPGISGKQEEMSSSRSGFAHLSCGPALAYAPQAVNRTGTG
                     PYPELSIRQRPCAPSDSMKRLMRYMECDR"
     gene            complement(<697719..>700052)
                     /gene="RH"
                     /locus_tag="LMJF_34_1550"
                     /db_xref="GeneID:5654920"
     mRNA            complement(<697719..>700052)
                     /gene="RH"
                     /locus_tag="LMJF_34_1550"
                     /product="putative ATP dependent DEAD-box helicase"
                     /transcript_id="XM_001686199.1"
                     /db_xref="GeneID:5654920"
     CDS             complement(697719..700052)
                     /gene="RH"
                     /locus_tag="LMJF_34_1550"
                     /codon_start=1
                     /product="putative ATP dependent DEAD-box helicase"
                     /protein_id="XP_001686251.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654920"
                     /db_xref="GOA:Q4Q347"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q347"
                     /translation="MPRPRTTSAYRLRRSTVPCVQSLGAFSHLIIATRTIVQSNVTGG
                     VRSLLDQFETRTLITRLRRNRNGNYYRFRQKLWLSQEALEKELTEITYSPVERQPFAL
                     LPQREAPRQVFACEGRGGTLLLEEVQAEARRASASESSSTPAAASILPSQSERCDDND
                     SLDFMASLLQADQSVGSKIITEADVEGTVLESARFRARQILASDLTCNAVAVSPSTSV
                     SLRKPAESTDAAGTSWSALGLDPLISSAAKQLYGPVPTRLQARLLPALLNEDHNDVLF
                     NGVTGSGKTSALVLGLLQGIRSEAAGMNILVATNTMNAMRLHDTVKALCRRAGGGVVV
                     DRPADDYSWLFLGTYREDYESYYEHLRRGLRRATGPARLFITTADVMCQLLFEKKMEF
                     EDFGYLRRVYVDDIGAQVPLLPESAPVAVVRERLRNPLAAELLLGTLHQLPGPHVRSV
                     LQLGMVSADVDGKLKDHLQALCMKPVAQTTVLSTVRIPSTVHCLFSFFLNDREDRFTY
                     LARLLWNARETIPGRAVLFVPDAEDVLNARRRLRGLGADVKIFSEVHGGSEFKGDWKF
                     LLLKESEAFGVDLPLVSHVFITFAPTSWQRFLHMCGRTGRMGNVGWVYVVSDKQDAKS
                     VREVAEALSVDFCNHVISDDLQQVRPADVERFTKQPELYGLDPQFAVRQHYTVQAENP
                     DMAYRKREFFSKPAMKQFQMEDYTPIPIKQRRFDHARQLSQDVERNPSIVLDMQKRGL
                     LDAHLKPTKTLKRYMDLKTHREAPDPFQKERKRPQRR"
     gene            complement(<701123..>701623)
                     /locus_tag="LMJF_34_1555"
                     /db_xref="GeneID:5654921"
     mRNA            complement(<701123..>701623)
                     /locus_tag="LMJF_34_1555"
                     /product="putative ubiquitin-conjugating enzyme"
                     /transcript_id="XM_001686200.1"
                     /db_xref="GeneID:5654921"
     CDS             complement(701123..701623)
                     /locus_tag="LMJF_34_1555"
                     /EC_number="6.3.2.19"
                     /codon_start=1
                     /product="putative ubiquitin-conjugating enzyme"
                     /protein_id="XP_001686252.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1555"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1555"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654921"
                     /db_xref="GOA:Q4Q346"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="UniProtKB/TrEMBL:Q4Q346"
                     /translation="MSVRTVRRANMDFARLTELAKSGSPTIRAVDMADENGATDHGDA
                     FHWRVRVMPPAESIYHGTTYDILFTLSREDYPFKPPAVRVLTRIFNPMVSEDGAVCEG
                     LLHNDDWKPTTPVPDVVAHVVKAIFVDYKIYAVLNERAAGVMATATPEEFKKHVQRTR
                     ASDARA"
     gene            complement(<709260..>709835)
                     /locus_tag="LMJF_34_1560"
                     /db_xref="GeneID:5654922"
     mRNA            complement(<709260..>709835)
                     /locus_tag="LMJF_34_1560"
                     /product="putative amastin-like surface protein"
                     /transcript_id="XM_001686201.1"
                     /db_xref="GeneID:5654922"
     CDS             complement(709260..709835)
                     /locus_tag="LMJF_34_1560"
                     /codon_start=1
                     /product="putative amastin-like surface protein"
                     /protein_id="XP_001686253.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1560"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1740"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654922"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4Q327"
                     /translation="MAYSIPLVVYVVVQFVALLLVLVGTPVDMFRMPSTGFDTSCITL
                     WGERFTCTSSGYFSYIDETFHNCPQRLTHFRIAQAFAIISIFVYFAAFVMGLVLLYGC
                     TIHRWVCLALNIVGAVTLFIVWAAMVVTYNKGESPRCPPLKEVSYYAAGFVLFLLAWI
                     LDILNMIILLLPCTVPATKANEKPESPTAQE"
     gene            complement(<712034..>714028)
                     /locus_tag="LMJF_34_1570"
                     /db_xref="GeneID:5654923"
     mRNA            complement(<712034..>714028)
                     /locus_tag="LMJF_34_1570"
                     /product="tuzin-like protein"
                     /transcript_id="XM_001686202.1"
                     /db_xref="GeneID:5654923"
     CDS             complement(712034..714028)
                     /locus_tag="LMJF_34_1570"
                     /codon_start=1
                     /product="tuzin-like protein"
                     /protein_id="XP_001686254.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1570"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1590"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1630"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1650"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1670"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1690"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1710"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1730"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1750"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1770"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1790"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1810"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1830"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1850"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1870"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1930"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1950"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654923"
                     /db_xref="UniProtKB/TrEMBL:Q4Q342"
                     /translation="MMALTLDPRWNAMRRGIAGIGVCAVDGRGGAAAPGSCRLSLCSC
                     LSPASSGGCGGADSALSEGGHCRECVCGMRGRLPSPKKPWNSLAGVLVGVRVTHAASV
                     LEDRPVALGRLVSRLSEAAYKAEMLRTGKRDRDGEDRRGDAAQLLVVDAGTRVTVRTE
                     GDPASGAAVAPSAMHMKGTIAKVNGNATYIILMEKGEVELSVASERIVALQPRKKLLQ
                     SARLVALVNWLRSCVHDPRDVEAIALVLFSRGWRAERMYLLEGVDLLPFVFVSRVELD
                     SVSEKARWERDHDKAMQMLRRERVKDTNFRYALAKYKGTMSCIAGVLVVAYVFTANLR
                     AYRRQQRGHQLRTAIETLSKAARPRKEEGMLAAAAEAFEVRREDEEALVRSVLTQMAP
                     SHPRIVALAGGSGGGRCVPCRRAVRVEGVALVHVDVGGTEDTLRSVVRALGVSNVEVC
                     GDLLGFVEEAMRGATVKASDGVPFLVMRLREGSDLGRVYGEVVSLVSDCQACHIVLAV
                     PMKALTPLNVSSRRLDFYCIPPFSRRQAFAYAEHTLDALDLVCFVEVVGTRSSDVDEL
                     CAALRQRGVDPVTYTSLMLARAMRRLQAALGPPGSPARAAIRQLASMPFADGVRDDAT
                     GAMSVLGQPDVQEMVLYDPVQHEWRFAQQVYHTAARCILI"
     gene            complement(<716811..>717389)
                     /locus_tag="LMJF_34_1580"
                     /db_xref="GeneID:5654924"
     mRNA            complement(<716811..>717389)
                     /locus_tag="LMJF_34_1580"
                     /product="putative amastin-like surface protein"
                     /transcript_id="XM_001686203.1"
                     /db_xref="GeneID:5654924"
     CDS             complement(716811..717389)
                     /locus_tag="LMJF_34_1580"
                     /codon_start=1
                     /product="putative amastin-like surface protein"
                     /protein_id="XP_001686255.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1580"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654924"
                     /db_xref="GOA:Q4Q335"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4Q335"
                     /translation="MKCSIPLVVYVVVQFVAFLLVLVGTPLDMFRAHNRPGVAQCLTL
                     FGFKLDCKGLQYDQTVDMQWIECPARITLFRLAQGCAIISILVYGAAFVLGLVLLYGC
                     TIHRWVCLALNIVGAVTLFIVWVAIVVTYNKDDGQKCPKVRDTGYRLGTGFALLVAAW
                     ILDILNIIFLLLPCTVPATKANEKPESPTAQE"
     gene            complement(<719588..>721582)
                     /locus_tag="LMJF_34_1590"
                     /db_xref="GeneID:5654925"
     mRNA            complement(<719588..>721582)
                     /locus_tag="LMJF_34_1590"
                     /product="tuzin-like protein"
                     /transcript_id="XM_001686204.1"
                     /db_xref="GeneID:5654925"
     CDS             complement(719588..721582)
                     /locus_tag="LMJF_34_1590"
                     /codon_start=1
                     /product="tuzin-like protein"
                     /protein_id="XP_001686256.1"
                     /db_xref="GeneID:5654925"
                     /db_xref="UniProtKB/TrEMBL:Q4Q342"
                     /translation="MMALTLDPRWNAMRRGIAGIGVCAVDGRGGAAAPGSCRLSLCSC
                     LSPASSGGCGGADSALSEGGHCRECVCGMRGRLPSPKKPWNSLAGVLVGVRVTHAASV
                     LEDRPVALGRLVSRLSEAAYKAEMLRTGKRDRDGEDRRGDAAQLLVVDAGTRVTVRTE
                     GDPASGAAVAPSAMHMKGTIAKVNGNATYIILMEKGEVELSVASERIVALQPRKKLLQ
                     SARLVALVNWLRSCVHDPRDVEAIALVLFSRGWRAERMYLLEGVDLLPFVFVSRVELD
                     SVSEKARWERDHDKAMQMLRRERVKDTNFRYALAKYKGTMSCIAGVLVVAYVFTANLR
                     AYRRQQRGHQLRTAIETLSKAARPRKEEGMLAAAAEAFEVRREDEEALVRSVLTQMAP
                     SHPRIVALAGGSGGGRCVPCRRAVRVEGVALVHVDVGGTEDTLRSVVRALGVSNVEVC
                     GDLLGFVEEAMRGATVKASDGVPFLVMRLREGSDLGRVYGEVVSLVSDCQACHIVLAV
                     PMKALTPLNVSSRRLDFYCIPPFSRRQAFAYAEHTLDALDLVCFVEVVGTRSSDVDEL
                     CAALRQRGVDPVTYTSLMLARAMRRLQAALGPPGSPARAAIRQLASMPFADGVRDDAT
                     GAMSVLGQPDVQEMVLYDPVQHEWRFAQQVYHTAARCILI"
     gene            complement(<724398..>724925)
                     /locus_tag="LMJF_34_1600"
                     /db_xref="GeneID:5654926"
     mRNA            complement(<724398..>724925)
                     /locus_tag="LMJF_34_1600"
                     /product="putative amastin-like surface protein"
                     /transcript_id="XM_001686205.1"
                     /db_xref="GeneID:5654926"
     CDS             complement(724398..724925)
                     /locus_tag="LMJF_34_1600"
                     /codon_start=1
                     /product="putative amastin-like surface protein"
                     /protein_id="XP_001686257.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654926"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4Q341"
                     /translation="MKRSIPLVVYVVVQFVAFLLVLVGTPLDMFRAHNRPGVAQCLTL
                     FGFKLDCESLEYLETVDTQWVDCPARITRFRLAQAFAIISIFVYGAAFVLGLVLLYGC
                     TIHRWVCLALNIVGAVTLFIVWAAMVVTYNKDDGQKCLKVRDTGYRLGAGFALLVVAW
                     ILDILNIIFLLLPCR"
     gene            complement(<726853..>728847)
                     /locus_tag="LMJF_34_1610"
                     /db_xref="GeneID:5654927"
     mRNA            complement(<726853..>728847)
                     /locus_tag="LMJF_34_1610"
                     /product="tuzin-like protein"
                     /transcript_id="XM_001686206.1"
                     /db_xref="GeneID:5654927"
     CDS             complement(726853..728847)
                     /locus_tag="LMJF_34_1610"
                     /codon_start=1
                     /product="tuzin-like protein"
                     /protein_id="XP_001686258.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654927"
                     /db_xref="UniProtKB/TrEMBL:Q4Q340"
                     /translation="MMALTLDPRWNAMRRGIAGIGVCAVDGRGGAAAPGSCRLSLCSC
                     LSPASSGGCGGADSALSEGGHCRECVCGMRGRLPSPKKPWNSLAGVLVGVRVTHAASV
                     LEDRPVALGRLVSRLSEAAYKAEMLRTGKRDRDGEDRRGDAAQLLVVDAGTRVTVRTE
                     GDPASGAAVAPSAMHMKGTIAKVNGNATYIILMEKGEVELSVASERIVALQPRKKLLQ
                     SARLVALVNWLRSCVHDPRDVEAIALVLFSRGWRAERMYLLEGVDLLPFVFVSRVELD
                     SVSEKARWERDHDKAMQMLRRERVKDTNFRYALAKYKGTMSCIAGVLVVAYVFTANLR
                     AYRRQQRGHQLRTAIETLSKAARPRKEEGMLAAAAEAFEVRREDEEALVRSVLAQMAP
                     SHPRIVALAGGSGGGRCVPCRRAVRVEGVALVHVDVGGTEDTLRSVVRALGVSNVEVC
                     GDLLGFVEEAMRGATVKASDGVPFLVMRLREGSDLGRVYGEVVSLVSDCQACHIVLAV
                     PMKALTPLNVSSRRLDFYCIPPFSRRQAFAYAEHTLDALDLVCFVEVVGTRSSDVDEL
                     CAALRQRGVDPVTYTSLMLARAMRRLQAALGPPGSPARAAIRQLASMPFADGVRDDAT
                     GAMSVLGQPDVQEMVLYDPVQHEWRFAQQVYHTAARCILI"
     gene            complement(<731617..>732195)
                     /locus_tag="LMJF_34_1620"
                     /db_xref="GeneID:5654928"
     mRNA            complement(<731617..>732195)
                     /locus_tag="LMJF_34_1620"
                     /product="putative amastin-like surface protein"
                     /transcript_id="XM_001686207.1"
                     /db_xref="GeneID:5654928"
     CDS             complement(731617..732195)
                     /locus_tag="LMJF_34_1620"
                     /codon_start=1
                     /product="putative amastin-like surface protein"
                     /protein_id="XP_001686259.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654928"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4Q339"
                     /translation="MKCSIPLVVYVVVQFVAFLLVLVGTPLEIFRAHNRPGVAQCLTL
                     FGFKLDCKGLQYDQTVDMQWIECPARITLFRLAQGCAIISILVYGAAFVLGLVLLYGC
                     TIHRWVCLALNIVGAVTLFIVWVAIVVTYNKDDGQKCPKVRDTGYRLGTGFALLVAAW
                     ILDILNIIFLLLPCTVPATKANEKPESPTAQE"
     gene            complement(<734394..>736388)
                     /locus_tag="LMJF_34_1630"
                     /db_xref="GeneID:5654929"
     mRNA            complement(<734394..>736388)
                     /locus_tag="LMJF_34_1630"
                     /product="tuzin-like protein"
                     /transcript_id="XM_001686208.1"
                     /db_xref="GeneID:5654929"
     CDS             complement(734394..736388)
                     /locus_tag="LMJF_34_1630"
                     /codon_start=1
                     /product="tuzin-like protein"
                     /protein_id="XP_001686260.1"
                     /db_xref="GeneID:5654929"
                     /db_xref="UniProtKB/TrEMBL:Q4Q342"
                     /translation="MMALTLDPRWNAMRRGIAGIGVCAVDGRGGAAAPGSCRLSLCSC
                     LSPASSGGCGGADSALSEGGHCRECVCGMRGRLPSPKKPWNSLAGVLVGVRVTHAASV
                     LEDRPVALGRLVSRLSEAAYKAEMLRTGKRDRDGEDRRGDAAQLLVVDAGTRVTVRTE
                     GDPASGAAVAPSAMHMKGTIAKVNGNATYIILMEKGEVELSVASERIVALQPRKKLLQ
                     SARLVALVNWLRSCVHDPRDVEAIALVLFSRGWRAERMYLLEGVDLLPFVFVSRVELD
                     SVSEKARWERDHDKAMQMLRRERVKDTNFRYALAKYKGTMSCIAGVLVVAYVFTANLR
                     AYRRQQRGHQLRTAIETLSKAARPRKEEGMLAAAAEAFEVRREDEEALVRSVLTQMAP
                     SHPRIVALAGGSGGGRCVPCRRAVRVEGVALVHVDVGGTEDTLRSVVRALGVSNVEVC
                     GDLLGFVEEAMRGATVKASDGVPFLVMRLREGSDLGRVYGEVVSLVSDCQACHIVLAV
                     PMKALTPLNVSSRRLDFYCIPPFSRRQAFAYAEHTLDALDLVCFVEVVGTRSSDVDEL
                     CAALRQRGVDPVTYTSLMLARAMRRLQAALGPPGSPARAAIRQLASMPFADGVRDDAT
                     GAMSVLGQPDVQEMVLYDPVQHEWRFAQQVYHTAARCILI"
     gene            complement(<739148..>739723)
                     /locus_tag="LMJF_34_1640"
                     /db_xref="GeneID:5654930"
     mRNA            complement(<739148..>739723)
                     /locus_tag="LMJF_34_1640"
                     /product="putative amastin-like surface protein"
                     /transcript_id="XM_001686209.1"
                     /db_xref="GeneID:5654930"
     CDS             complement(739148..739723)
                     /locus_tag="LMJF_34_1640"
                     /codon_start=1
                     /product="putative amastin-like surface protein"
                     /protein_id="XP_001686261.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654930"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4Q337"
                     /translation="MKRSIPLVVYVVVQFVAFLLVLAGTSADMFRIPRGSLPTLCITL
                     WGLRLTCNSSGYAAYIDATFRPCPHRIARFRLAQAFALISILVYGAAFVLGLVLLFYC
                     SLLRLVCLVLNIVGVVTLCVVWAAIAVTYNKDDRSFCRGLKVTGHYAAGFFLLVVAWI
                     LDILNIIFLLLPLQMRGSQDCANSMDYTEQD"
     gene            complement(<741995..>743989)
                     /locus_tag="LMJF_34_1650"
                     /db_xref="GeneID:5654931"
     mRNA            complement(<741995..>743989)
                     /locus_tag="LMJF_34_1650"
                     /product="tuzin-like protein"
                     /transcript_id="XM_001686210.1"
                     /db_xref="GeneID:5654931"
     CDS             complement(741995..743989)
                     /locus_tag="LMJF_34_1650"
                     /codon_start=1
                     /product="tuzin-like protein"
                     /protein_id="XP_001686262.1"
                     /db_xref="GeneID:5654931"
                     /db_xref="UniProtKB/TrEMBL:Q4Q342"
                     /translation="MMALTLDPRWNAMRRGIAGIGVCAVDGRGGAAAPGSCRLSLCSC
                     LSPASSGGCGGADSALSEGGHCRECVCGMRGRLPSPKKPWNSLAGVLVGVRVTHAASV
                     LEDRPVALGRLVSRLSEAAYKAEMLRTGKRDRDGEDRRGDAAQLLVVDAGTRVTVRTE
                     GDPASGAAVAPSAMHMKGTIAKVNGNATYIILMEKGEVELSVASERIVALQPRKKLLQ
                     SARLVALVNWLRSCVHDPRDVEAIALVLFSRGWRAERMYLLEGVDLLPFVFVSRVELD
                     SVSEKARWERDHDKAMQMLRRERVKDTNFRYALAKYKGTMSCIAGVLVVAYVFTANLR
                     AYRRQQRGHQLRTAIETLSKAARPRKEEGMLAAAAEAFEVRREDEEALVRSVLTQMAP
                     SHPRIVALAGGSGGGRCVPCRRAVRVEGVALVHVDVGGTEDTLRSVVRALGVSNVEVC
                     GDLLGFVEEAMRGATVKASDGVPFLVMRLREGSDLGRVYGEVVSLVSDCQACHIVLAV
                     PMKALTPLNVSSRRLDFYCIPPFSRRQAFAYAEHTLDALDLVCFVEVVGTRSSDVDEL
                     CAALRQRGVDPVTYTSLMLARAMRRLQAALGPPGSPARAAIRQLASMPFADGVRDDAT
                     GAMSVLGQPDVQEMVLYDPVQHEWRFAQQVYHTAARCILI"
     gene            complement(<746747..>747325)
                     /locus_tag="LMJF_34_1660"
                     /db_xref="GeneID:5654932"
     mRNA            complement(<746747..>747325)
                     /locus_tag="LMJF_34_1660"
                     /product="putative amastin-like surface protein"
                     /transcript_id="XM_001686211.1"
                     /db_xref="GeneID:5654932"
     CDS             complement(746747..747325)
                     /locus_tag="LMJF_34_1660"
                     /codon_start=1
                     /product="putative amastin-like surface protein"
                     /protein_id="XP_001686263.1"
                     /db_xref="GeneID:5654932"
                     /db_xref="GOA:Q4Q335"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4Q335"
                     /translation="MKCSIPLVVYVVVQFVAFLLVLVGTPLDMFRAHNRPGVAQCLTL
                     FGFKLDCKGLQYDQTVDMQWIECPARITLFRLAQGCAIISILVYGAAFVLGLVLLYGC
                     TIHRWVCLALNIVGAVTLFIVWVAIVVTYNKDDGQKCPKVRDTGYRLGTGFALLVAAW
                     ILDILNIIFLLLPCTVPATKANEKPESPTAQE"
     gene            complement(<749524..>751518)
                     /locus_tag="LMJF_34_1670"
                     /db_xref="GeneID:5654933"
     mRNA            complement(<749524..>751518)
                     /locus_tag="LMJF_34_1670"
                     /product="tuzin-like protein"
                     /transcript_id="XM_001686212.1"
                     /db_xref="GeneID:5654933"
     CDS             complement(749524..751518)
                     /locus_tag="LMJF_34_1670"
                     /codon_start=1
                     /product="tuzin-like protein"
                     /protein_id="XP_001686264.1"
                     /db_xref="GeneID:5654933"
                     /db_xref="UniProtKB/TrEMBL:Q4Q342"
                     /translation="MMALTLDPRWNAMRRGIAGIGVCAVDGRGGAAAPGSCRLSLCSC
                     LSPASSGGCGGADSALSEGGHCRECVCGMRGRLPSPKKPWNSLAGVLVGVRVTHAASV
                     LEDRPVALGRLVSRLSEAAYKAEMLRTGKRDRDGEDRRGDAAQLLVVDAGTRVTVRTE
                     GDPASGAAVAPSAMHMKGTIAKVNGNATYIILMEKGEVELSVASERIVALQPRKKLLQ
                     SARLVALVNWLRSCVHDPRDVEAIALVLFSRGWRAERMYLLEGVDLLPFVFVSRVELD
                     SVSEKARWERDHDKAMQMLRRERVKDTNFRYALAKYKGTMSCIAGVLVVAYVFTANLR
                     AYRRQQRGHQLRTAIETLSKAARPRKEEGMLAAAAEAFEVRREDEEALVRSVLTQMAP
                     SHPRIVALAGGSGGGRCVPCRRAVRVEGVALVHVDVGGTEDTLRSVVRALGVSNVEVC
                     GDLLGFVEEAMRGATVKASDGVPFLVMRLREGSDLGRVYGEVVSLVSDCQACHIVLAV
                     PMKALTPLNVSSRRLDFYCIPPFSRRQAFAYAEHTLDALDLVCFVEVVGTRSSDVDEL
                     CAALRQRGVDPVTYTSLMLARAMRRLQAALGPPGSPARAAIRQLASMPFADGVRDDAT
                     GAMSVLGQPDVQEMVLYDPVQHEWRFAQQVYHTAARCILI"
     gene            complement(<754286..>754864)
                     /locus_tag="LMJF_34_1680"
                     /db_xref="GeneID:5654934"
     mRNA            complement(<754286..>754864)
                     /locus_tag="LMJF_34_1680"
                     /product="putative amastin-like surface protein"
                     /transcript_id="XM_001686213.1"
                     /db_xref="GeneID:5654934"
     CDS             complement(754286..754864)
                     /locus_tag="LMJF_34_1680"
                     /codon_start=1
                     /product="putative amastin-like surface protein"
                     /protein_id="XP_001686265.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654934"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4Q333"
                     /translation="MKCSIPLVVYVVVQFVAFLLVLVGTPLEIFRAPNRPGVAQCLTL
                     FGLKFDCESLEYLETVDMQWIECPARITLFRLAQGCAIISILVYGAAFVLGLVLLYGC
                     TIYRWVCLALNIVGAVTLFIVWVAIVVTYNKDDGQKCPKVRDTGYRLGTGFALLVAAW
                     ILDILNIIFLLLPCTVPATKANEKPESPTAQE"
     gene            complement(<757053..>759047)
                     /locus_tag="LMJF_34_1690"
                     /db_xref="GeneID:5654935"
     mRNA            complement(<757053..>759047)
                     /locus_tag="LMJF_34_1690"
                     /product="tuzin-like protein"
                     /transcript_id="XM_001686214.1"
                     /db_xref="GeneID:5654935"
     CDS             complement(757053..759047)
                     /locus_tag="LMJF_34_1690"
                     /codon_start=1
                     /product="tuzin-like protein"
                     /protein_id="XP_001686266.1"
                     /db_xref="GeneID:5654935"
                     /db_xref="UniProtKB/TrEMBL:Q4Q342"
                     /translation="MMALTLDPRWNAMRRGIAGIGVCAVDGRGGAAAPGSCRLSLCSC
                     LSPASSGGCGGADSALSEGGHCRECVCGMRGRLPSPKKPWNSLAGVLVGVRVTHAASV
                     LEDRPVALGRLVSRLSEAAYKAEMLRTGKRDRDGEDRRGDAAQLLVVDAGTRVTVRTE
                     GDPASGAAVAPSAMHMKGTIAKVNGNATYIILMEKGEVELSVASERIVALQPRKKLLQ
                     SARLVALVNWLRSCVHDPRDVEAIALVLFSRGWRAERMYLLEGVDLLPFVFVSRVELD
                     SVSEKARWERDHDKAMQMLRRERVKDTNFRYALAKYKGTMSCIAGVLVVAYVFTANLR
                     AYRRQQRGHQLRTAIETLSKAARPRKEEGMLAAAAEAFEVRREDEEALVRSVLTQMAP
                     SHPRIVALAGGSGGGRCVPCRRAVRVEGVALVHVDVGGTEDTLRSVVRALGVSNVEVC
                     GDLLGFVEEAMRGATVKASDGVPFLVMRLREGSDLGRVYGEVVSLVSDCQACHIVLAV
                     PMKALTPLNVSSRRLDFYCIPPFSRRQAFAYAEHTLDALDLVCFVEVVGTRSSDVDEL
                     CAALRQRGVDPVTYTSLMLARAMRRLQAALGPPGSPARAAIRQLASMPFADGVRDDAT
                     GAMSVLGQPDVQEMVLYDPVQHEWRFAQQVYHTAARCILI"
     gene            complement(<761789..>762403)
                     /locus_tag="LMJF_34_1700"
                     /db_xref="GeneID:5654936"
     mRNA            complement(<761789..>762403)
                     /locus_tag="LMJF_34_1700"
                     /product="putative amastin-like surface protein"
                     /transcript_id="XM_001686215.1"
                     /db_xref="GeneID:5654936"
     CDS             complement(761789..762403)
                     /locus_tag="LMJF_34_1700"
                     /codon_start=1
                     /product="putative amastin-like surface protein"
                     /protein_id="XP_001686267.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1700"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1760"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1780"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1800"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1820"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1860"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1940"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654936"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4Q325"
                     /translation="MKCSIPLVVYVVVQFVAFLLVLVGTPLEMFRAPNRPGVAQCLTL
                     FGFKLDCKSLEYEETVDMQWLNCPARIARFRLAQAFTLISILVYGAAFVLGLVLLYGC
                     TIHRWVCLALNIVGAVTLCVVWVAMVVTYKKPDEPLCREVRNMGYRFGTGFALLVVAW
                     ILDILNIIFLLLPLQMRGSQDCANSMESQRTNNSKQATGSGGRA"
     gene            complement(<764602..>766596)
                     /locus_tag="LMJF_34_1710"
                     /db_xref="GeneID:5654937"
     mRNA            complement(<764602..>766596)
                     /locus_tag="LMJF_34_1710"
                     /product="tuzin-like protein"
                     /transcript_id="XM_001686216.1"
                     /db_xref="GeneID:5654937"
     CDS             complement(764602..766596)
                     /locus_tag="LMJF_34_1710"
                     /codon_start=1
                     /product="tuzin-like protein"
                     /protein_id="XP_001686268.1"
                     /db_xref="GeneID:5654937"
                     /db_xref="UniProtKB/TrEMBL:Q4Q342"
                     /translation="MMALTLDPRWNAMRRGIAGIGVCAVDGRGGAAAPGSCRLSLCSC
                     LSPASSGGCGGADSALSEGGHCRECVCGMRGRLPSPKKPWNSLAGVLVGVRVTHAASV
                     LEDRPVALGRLVSRLSEAAYKAEMLRTGKRDRDGEDRRGDAAQLLVVDAGTRVTVRTE
                     GDPASGAAVAPSAMHMKGTIAKVNGNATYIILMEKGEVELSVASERIVALQPRKKLLQ
                     SARLVALVNWLRSCVHDPRDVEAIALVLFSRGWRAERMYLLEGVDLLPFVFVSRVELD
                     SVSEKARWERDHDKAMQMLRRERVKDTNFRYALAKYKGTMSCIAGVLVVAYVFTANLR
                     AYRRQQRGHQLRTAIETLSKAARPRKEEGMLAAAAEAFEVRREDEEALVRSVLTQMAP
                     SHPRIVALAGGSGGGRCVPCRRAVRVEGVALVHVDVGGTEDTLRSVVRALGVSNVEVC
                     GDLLGFVEEAMRGATVKASDGVPFLVMRLREGSDLGRVYGEVVSLVSDCQACHIVLAV
                     PMKALTPLNVSSRRLDFYCIPPFSRRQAFAYAEHTLDALDLVCFVEVVGTRSSDVDEL
                     CAALRQRGVDPVTYTSLMLARAMRRLQAALGPPGSPARAAIRQLASMPFADGVRDDAT
                     GAMSVLGQPDVQEMVLYDPVQHEWRFAQQVYHTAARCILI"
     gene            complement(<769367..>769945)
                     /locus_tag="LMJF_34_1720"
                     /db_xref="GeneID:5654938"
     mRNA            complement(<769367..>769945)
                     /locus_tag="LMJF_34_1720"
                     /product="putative amastin-like surface protein"
                     /transcript_id="XM_001686217.1"
                     /db_xref="GeneID:5654938"
     CDS             complement(769367..769945)
                     /locus_tag="LMJF_34_1720"
                     /codon_start=1
                     /product="putative amastin-like surface protein"
                     /protein_id="XP_001686269.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654938"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4Q329"
                     /translation="MKCSIPLVVYVVVQFVAFLLVLVGTPLEMFRAPNRPGVAQCLTL
                     FGFKLDCKSLEYEETVDMQWLNCPARIARFRLAQAFTLISILVYGAAFVLGLVLLYGC
                     TIHRWVCLALNIVGAVTLCVVWVAMVVTYKKPDEPLCREVRNMGYRFGTGFALLVVAW
                     ILDILNMIILLLPCTVPATKANEKPESPTAQE"
     gene            complement(<772144..>774138)
                     /locus_tag="LMJF_34_1730"
                     /db_xref="GeneID:5654939"
     mRNA            complement(<772144..>774138)
                     /locus_tag="LMJF_34_1730"
                     /product="tuzin-like protein"
                     /transcript_id="XM_001686218.1"
                     /db_xref="GeneID:5654939"
     CDS             complement(772144..774138)
                     /locus_tag="LMJF_34_1730"
                     /codon_start=1
                     /product="tuzin-like protein"
                     /protein_id="XP_001686270.1"
                     /db_xref="GeneID:5654939"
                     /db_xref="UniProtKB/TrEMBL:Q4Q342"
                     /translation="MMALTLDPRWNAMRRGIAGIGVCAVDGRGGAAAPGSCRLSLCSC
                     LSPASSGGCGGADSALSEGGHCRECVCGMRGRLPSPKKPWNSLAGVLVGVRVTHAASV
                     LEDRPVALGRLVSRLSEAAYKAEMLRTGKRDRDGEDRRGDAAQLLVVDAGTRVTVRTE
                     GDPASGAAVAPSAMHMKGTIAKVNGNATYIILMEKGEVELSVASERIVALQPRKKLLQ
                     SARLVALVNWLRSCVHDPRDVEAIALVLFSRGWRAERMYLLEGVDLLPFVFVSRVELD
                     SVSEKARWERDHDKAMQMLRRERVKDTNFRYALAKYKGTMSCIAGVLVVAYVFTANLR
                     AYRRQQRGHQLRTAIETLSKAARPRKEEGMLAAAAEAFEVRREDEEALVRSVLTQMAP
                     SHPRIVALAGGSGGGRCVPCRRAVRVEGVALVHVDVGGTEDTLRSVVRALGVSNVEVC
                     GDLLGFVEEAMRGATVKASDGVPFLVMRLREGSDLGRVYGEVVSLVSDCQACHIVLAV
                     PMKALTPLNVSSRRLDFYCIPPFSRRQAFAYAEHTLDALDLVCFVEVVGTRSSDVDEL
                     CAALRQRGVDPVTYTSLMLARAMRRLQAALGPPGSPARAAIRQLASMPFADGVRDDAT
                     GAMSVLGQPDVQEMVLYDPVQHEWRFAQQVYHTAARCILI"
     gene            complement(<776904..>777479)
                     /locus_tag="LMJF_34_1740"
                     /db_xref="GeneID:5654940"
     mRNA            complement(<776904..>777479)
                     /locus_tag="LMJF_34_1740"
                     /product="putative amastin-like surface protein"
                     /transcript_id="XM_001686219.1"
                     /db_xref="GeneID:5654940"
     CDS             complement(776904..777479)
                     /locus_tag="LMJF_34_1740"
                     /codon_start=1
                     /product="putative amastin-like surface protein"
                     /protein_id="XP_001686271.1"
                     /db_xref="GeneID:5654940"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4Q327"
                     /translation="MAYSIPLVVYVVVQFVALLLVLVGTPVDMFRMPSTGFDTSCITL
                     WGERFTCTSSGYFSYIDETFHNCPQRLTHFRIAQAFAIISIFVYFAAFVMGLVLLYGC
                     TIHRWVCLALNIVGAVTLFIVWAAMVVTYNKGESPRCPPLKEVSYYAAGFVLFLLAWI
                     LDILNMIILLLPCTVPATKANEKPESPTAQE"
     gene            complement(<779677..>781671)
                     /locus_tag="LMJF_34_1750"
                     /db_xref="GeneID:5654941"
     mRNA            complement(<779677..>781671)
                     /locus_tag="LMJF_34_1750"
                     /product="tuzin-like protein"
                     /transcript_id="XM_001686220.1"
                     /db_xref="GeneID:5654941"
     CDS             complement(779677..781671)
                     /locus_tag="LMJF_34_1750"
                     /codon_start=1
                     /product="tuzin-like protein"
                     /protein_id="XP_001686272.1"
                     /db_xref="GeneID:5654941"
                     /db_xref="UniProtKB/TrEMBL:Q4Q342"
                     /translation="MMALTLDPRWNAMRRGIAGIGVCAVDGRGGAAAPGSCRLSLCSC
                     LSPASSGGCGGADSALSEGGHCRECVCGMRGRLPSPKKPWNSLAGVLVGVRVTHAASV
                     LEDRPVALGRLVSRLSEAAYKAEMLRTGKRDRDGEDRRGDAAQLLVVDAGTRVTVRTE
                     GDPASGAAVAPSAMHMKGTIAKVNGNATYIILMEKGEVELSVASERIVALQPRKKLLQ
                     SARLVALVNWLRSCVHDPRDVEAIALVLFSRGWRAERMYLLEGVDLLPFVFVSRVELD
                     SVSEKARWERDHDKAMQMLRRERVKDTNFRYALAKYKGTMSCIAGVLVVAYVFTANLR
                     AYRRQQRGHQLRTAIETLSKAARPRKEEGMLAAAAEAFEVRREDEEALVRSVLTQMAP
                     SHPRIVALAGGSGGGRCVPCRRAVRVEGVALVHVDVGGTEDTLRSVVRALGVSNVEVC
                     GDLLGFVEEAMRGATVKASDGVPFLVMRLREGSDLGRVYGEVVSLVSDCQACHIVLAV
                     PMKALTPLNVSSRRLDFYCIPPFSRRQAFAYAEHTLDALDLVCFVEVVGTRSSDVDEL
                     CAALRQRGVDPVTYTSLMLARAMRRLQAALGPPGSPARAAIRQLASMPFADGVRDDAT
                     GAMSVLGQPDVQEMVLYDPVQHEWRFAQQVYHTAARCILI"
     gene            complement(<784403..>785017)
                     /locus_tag="LMJF_34_1760"
                     /db_xref="GeneID:5654942"
     mRNA            complement(<784403..>785017)
                     /locus_tag="LMJF_34_1760"
                     /product="putative amastin-like surface protein"
                     /transcript_id="XM_001686221.1"
                     /db_xref="GeneID:5654942"
     CDS             complement(784403..785017)
                     /locus_tag="LMJF_34_1760"
                     /codon_start=1
                     /product="putative amastin-like surface protein"
                     /protein_id="XP_001686273.1"
                     /db_xref="GeneID:5654942"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4Q325"
                     /translation="MKCSIPLVVYVVVQFVAFLLVLVGTPLEMFRAPNRPGVAQCLTL
                     FGFKLDCKSLEYEETVDMQWLNCPARIARFRLAQAFTLISILVYGAAFVLGLVLLYGC
                     TIHRWVCLALNIVGAVTLCVVWVAMVVTYKKPDEPLCREVRNMGYRFGTGFALLVVAW
                     ILDILNIIFLLLPLQMRGSQDCANSMESQRTNNSKQATGSGGRA"
     gene            complement(<787216..>789210)
                     /locus_tag="LMJF_34_1770"
                     /db_xref="GeneID:5654943"
     mRNA            complement(<787216..>789210)
                     /locus_tag="LMJF_34_1770"
                     /product="tuzin-like protein"
                     /transcript_id="XM_001686222.1"
                     /db_xref="GeneID:5654943"
     CDS             complement(787216..789210)
                     /locus_tag="LMJF_34_1770"
                     /codon_start=1
                     /product="tuzin-like protein"
                     /protein_id="XP_001686274.1"
                     /db_xref="GeneID:5654943"
                     /db_xref="UniProtKB/TrEMBL:Q4Q342"
                     /translation="MMALTLDPRWNAMRRGIAGIGVCAVDGRGGAAAPGSCRLSLCSC
                     LSPASSGGCGGADSALSEGGHCRECVCGMRGRLPSPKKPWNSLAGVLVGVRVTHAASV
                     LEDRPVALGRLVSRLSEAAYKAEMLRTGKRDRDGEDRRGDAAQLLVVDAGTRVTVRTE
                     GDPASGAAVAPSAMHMKGTIAKVNGNATYIILMEKGEVELSVASERIVALQPRKKLLQ
                     SARLVALVNWLRSCVHDPRDVEAIALVLFSRGWRAERMYLLEGVDLLPFVFVSRVELD
                     SVSEKARWERDHDKAMQMLRRERVKDTNFRYALAKYKGTMSCIAGVLVVAYVFTANLR
                     AYRRQQRGHQLRTAIETLSKAARPRKEEGMLAAAAEAFEVRREDEEALVRSVLTQMAP
                     SHPRIVALAGGSGGGRCVPCRRAVRVEGVALVHVDVGGTEDTLRSVVRALGVSNVEVC
                     GDLLGFVEEAMRGATVKASDGVPFLVMRLREGSDLGRVYGEVVSLVSDCQACHIVLAV
                     PMKALTPLNVSSRRLDFYCIPPFSRRQAFAYAEHTLDALDLVCFVEVVGTRSSDVDEL
                     CAALRQRGVDPVTYTSLMLARAMRRLQAALGPPGSPARAAIRQLASMPFADGVRDDAT
                     GAMSVLGQPDVQEMVLYDPVQHEWRFAQQVYHTAARCILI"
     gene            complement(<791956..>792570)
                     /locus_tag="LMJF_34_1780"
                     /db_xref="GeneID:5654944"
     mRNA            complement(<791956..>792570)
                     /locus_tag="LMJF_34_1780"
                     /product="putative amastin-like surface protein"
                     /transcript_id="XM_001686223.1"
                     /db_xref="GeneID:5654944"
     CDS             complement(791956..792570)
                     /locus_tag="LMJF_34_1780"
                     /codon_start=1
                     /product="putative amastin-like surface protein"
                     /protein_id="XP_001686275.1"
                     /db_xref="GeneID:5654944"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4Q325"
                     /translation="MKCSIPLVVYVVVQFVAFLLVLVGTPLEMFRAPNRPGVAQCLTL
                     FGFKLDCKSLEYEETVDMQWLNCPARIARFRLAQAFTLISILVYGAAFVLGLVLLYGC
                     TIHRWVCLALNIVGAVTLCVVWVAMVVTYKKPDEPLCREVRNMGYRFGTGFALLVVAW
                     ILDILNIIFLLLPLQMRGSQDCANSMESQRTNNSKQATGSGGRA"
     gene            complement(<794769..>796763)
                     /locus_tag="LMJF_34_1790"
                     /db_xref="GeneID:5654945"
     mRNA            complement(<794769..>796763)
                     /locus_tag="LMJF_34_1790"
                     /product="tuzin-like protein"
                     /transcript_id="XM_001686224.1"
                     /db_xref="GeneID:5654945"
     CDS             complement(794769..796763)
                     /locus_tag="LMJF_34_1790"
                     /codon_start=1
                     /product="tuzin-like protein"
                     /protein_id="XP_001686276.1"
                     /db_xref="GeneID:5654945"
                     /db_xref="UniProtKB/TrEMBL:Q4Q342"
                     /translation="MMALTLDPRWNAMRRGIAGIGVCAVDGRGGAAAPGSCRLSLCSC
                     LSPASSGGCGGADSALSEGGHCRECVCGMRGRLPSPKKPWNSLAGVLVGVRVTHAASV
                     LEDRPVALGRLVSRLSEAAYKAEMLRTGKRDRDGEDRRGDAAQLLVVDAGTRVTVRTE
                     GDPASGAAVAPSAMHMKGTIAKVNGNATYIILMEKGEVELSVASERIVALQPRKKLLQ
                     SARLVALVNWLRSCVHDPRDVEAIALVLFSRGWRAERMYLLEGVDLLPFVFVSRVELD
                     SVSEKARWERDHDKAMQMLRRERVKDTNFRYALAKYKGTMSCIAGVLVVAYVFTANLR
                     AYRRQQRGHQLRTAIETLSKAARPRKEEGMLAAAAEAFEVRREDEEALVRSVLTQMAP
                     SHPRIVALAGGSGGGRCVPCRRAVRVEGVALVHVDVGGTEDTLRSVVRALGVSNVEVC
                     GDLLGFVEEAMRGATVKASDGVPFLVMRLREGSDLGRVYGEVVSLVSDCQACHIVLAV
                     PMKALTPLNVSSRRLDFYCIPPFSRRQAFAYAEHTLDALDLVCFVEVVGTRSSDVDEL
                     CAALRQRGVDPVTYTSLMLARAMRRLQAALGPPGSPARAAIRQLASMPFADGVRDDAT
                     GAMSVLGQPDVQEMVLYDPVQHEWRFAQQVYHTAARCILI"
     gene            complement(<799498..>800112)
                     /locus_tag="LMJF_34_1800"
                     /db_xref="GeneID:5654946"
     mRNA            complement(<799498..>800112)
                     /locus_tag="LMJF_34_1800"
                     /product="putative amastin-like surface protein"
                     /transcript_id="XM_001686225.1"
                     /db_xref="GeneID:5654946"
     CDS             complement(799498..800112)
                     /locus_tag="LMJF_34_1800"
                     /codon_start=1
                     /product="putative amastin-like surface protein"
                     /protein_id="XP_001686277.1"
                     /db_xref="GeneID:5654946"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4Q325"
                     /translation="MKCSIPLVVYVVVQFVAFLLVLVGTPLEMFRAPNRPGVAQCLTL
                     FGFKLDCKSLEYEETVDMQWLNCPARIARFRLAQAFTLISILVYGAAFVLGLVLLYGC
                     TIHRWVCLALNIVGAVTLCVVWVAMVVTYKKPDEPLCREVRNMGYRFGTGFALLVVAW
                     ILDILNIIFLLLPLQMRGSQDCANSMESQRTNNSKQATGSGGRA"
     gene            complement(<802311..>804305)
                     /locus_tag="LMJF_34_1810"
                     /db_xref="GeneID:5654947"
     mRNA            complement(<802311..>804305)
                     /locus_tag="LMJF_34_1810"
                     /product="tuzin-like protein"
                     /transcript_id="XM_001686226.1"
                     /db_xref="GeneID:5654947"
     CDS             complement(802311..804305)
                     /locus_tag="LMJF_34_1810"
                     /codon_start=1
                     /product="tuzin-like protein"
                     /protein_id="XP_001686278.1"
                     /db_xref="GeneID:5654947"
                     /db_xref="UniProtKB/TrEMBL:Q4Q342"
                     /translation="MMALTLDPRWNAMRRGIAGIGVCAVDGRGGAAAPGSCRLSLCSC
                     LSPASSGGCGGADSALSEGGHCRECVCGMRGRLPSPKKPWNSLAGVLVGVRVTHAASV
                     LEDRPVALGRLVSRLSEAAYKAEMLRTGKRDRDGEDRRGDAAQLLVVDAGTRVTVRTE
                     GDPASGAAVAPSAMHMKGTIAKVNGNATYIILMEKGEVELSVASERIVALQPRKKLLQ
                     SARLVALVNWLRSCVHDPRDVEAIALVLFSRGWRAERMYLLEGVDLLPFVFVSRVELD
                     SVSEKARWERDHDKAMQMLRRERVKDTNFRYALAKYKGTMSCIAGVLVVAYVFTANLR
                     AYRRQQRGHQLRTAIETLSKAARPRKEEGMLAAAAEAFEVRREDEEALVRSVLTQMAP
                     SHPRIVALAGGSGGGRCVPCRRAVRVEGVALVHVDVGGTEDTLRSVVRALGVSNVEVC
                     GDLLGFVEEAMRGATVKASDGVPFLVMRLREGSDLGRVYGEVVSLVSDCQACHIVLAV
                     PMKALTPLNVSSRRLDFYCIPPFSRRQAFAYAEHTLDALDLVCFVEVVGTRSSDVDEL
                     CAALRQRGVDPVTYTSLMLARAMRRLQAALGPPGSPARAAIRQLASMPFADGVRDDAT
                     GAMSVLGQPDVQEMVLYDPVQHEWRFAQQVYHTAARCILI"
     gene            complement(<807037..>807651)
                     /locus_tag="LMJF_34_1820"
                     /db_xref="GeneID:5654948"
     mRNA            complement(<807037..>807651)
                     /locus_tag="LMJF_34_1820"
                     /product="putative amastin-like surface protein"
                     /transcript_id="XM_001686227.1"
                     /db_xref="GeneID:5654948"
     CDS             complement(807037..807651)
                     /locus_tag="LMJF_34_1820"
                     /codon_start=1
                     /product="putative amastin-like surface protein"
                     /protein_id="XP_001686279.1"
                     /db_xref="GeneID:5654948"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4Q325"
                     /translation="MKCSIPLVVYVVVQFVAFLLVLVGTPLEMFRAPNRPGVAQCLTL
                     FGFKLDCKSLEYEETVDMQWLNCPARIARFRLAQAFTLISILVYGAAFVLGLVLLYGC
                     TIHRWVCLALNIVGAVTLCVVWVAMVVTYKKPDEPLCREVRNMGYRFGTGFALLVVAW
                     ILDILNIIFLLLPLQMRGSQDCANSMESQRTNNSKQATGSGGRA"
     gene            complement(<809850..>811844)
                     /locus_tag="LMJF_34_1830"
                     /db_xref="GeneID:5654949"
     mRNA            complement(<809850..>811844)
                     /locus_tag="LMJF_34_1830"
                     /product="tuzin-like protein"
                     /transcript_id="XM_001686228.1"
                     /db_xref="GeneID:5654949"
     CDS             complement(809850..811844)
                     /locus_tag="LMJF_34_1830"
                     /codon_start=1
                     /product="tuzin-like protein"
                     /protein_id="XP_001686280.1"
                     /db_xref="GeneID:5654949"
                     /db_xref="UniProtKB/TrEMBL:Q4Q342"
                     /translation="MMALTLDPRWNAMRRGIAGIGVCAVDGRGGAAAPGSCRLSLCSC
                     LSPASSGGCGGADSALSEGGHCRECVCGMRGRLPSPKKPWNSLAGVLVGVRVTHAASV
                     LEDRPVALGRLVSRLSEAAYKAEMLRTGKRDRDGEDRRGDAAQLLVVDAGTRVTVRTE
                     GDPASGAAVAPSAMHMKGTIAKVNGNATYIILMEKGEVELSVASERIVALQPRKKLLQ
                     SARLVALVNWLRSCVHDPRDVEAIALVLFSRGWRAERMYLLEGVDLLPFVFVSRVELD
                     SVSEKARWERDHDKAMQMLRRERVKDTNFRYALAKYKGTMSCIAGVLVVAYVFTANLR
                     AYRRQQRGHQLRTAIETLSKAARPRKEEGMLAAAAEAFEVRREDEEALVRSVLTQMAP
                     SHPRIVALAGGSGGGRCVPCRRAVRVEGVALVHVDVGGTEDTLRSVVRALGVSNVEVC
                     GDLLGFVEEAMRGATVKASDGVPFLVMRLREGSDLGRVYGEVVSLVSDCQACHIVLAV
                     PMKALTPLNVSSRRLDFYCIPPFSRRQAFAYAEHTLDALDLVCFVEVVGTRSSDVDEL
                     CAALRQRGVDPVTYTSLMLARAMRRLQAALGPPGSPARAAIRQLASMPFADGVRDDAT
                     GAMSVLGQPDVQEMVLYDPVQHEWRFAQQVYHTAARCILI"
     gene            complement(<814597..>815205)
                     /locus_tag="LMJF_34_1840"
                     /db_xref="GeneID:5654950"
     mRNA            complement(<814597..>815205)
                     /locus_tag="LMJF_34_1840"
                     /product="putative amastin-like surface protein"
                     /transcript_id="XM_001686229.1"
                     /db_xref="GeneID:5654950"
     CDS             complement(814597..815205)
                     /locus_tag="LMJF_34_1840"
                     /codon_start=1
                     /product="putative amastin-like surface protein"
                     /protein_id="XP_001686281.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654950"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4Q317"
                     /translation="MKRSIPLVVYVVVQFVAFLLVLVGTPLDIFRGVNPQVLGNLMVC
                     ITLFGVKVDCYNTTYAESAEVLWADCLNRLNRFHVAQAFAIISILVYFAAFFFGLLLI
                     FCCPCLRWLCLALNIIGVVTLFIVWVAMVVTYYKDDNAACPKARNEFTFGIGFDLLMT
                     AWCVDIIAAILMLTYAVNPSWMNKNETSQQEKQGNYIYAQRG"
     gene            complement(<817133..>819127)
                     /locus_tag="LMJF_34_1850"
                     /db_xref="GeneID:5654951"
     mRNA            complement(<817133..>819127)
                     /locus_tag="LMJF_34_1850"
                     /product="tuzin-like protein"
                     /transcript_id="XM_001686230.1"
                     /db_xref="GeneID:5654951"
     CDS             complement(817133..819127)
                     /locus_tag="LMJF_34_1850"
                     /codon_start=1
                     /product="tuzin-like protein"
                     /protein_id="XP_001686282.1"
                     /db_xref="GeneID:5654951"
                     /db_xref="UniProtKB/TrEMBL:Q4Q342"
                     /translation="MMALTLDPRWNAMRRGIAGIGVCAVDGRGGAAAPGSCRLSLCSC
                     LSPASSGGCGGADSALSEGGHCRECVCGMRGRLPSPKKPWNSLAGVLVGVRVTHAASV
                     LEDRPVALGRLVSRLSEAAYKAEMLRTGKRDRDGEDRRGDAAQLLVVDAGTRVTVRTE
                     GDPASGAAVAPSAMHMKGTIAKVNGNATYIILMEKGEVELSVASERIVALQPRKKLLQ
                     SARLVALVNWLRSCVHDPRDVEAIALVLFSRGWRAERMYLLEGVDLLPFVFVSRVELD
                     SVSEKARWERDHDKAMQMLRRERVKDTNFRYALAKYKGTMSCIAGVLVVAYVFTANLR
                     AYRRQQRGHQLRTAIETLSKAARPRKEEGMLAAAAEAFEVRREDEEALVRSVLTQMAP
                     SHPRIVALAGGSGGGRCVPCRRAVRVEGVALVHVDVGGTEDTLRSVVRALGVSNVEVC
                     GDLLGFVEEAMRGATVKASDGVPFLVMRLREGSDLGRVYGEVVSLVSDCQACHIVLAV
                     PMKALTPLNVSSRRLDFYCIPPFSRRQAFAYAEHTLDALDLVCFVEVVGTRSSDVDEL
                     CAALRQRGVDPVTYTSLMLARAMRRLQAALGPPGSPARAAIRQLASMPFADGVRDDAT
                     GAMSVLGQPDVQEMVLYDPVQHEWRFAQQVYHTAARCILI"
     gene            complement(<821860..>822474)
                     /locus_tag="LMJF_34_1860"
                     /db_xref="GeneID:5654952"
     mRNA            complement(<821860..>822474)
                     /locus_tag="LMJF_34_1860"
                     /product="putative amastin-like surface protein"
                     /transcript_id="XM_001686231.1"
                     /db_xref="GeneID:5654952"
     CDS             complement(821860..822474)
                     /locus_tag="LMJF_34_1860"
                     /codon_start=1
                     /product="putative amastin-like surface protein"
                     /protein_id="XP_001686283.1"
                     /db_xref="GeneID:5654952"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4Q325"
                     /translation="MKCSIPLVVYVVVQFVAFLLVLVGTPLEMFRAPNRPGVAQCLTL
                     FGFKLDCKSLEYEETVDMQWLNCPARIARFRLAQAFTLISILVYGAAFVLGLVLLYGC
                     TIHRWVCLALNIVGAVTLCVVWVAMVVTYKKPDEPLCREVRNMGYRFGTGFALLVVAW
                     ILDILNIIFLLLPLQMRGSQDCANSMESQRTNNSKQATGSGGRA"
     gene            complement(<824673..>826667)
                     /locus_tag="LMJF_34_1870"
                     /db_xref="GeneID:5654953"
     mRNA            complement(<824673..>826667)
                     /locus_tag="LMJF_34_1870"
                     /product="tuzin-like protein"
                     /transcript_id="XM_001686232.1"
                     /db_xref="GeneID:5654953"
     CDS             complement(824673..826667)
                     /locus_tag="LMJF_34_1870"
                     /codon_start=1
                     /product="tuzin-like protein"
                     /protein_id="XP_001686284.1"
                     /db_xref="GeneID:5654953"
                     /db_xref="UniProtKB/TrEMBL:Q4Q342"
                     /translation="MMALTLDPRWNAMRRGIAGIGVCAVDGRGGAAAPGSCRLSLCSC
                     LSPASSGGCGGADSALSEGGHCRECVCGMRGRLPSPKKPWNSLAGVLVGVRVTHAASV
                     LEDRPVALGRLVSRLSEAAYKAEMLRTGKRDRDGEDRRGDAAQLLVVDAGTRVTVRTE
                     GDPASGAAVAPSAMHMKGTIAKVNGNATYIILMEKGEVELSVASERIVALQPRKKLLQ
                     SARLVALVNWLRSCVHDPRDVEAIALVLFSRGWRAERMYLLEGVDLLPFVFVSRVELD
                     SVSEKARWERDHDKAMQMLRRERVKDTNFRYALAKYKGTMSCIAGVLVVAYVFTANLR
                     AYRRQQRGHQLRTAIETLSKAARPRKEEGMLAAAAEAFEVRREDEEALVRSVLTQMAP
                     SHPRIVALAGGSGGGRCVPCRRAVRVEGVALVHVDVGGTEDTLRSVVRALGVSNVEVC
                     GDLLGFVEEAMRGATVKASDGVPFLVMRLREGSDLGRVYGEVVSLVSDCQACHIVLAV
                     PMKALTPLNVSSRRLDFYCIPPFSRRQAFAYAEHTLDALDLVCFVEVVGTRSSDVDEL
                     CAALRQRGVDPVTYTSLMLARAMRRLQAALGPPGSPARAAIRQLASMPFADGVRDDAT
                     GAMSVLGQPDVQEMVLYDPVQHEWRFAQQVYHTAARCILI"
     gene            complement(<829448..>830026)
                     /locus_tag="LMJF_34_1880"
                     /db_xref="GeneID:5654954"
     mRNA            complement(<829448..>830026)
                     /locus_tag="LMJF_34_1880"
                     /product="putative amastin-like surface protein"
                     /transcript_id="XM_001686233.1"
                     /db_xref="GeneID:5654954"
     CDS             complement(829448..830026)
                     /locus_tag="LMJF_34_1880"
                     /codon_start=1
                     /product="putative amastin-like surface protein"
                     /protein_id="XP_001686285.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654954"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4Q313"
                     /translation="MKCSIPLVVYVVVQFVAFLLVLVGTPLEIFRAHNRPGVAQCLTL
                     FGFKLDCKGLQYDQTVDMQWIECPARITLFRLAQGCAIISILVYGAAFVLGLVLLYGC
                     TIYRWVCLALNIVGAVTLFIVWVAIVVTYNKDDGQKCPKVRDTGYRLGTGFALLVAAW
                     ILDILNIIFLLLPCTVPATKANEKPESPTAQE"
     gene            complement(<832221..>834215)
                     /locus_tag="LMJF_34_1890"
                     /db_xref="GeneID:5654955"
     mRNA            complement(<832221..>834215)
                     /locus_tag="LMJF_34_1890"
                     /product="tuzin-like protein"
                     /transcript_id="XM_001686234.1"
                     /db_xref="GeneID:5654955"
     CDS             complement(832221..834215)
                     /locus_tag="LMJF_34_1890"
                     /codon_start=1
                     /product="tuzin-like protein"
                     /protein_id="XP_001686286.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654955"
                     /db_xref="UniProtKB/TrEMBL:Q4Q312"
                     /translation="MMALTLDPRWNAMRRGIAGIGVCAVDGRGGAAAPGSCRLSLCSC
                     LSPASSGGCGGADSALSEGGHCRECVCGMRGRLPSPKKPWNSLAGVLVGVRVTHAASV
                     LEDRPVALGRLVSRLSEAAYKAEMLRTGKRDRDGEDRRGDAAQLLVVDAGTRVTVRTE
                     GDPASGAAVAPSAMHMKGTIAKVNGNATYIILMEKGEVELSVASERIVALQPRKKLLQ
                     SARLVALVNWLRSCVHDPRDVEAIALVLFSRGWRAERMYLLEGVDLLPFVFVSRVELD
                     SVSEKARWERDHDKAMQMLRRERVKDTNFRYALAKYKGTMSCIAGVLVVAYVFTANLR
                     AYRRQQRGHQLRTAIETLSKAARPRKEEGMLAAAAEAFEVRREDEEALVRSVLTQMAP
                     SHSRIVALAGGSGGGRCVPCRRAVRVEGVALVHVDVGGTEDTLRSVVRALGVSNVEVC
                     GDLLGFVEEAMRGATVKASDGVPFLVMRLREGNDLGRVYGEVVSLVSDCQACHIVLAV
                     PMKALTPLNVSSRRLDFYCIPPFSRRQAFAYAEHTLDALDLVCFVEVVGTRSSDVDEL
                     CAALRQRGVDPVTYTSLMLARAMRRLQAALGPPGSPARAAIRQLASMPFADGVRDDAT
                     GAMSVLGQPDVQEMVLYDPVQHEWRLAQQVYHTAARCILI"
     gene            complement(<836985..>837560)
                     /locus_tag="LMJF_34_1900"
                     /db_xref="GeneID:5654956"
     mRNA            complement(<836985..>837560)
                     /locus_tag="LMJF_34_1900"
                     /product="putative amastin-like surface protein"
                     /transcript_id="XM_001686235.1"
                     /db_xref="GeneID:5654956"
     CDS             complement(836985..837560)
                     /locus_tag="LMJF_34_1900"
                     /codon_start=1
                     /product="putative amastin-like surface protein"
                     /protein_id="XP_001686287.1"
                     /db_xref="GeneID:5654956"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4Q327"
                     /translation="MAYSIPLVVYVVVQFVALLLVLVGTPVDMFRMPSTGFDTSCITL
                     WGERFTCTSSGYFSYIDETFHNCPQRLTHFRIAQAFAIISIFVYFAAFVMGLVLLYGC
                     TIHRWVCLALNIVGAVTLFIVWAAMVVTYNKGESPRCPPLKEVSYYAAGFVLFLLAWI
                     LDILNMIILLLPCTVPATKANEKPESPTAQE"
     gene            complement(<839756..>841750)
                     /locus_tag="LMJF_34_1910"
                     /db_xref="GeneID:5654957"
     mRNA            complement(<839756..>841750)
                     /locus_tag="LMJF_34_1910"
                     /product="tuzin-like protein"
                     /transcript_id="XM_001686236.1"
                     /db_xref="GeneID:5654957"
     CDS             complement(839756..841750)
                     /locus_tag="LMJF_34_1910"
                     /codon_start=1
                     /product="tuzin-like protein"
                     /protein_id="XP_001686288.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654957"
                     /db_xref="UniProtKB/TrEMBL:Q4Q310"
                     /translation="MMALTLDPRWNAMRRGIAGIGVCAVDGRGGAAAPGSCRLSLCSC
                     LSPASSGGCGGADSALSEGGHCRECVCGMRGRLPSPKKPWNSLAGVLVGVRVTHAASV
                     LEDRPVALGRLVSRLSEAAYKAEMLRTGKRDRDGEDRRGDAAQLLVVDAGTRVTVRTE
                     GDPASGAAVAPSAMHMKGTIAKVNGNATYIILMEKGEVELSVASERIVALQPRKKLLQ
                     SARLVALVNWLRSCVHDPRDVEAIALVLFSRGWRAERMYLLEGVDLLPFVFVSRVELD
                     SVSEKARWERDHDKAMQMLRRERVKDTNFRYALAKYKGTMSCIAGVLVVAYVFTANLR
                     AYRRQQRGHQLRTAIETLSKAARPRKEEGMLAAAAEAFEVRREDEEALVRSVLTQMAP
                     SHPRIVALAGGSGGGRCVPCRRAVRVEGVALVHVDVGGTEDTLRSVVRALGVSNVEVC
                     GDLLGFVEEAMRGATVKASDGVPFLVMRLREGSDLGRVYGEVVSLVSDCQACHIVLAV
                     PMKALTPLNVSSRRLDFYCIPPFSRRQAFAYAEHTLDALDLVCFVEVVGTRSSDVDEL
                     CAALRQRGVDPVTYTSLMLARAMRRLQAALGPPGSPARAAIRQLASMPFADGVRDDAT
                     GAMSVLGQPDVQEMVLYDPVQHEWRLAQQVYHTAARCILI"
     gene            complement(<844495..>845106)
                     /locus_tag="LMJF_34_1920"
                     /db_xref="GeneID:5654958"
     mRNA            complement(<844495..>845106)
                     /locus_tag="LMJF_34_1920"
                     /product="putative amastin-like surface protein"
                     /transcript_id="XM_001686237.1"
                     /db_xref="GeneID:5654958"
     CDS             complement(844495..845106)
                     /locus_tag="LMJF_34_1920"
                     /codon_start=1
                     /product="putative amastin-like surface protein"
                     /protein_id="XP_001686289.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654958"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4Q309"
                     /translation="MAYSVPFVVYVVVQFVAFLLVLAGTPLDMFHIRTRGVNTSCITL
                     WGDKLACNSSGYFVYIDKMFINCPPRLPRFRVAQAFALISVLVYGAAFIAGLTLLFYC
                     SLLRVVCLTLNIVGAVTLCVVWVAMVVTYHKGETPRCPPLKRTGSYAAGFFLLVVAWI
                     LDILNIIFLLLPLQMRGSQDCANSMESQRKNNSKQATGSGGRA"
     gene            complement(<847303..>849297)
                     /locus_tag="LMJF_34_1930"
                     /db_xref="GeneID:5654959"
     mRNA            complement(<847303..>849297)
                     /locus_tag="LMJF_34_1930"
                     /product="tuzin-like protein"
                     /transcript_id="XM_001686238.1"
                     /db_xref="GeneID:5654959"
     CDS             complement(847303..849297)
                     /locus_tag="LMJF_34_1930"
                     /codon_start=1
                     /product="tuzin-like protein"
                     /protein_id="XP_001686290.1"
                     /db_xref="GeneID:5654959"
                     /db_xref="UniProtKB/TrEMBL:Q4Q342"
                     /translation="MMALTLDPRWNAMRRGIAGIGVCAVDGRGGAAAPGSCRLSLCSC
                     LSPASSGGCGGADSALSEGGHCRECVCGMRGRLPSPKKPWNSLAGVLVGVRVTHAASV
                     LEDRPVALGRLVSRLSEAAYKAEMLRTGKRDRDGEDRRGDAAQLLVVDAGTRVTVRTE
                     GDPASGAAVAPSAMHMKGTIAKVNGNATYIILMEKGEVELSVASERIVALQPRKKLLQ
                     SARLVALVNWLRSCVHDPRDVEAIALVLFSRGWRAERMYLLEGVDLLPFVFVSRVELD
                     SVSEKARWERDHDKAMQMLRRERVKDTNFRYALAKYKGTMSCIAGVLVVAYVFTANLR
                     AYRRQQRGHQLRTAIETLSKAARPRKEEGMLAAAAEAFEVRREDEEALVRSVLTQMAP
                     SHPRIVALAGGSGGGRCVPCRRAVRVEGVALVHVDVGGTEDTLRSVVRALGVSNVEVC
                     GDLLGFVEEAMRGATVKASDGVPFLVMRLREGSDLGRVYGEVVSLVSDCQACHIVLAV
                     PMKALTPLNVSSRRLDFYCIPPFSRRQAFAYAEHTLDALDLVCFVEVVGTRSSDVDEL
                     CAALRQRGVDPVTYTSLMLARAMRRLQAALGPPGSPARAAIRQLASMPFADGVRDDAT
                     GAMSVLGQPDVQEMVLYDPVQHEWRFAQQVYHTAARCILI"
     gene            complement(<852030..>852644)
                     /locus_tag="LMJF_34_1940"
                     /db_xref="GeneID:5654960"
     mRNA            complement(<852030..>852644)
                     /locus_tag="LMJF_34_1940"
                     /product="putative amastin-like surface protein"
                     /transcript_id="XM_001686239.1"
                     /db_xref="GeneID:5654960"
     CDS             complement(852030..852644)
                     /locus_tag="LMJF_34_1940"
                     /codon_start=1
                     /product="putative amastin-like surface protein"
                     /protein_id="XP_001686291.1"
                     /db_xref="GeneID:5654960"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4Q325"
                     /translation="MKCSIPLVVYVVVQFVAFLLVLVGTPLEMFRAPNRPGVAQCLTL
                     FGFKLDCKSLEYEETVDMQWLNCPARIARFRLAQAFTLISILVYGAAFVLGLVLLYGC
                     TIHRWVCLALNIVGAVTLCVVWVAMVVTYKKPDEPLCREVRNMGYRFGTGFALLVVAW
                     ILDILNIIFLLLPLQMRGSQDCANSMESQRTNNSKQATGSGGRA"
     gene            complement(<854843..>856837)
                     /locus_tag="LMJF_34_1950"
                     /db_xref="GeneID:5654961"
     mRNA            complement(<854843..>856837)
                     /locus_tag="LMJF_34_1950"
                     /product="tuzin-like protein"
                     /transcript_id="XM_001686240.1"
                     /db_xref="GeneID:5654961"
     CDS             complement(854843..856837)
                     /locus_tag="LMJF_34_1950"
                     /codon_start=1
                     /product="tuzin-like protein"
                     /protein_id="XP_001686292.1"
                     /db_xref="GeneID:5654961"
                     /db_xref="UniProtKB/TrEMBL:Q4Q342"
                     /translation="MMALTLDPRWNAMRRGIAGIGVCAVDGRGGAAAPGSCRLSLCSC
                     LSPASSGGCGGADSALSEGGHCRECVCGMRGRLPSPKKPWNSLAGVLVGVRVTHAASV
                     LEDRPVALGRLVSRLSEAAYKAEMLRTGKRDRDGEDRRGDAAQLLVVDAGTRVTVRTE
                     GDPASGAAVAPSAMHMKGTIAKVNGNATYIILMEKGEVELSVASERIVALQPRKKLLQ
                     SARLVALVNWLRSCVHDPRDVEAIALVLFSRGWRAERMYLLEGVDLLPFVFVSRVELD
                     SVSEKARWERDHDKAMQMLRRERVKDTNFRYALAKYKGTMSCIAGVLVVAYVFTANLR
                     AYRRQQRGHQLRTAIETLSKAARPRKEEGMLAAAAEAFEVRREDEEALVRSVLTQMAP
                     SHPRIVALAGGSGGGRCVPCRRAVRVEGVALVHVDVGGTEDTLRSVVRALGVSNVEVC
                     GDLLGFVEEAMRGATVKASDGVPFLVMRLREGSDLGRVYGEVVSLVSDCQACHIVLAV
                     PMKALTPLNVSSRRLDFYCIPPFSRRQAFAYAEHTLDALDLVCFVEVVGTRSSDVDEL
                     CAALRQRGVDPVTYTSLMLARAMRRLQAALGPPGSPARAAIRQLASMPFADGVRDDAT
                     GAMSVLGQPDVQEMVLYDPVQHEWRFAQQVYHTAARCILI"
     gene            complement(<859597..>860175)
                     /locus_tag="LMJF_34_1960"
                     /db_xref="GeneID:5654962"
     mRNA            complement(<859597..>860175)
                     /locus_tag="LMJF_34_1960"
                     /product="putative amastin-like surface protein"
                     /transcript_id="XM_001686241.1"
                     /db_xref="GeneID:5654962"
     CDS             complement(859597..860175)
                     /locus_tag="LMJF_34_1960"
                     /codon_start=1
                     /product="putative amastin-like surface protein"
                     /protein_id="XP_001686293.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654962"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4Q305"
                     /translation="MKCSIPLVVYVVVQFVAFLLVLVGTPLEIFRAPNRPGVAQCLTL
                     FGFKLDCKGLQYDQTVDMQWIECPARITLFRLAQGCAIISILVYGAAFVLGLVLLYGC
                     TIHRWVCLALNIVGAVTLFIVWVAIVVTYNKDDGQKCPKVRDTGYRLGTGFALLVAAW
                     ILDILNIIFLLLPCTVPATKANEKPESPTAQE"
     gene            complement(<862375..>864369)
                     /locus_tag="LMJF_34_1970"
                     /db_xref="GeneID:5654963"
     mRNA            complement(<862375..>864369)
                     /locus_tag="LMJF_34_1970"
                     /product="tuzin-like protein"
                     /transcript_id="XM_001686242.1"
                     /db_xref="GeneID:5654963"
     CDS             complement(862375..864369)
                     /locus_tag="LMJF_34_1970"
                     /codon_start=1
                     /product="tuzin-like protein"
                     /protein_id="XP_001686294.1"
                     /db_xref="GeneID:5654963"
                     /db_xref="UniProtKB/TrEMBL:Q4Q342"
                     /translation="MMALTLDPRWNAMRRGIAGIGVCAVDGRGGAAAPGSCRLSLCSC
                     LSPASSGGCGGADSALSEGGHCRECVCGMRGRLPSPKKPWNSLAGVLVGVRVTHAASV
                     LEDRPVALGRLVSRLSEAAYKAEMLRTGKRDRDGEDRRGDAAQLLVVDAGTRVTVRTE
                     GDPASGAAVAPSAMHMKGTIAKVNGNATYIILMEKGEVELSVASERIVALQPRKKLLQ
                     SARLVALVNWLRSCVHDPRDVEAIALVLFSRGWRAERMYLLEGVDLLPFVFVSRVELD
                     SVSEKARWERDHDKAMQMLRRERVKDTNFRYALAKYKGTMSCIAGVLVVAYVFTANLR
                     AYRRQQRGHQLRTAIETLSKAARPRKEEGMLAAAAEAFEVRREDEEALVRSVLTQMAP
                     SHPRIVALAGGSGGGRCVPCRRAVRVEGVALVHVDVGGTEDTLRSVVRALGVSNVEVC
                     GDLLGFVEEAMRGATVKASDGVPFLVMRLREGSDLGRVYGEVVSLVSDCQACHIVLAV
                     PMKALTPLNVSSRRLDFYCIPPFSRRQAFAYAEHTLDALDLVCFVEVVGTRSSDVDEL
                     CAALRQRGVDPVTYTSLMLARAMRRLQAALGPPGSPARAAIRQLASMPFADGVRDDAT
                     GAMSVLGQPDVQEMVLYDPVQHEWRFAQQVYHTAARCILI"
     gene            complement(<867102..>867716)
                     /locus_tag="LMJF_34_1980"
                     /db_xref="GeneID:5654964"
     mRNA            complement(<867102..>867716)
                     /locus_tag="LMJF_34_1980"
                     /product="putative amastin-like surface protein"
                     /transcript_id="XM_001686243.1"
                     /db_xref="GeneID:5654964"
     CDS             complement(867102..867716)
                     /locus_tag="LMJF_34_1980"
                     /codon_start=1
                     /product="putative amastin-like surface protein"
                     /protein_id="XP_001686295.1"
                     /db_xref="GeneID:5654964"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4Q325"
                     /translation="MKCSIPLVVYVVVQFVAFLLVLVGTPLEMFRAPNRPGVAQCLTL
                     FGFKLDCKSLEYEETVDMQWLNCPARIARFRLAQAFTLISILVYGAAFVLGLVLLYGC
                     TIHRWVCLALNIVGAVTLCVVWVAMVVTYKKPDEPLCREVRNMGYRFGTGFALLVVAW
                     ILDILNIIFLLLPLQMRGSQDCANSMESQRTNNSKQATGSGGRA"
     gene            complement(<869760..>872879)
                     /locus_tag="LMJF_34_1990"
                     /db_xref="GeneID:5654965"
     mRNA            complement(<869760..>872879)
                     /locus_tag="LMJF_34_1990"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686244.1"
                     /db_xref="GeneID:5654965"
     CDS             complement(869760..872879)
                     /locus_tag="LMJF_34_1990"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686296.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.1990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.1990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654965"
                     /db_xref="GOA:Q4Q302"
                     /db_xref="InterPro:IPR010488"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q302"
                     /translation="MMQSPPPYVPFVEYVLKAIEHPPYMYVAKLAACCTMLFLTRENP
                     ELLQELCHKWAARFAQDRLRLIRHIRKRASYCIDSPDPTSYVGRDEKDSSEDTSDDGC
                     AAHSSEDHTDKRNVAAGMSCCDPDKSVEHLLSILNTLVPMYFSWNWHRADYVIQINKE
                     YEVYVREYVLPMCADLAPNEGADDVVHTPWLLPPHTYLEPTESLLSLDTFASTVAPRP
                     CVGSPHRPSCVASTSVSGAAPNRQDIVSASGPPIAGNAKMDGLDFPSRQQQFTFRSVS
                     KRKPLDAIATAPLPKLSPTFGNTLTGDAASTSSPSMGPVSAHACNTATSNGFTHTMSP
                     NVMSARAFNAAAVSGLHFLTLSNYCEALQRNTTGLVIVFHAKYSAKSNEVIDMFQKIT
                     AKRVLDPMPTIAVVYAVAEPELSSLYKVSWFPTIVYIPPILHQKHRHHYPNAGAHTRT
                     DHAEDENKYNADTDRKQDADAGTSTADSTSLSTSWVPKALAKASARSTQARSAPFRCG
                     PSPVVDAEPPALPHNEEEPSHRTTGGSGNASQGTSATPGTNQVARAPQNTSMSPRPST
                     PTRGRGKAYKIVGDLHAASGRHTSALPSSQPDAPSLLAQWPDKWTAASPRTPTEILFS
                     TSVGESARNEFVTTPPQFSSSSTTTRANSSAQGGSVEDRVQPLAEDSGGAAGDFLEDI
                     VSGGDYVIYPLDGVQTVPALVEWISSRGASVPRLRKMKEFFTCIKTIRQEEKFKRYRE
                     LYSAVVTLRRLQGIKEDLSVTGSGGTGGTPTPLPSTPSHQQPPDQPLFIFLGGGMAAG
                     KTTAVAALAKSSWWESHKEQSVVVNADEFKLPLECEMSSSEAHTHSTRAAENLLVKAI
                     NQGRSIVLDGTMMWKPFVQQVVAMVRDAHLTLFKQGPGYIDKTQMEKYFVAEKARQPA
                     LPMPYKILFLGITVEVETAVPRGFLRKFQTNRGVPISVQLRSFKLFAENFTDYVSLVD
                     ETTLFNNNVFVKLEKGELPPVLAECSSKTNGKLVVHDDAAFQQFLRQQQINDDADNVL
                     ELYPTTPGE"
     gene            complement(<876059..>876892)
                     /gene="PPI"
                     /locus_tag="LMJF_34_2000"
                     /db_xref="GeneID:5654966"
     mRNA            complement(<876059..>876892)
                     /gene="PPI"
                     /locus_tag="LMJF_34_2000"
                     /product="pyroglutamyl-peptidase I (C15 family)"
                     /transcript_id="XM_001686245.1"
                     /db_xref="GeneID:5654966"
     CDS             complement(876059..876892)
                     /gene="PPI"
                     /locus_tag="LMJF_34_2000"
                     /codon_start=1
                     /product="pyroglutamyl-peptidase I (C15 family)"
                     /protein_id="XP_001686297.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654966"
                     /db_xref="GOA:Q4Q301"
                     /db_xref="InterPro:IPR016125"
                     /db_xref="UniProtKB/TrEMBL:Q4Q301"
                     /translation="MLHSKAGIVVFITGYGPFATVKVNPSSDIALRVAEGLKRHPDVA
                     EVRYTELDVSVTSVAAYFEKVERDTADIIAEHGAGQVKILLCHLGVHNDTTGLICVEV
                     QGCNELFSSVPDVDGKVLNHEPIVPEDGAIEVFHESWFGKEGSPQLEKLERLIQQVND
                     TVAESWHHWVTGAVTNNEVTSADTDRKDMAMPTFQAPSSAISRNAGRYLCNCALYHAL
                     RLQEKNPGVVYGIFVHVVDPIRGKTEIEGGPIVAYNPPTIVQSVQVQCLMHGLLSLMT
                     M"
     gene            complement(<878828..>879307)
                     /locus_tag="LMJF_34_2010"
                     /db_xref="GeneID:5654967"
     mRNA            complement(<878828..>879307)
                     /locus_tag="LMJF_34_2010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686246.1"
                     /db_xref="GeneID:5654967"
     CDS             complement(878828..879307)
                     /locus_tag="LMJF_34_2010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686298.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654967"
                     /db_xref="UniProtKB/TrEMBL:Q4Q300"
                     /translation="MLRCAVLAATTVRRSGAAAARNPPTRATAPKDPTSDAEAGCSAP
                     NTHVDTSLQHAKEETHASFVRVEKAPATQDQLQKFLFQGRRGSSSSEYYVSRSIPGHP
                     DTVAELLGAGRADPEWMWLKLLCFLCVSSTFGTTLYGYCFGEHMKYFKDEPWSPFRH"
     gene            complement(<881110..>882999)
                     /locus_tag="LMJF_34_2020"
                     /db_xref="GeneID:5654968"
     mRNA            complement(<881110..>882999)
                     /locus_tag="LMJF_34_2020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686247.1"
                     /db_xref="GeneID:5654968"
     CDS             complement(881110..882999)
                     /locus_tag="LMJF_34_2020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686299.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654968"
                     /db_xref="InterPro:IPR000408"
                     /db_xref="InterPro:IPR009091"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2Z9"
                     /translation="MITDAEFWQEIRRSMSGGECIFSSMLALIHARQSAIDAHVTTPE
                     REVHKLTTWGQKRHDEVTGRVFTSEQKREMEMEAREKEARLKEIDKPLEANKAFRAGR
                     VPEDTPVYGVSSSTMCVLQQVMMFAVPIYVLRYNVPAMSMSWNTSCFIDRQSKQLITF
                     GSGHGVKVPQHLRGRGCVAGDGFFAILTNQDEVWSSGGLKVSSSSIDGPTALGREDAM
                     TGIAGKTLMLVGHGQRLAIVTRAFTVRSLSALSNPIRSIMPHRHVRFLDLGYGEDYYM
                     VGTDSIVYKTTASRRAVSTPRRVMTLCRTPVSRIASGMGFLLIIDQNGHLLSFGRNKK
                     GQLGNGEVQDARRKPYFQQKLTHHYFVQVSAGDCHSLALTSNGIVYGAGSNESGQLGL
                     GRSLKQVCKFTPIPLGNDMRCIGIAAGPAGSMFYCDNGRVLTCGLNDSMQLGLETSEK
                     IVFEPTPIAVIFNGVESYTLDFGGFCRPEGESRAPPADMPGAVGEEGGISSSSPAMVS
                     ALYRNKASSNRASQETTVINFSETSGNNTTNANNTNEKNANATPTETARPGENSGTQE
                     DHQPVENNISANDSTVERRNEKGKPKTRHDENAHNGGQNDAVKGRGKFKAKETKPKCG
                     CCTVV"
     gene            complement(<884595..>888110)
                     /locus_tag="LMJF_34_2030"
                     /db_xref="GeneID:5654969"
     mRNA            complement(<884595..>888110)
                     /locus_tag="LMJF_34_2030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686248.1"
                     /db_xref="GeneID:5654969"
     CDS             complement(884595..888110)
                     /locus_tag="LMJF_34_2030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686300.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654969"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2Z8"
                     /translation="MEALRNGDGDSSRRILSTLLPVLEARLHAMQCKPSAHTSSAAIE
                     SWRLAHALTLNNYGCQLRRDGLTAEALRQFLRAKQVETLVFGKPSCSTMLNLSAVLLS
                     SGAAEEALTISKECVMAAQDGEPILFITALHNLAVTLGQQTSERERKAALPTMLQALR
                     EAQSALGEKHATTLMLKEKCGLTSGWIAQDRGAEAGPEIAAPVRAAESPSGHGTLHAN
                     SAAQSPSPTPLTAQEIARAALYTLNFGEPVHAHPIAHNVAVLDAAEPAKGDPNAWEQD
                     AYPAFALRHSPDADARSQGYAGRMTQDNQESPLSPPRQSTHLDSVAEADAVRATHLKM
                     PLGESALPKPLHVSSRQSSTAASVDQHCLNSVNLSGMQRSVASAPLETVLQEPFQTAS
                     LVMSRSVPNLVGPAGSIRDLYKMDSEDGERVPGFLRFSLPPRLPAANKVSLPLRKVAP
                     QGSSPEPSNAAAEGFHRKPSPATMPRSVSKGSGDSNPESSTAATPITIMPTAGDLKTV
                     DKSEKPLPKMGGPATLPSAPQRSLFRCCGSLYARHTVHREVEKQEERAYRAQREAEKK
                     AAEAETAFQLALQKIQSRTQNSAAVTIQHAWRQWWSAVGRARRDVQLQRLEELQRRRR
                     ERLALGFVAGKMPGRSGKVTIPPPPSQQHGHVGGYVVPAVVLRCWRTWLANTVCVRHV
                     AKSHRSPVDARLHEADVRRGVCRIQALWRGAIVRHRRVQYQQQPQSDGENAPVIAVSA
                     AYRRRAEAELREYSALVLQMAYRSYRARQLRRRLYLAKHSGPAAVIQRWLRCRLADQR
                     NRGVDSRTIRVRDAAARSIQRVWRGYLGRVTFRMRELRRRMDHAGFYPLALEASIGTA
                     RHLAATDEGEGMAAKHISTKTSTPPSPAAVKRAGARSSSGKPDSFAAGKTALDSNCNA
                     ALVDAYAADCLQRSGEVYRLRDAERDRYHIGLYVDVRATKERQAWQESLRLRPTEVLR
                     RRVAMDTRIHEEQRAFTELRAALAIQRAFRAWRRMQKDKSRDTNFLYYSRALYQQHEL
                     GSLVARKQRQRDIVRAIALYGDSTIAMRAERVKAAQELALVADCNGPASSSSGLNGVI
                     AAPRKGAMKIASYAERMARKQQRQEQEAMQRRDEVLVALTYPHDMAHAREGPDECAAR
                     IGTTYEHPYYIPYMNEEHCRALGID"
     gene            complement(<896173..>897423)
                     /locus_tag="LMJF_34_2040"
                     /db_xref="GeneID:5654970"
     mRNA            complement(<896173..>897423)
                     /locus_tag="LMJF_34_2040"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686249.1"
                     /db_xref="GeneID:5654970"
     CDS             complement(896173..897423)
                     /locus_tag="LMJF_34_2040"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686301.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654970"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2Z7"
                     /translation="MQGSSTCFATPPRRHNASLSAEAELTVLTAGISLAHEEMCTRKV
                     GGTVFNRTPADGAPRYKSNSSLTAVAVLSVDLSPRQRRGGTSFASGILAECDSPCGSP
                     RVHLTRPFSSRGSFAKPVLCGSLPSTGAPSLKAADGALANRSSSGLHGVSPSISVTPS
                     EAEEDVTATSAESVFATASMEPLVTPGSIVLTANDARPSSSPSFTYFPSGGGGVPQES
                     SASTIDKANTVGSATAFRLSSVPGMCDGCGAIKNNNSSIEHKCFEPLQLDASCHLFSP
                     LQRFSSVHTSQRASCVPTLEPCAFNCGGAPVDHKDVTLACPLSSVQHGKLCEIVKQQL
                     LLHACLVSIAREREDGEDLQRRAKSTLEKAQLQQRQRRCTRLLSIMCLLWSVFLRLPL
                     RILKRALTTSAGKLWKLLLLTQES"
     gene            complement(<902641..>905052)
                     /locus_tag="LMJF_34_2050"
                     /db_xref="GeneID:5654971"
     mRNA            complement(<902641..>905052)
                     /locus_tag="LMJF_34_2050"
                     /product="putative ATP-dependent RNA helicase"
                     /transcript_id="XM_001686250.1"
                     /db_xref="GeneID:5654971"
     CDS             complement(902641..905052)
                     /locus_tag="LMJF_34_2050"
                     /codon_start=1
                     /product="putative ATP-dependent RNA helicase"
                     /protein_id="XP_001686302.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654971"
                     /db_xref="GOA:Q4Q2Z6"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR012541"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2Z6"
                     /translation="MIGHGKWEAAVESAADSKKKGGGFQSFNLEKPLLDAILKQGFSV
                     PTPIQRKAIPPMLQGNDVVAMARTGSGKTAAFLIPMLNTLKAHAKIVGIRGLVLSPTR
                     ELSLQILRNGFALNKFLDLRFAALVGGDSMDQQFELLASNPDVVVATPGRLLHIMEEA
                     SLHLTSVRCLVLDEADRLFELGLQPQIGAIMQKLPESCQRALFSATMPTVLAEFTSAG
                     LHNPVVIRLDSEMKLSDQLKQSAFLVRNDEKVAALIVLLKRVLHVGEAAANSAQALIF
                     SESKFHVEFLQMILTHYSISTSAVHGQMDQEARRLAVRSFAKRETSVMVVTDVAARGL
                     DLPLLDNVVNFSFPFNPKLFVHRVGRVARAGRSGTAYSIMTFEDFPYYVDLMQFIGRP
                     LQSAPVPGDLLFTPDDGCYGRLPEEDIQLELDFLKRLHENDVEVRNMARVVENAHKKF
                     NRTKKKPTHEAIQEARKPQYAFDRTPLHPMLLERLGSTRVRADEVRFDLKRFKPKELF
                     LEIGSKEKLFEIRPPETAQSLARSSNAEGGAKKVGAASTPPPAKQLSFAEKMLQRAQE
                     RRKREHEAGSSTSVNSDDAVMNLVTHPRQAALGHKESMETGAYRDENFFMDLERRDTL
                     DNAHYSVKDATMDMTAETAEEAAQQRQVFAWSKKKNRYVQMHVNDAKALLRGIKNEAG
                     KAINYKSKLQAYSKWMKKSNMRIQDVGEEEDLVPLKRAKAAAFSSQPQGDDVGNGNDD
                     FVDISDPNQGKKLRIGRKQKRLPKDGHVRSFEEMAAMRRKAEKEKSRLARKSQRSGAG
                     KKKSK"
     gene            complement(<905931..>906878)
                     /locus_tag="LMJF_34_2060"
                     /db_xref="GeneID:5654972"
     mRNA            complement(<905931..>906878)
                     /locus_tag="LMJF_34_2060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686251.1"
                     /db_xref="GeneID:5654972"
     CDS             complement(905931..906878)
                     /locus_tag="LMJF_34_2060"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686303.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654972"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2Z5"
                     /translation="MSCAQVDMSDTQPAPSRAKSRRKCAVYLGSTTFVEIEDDPSTIT
                     LEELCEAFGTPWESGMHVKHRATGRVVATLPFEPMPTLEDVSDAFIKAESTTATTHTG
                     DLTVPTAYDNAEEDVDGAEEGETMYAVVYDLVTPTAPGDNGDSELAAAVTAAGLLENL
                     PADADGTCNIGETMRKLVELGAAELLTAEPLSVSQARREYNPPEAPGLLRRIVYPASQ
                     YSPYRLDRDPLHTDKLSFYRSSTVTASVPSGPPPTSCTGLHALPVWDYGEGGLYTSYF
                     DSYDLSCPMRGPFVRPSAAGKAALVMPLSDEEHHRIFGA"
     gene            complement(<908481..>911867)
                     /locus_tag="LMJF_34_2070"
                     /db_xref="GeneID:5654973"
     mRNA            complement(<908481..>911867)
                     /locus_tag="LMJF_34_2070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686252.1"
                     /db_xref="GeneID:5654973"
     CDS             complement(908481..911867)
                     /locus_tag="LMJF_34_2070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686304.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654973"
                     /db_xref="GOA:Q4Q2Z4"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="InterPro:IPR003838"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2Z4"
                     /translation="MAAASSNCQDEGLQHFRSAGRSPTFDHLKLRESVYDNIIGQVNG
                     ARAVDKLRKVGAIDRISEGKAVNSKSLEYSDTITPSTSNPNVLKLPALQQNRRLAVDL
                     EFNDDAPPAWTLLRRVTHNVWMSLKMTRLFLSLAWADIKARTCSYCLGFFSVFIVVLL
                     LVLMFSILVHMPILFLHFSEETRGEFDLIIGPGSLMSKATGINYTRINELFPESDPDY
                     GYSAPRFLDIYMARTTRSCPGKNVTQMWYNADGSVCDDVDLCMSGCFSNGTAAVDLIA
                     IDAAAEARMEFGTHYDEPTLNEGELILSHRAAVLMGGVNVGDTIILYGDARLNIQLPF
                     ANLTHNDSSNVMMPFKVVSVIHEYYRKFPDVDTFVVVSFQTFLRDLAKGLGPDTSTRG
                     VEGVANTNPSDCASAVYFTMNPEARLKAYSLTSYEKIRRNVVVWASGVLSPLGFMQVS
                     RSAPQLRGLYVTRLFSAFVGLIMSLILLALVLLSVVLIYTLLTVGIETKTYELGIQRM
                     IGLTKENLIFLVLANAYAFTLPAWLIGLAAGQGTYTGVRIVFAKFVDVQLPMLVTGAS
                     LGWATVAGLGIPIVASFFPILSLVTQKLPDAINTSRGRNSGVIYKIERDDSTQWNGTM
                     LVLGVLFFAFGFLIYYLFPTALIAMNLNLIFYIFFGVLIGLLAGLVLLAMNFERVAQT
                     CISYLLLFWESRAVFSFMQKSLSAHRRRNRKTALMYALSLAFVIFITVVVQIQLVSYE
                     YSSRQRMGCELYVETKGLTVEEYWAIEEIIEHQMETGIISAYTYDYNSSALTSLKGAT
                     VSSIGRLRSSGTKLKPLPPNYFEVMDRTYLHVNNYQSIVGRYGLVRALYSPEGLYKGI
                     LSSGAADTLGVGSADGVVLLKITKVQNATLNTEVIRRVTIRPVATLNTAPAIDTSKYT
                     GTQGDVVLSIPGLFRHLNESRVSVLNGNVGKIRLRMNDPNWYDFIGDLLTGSIAALGH
                     TVTVTNIRDATRDMAAASEALNFFFIVAEIMILVICFFSLMSSMTTNVLDSSKEIGVL
                     LCLGMSHFQVYRVYVWEAFVLVVSSGVMGLIVGLVVAYTMQLQNILFTQLPLPFPFPY
                     IQLAILVVIGLVSALASSISPVAYLLGLPSVTHILRRTIH"
     gene            complement(<918467..>924115)
                     /locus_tag="LMJF_34_2080"
                     /db_xref="GeneID:5654974"
     mRNA            complement(<918467..>924115)
                     /locus_tag="LMJF_34_2080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686253.1"
                     /db_xref="GeneID:5654974"
     CDS             complement(918467..924115)
                     /locus_tag="LMJF_34_2080"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686305.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654974"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2Z3"
                     /translation="MPLSPEEGARAPHVVMDPLAALRRCLQYVCSHPEVYGDDVRGLL
                     DREVMHVVRLKASEVSLANGERPLLVDSLESTGVRQAARALTGVPPLNTIPAQSTASN
                     GAVPDSVSAGDLFGYGSVSFLPAFSVGFSALLQDSRADWPRADQAGGSRYSDERKTFC
                     GRFPSTSSFPAAPQLSQDECIQWNDTLPPSCASANPRGIRTIGLESVRNDEAVKSSVF
                     SEDMDMDGGGTHSDKTRQASPSLSPGATFEAHGRFNPQDQSPALGLHEGTPNSLSAAP
                     PSAVCRADGTVLLVDQQGYEVTYLRTQLQQLEAAFNSKCVRLHELEVENRQFAEKMKA
                     SEEARARWAAQHHAMKGQVEVMRRELDGWKDRANDAVTAATKKSKQQNQRAKQIVYSQ
                     LSDAKQEIVRLGQLWRETERALQETRRAFENTEKEAVAAHNHLTDVFHYLERLERRIA
                     RRDVYVSLCERRQRSLEEKYEKLRWGYEELSTLDGRYSYVDYMLTTRPLWSVYLFVRL
                     ARHQGEYVALENPMEVQQRLLLMAGQAEKGREVSPEAAAATLAAMEPLYGLIFSRSPQ
                     GGRLVAQEYDFRLVFRTMVAETTADLSRRGRPKQVRTTLHGSVACRVIRWHERYSIDY
                     LRGQDDDPESAELHRKCVPLLTLASVLLPLRSRAGAILMRPTPVEAAASSANVADSTA
                     PEQAAGAEEERVHTLLSTTSNKRHYDEATIRFVLRCFWKERLSSFSQQMNARVSAVNE
                     KRARKRELEGTLQNGKTEKRISPTGECLPPVSESSARSDESDDDEDDVAVNQTFLAAL
                     VDFSTRFAVQQASSGIAAPTKSGVPPSKATLVNVRGVLTRGASDTKLGGRSATSISYP
                     DSKAALDSMWDSGRIFFAVVLQPGRSAATKQEATSPTSDAPTPEEVSILAEEAREMLA
                     ALYYYTLEYKDLDPDFRLFYLVAHQMIPEMVAVNFFAGLEAFQLESVALLEWRLQCLS
                     AGMHIGATRTAAGQPPSSPTMPKEVEDPLMALTRAVDVIDDALLDGEEEDIETDSDGD
                     GYGSILPFRASAQTQVHPSTASSATTGQRQEGRREDSSTAETQSPVRPVSRRTCELQL
                     LHNIRAYLRERRGLMQGEQGVECVDGDAELGENAENPTRARLAAFSFGEAPPEWTALE
                     ERVLNILGPHTALLDTFRHQYRKRKGEDAVQTKGKPMRPGKELDHLRRRRSERNRRHE
                     RAKYLSATRGLLTAEDVLALVQRHCLATYAVSCCGTPRFSLLGSLFGRSSDRGCDASS
                     GLDPYAIVGHLPLTGLHLQRLRFALSLDQPSHLIRTSALFSVDPVTKSNSHFYDAYLT
                     IVLDVFEQQQSFLMHSVLCSCAARHELYAAEGAEDCDGLIPIACLKKGLTAAFSTISG
                     TSQHALAVLNHLVQYDELLRLEDEVRFEQFTDAPLLLNVPPRHGRGCFTADGDGSVEQ
                     GPGDVIDEGKWNLREEADSCSLLNIAFALRMSYIVWGEVSAGTAEALVHRIVKRAVPV
                     CCSDAVQGDAVWAVSAVAVNKDATVVEEFTEWDIFDQTTRQQYARALMRLQKGHNGDA
                     NPLRRTLSALQTELLRPASILSSRARVGASMSLSPGAVDVDALYPDVAGVWTTTKVLA
                     EIQKHMERAAAAVPAKGTGASGKGRKKRNLSQPHKSLFSVQAAGKGNDSADEEEQVPD
                     YGLLSLVRALGFAPPLLTSVPGVGGAAANKKGGGRKSTTKRGASKSRAGPETAIPACL
                     QQEYSEKLSMQLQDLAARVAALTPSDLNRFPEDMSVAGDVSVNMEGATPSANSLSVSN
                     RSVDAPTPESSPSRVHSVSLARKSLQSTSQSKLHKKVIVETPVDTKRNSLEPHALAPA
                     WVPLFPGSTSALDNVGAPLSSSMPMDVSKLYAICAALSMT"
     gene            complement(<925773..>926930)
                     /locus_tag="LMJF_34_2090"
                     /db_xref="GeneID:5654975"
     mRNA            complement(<925773..>926930)
                     /locus_tag="LMJF_34_2090"
                     /product="putative protein kinase"
                     /transcript_id="XM_001686254.1"
                     /db_xref="GeneID:5654975"
     CDS             complement(925773..926930)
                     /locus_tag="LMJF_34_2090"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001686306.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654975"
                     /db_xref="GOA:Q4Q2Z2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2Z2"
                     /translation="MPPKLKPLPAKKFTLPPELAEKSDELTVGNIRVGPSGVEFTGEG
                     DLQVRRPDLNFENLKRVRQLGQGTQGNVSMYVTADKSVFAVKKITIPVTLDTRTRQTV
                     AAELRNIFSAQSNEYTVNLYNAFYRNRALRLVMEYMDWGNIDELIAEKVKIPPTVCGY
                     IASQMLHALAVLHTKSNIVTEPNQHKSLRQIHRDIKPANVLLSTTGCVKLADFGIATS
                     AETIGVNSFVGTATYMSPERIQGRRYSTPSDIWSVGVVVAQMLLGHYPFSSVGKGFMA
                     LLREINSVEKYPLMEETGCSQEAQDFIDSCLRQDPDDRSSAFELLESPWIKYCEEHGK
                     AEMVALLASLGDRNRQYCEDDALQGASRETSTLSLPRDTSETCKADNPLGM"
     gene            complement(<929472..>931982)
                     /locus_tag="LMJF_34_2100"
                     /db_xref="GeneID:5654976"
     mRNA            complement(<929472..>931982)
                     /locus_tag="LMJF_34_2100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686255.2"
                     /db_xref="GeneID:5654976"
     CDS             complement(929472..931982)
                     /locus_tag="LMJF_34_2100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686307.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654976"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2Z1"
                     /translation="MFRKCINARKPLAHGSQRIYQLLPSTAMVTYLGPDMRKIDQVHR
                     QKGYFTPSEVAEVFIPLVPTFPVESRHVMTTVPPEILKQIEKVAGSTSTLAQVVFEHY
                     PMLFHYTPNRYRPAVVQLNSEFWFVRQHPGYGKADRALSQFRSHALMDFDAPDTADGA
                     SGVEPLYAASEKAAAEVAPSLRGRANSTSQRKPWSVEMLAVLVRNLPRVPTPECSSQD
                     VTSNKMLSPSDGKPLVRERYRPLNLVQWINGFPPDDLAFVTKAREGSVVQLITQYVHV
                     FQLMSLKKGDHNLFVEGHVLLSGGAGSKWKADVVDLPASAASAMADIKNSDEASLARE
                     AGEEEVTMAGWWSVDNADAIKDSGIAVHTPKSTAVGNAKFTLDGRERAFKQAVTEELI
                     GLDGLVEDGGGGATELDSERDVMAFGEDADEAGAIALGEDDDAEVDHHGGNAGDICRG
                     GRGNHDPGSPSSPHEKYSRSQRAPPRGASMDAVTAFGLPLEEIYIRRLPPDVAPRSLS
                     DLDETTSPDPDLLSLAASFLASPPSLQSPTADCFFRRCRRKRWRVVNAVDEVWRWVAV
                     ERLYAGFTAEQRSHLRERYRGLVGFLRYHGKVFELSGDLMYVIAHDPAGTVAPIPPME
                     RAFRYANRVVLPEDFDDNPDRSASLLGEAERRKFVRVLGEGAIPSFRRHLLLLDPDNP
                     LMQHEVLYDEIANLLPDHPVPYIEMMAKLPPVMRAALPHALNLAASKRIDVYVERGRT
                     MVRKKTAAQPGAAPAASRPQTSVEEAIAELLQLPIGKDGISIKALVGMHLSVPAANTL
                     SDHFGSVARAVRMLPQYFEVWEDDSVARKRIVMVRLRH"
     gene            complement(<935714..>937972)
                     /locus_tag="LMJF_34_2110"
                     /db_xref="GeneID:5654977"
     mRNA            complement(<935714..>937972)
                     /locus_tag="LMJF_34_2110"
                     /product="putative cardiolipin synthetase"
                     /transcript_id="XM_001686256.1"
                     /db_xref="GeneID:5654977"
     CDS             complement(935714..937972)
                     /locus_tag="LMJF_34_2110"
                     /EC_number="2.7.8.-"
                     /codon_start=1
                     /product="putative cardiolipin synthetase"
                     /protein_id="XP_001686308.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654977"
                     /db_xref="GOA:Q4Q2Z0"
                     /db_xref="InterPro:IPR001736"
                     /db_xref="InterPro:IPR025202"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2Z0"
                     /translation="MAAGAPSRVSRGLSLFERLQQRRVQLHTSANIKKKVREAFLSAV
                     VAYEQLLAAATKALEPSSQFLPLSASTASPPSQPSPEASGSADAGGTAAFYLDKMQHT
                     FKEAKRYYNSTPFDQRWDDILSSLAVLGRMSHGNVVVPFHDSATAFESMWAAVKEAKE
                     RVHWQTYICKDDFIGQGTVRRLVQARQRGCDTELLYDCGGNISGRARLTEELKQCGAK
                     VIPYCPFFRSVATYFIKGLDWKRSPGLRNHRKILLVDASQGFCGGLNIGNEYCGKEAG
                     GTGKFRDTHCSVIGPAAAHLAEVYRDTKQPHPWKYGWRRWRQIASQQITRRVKQGRMR
                     MERNELYRAFQEERGRSGCRLQDVPSASMKVMRGRWNKQTNQLLTLMRWSRSGLSSET
                     LLDREATRHTQGQESVRAGGKEVTLREGAAVSCAALAESGVKVTNHVPGSFVVKDAND
                     STATSAFPPPSEFSASAAGTRARAPLATPAAAPSSGGKLNSARNSAMRRKLLAARREA
                     LSRATDLPHKRAYTDMLRRIPILDTEPVPEAQMYLRHREPMTQVLSCNPRYRDYSIQY
                     AFWQVTRKCHRRIWITTPYYLPTRKLFSALVQAARRGVDVRLLAGSNQTTDPWFMWHA
                     SNYITERLLRAGVKIYEFQGQQIMHAKTVVVDSVWCSIGSYNWDLMSNRNLEVCLCHL
                     DLEVAHSMETQFLRDLAQSVEVRLEDHKQRSLWLRFTSWLFYNFVFLLDRITFRSFAN
                     EDIVDAPGSPCD"
     gene            complement(<939713..>940633)
                     /locus_tag="LMJF_34_2120"
                     /db_xref="GeneID:5654978"
     mRNA            complement(<939713..>940633)
                     /locus_tag="LMJF_34_2120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686257.1"
                     /db_xref="GeneID:5654978"
     CDS             complement(939713..940633)
                     /locus_tag="LMJF_34_2120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686309.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654978"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2Y9"
                     /translation="MSLWPFRTGNDDRFQTSSGPSGADDIYATMREGGLPPHSYGVEV
                     DSYLEWRWRRGFLQSVFPVTCYGAVAGFCVGFRQSRIEGRYVGRYRIMWRYTSTFAAV
                     GLLTSAFHHLLVVRNRYHDKFYYPVVAGTAGAVVLSLASQMGTIGQGMFVGAFLGILY
                     GLGCYGVTYYHRRRLRVFLHEQRVRQVPIHKVSPELQPMYRAFLYDNRPLEEEDKKSR
                     EAVTLSRSVDDTRLDAHTFMSNMTPEVFDWVNFPDWWPLKWPMQTEEEQMLLERQRNE
                     EIERRKNTFLETEDAGLLKRKNRAKRYRDL"
     gene            complement(<942020..>942262)
                     /locus_tag="LMJF_34_2125"
                     /db_xref="GeneID:5654979"
     mRNA            complement(<942020..>942262)
                     /locus_tag="LMJF_34_2125"
                     /product="ubiquitin-like protein"
                     /transcript_id="XM_001686258.1"
                     /db_xref="GeneID:5654979"
     CDS             complement(942020..942262)
                     /locus_tag="LMJF_34_2125"
                     /codon_start=1
                     /product="ubiquitin-like protein"
                     /protein_id="XP_001686310.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2125"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2125"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654979"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR019956"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2Y8"
                     /translation="MTFSFSVISTTGQRISISVLGPDNTVGDIKAKLEETEGIPQKMI
                     MLVHSGRKLEDNATLEECNIHAGITINMVLALRAGR"
     gene            complement(<943756..>944235)
                     /locus_tag="LMJF_34_2130"
                     /db_xref="GeneID:5654980"
     mRNA            complement(<943756..>944235)
                     /locus_tag="LMJF_34_2130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686259.1"
                     /db_xref="GeneID:5654980"
     CDS             complement(943756..944235)
                     /locus_tag="LMJF_34_2130"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686311.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654980"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2Y7"
                     /translation="MVKMLRNLIRYVGLVLVLLFFITNGIDKLAAPSVGAAFLAKSNF
                     PRMVAKMGIKLSPSEYIYVVRTAGVMSVTFSLFILLGVGRSFFSFLMAIGMILTTVAF
                     YVDLDYPFDTAEENVHHILKNASLVGALLFVTGSGHRSRRYSQARVAPDSSRAKKNN"
     gene            complement(<945181..>945912)
                     /locus_tag="LMJF_34_2140"
                     /db_xref="GeneID:5654981"
     mRNA            complement(<945181..>945912)
                     /locus_tag="LMJF_34_2140"
                     /product="transcriptional regulator, Sir2 family
                     protein,nicotinic acid mononucleotide
                     5,6-dimethylbenzimidazole (cobb) protein"
                     /transcript_id="XM_001686260.1"
                     /db_xref="GeneID:5654981"
     CDS             complement(945181..945912)
                     /locus_tag="LMJF_34_2140"
                     /codon_start=1
                     /product="transcriptional regulator, Sir2 family
                     protein,nicotinic acid mononucleotide
                     5,6-dimethylbenzimidazole (cobb) protein"
                     /protein_id="XP_001686312.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654981"
                     /db_xref="GOA:Q4Q2Y6"
                     /db_xref="InterPro:IPR003000"
                     /db_xref="InterPro:IPR026590"
                     /db_xref="InterPro:IPR026591"
                     /db_xref="InterPro:IPR027546"
                     /db_xref="InterPro:IPR029035"
                     /translation="MKACRCITILTGAGISAESGISTFRDSNGLWCNHHVEDVASPDA
                     FIRNPALVQLFYNERRRNLLLSSVKPNKAHTALAKLEEELSGKGKVFIVTQNVDNLHE
                     RAGSKNVLHMHGELLKARCTATGNVFEWQKDIVGDVDRCPDCGFLGTLRPHIVWFGEM
                     PLCMDEIESILSTTDLFVAIGTSGNVYPAAGFVKRAQFYGATTLELNLQEGSNSTLFQ
                     ESIYGKASSIVPTWVDQVLKESLKK"
     gene            complement(<950336..>954760)
                     /locus_tag="LMJF_34_2150"
                     /db_xref="GeneID:5654982"
     mRNA            complement(<950336..>954760)
                     /locus_tag="LMJF_34_2150"
                     /product="putative protein kinase"
                     /transcript_id="XM_001686261.1"
                     /db_xref="GeneID:5654982"
     CDS             complement(950336..954760)
                     /locus_tag="LMJF_34_2150"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001686313.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654982"
                     /db_xref="GOA:Q4Q2Y5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2Y5"
                     /translation="MPQDARLQPFSFVGIEATVRPEQRRRSAGKRSGTHGGPLKRFFL
                     FLFLTALALCSVCRSQAPSAHFHPAQGIGADETLSNAPSVGSVALRYTFPGSSLALLV
                     TESGHLHAYDLERGQHAWCADAGGDMITVTIDLPPSKEAALRDPLALPFLVRGNSLFT
                     RVPFFMFTPLESMDATERLEELPQSLRTYFFMNISTLLRRQTLFLGGTDVYVTTSVQV
                     ADLDASTGRPVGGRETPSQAFSGSNAPRSPPRGASTTESHRVPHNELLPLLHILRYNI
                     ALHVVRPGEYSWSIRLSQLRMSPRAVVQPSFPLHFSAHSAADTSSAAATEDDSEHTPR
                     FFSQFMRSMFDYDDEHVVNLAYRRAADQQANPTPAARTSTAVLMRNLQRTHTQAADYI
                     SRVVSVHQLNASHVSLRSVHDGTTAWTSTLPHVARESSGNGTDSTASSSNATSTVIAA
                     YVWVSGADEIFRVPVLRSASGSLVEEAEQLRISMEADARGDAPTGLPRLTSASVAGAL
                     VPTTHAAGRLQLLTLMQSGDSGRGHCRDGGACGEWATDDVEADEREETELAAYYHQCT
                     WWETPPVSWPFLTGAFNGESGAVTFQAIDSATSSRTVVGTSGVYSTENTLLGFDSSGA
                     VVKTGLAWRTAAFISFHVLCLAGSIAFLCAGVPPRGQLQRAWAQADRNRDRVSHTSSS
                     HQPSTQLVPQDLLSPRGGRGTPFSLIMDSFSIDTLGLGTLPTASVSMATVSLPHSDDS
                     LQELMRHHQLGHLSGSPPRSPWVYPAPEQVRSITYDESEKMFRVTATSATKTTRGTAD
                     SSKAGFDMTSSTVQQKATKSETPVKKAAASSSSPANSAEADKAVASASNSSSDDDTVD
                     IDLGERWWLRAQFSPRQHASAPALDETFSDRGSSYSRSQANTGTEGEGKLFQLHFKVL
                     EKIGFGGEGSVFCVEHRVTHARYAIKAIHIHEKDEERVVQEAVLHSSFDNANVVRFYF
                     CWIEDIAVSTANRLELCHRDEDGLETTSLAYSDNSLMVSTSGNTNGHSTDHDTASKAG
                     DTYHMLFIQMEYFSRGTLADWLRLRTGFFRLEVLRYMKQIGKGLAYLHNLDVVHHDLK
                     PTNIFVSNDNVLKIGDFGLAKRRGNANGSAGDLASNVAGGQQEGSVVGGSPLYSSPEQ
                     RRGEPVNKPSDIFSLGIIAVEMLCTFTTLHERIRILTDAHQLILPEELEAEFPDEAQL
                     IKSMLAANPLQRPQIRKFLRQINKLIVALEAQESDEEAEKPPPPSPLDGTEHSESRNG
                     NDEAATAALVDDSASALATATATSKLGNTPLSTSVAAASSSRGRPVAADLASGGHADS
                     FSDVQDSFSSPLGEQKSRVALLPVFHSEAATGTSVAATSPMAATTSVHDTNAASAGKH
                     VTRRGDSLASLHASTMVKRGNTYHHRRRGSASPNMEAEIGRLHICEMVATGSASRQGF
                     FANDPYGLPTTPVMYTEDADLSTILKRDLQDRTVSAPD"
     gene            complement(<956573..>958048)
                     /locus_tag="LMJF_34_2160"
                     /db_xref="GeneID:5654983"
     mRNA            complement(<956573..>958048)
                     /locus_tag="LMJF_34_2160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686262.1"
                     /db_xref="GeneID:5654983"
     CDS             complement(956573..958048)
                     /locus_tag="LMJF_34_2160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686314.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654983"
                     /db_xref="InterPro:IPR016117"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2Y4"
                     /translation="MTANSPSSAVDLLRFLAISLAVHADAICCAVDDVEAAIVESSTN
                     DELLEALENELAALLDRQRRLHVTRSMIALSQDERRRGMELRRSWQSLTQQHGSKRIQ
                     TSRTPSSRSASLMRGTPRHPGETLSMDLFPDEPEQEYGASAVSTRGLSTTTSWTAPCA
                     GSDADSVDAQVERLKARIMHLDRYSLRGKLLQLESQKNAVKEIDLEDLVARVVDPFEF
                     PASVQTLWCSAASPHSTGSQASPCAPFTGASHRCAHSQDVTLAQHATGKGGVVNHTNI
                     DLLLARACQRLSGRAADALEALASTNVSEASAAAHLLGCMVYAAELDSSGSTDLAAVQ
                     QLQTMPRDTLSHLYDHCVRNSVCEAKLDDRCFGVRDTVLAAQDFNALPAEWATSQSLS
                     HVPLDEILPSVRHLLSPRFTFADVAELKQLQEKRVALQEKLVKLVVDGQEKDAELLQD
                     IAGSQRDRAVAAARLAVAEMTPTSTSAHAWKTMVLVRDDER"
     gene            complement(<959375..>961072)
                     /locus_tag="LMJF_34_2170"
                     /db_xref="GeneID:5654984"
     mRNA            complement(<959375..>961072)
                     /locus_tag="LMJF_34_2170"
                     /product="putative 8-oxoguanine DNA glycosylase"
                     /transcript_id="XM_001686263.1"
                     /db_xref="GeneID:5654984"
     CDS             complement(959375..961072)
                     /locus_tag="LMJF_34_2170"
                     /codon_start=1
                     /product="putative 8-oxoguanine DNA glycosylase"
                     /protein_id="XP_001686315.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654984"
                     /db_xref="GOA:Q4Q2Y3"
                     /db_xref="InterPro:IPR003265"
                     /db_xref="InterPro:IPR003583"
                     /db_xref="InterPro:IPR011257"
                     /db_xref="InterPro:IPR012904"
                     /db_xref="InterPro:IPR023170"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2Y3"
                     /translation="MTTSCMTPLHSWRVLTSSLKAKVSLQMTLCGGQCFHWYRTPRGT
                     FVGVIGDGVFELREVQCRAKLQNQELQRTASQRPASTRAKRRRAASSPASTSEAAMGQ
                     NYCCSCCWIEYRRLWPLAHPLRLRGKGRTSPLPSSLRHTAASSAHTVGESDEEMLSRY
                     LSLDVDLDQLWQEWTDSPETRKHPLVEYLVGSRRQRQLLRSGHGQRVCEHDEAQANLY
                     IPIRHVRQDLHSCLFSFLCSQNNNVTRITGMIYALSRAYGDHLCDVQLATGEVRAPRK
                     SAADTRSKAPQTHSRSDPAATRRDTMASPSLKPHSASANAPEWLSVYSFPSLEQLATV
                     TEDTLRSLGFGYRSKYIVEAVSFIRTQLPPPELQDEKAVKGKMHFPPHLIRQHGACYR
                     NGFYSAVLGHHSYHHQHQRDMLLLLPGVGRKVADCVALFALNRTHIVPVDTHMAQVAV
                     EYLAAPSAATAVGRKRSRPGCPLPEEEARSRDNLLLEWRKQAEVLKVKKGVSPATVKA
                     IEEGGSSAAAPLRASRKTPVPPLYERHHNVIQEAFRKLFGNYAGWAHSILFYYRMRK"
     gene            complement(<961963..>966600)
                     /locus_tag="LMJF_34_2180"
                     /db_xref="GeneID:5654985"
     mRNA            complement(<961963..>966600)
                     /locus_tag="LMJF_34_2180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686264.1"
                     /db_xref="GeneID:5654985"
     CDS             complement(961963..966600)
                     /locus_tag="LMJF_34_2180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686316.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654985"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2Y2"
                     /translation="MNASSFLLTPPAVPRQESSVASHLTSSPLLVDVVPFEASLQRLL
                     YEKVSTDEQMCSYSVQQAYRGLLYGVRATTLTLTGAGVGTMNHESALAPSKEGATQRD
                     AALTAATVTDACVLRGWQAVLYRMALAATRSAADLECAIFLSTRILCDPATAHGQGNE
                     RPCCTHEWTQALLRGLPLRGVVKGSSEHKELDDRFVRLVHANRRYQLGFVLILSNTLR
                     MLASGHVEGQRLCAEHTELFTGIAQGMVPAVASYVEELMRESALHAVRRTDAGSAAPL
                     PSRLTVELNHLVVHSVHWLTTDVLLAHMDAEADSSVDAKEAALKSRRQKKRPPVLDRD
                     LPACLWGCVTMVRNALRRGLRWLVEEFDHRGSRTAVKPATALLSAVSKQLEDVFTDVV
                     KHQELLQCSLLNAMREFNGAASHNARSLTEMVWAHTLQMCFLVRNLTGVWVAVHGGLG
                     VSTASAGLVLPAYRDVLMFMASALLRVPALQDAKENERTTFMATDAALSACLALVAAA
                     PTTTLQAELWATDSGVTQQIHALLVQRALRYRSERVLRLASLLSRAVLDAAVRGGALA
                     GFAADSSDQLLELLESEDDAASRCVSELLCVSILEHPYRLIPALFRMLEHGSTVTRRH
                     VLEVLCSLPDLVSEQRTAEQDTAETHSSHVSASDTVVPWPGGHSKSIGAHRRNVLRLL
                     AENLLLRLSDEELCLRLLSSSLFAKVHPDDVLLPLLNLCLQRDDTGRKQGAALSALTS
                     LVTAHTSTAETYLLLLQCGYQCLAAANGGTFSALVAPEGVKMATDGGDSEQSPTKVRR
                     PTPQTPGDILSQALLYSADGIAGSAHDVSSTPAAMSTTVVEMNASSSDAHAGQWRRKE
                     AQLQTALLTLTDRWVRVAAASWTYACHSLPLFQFLTRQAKGGAGDGTTDHASDSGAPA
                     DEWVQWVMKYTLRLTASLTGLFKDDLSSTDQARLNTMHLRAIWDTFFACASATEGPPD
                     DRWTRIACRAGGTGSGGDADASARLHAVLLPLLCLRSCAPKTFAVADATFVTDAVESP
                     AEGDEDGDVANIVRRLWRVLWRGATTEAQSDATIFAAYPEIHRVALEVVCRFPARLFF
                     GAWTRWAAAHAKETEASDALSSLGDELSVSRLFAYRVYLFGVSSYLAAASVQTASRHS
                     DPSASTAAALSADHGSDFASDLQVVLDYRATLERLLNVTLPHWLMEKEGDISVNLPSS
                     RQGGSLGAAGEAGPRIPISQGSSEKAEAMRQRLCVAAVDAAAVVGVVTLAKTNGFPTS
                     SSPPTPGNGYTSVLYALCNSLLATPLTGLAKAYRDAEKREMSKELPRHDNASRETDWT
                     WQLTRFQLCLHIHECMLNAISLHPTHAKGLLLCWFRGFLRPIVELSNAACRSVVGREL
                     HECRAAVDACSVIFQAVLLARKVGSPAAPALTNSAEDKSSASSSLLFRLAWEEREALV
                     SFSLGCVRFTASAAVQIVGVRLLSALLVAAPELFLSMEGLSTQTVTSAPSPRMGSSAS
                     PWCAFEDEQRLLSSAASALQSIALMHPDRPTRVLADEVLRMLEKAATASGT"
     gene            complement(<974318..>978466)
                     /locus_tag="LMJF_34_2190"
                     /db_xref="GeneID:5654986"
     mRNA            complement(<974318..>978466)
                     /locus_tag="LMJF_34_2190"
                     /product="putative dual specificity protein phosphatase"
                     /transcript_id="XM_001686265.1"
                     /db_xref="GeneID:5654986"
     CDS             complement(974318..978466)
                     /locus_tag="LMJF_34_2190"
                     /EC_number="3.1.3.48"
                     /codon_start=1
                     /product="putative dual specificity protein phosphatase"
                     /protein_id="XP_001686317.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654986"
                     /db_xref="GOA:Q4Q2Y1"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020422"
                     /db_xref="InterPro:IPR024950"
                     /db_xref="InterPro:IPR025875"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2Y1"
                     /translation="MYEVLDALRSSSVGLLFRNHPEVSFSNRSCVICIPDFHQDETID
                     GYRLRAAYNAGTIGRSYFATRDIAALSSRCTPPHGSSDCVSDDAGKGPVFRILKVISF
                     VLRRRLLEEITAEQRVLVNIVHQNVLHISDVLNDEAKENMIVITNYHAKGNIGNYAGR
                     LSHDSDKLRRILVEVAVGLRILHSHRVYHHNLKLDNVLENSEGHFCIADAGFWRLFAV
                     QCPEDLVFNGELACLPPEVFDPEGPYATGEVNVVSDEGAAGVAAVDIWGFGVLMYRLA
                     YGCDPVEIAECSYAQVHERLMGFDLSFPPRPHWSFAYDIEDAIRLCLQKEPSKRPSVL
                     RLLQHTFFKHSLVVGTSSLMRKMSMTSSFAFGGQMVGSFGDQTMSALALRGASISSVA
                     VPNYRTQQRNGFQVDAFLGEGRFSETMMVHLRRNHSKQFAFKIIYKSILRRLQAPGRE
                     RWAREMRRQLVFSRKVDHPNVMRFIDIVEDKKVNCFVVQDYMSGGAIEAVPPVKGDSS
                     SPTLQEFLVDVLAGLVHLHDNGVAHLSLLPTNIFFCEHTFHYRIADFGPLFVTADTLV
                     DSIAEGAPLYRLPAWVQRHSPLHGPGVDMFCVGLLAASVLPELFSTVWAELLDGEKSK
                     TFAVEKVLTAVQKSRAQLTPALISFIEDALEGRFEDARAALKHTYFRNLSFAQNLPKT
                     IVEVTEEELQSAVHSKPETRDEARMLEVLAQDPFQESQMLSSAGDATLHGSESCTEAS
                     VIAVAAGEKPTVLVFQGENLLCGQCSAELTVALYQCSDCDSYIRCGKCSVGNYHKDGH
                     ELVPLLIHTIEHSRDGANKAVLVQPSTVPDVHALETLEMTANFPVGSLTAHLVAQRAA
                     ERSIAVRSTGGGSITKGMFGDMESVVRLPDDISEQSISVNINGRSFISFRGLGGVPGG
                     GLNLGSGANNSNTGFSTAGFPNGRADAVTPKDSGSLCLPPPMRLSLMKDKEARKLALP
                     KAEEIEDDDWQQELERCRTSNHSELLLYNYGLDEVPPEVYDPPLLQVVILDISQNNLR
                     SLPHELSFLIHLRKLVVSYNKLTELPDSLGNLSELESLDASHNALVDLPQTFIYLSSL
                     TSAALDYNSFSSIPDSLLDIVAPPLCSSASNVMENFTMATPQVNGTRIASFMFNPAGS
                     LVGGSSVSNSKAVIMSPKLKVIYLAANDSLTTLPLRERLQRFDDLTIALDNEPSLYKD
                     YYEKNLDTELPNITVNWNKLYPDEIVPYLYCGSLRSAQSQMVYRKLNITYLLTVGRQL
                     VPVPPEGGHHKIIVVDDIPGANIRMSFQEAVDFIEESQSKKSGCLVHCFAGLSRSATT
                     VIAYLMIKRGMRLDEAYRVTKKGRPAILPNKGFFDQLVELDKELYPKPDRPLDIESLG
                     RSAN"
     gene            complement(<984159..>985460)
                     /locus_tag="LMJF_34_2200"
                     /db_xref="GeneID:5654987"
     mRNA            complement(<984159..>985460)
                     /locus_tag="LMJF_34_2200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686266.1"
                     /db_xref="GeneID:5654987"
     CDS             complement(984159..985460)
                     /locus_tag="LMJF_34_2200"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686318.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654987"
                     /db_xref="GOA:Q4Q2Y0"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR017937"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2Y0"
                     /translation="MWRGTASAVQLLGALLVVVCLVHTSLAYPYGRSSAVTELTPASL
                     HAFVNTHKPVVILFYAPWCGHCKQFHPEYERFAESVKGTIRVGAIDADKNAVIGQQFG
                     VRGFPTIKYWKSGTKSVSSSQDYQGQRTAAALQSWMVEGISSSKVMTVTTAEQIKQAA
                     RDAPKKMIGVLLSAKNKVPPMFSVMAMSPKLKELPLVFAGSCSPEQGVAKAFGVSQLP
                     MLGVLRYTPADDDAEERFEMVQYAKKTIAYEPVARFFLDCAEKECSAGTETSMNSVSL
                     DEDGSQHQTREATRQSSVALPVEPVEYTPKVISQFCAPQARKIRGQSPLCVFSLSEHV
                     NLDNVHQYFKNDPLLFFDASQHKEELLQQFQADFGVQMAPPGEAAASLAGSIVVLRHS
                     KPTRVRYALLEHVDSDDDLQAALQRILNGEVHLRSEHVGAA"
     gene            complement(<990605..>992608)
                     /locus_tag="LMJF_34_2210"
                     /db_xref="GeneID:5654988"
     mRNA            complement(<990605..>992608)
                     /locus_tag="LMJF_34_2210"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686267.1"
                     /db_xref="GeneID:5654988"
     CDS             complement(990605..992608)
                     /locus_tag="LMJF_34_2210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686319.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654988"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2X9"
                     /translation="MAPRGCGPGKEGLTTQVMEDGAENSPAAAKAAQMEGTPYTPTNP
                     PGRNGSLSAFKTPMTSPPRQGLSLRLLTTHAATAAHTPTVRPCSSGVSPPNAGLLATP
                     TPLHRAHRWRGSGATPGWESLGEITGFPTPVKLSPIPTKGYSAYPELVATATAAAEAA
                     TLTSTPCASGSPFPVVSAVQGDGHGCDDDKLDAATPAAIANAFETAENARASRCQATG
                     VFFSEGGGVPPLSDGNIADYLSSAHSISTIGSECSVSPIRVRARQTTRVWTPHPSEVS
                     QQQHPTPPPSSIEGHSSRFLSDFPSSAAVHQPPPQQQQPSVLRASPIVGAVRIFLCDH
                     AFSAHSSPSRTALHSERAAEEASEDLTAMSLMFTEAQAQPLHQQPQQLFPPDAATGDL
                     ALLHMPADHSAGGWVTPRYVADTLSLGTPTVSMIQSPAQALGESCCSLVMPPAAQYIH
                     ALPIPGLQRRNPPVARAAQHAGLAVEGVGGESDAPALANEARQNRRRQPQHPALMSPA
                     LSDGEEENCTPCFTVASSSAKPPPPRVQASPLVSLDASPPLEAKQPLFSKPAKAQCDA
                     SVQWGTSFTTCLRSRIVHQESGRLDSSARTAPRCASSFASQLQRPSSSKGPATSPQAC
                     QQPHLGLPSTKDTSRSVEVSYVRYRPTLTSISNCATHFIDSWL"
     gene            complement(<994835..>996952)
                     /locus_tag="LMJF_34_2220"
                     /db_xref="GeneID:5654989"
     mRNA            complement(<994835..>996952)
                     /locus_tag="LMJF_34_2220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686268.1"
                     /db_xref="GeneID:5654989"
     CDS             complement(994835..996952)
                     /locus_tag="LMJF_34_2220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686320.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654989"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2X8"
                     /translation="MQAKNKVVVLHPEGSQIITLDLSIEVPAPAAGAAAPLQPKRGTT
                     TVSKSMAREEKETAAKTLGRIRLLFAPPRSSGQSSKRMTKEKIFAECPTVRVLCRSSD
                     LAGMAEEDGPLAAPGTTSVVLPSLDETALFTELNTELPNRVFWKHARVLCVNETIVSV
                     LYNVPTVVSVTSPGIPYVGLPLACADVSLLFASKESLCFEWCVLSETSASTRSANHGD
                     AAFCVVGTAPTFTPTSDLQGKEMMLRVSLDPATGLWTEMRLPGVVRQLPPPVPRWQET
                     TTSVNYPAFRVVTYNILYDDFCTSKSSKAKIYPFATDDILDLGNRKVRIVQELLAYHM
                     DIVCLQECGRDVFQSYFLPVMRACGYDGVYCNKSGSVKEGCGFLFRESRFQLVQHASV
                     PLNFQTLSTMFPELAGRVGACPELKEALSAVTSIGARVVLRESTSGKEIVVGNTHLFY
                     HANACHIRVLQAYMLLHWLNDATLISPGGDAATSPSPSLADRARPRRPLVMCGDFNCT
                     HPTGAYRLLTTGQVEADHPSWDKGKLFRWGCARLLGYDADDLVELLGKDAELPHATVA
                     RKDCKRQHKSPAETAAPTPADPTAGPAEASNETQAQEDPTQSEGGERVIRKVFHEALY
                     GPQVRLQDAYQRTDLSLPWTNFTLTFREVIDYIFFSEDSLEVLRTVPIPSEAELTENF
                     ALPNKKYPSDHVALVADLAFTMQ"
     gene            complement(<998291..>998764)
                     /locus_tag="LMJF_34_2230"
                     /db_xref="GeneID:5654990"
     mRNA            complement(<998291..>998764)
                     /locus_tag="LMJF_34_2230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686269.1"
                     /db_xref="GeneID:5654990"
     CDS             complement(998291..998764)
                     /locus_tag="LMJF_34_2230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686321.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654990"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2X7"
                     /translation="MVAVATLLRWFSFFSLATLQKPFLPVVKDVIVYVCMSGALLFLV
                     TVVLAYGLADKEMQQYLTPTARVAVPDGMSTKGNTVLVPFSYEAFVSASVTVSVVAAL
                     AVLLCCSFVLQVTWDGMATCVVPMVALTVNTVKPKCWDTAEDYRGKVPPPPEAAT"
     gene            complement(<999767..>1003291)
                     /locus_tag="LMJF_34_2240"
                     /db_xref="GeneID:5654991"
     mRNA            complement(<999767..>1003291)
                     /locus_tag="LMJF_34_2240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686270.1"
                     /db_xref="GeneID:5654991"
     CDS             complement(999767..1003291)
                     /locus_tag="LMJF_34_2240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686322.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654991"
                     /db_xref="GOA:Q4Q2X6"
                     /db_xref="InterPro:IPR005194"
                     /db_xref="InterPro:IPR005195"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR012341"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2X6"
                     /translation="MNPLLARDYEVPKKPIFLLEGRDVVQSTEASAFVSNSVTDSVMY
                     STNGNLGLRHLSEVERVGFKTEVLMNGVYHEEPTDISEYMGIPRTNQVGASICTVDFD
                     CMLDGESGTLSSIPSRKLNLDDGAYRSHCTDVMSADGGLIFDTKYVRTVGLSDLSTWG
                     AQVCYSDFRLGAKGSPVSVGSDTKIGFGNCVAGAGAPHSPSLDSMSDGTLQMHSPHVT
                     YCPHSDLDYRIELVVLISIDQECWDVAHQQMDRVHQCSLTSDKEVTTFTEVECVVKYG
                     DTYRPLQAEVEGTPWVRETESGTTSPFSRDRYNVSAGGGSSYSNTESKEHGNGDRDGG
                     SNSVFLRPGSWHYHTFHSPNKAQKSYVIKKRFIMPLTPETVPDSVVLTFRACHKREPT
                     EQRPRALPTIEEMIADQKAALQLFWKTFDADVKLQDELSPSRSSLPFVYNAFRMFMIS
                     HGLEGGLSRSGLSAAGDGLQFNLSEYIYYGLYYLLTQPEACLRLLKSVYHMLPQSRKY
                     ARVLAMNRGAVFPLNTISGVHSTHAANVSNARFHVNAEIGFLIALYDEAAESISAEDR
                     LLLLELMMESARIWPQCGEWQDDHTVFRLDNIAGTDEYNSNASGNFYVNISARRHIAS
                     AFSFLDRQREHLTEEQLNSVFASLAMTRHEMAELQAVGDGIVLPQRHERLGVYMVHDN
                     FDTLIDWGNERAMHPLHLNYHPIHIYRRKLIDVPEVLLGMLLYPDEFDQRDFQQNFEY
                     YLPLCTFDSPESLFVMVHALCRARSNFSQPMPLLRSLANIDLDNIVYSAEGGLHFSAM
                     ASTLPGLIFGCGGVQLSHKGLQVRPILPARIERYSFTIKWRGAVLRVLVDRANITYDL
                     LSGASLRFIHGTPGERIHLHTGFGRCPETTHLAIPRTSQSQVAQFDGVVLLSDCLFDN
                     LLEYSYRSWYKTLETLFDTYRMLHNRPIPSLTPEEFIEKVVYQHEDGEISFSGIDQIL
                     QRRGLCLELGTPEDAEIVETRYGLANAKLAEMTEMVVMSPPPVNAGLFCLLKGLVENG
                     VALAVVSYSRTLKQLLASNPQLARLFVASIDGEEAHDWKIKGQPHLDLYMRAAEKIHV
                     DINRCLVISHHLDRGFNAKEMSKFRMFIDVEDPFVSSRFLSSQYPSLTPEESKETGRD
                     NPVVCRLELSRIPSSIDELEDMVDGRKL"
     gene            complement(<1007086..>1012881)
                     /locus_tag="LMJF_34_2250"
                     /db_xref="GeneID:5654992"
     mRNA            complement(<1007086..>1012881)
                     /locus_tag="LMJF_34_2250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686271.1"
                     /db_xref="GeneID:5654992"
     CDS             complement(1007086..1012881)
                     /locus_tag="LMJF_34_2250"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686323.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654992"
                     /db_xref="InterPro:IPR011043"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2X5"
                     /translation="MSSASPPLPQRGDAVQVQLVNADGSTIAQRPIHIEELLQQKDHT
                     VDIGAGIALRLEALNAEQDYSDDNDTSAPDDSADDEEETKGSAEGAGARDESAAAAAP
                     PPGTQATMDWYDVLDALRREQLDVKRNAAEVEDTMRKSGEGEGRLVTRHFNESRSAAT
                     PLKWFSKATGLEGKAVAADDAARSLPPPGASRREVWASLAPAKNNTHPPNYKVLRYVS
                     YMPVLEYRRFRPTALAFHAAASYLSRKDFGQRLLVYGGVSFGARTVEQELYEFSILTG
                     NWRRVEGRQLVPAGHYGHTMTVVESFDRLVVVGGIGPGGAAVSKEKRQAWVTDPLRAP
                     RYRCLCPLLHCRAGQAATALARADRTAAPLPLSVSHVSVGFVSLLFDMNLSDQTWRAI
                     QPATQFPLVYHTTVHFGKELFVFGGLTDDLRVSGQLLAINSATYAVRRIKTSAGSSSR
                     FRQGVAPDDEAGEMHSGSDLDEGEAAGPGPRFLHTAVRYGPYMIVYGGYDAQNEVLGD
                     CWAFDMANERWEQLRCRGEAAGRAGHDCCVVGCRMLVTGGFESSLDEAGKAASPVTTV
                     MELNLVPTVHGEHIWRAEVRAHPPLPPLAFTRCAPCGDDHSFLLFGGLTKRARHPSQS
                     RSVGKRFASAKRHAAASAAEESGADDAVDSDVDVDSRPASHKVSERGASLAARHGLWK
                     RLAPFDDGLVLTFPEKRRRSKGAKDEPVVNARGIEVAADELPEHLKAFVRRQEDFVRK
                     KDAAAAETIRKTTLEEQEEMEPALYLTDAEIELLLHRSEECCVAFAERYKMNTLPSNV
                     PDREERVHLIEECISKSRQIRDVMRSMKGSAPGVTAVKSKTHRKRAGQKFEDYSAAKP
                     FRRVVVMHLLESIKQHLSRMHRLNKALLTVDWPEKEGFLEAVDDMQNSVHAVSRAING
                     VLNKYIQHRVESLMKGVDKHKEVMRLLTQVVEKNLHDKIWGIEAARDEKRQKHQRARA
                     AVAAPGQPAAAARSGSSSPAARRGRSARSRSLGGGYHADESKAVVCMMDREWHGLLNR
                     ARMVEKCAGHLRRYCEEGAATSDTAPLSALPPPPAPPPPRPSVEGPLSLPLAPQQAPS
                     LMMQVQPSLQAPTLAPGGLMAPPVLLPASVPLAGLLTSEAPEVPPVAAPASTAGEAGA
                     ARPREIMIQRSNELRMTTATVAEEVRKAALDFHAALAQAAAALPSASSAHASSATTTV
                     SHPTAAPPRTTVGADIVAPTTPTPQLPVPAVMSSHTTTAAAIPGPTLAFQSSPSGASS
                     SSSSGSSRSSSSSGSSGPAAATVMRGPSLQLPPGGSLPFATAAPPESTGFVRLQQPVT
                     ASVGLSTEAPLANVQQPQLILAATSSHDAAPGASRGSRNPKTTSAAPAQASTVQGHAV
                     SLSVLRPILAAKESLQQLQDKVTLIRLNEWDVSDLAGAPQDVKVEKLYRRLSKLLTGV
                     AQCVTATFLAKAGARPPRLRPTSVSVGPPPQRPRSKKSTGEARTSGAATKRASQSKSL
                     TSVAEARAISASAVFSQTLFSGAGGDKGDPSREGRGAAVGALPGAADGNVGDTLRLMP
                     LPPPVHNQVDDADDGWLSKRSRPTYGEAAGVPLVSHEALLRDVRPAVVPTAAAFTSAA
                     GPSAVEVHAVYPDARTVPNASATSLLCGSVAPPAIAAGPWAPAVSSVQRSGTAPVVAL
                     SVVPKVVMPAGANDVSTDEAGAAYMTQSPRRRRRSTIADLTQLRHLSQNRLHDGSFGD
                     GTASSGDGIDPVTREPVTNITRGNFVVNADYLSRVAPHALLAATTAEIELQGGAGGMQ
                     QAWSDIDEDYFYFGRPVGKRATAAETVVSGPPYISNRPRGGVGVSPPVGTVMGSPRVN
                     AELAASPIRGIPGVIPASTALRTRSSTARGSSSGRRVSDHYLSSTASQLLKLHTARPV
                     VLKSGSKHSFFTPGELHLMQARERLRSKSSM"
     gene            complement(<1013873..>1016290)
                     /locus_tag="LMJF_34_2260"
                     /db_xref="GeneID:5654993"
     mRNA            complement(<1013873..>1016290)
                     /locus_tag="LMJF_34_2260"
                     /product="ATP-dependent RNA helicase-like protein"
                     /transcript_id="XM_001686272.2"
                     /db_xref="GeneID:5654993"
     CDS             complement(1013873..1016290)
                     /locus_tag="LMJF_34_2260"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase-like protein"
                     /protein_id="XP_001686324.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654993"
                     /db_xref="GOA:Q4Q2X4"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2X4"
                     /translation="MLSWVKIPMLLHPALHRLALLFCLSCCKFCTLPTAHLMALKRVR
                     EEAAENGEVGLGDTLVSQLPKKRPDMAACTSSSALSPFTRQPFSARYRQLLQSRQRLP
                     VFEKRHLIQETVRTNAVTLLVGETGSGKTTQVPHFLAELQDAFTGVIACTQPRRIAAI
                     SVATRVAEEMDVPLGAHVGYHVRFDSRQCDATRVLYMTDGMLLREAFTDSDLQKYSVV
                     VVDEAHERTIDTDVVLGLLKRLLTRRPLFRLVVMSATLDVAKIQSYFPGAPLVHVSGR
                     MHDVDVLYMPHPVRDYVEATVSCVLQLHEREPAGDILCFLTGEAEIERAVAALHQALG
                     SSSAAASKEQNAPTQGPGKGLTVLNTPADDLARPTEVVVVPLYGSLSLQEQQKVFATY
                     PPNTRKVVVATNIAETSVTIDGIVYVVDCGYQKQSLYNSEARVDYLLPAVISKASAEQ
                     RTGRAGRTRPGKCFRLFTSADFATFPDQTHPEILRTNIVNTVLLLLTLGVANPCEFPF
                     IDPPSDQGMSDAFYQLLYFGAVDDGLQLTDFGRRMAVLPVDVCLARMLLMAPKHGCGA
                     DAAVVAAMLEAGNAFSRPPSRLAEAREAHARFDNADGDHVALFRVFHAYFKNQQNGKR
                     FCYENYLRHQTLQQAVQVYKQLRRLMSQLMIPVQSTYIPEREYVDTVALRKAVLEGFF
                     TQVAFLTPVAPITHRAGADPTTRVYRTVRDALSATLHRQSVLAAAHKLRALPTWIVFD
                     RLEVQGDSGTFIRTASAVEVGWLLDVSDFYTDLSEIPDGEIAQVLRRAREVESSAHPC
                     KATRESV"
     gene            complement(<1017041..>1018666)
                     /locus_tag="LMJF_34_2270"
                     /db_xref="GeneID:5654994"
     mRNA            complement(<1017041..>1018666)
                     /locus_tag="LMJF_34_2270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686273.1"
                     /db_xref="GeneID:5654994"
     CDS             complement(1017041..1018666)
                     /locus_tag="LMJF_34_2270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686325.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654994"
                     /db_xref="GOA:Q4Q2X3"
                     /db_xref="InterPro:IPR001401"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2X3"
                     /translation="MSEMQEALEKKEAWDRHLESTLLQLSHFYTSRIEPVEASYNYNV
                     FRPTWFAESIKQKMPLVTFLGPFSSGKSSFINYLLQGDYLMTGPQPVTDKFTVVMYGE
                     QFQQIPGRVLMADSRLPYRCLSQFGDAFAEFFAGVVAPHPILRSVSFIDTPGILEASG
                     DMHSRRYDYIEVCRWFVEKSDLVFFLFDPTKLDAGPELRQVFSKALLHEESKIRIVMN
                     KADSVRAQELMRVYGSLYWNLSNLVRSTEPPRLYVSSFWDKPYHDGTDHALFEKEKED
                     LLYELIVTIPLQSLDRRVTSMIRRASDVLLFALICASYRTRLPAVFGKSKAKERFYEE
                     YETIVKDLASRYHTSESSFPRCADVRAFLTRVDSKDFLDIEKLEKRGWITSLKSTIDV
                     DLPRLLQPLKEYSMSDPRERREAIQLQRKYMQQRATAAPPARAATVASLGGNDPPSAT
                     PKAVVSPPPAAAPAAGSVSSTIDAQAQMVTMMLQMLAAQQQQQQASSPSIGQTNPGAA
                     ATVSNDQMQFTMQSMMAMMQQQMQQQQPQQQQR"
     gene            complement(<1020436..>1022688)
                     /locus_tag="LMJF_34_2280"
                     /db_xref="GeneID:5654995"
     mRNA            complement(<1020436..>1022688)
                     /locus_tag="LMJF_34_2280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686274.1"
                     /db_xref="GeneID:5654995"
     CDS             complement(1020436..1022688)
                     /locus_tag="LMJF_34_2280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686326.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654995"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2X2"
                     /translation="MVALVESWDTYLVPSLQLVSSTKVSEQGCAGVDQRTCVFASEAS
                     PFRYHLTDACPIFTASEQDSSDQVSPTTSGPNSTGGTPADVPAALSSSSLLWLLTLVS
                     RNVELLRAAAHLFLQFNAQFAALVESNAVTVNALRARHQHQLDSLLEVTDNHAATNMI
                     VDSAVTERVVLQQQQELDAAERRCAAAEQRLEVELQKTFWRFLTTSAPDAVAAANRKQ
                     QSLGWANGGDGAGADSSLYRAEVDVSRFAEVRKAASPNPHRCNTAVAPFSPVRLVPVR
                     TIKLSNEVGDASAAAAASRTQSPSKRSQDSALQPIVLDISPVSALSRCLGCCSGTQLG
                     AIASSVSSAAEEHLLRLAHTRHSVLLFIGSESAAMDVMQSCKAPELLLGAGHSCRDRF
                     QPLANHPVLRVLFTTRLWGANVVLLWNPAQDAALAVAAQAVVEDALELAYAWDADMFS
                     VAVLEGARLPSYAGAGGVSAVATGASSTSAAFFASQAVSMEVLRQLRNSVTRELLDTA
                     GMRRARRWQGTATWMQQGIGSAAAATTGTHMCPRAVGVLYVSQSAQQEQENQLQHQEV
                     SCTASSIRSNAASPLRGDNSIVSVMSSSFLFSPTSPASAFRGPCITFNTPLAIRAFLP
                     LAEEYFIREQPSLVRGSSRGGGDGHHGVSEAASSSTLNQEGGGARGLLRRTASATATE
                     DDDASFSSEKDARFSPASLSATSAPASSPAIDAIRASGSGGEAGLRRQPEMTLESLIQ
                     YAFGDLAEIL"
     gene            complement(<1024685..>1025680)
                     /locus_tag="LMJF_34_2290"
                     /db_xref="GeneID:5654996"
     mRNA            complement(<1024685..>1025680)
                     /locus_tag="LMJF_34_2290"
                     /product="putative G-actin binding protein"
                     /transcript_id="XM_001686275.1"
                     /db_xref="GeneID:5654996"
     CDS             complement(1024685..1025680)
                     /locus_tag="LMJF_34_2290"
                     /codon_start=1
                     /product="putative G-actin binding protein"
                     /protein_id="XP_001686327.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654996"
                     /db_xref="GOA:Q4Q2X1"
                     /db_xref="InterPro:IPR002108"
                     /db_xref="InterPro:IPR028458"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2X1"
                     /translation="MLHIDFCIAADAQEALEESGKPNTATVAVPIILEKEVLKLLAPP
                     VCSSDGGFEYDLNATRTLLGAKGATAAYIVVRTAPSTQYVVIYVSDTTSAKNRMLYST
                     GLSRVVEATPHAQKRTVRISSVSELLPSLFEAESKKVKEALMTESERHHAAIARMEVA
                     PQPVALPGVAVQITTDADDGLSQFAGGAVEVATFKIEAGQLQLDKTVAQLNGNLDQVK
                     SILTDADPRFVLLRYPSPKTQLAEAVMVYVCPPTCSPKIKIQYASSAAAFREQALRHK
                     IQLAHKVETDTTATLADDVRSAFEPFPSADARKTHGRLSSCPPTSWAPKGHSMLI"
     gene            complement(<1026562..>1028469)
                     /locus_tag="LMJF_34_2300"
                     /db_xref="GeneID:5654997"
     mRNA            complement(<1026562..>1028469)
                     /locus_tag="LMJF_34_2300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686276.1"
                     /db_xref="GeneID:5654997"
     CDS             complement(1026562..1028469)
                     /locus_tag="LMJF_34_2300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686328.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654997"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2X0"
                     /translation="MDTQMSFFVAVAHPSQAVAGVMQQVFPEPPARGGEGKPFIYFPL
                     PSPSATTSTATRKRSRSPAGVKGAAQSSTATSPATPLLLEGRAALCRFIEYGNQPSPA
                     SMWFSRHSETPSTPAQLFANHTDPSRSALAPKHRWCFAALRQAMWLLCRVVQLDSSGY
                     YLRATSPSNTGADATAVAGGALPLSTEAPAATARVTTLELYCRFQALELELEDAALRA
                     GAATQADAVPDSIRQQLRSDVDATVACIEESLNALESTLVQMLLGSFADFSVNGASTV
                     DMPLAPSLEYVARMLRELPSVLHAEQWPTQFVCDSNAPLSGSGTELRNAEAITSSSSS
                     VLERTLLGISPLSGTDAAVSQFLERLGGATTSLALRSLFDLCHADVWNLLGVAATSPI
                     SRLAALEKLAAAANGSASAPGPCRPVLDAETLEFKDILVWAWNRQYGCVGLRRLFFEM
                     QVLFYRYAMNAQATSKQSRAGNGATLRDVCELWAVWRLSLQKWSAAFLAKLGTHEQTA
                     DVLDASTLRADACDLMRQHAIAVSGLAEVQRMALRVITKLQTVDAKGWFAVPAFDLVN
                     VDFTSVRYWISSPVFARKSKREAYRSLCRTLERMVDSCVQKYGPTHAFSDVITTVRQQ
                     LVDVARAEGLL"
     gene            complement(<1029563..>1029814)
                     /locus_tag="LMJF_34_2310"
                     /db_xref="GeneID:5654998"
     mRNA            complement(<1029563..>1029814)
                     /locus_tag="LMJF_34_2310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686277.1"
                     /db_xref="GeneID:5654998"
     CDS             complement(1029563..1029814)
                     /locus_tag="LMJF_34_2310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686329.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654998"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2W9"
                     /translation="MLQRTTLRCYSALVGQATPVLLGSKGGTPKRKKNPMQLRRKTYG
                     LHFKERYLKLEEWYFCPLCAEPKKQGEWCRREDCRQIKP"
     gene            complement(<1030856..>1031254)
                     /locus_tag="LMJF_34_2320"
                     /db_xref="GeneID:5654999"
     mRNA            complement(<1030856..>1031254)
                     /locus_tag="LMJF_34_2320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686278.1"
                     /db_xref="GeneID:5654999"
     CDS             complement(1030856..1031254)
                     /locus_tag="LMJF_34_2320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686330.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5654999"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2W8"
                     /translation="MAVLDYLFYAGVLLLAHALYMACSIREQLQASHHSHGHIPAISF
                     GGHNVSITAMMVPITLEVLAGTLLGITGFAHRHKMQDARLCDVTKYLHYDNQMNSGVG
                     FIHFNHRGTVACKRDELKEECKPLVQKKKE"
     gene            complement(<1032197..>1032628)
                     /locus_tag="LMJF_34_2330"
                     /db_xref="GeneID:5655000"
     mRNA            complement(<1032197..>1032628)
                     /locus_tag="LMJF_34_2330"
                     /product="putative clathrin coat assembly protein AP17"
                     /transcript_id="XM_001686279.1"
                     /db_xref="GeneID:5655000"
     CDS             complement(1032197..1032628)
                     /locus_tag="LMJF_34_2330"
                     /codon_start=1
                     /product="putative clathrin coat assembly protein AP17"
                     /protein_id="XP_001686331.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655000"
                     /db_xref="GOA:Q4Q2W7"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR016635"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="InterPro:IPR027156"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2W7"
                     /translation="MIHFILLQNRVGKTRLAKFYIPVDDAGQAQIKRQVHVIVNTRDT
                     RATNFVSYESIKLVYRRYAGLFFILGIDQEDNDLMYVELIHLLVEVLDMFFKDVCELD
                     LIFNFHKVFMIIDEMIMGGEIQEVSRPVILNRLQELEISSK"
     gene            complement(<1033851..>1036523)
                     /locus_tag="LMJF_34_2340"
                     /db_xref="GeneID:5655001"
     mRNA            complement(<1033851..>1036523)
                     /locus_tag="LMJF_34_2340"
                     /product="putative asparaginyl-tRNA synthetase"
                     /transcript_id="XM_001686280.1"
                     /db_xref="GeneID:5655001"
     CDS             complement(1033851..1036523)
                     /locus_tag="LMJF_34_2340"
                     /EC_number="6.1.1.22"
                     /codon_start=1
                     /product="putative asparaginyl-tRNA synthetase"
                     /protein_id="XP_001686332.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655001"
                     /db_xref="GOA:Q4Q2W6"
                     /db_xref="InterPro:IPR002312"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR004522"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR007639"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018150"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2W6"
                     /translation="MHAKALARLRMHHAARQRMSSVGMWRALWVVAKLTMVEKEAPDW
                     QTTIPMNLAMTTEKLHALPSSMMASSVRLAVDEAPSFTTTSPPLAPGRGFTELRCSVP
                     VPVSLEQPPLATSLPRRDRGWRTGTCASFSSALGLTAASSLPSSLRQHWSSCTTPSRC
                     PFFSLALPLCLLRHRRTLPPQHHHRSPCLPLHTPCRTIAIQLHPVLLFKASGSKDPRT
                     KSGSTMENEQQRTAAIAQLKAVVGLDDKGAKDLSSKPERVADVLAFFAQHNIDEASPR
                     EQKVMLFNVWTKVKKPEHRDPVTTFILEGKLDSTQKVDAAIRFVNAAGSDVVDTAAMS
                     AECGVGVMVSREDVEKAVAAALATEDVIALKTKWDKNPNMMLGQMRRVTALRWADVEH
                     MRAALERQIPGLIKDVIVEAKPAAAKEEAAAMPKKEVESCRQNSNFKDVAQGLPRSPI
                     GELLSHKEGACVYVVGWAHRVRHQSRMSFVVLRDGTGFIQCVFDGSTEPFHRESCVAI
                     RGTLRHEPKAKSELQPPMELHVDEYAVVGDSDGTIETVITAESSVDKLYDQRHVVVRG
                     TLASSVLKVRHELLRVFREHFWSRHYYEVTPPTLVQTQVEGGSTLFEVLYYGETAYLT
                     QSSQLYLESVTASLGNVYCCVPSYRAERSKTKRHLSEFTHLEAEYDVCSFEDLLNHLE
                     DMFCTVIRTVIERVGDLVAMLNPSQLIDPNGNVRDPANYKFTPTRPFRRLRYAEAIQF
                     CNENGILNTETGKPFEFGDDITDQPERAMVAKLGEFVFMTHFPASMKSFYMQRDPDDP
                     TLTESVDVLAPGIGEVLGGSMRMYKYDELLDAYKREGLDASTYYWYTDQRRYGGAPHG
                     GFGLGVERLLVWMLNLDSVKDACLYPRYMGRCKP"
     gene            complement(<1037635..>1038255)
                     /locus_tag="LMJF_34_2350"
                     /db_xref="GeneID:5655002"
     mRNA            complement(<1037635..>1038255)
                     /locus_tag="LMJF_34_2350"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686281.1"
                     /db_xref="GeneID:5655002"
     CDS             complement(1037635..1038255)
                     /locus_tag="LMJF_34_2350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686333.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655002"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2W5"
                     /translation="MSHIHHTYHGRVGSSTTTLSCSSFAAQGSEKQLQYGQRCALLRE
                     ERYRRISICALENSEWAELCIVCADELAEEWWREDARKSNNAGPAEPRPPRYTYRYRA
                     GATVSVLSVGQSTEALNGSLTAAAGCVNAEENQLRLWEWENRADLQEWELGERKEMAQ
                     AMQRILETQRELELAHLEGACRRVMNGTTALNWTSYPRYDAPELLS"
     gene            complement(<1040402..>1041700)
                     /locus_tag="LMJF_34_2360"
                     /db_xref="GeneID:5655003"
     mRNA            complement(<1040402..>1041700)
                     /locus_tag="LMJF_34_2360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686282.1"
                     /db_xref="GeneID:5655003"
     CDS             complement(1040402..1041700)
                     /locus_tag="LMJF_34_2360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686334.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655003"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2W4"
                     /translation="MSTMAASRSDTPAPVHEMSMERLRREYVSLKSTSYSLTVEESHL
                     IRKIETLREESVRAVLNAEMKEEQVSNQLFRRLDGAEREVQRYQALLKEEESEAESLS
                     GRIKEMRSQQTEVENALEERQEYLLMNLQRKLLDMARKKTAVEQELMAERQKYLDVLV
                     TRLNMLRGRGVGSSTESSVTIHSQPSPAEANTVPVAKHLDVPLPTTAAPHISTPLLRT
                     GVPLGDNHGMLPAEKPLREDAHTDAGLPLPFVLSPAISAQKKPKDGVIVNASRGNTSS
                     TSGRLSASTTPLSADLTPRSSHSSETHHAVVALERKLNQLLLEQAAAMQRTSATEKQC
                     AVLTAKLHAVQEATFLDRARASKMKEELEKARARLSEVKARDRSGIPFSPLDDTSVMS
                     GSNASFDNSSPLVLSSLSLRERTRELLSSVPQPNANERPC"
     gene            complement(<1043489..>1044586)
                     /locus_tag="LMJF_34_2370"
                     /db_xref="GeneID:5655004"
     mRNA            complement(<1043489..>1044586)
                     /locus_tag="LMJF_34_2370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686283.1"
                     /db_xref="GeneID:5655004"
     CDS             complement(1043489..1044586)
                     /locus_tag="LMJF_34_2370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686335.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655004"
                     /db_xref="GOA:Q4Q2W3"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2W3"
                     /translation="MSAEGDMEGVAYDSTLGATLDPGEGEEELASYLVPRLATYAPSA
                     SPLSSSLASQVGEADGAAEEDHAVPLSRQRGGSGSQARDSGERSAAHALEDDTAEGVA
                     LRASHGLPARSSASPDEEAQATAGSGLDPYLTETDAEDVDDWREEDEHDVDEDDEEEA
                     DNTDAPPQTRSGTRHGGASDVPNYVNAFAHSRVKALLKYEGSSSIISKDAISAVSEAV
                     ALLTRDLVALAAGEATRRHCKTVTYEDIARVAQLLDRFSFLAEVVPPVAASSSNALGA
                     GSSIVVGSSVHSTATPGSSSGTKRHGNPSVRSRSAHGRPGRNALQNLGESPPASARSK
                     TAHVGVLGAAAHRSAVHPQPGAGLRQATLRF"
     gene            complement(<1052970..>1054055)
                     /locus_tag="LMJF_34_2380"
                     /db_xref="GeneID:5655005"
     mRNA            complement(<1052970..>1054055)
                     /locus_tag="LMJF_34_2380"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686284.1"
                     /db_xref="GeneID:5655005"
     CDS             complement(1052970..1054055)
                     /locus_tag="LMJF_34_2380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686336.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655005"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2W2"
                     /translation="MNILHKIFTPGSKSKKTLLHCDAELGDRQSHSSSKVSTAVQVKS
                     KLTAASSDDDDCGPLMRSVSMTVVSDPVPSSFKTNSSFANQSRPTQGPASFKSARLAN
                     SFSNASCHLERHHQHTAALASSVSRHNQRSLFDKIHSSGSFAVGETTVSGGSFTANGG
                     TVNLWRLPWTQQKVTMCPNCHRPRQRDRTMQVSRASYTLQETTIENGMGDDMSEANED
                     MSYSDSEGMGGPMSDSVTCRCGVVSEGDAPLDYDDSAEATEEHPKLFVVETQNPSAVQ
                     LPGTIAEASDSEGEGREDVRRSYKLSLVSSPTPTSLRRRAPRVQPLLSGASPQTNTAS
                     VPKRVTHWLHEQQTSEARVVLKPKAAR"
     gene            complement(<1059336..>1059881)
                     /locus_tag="LMJF_34_2390"
                     /db_xref="GeneID:5655006"
     mRNA            complement(<1059336..>1059881)
                     /locus_tag="LMJF_34_2390"
                     /product="putative centrin"
                     /transcript_id="XM_001686285.1"
                     /db_xref="GeneID:5655006"
     CDS             complement(1059336..1059881)
                     /locus_tag="LMJF_34_2390"
                     /codon_start=1
                     /product="putative centrin"
                     /protein_id="XP_001686337.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655006"
                     /db_xref="GOA:Q4Q2W1"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2W1"
                     /translation="MNITSRTSGPLRTTAPAASAPSAAARRRFQLTEEQRQEIREAFE
                     LFDSDKNGLIDVHEMKVSMRALGFDAKREEVLQLMQDCAARDQNNQPLMDLPGFTDIM
                     TDKFAQRDPRQEMVKAFQLFDENNTGKISLRSLRRVARELGENMSDEELQAMIDEFDV
                     DQDGEINLEEFLAIMLEEDDY"
     gene            complement(<1060997..>1062001)
                     /locus_tag="LMJF_34_2400"
                     /db_xref="GeneID:5655007"
     mRNA            complement(<1060997..>1062001)
                     /locus_tag="LMJF_34_2400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686286.1"
                     /db_xref="GeneID:5655007"
     CDS             complement(1060997..1062001)
                     /locus_tag="LMJF_34_2400"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686338.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655007"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2W0"
                     /translation="MLRKSGRRLALEGERQFFHPGNSPMQSTGGLPFYGNLYAGRVDS
                     QNYVPPRQGGSGLLEVDKSLWDNPATRQKLQSCPYFALSDQVMFHNMDPVYLDPGLLS
                     PEEHQLLLLFSRAYYEKWSVIHRRPPHALPRLRITYGSSKLLDEILFLLDVHPDVCEV
                     LKKEYAVDDSTLIGMNPNLWSSAYLDPANMDHLSGRVLEFAGVPEPKRTKFFLLLDQM
                     RRIKVHRRDLPNSEERVDVVPFCYGVTLYDFCKFLGITPYSGQLKVYDYVDLQGTARS
                     ETLKDEDSYFDYLVALFYRADVRSATLTDLADASDHTCRYTVTVEPFTTADRRVGRWF
                     "
     gene            complement(<1063778..>1065043)
                     /locus_tag="LMJF_34_2410"
                     /db_xref="GeneID:5655008"
     mRNA            complement(<1063778..>1065043)
                     /locus_tag="LMJF_34_2410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686287.1"
                     /db_xref="GeneID:5655008"
     CDS             complement(1063778..1065043)
                     /locus_tag="LMJF_34_2410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686339.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655008"
                     /db_xref="GOA:Q4Q2V9"
                     /db_xref="InterPro:IPR001544"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2V9"
                     /translation="MSCVHVPLDLLLTFPSPFFIARLSSPRMPHTRIRPSRQHPLTSR
                     SMLVFHLRTSGRAHSYSGRGQNTMERIPLVVRRMVAAEQSCGFVHFFASLADASATPL
                     VIEAKAFSSAAAGGAADDAAPTYQLVYDVMRSRNGHILFKKSYAERFTHSLALAAPVH
                     ALPAQLRSLVQSRLQAYIESPGVYLDGATERNVKLLSWIPATAASTTQEEAFPIPGIV
                     MLVKSSYPSESMYREGAKLGLLFNAHRTNPNAKVAQMGLRDRANAYLAENDVYEVLLV
                     HDAADAYLVPEGSRSNYLLQKSDGTWWCSAEEDILVGITLKTTYRVVQACGLGSVQHA
                     KLTLKDILESKSLFILGTSPTIMPVQSVLLYRDTETRRLYEEAVRGLGTTAGTVQQVS
                     DDKAELLFPVNVELAAALRAQYFAEAASS"
     gene            complement(<1065663..>1067315)
                     /locus_tag="LMJF_34_2420"
                     /db_xref="GeneID:5655009"
     mRNA            complement(<1065663..>1067315)
                     /locus_tag="LMJF_34_2420"
                     /product="putative
                     dolichyl-P-Man:GDP-Man1GlcNAc2-PP-dolichyl
                     alpha-1,3-mannosyltransferase"
                     /transcript_id="XM_001686288.1"
                     /db_xref="GeneID:5655009"
     CDS             complement(1065663..1067315)
                     /locus_tag="LMJF_34_2420"
                     /EC_number="2.4.1.132"
                     /codon_start=1
                     /product="putative
                     dolichyl-P-Man:GDP-Man1GlcNAc2-PP-dolichyl
                     alpha-1,3-mannosyltransferase"
                     /protein_id="XP_001686340.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655009"
                     /db_xref="GOA:Q4Q2V8"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="InterPro:IPR027054"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2V8"
                     /translation="MELMLLGFLYAFGAACVVNYFIMFVRIRTTEMYVQRRKRVVEAY
                     EKLHGPLGNRAAEERGGEGEAPETGASADLLSKEPLRVAFLHPDLGIGGAERLIIDAA
                     VGLQKRQSIRLVEVIIVTSHHDRSRAFKETTDGTVRIVVRGSALPASIFGHAKVLCAT
                     IRMGFAAFATCWSFPNTDCFVVDQVAAAMPALHLFAGRTPILFYSHFPDRLCDPNRNP
                     DGTFKSAGSGVAPWHAIYRGFFDQVEASSMKFATSIVCNSKFSRQVCIDTFPTLADKI
                     HETTDIFYPPVETKVREVTEDALSKSAALRELKQAVSSAVTFVSINRYERKKNIELAI
                     EAFALLLSTGEFKNAESKKPLMLIIAGGYDPRLAENVQYADELAALATAKLRIPASQV
                     RCLKNISDDEKAVLLSEMRALVYTPSREHFGIVPVEAMAYSKPVVAIADGGPCESVGS
                     VELEDPSKCGGLLSSPEPAAFAEKMACFARDPVYAAKVGAQGRARVLERFSTEAFSTQ
                     LVTRLVRLRSEADKRLLAEGIELAKKEAASKAGKSSLKAKRD"
     gene            complement(<1070014..>1072440)
                     /locus_tag="LMJF_34_2430"
                     /db_xref="GeneID:5655010"
     mRNA            complement(<1070014..>1072440)
                     /locus_tag="LMJF_34_2430"
                     /product="DNAj-like protein"
                     /transcript_id="XM_001686289.1"
                     /db_xref="GeneID:5655010"
     CDS             complement(1070014..1072440)
                     /locus_tag="LMJF_34_2430"
                     /codon_start=1
                     /product="DNAj-like protein"
                     /protein_id="XP_001686341.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655010"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2V7"
                     /translation="MSTALGMEPEVASSSASSSSQLEQPTVDPRNVGTDAGNRSPELS
                     LNTATASASGLAYPNNLNVNKMSGVRAGATDKLQGGAFAHRGVNGVTARFTDPKDENG
                     FTVFSRRPIGASAAATGLSQQQTSPTSTLAPNVSNGGGASSGHALRSSVNASGAAAND
                     EHPGVMEFAKNLSERHLRCALCAKVVVDVVLIGAHASVACRRCALALPGTHIIELPRP
                     LREVLRALKAAAGLPEPNDDFVGDRRILRAKRPLPVSATQPNGAESTAKEETAAVASP
                     GSPATTSATSTAAMQAVLAELTDAETAERHQIGSAEASSRAEITTRRSAAIAARAAPA
                     AATGKPNGITSRQYKLEADRKYENAEYVAALELYTKAIKLQPMDHQSNAKFLYGNRSA
                     AHYMAQRYNECIEDCLEVVRLDPSSVKMLSRAARSACTMGNLKRAMEIMESTPRDSLT
                     SDMEAELARYKSGLEAYRHAERCFGTPEGDEQYRMLVAQFSDTVPFRVRSAESLREQR
                     HYMRAVEVLEALSYSTRTPAACRIMSECLYLSGFEYFERARKCIVDAAQLDDACNELL
                     KKIDAVDDGKQKGNSNFNKKNYGPAAEYYTVAIQAAADNDQVLRVLYCNRAAAYKELG
                     RYREGVEDCTKTLQIDKEFYKAYARRARCHEHLGDHFAAVRDFKKAIEYDSTDRELAR
                     ELRAAEQNLAKEAEKERDFYFQLGVSRTATEREIKLKYRELSLRWHPDKCIGLDEVER
                     ERAEHKFKIISEAYATLVDAGKRREYDAKQDRERFTRAGGFNFSSTYSGGNANDYYRG
                     RHRAGGNGFW"
     gene            complement(<1075067..>1075633)
                     /locus_tag="LMJF_34_2440"
                     /db_xref="GeneID:5655011"
     mRNA            complement(<1075067..>1075633)
                     /locus_tag="LMJF_34_2440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686290.1"
                     /db_xref="GeneID:5655011"
     CDS             complement(1075067..1075633)
                     /locus_tag="LMJF_34_2440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686342.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655011"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2V6"
                     /translation="MSFQIEKQPARNFAFATPGESYLILASSASLRKHLTDSYWCEAM
                     EQVCAGKLEGVAVRYTGDNLVMVQFCPTNLSPAGYRYPLFMSIPIEFLVPLAESIFNI
                     PPTSDLQGSFGTATTGSFHSRSSSEGRSTSNGATMPRLCVVCGRFNVPGMIHRLHGWK
                     CKECKGTKSDNRLRQEAQKLRKRMRAHA"
     gene            complement(<1077615..>1083233)
                     /locus_tag="LMJF_34_2450"
                     /db_xref="GeneID:5655012"
     mRNA            complement(<1077615..>1083233)
                     /locus_tag="LMJF_34_2450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686291.1"
                     /db_xref="GeneID:5655012"
     CDS             complement(1077615..1083233)
                     /locus_tag="LMJF_34_2450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686343.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655012"
                     /db_xref="GOA:Q4Q2V5"
                     /db_xref="InterPro:IPR000904"
                     /db_xref="InterPro:IPR023394"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2V5"
                     /translation="MASLCASACDLHAVLSDSGETDRQMVLIHVDNTLLAMRTSNRLN
                     YRSGPLKEKEASEYAAAQELLDLQRCLFAGAVPASDRASSSSSVHPTPQGKSNPACAF
                     TTEALPDLVPFFLQDSCAKHAEVSEVAILSAFANVCRSPNTSAVVTGVALTALVDILD
                     LPCAFVSMYGVYAAIEAASETRAEVHDSASHEVLLSRIFSVYVAALNHPAAVMADGGV
                     HVRALGRMMVLATHPEASQLLKRTVEKSMRLIVMTLFRRLLHLPADEDARGALVAAGV
                     TVLRFISRLISGEIACFDSDGREVASTVAFGGSEGLAGTSASGGSGDDKTSPWENTIT
                     LIQLEGLALAQDCLLLLRCSLSKPLFAPLLDTVQNQLCRALLIAGVGATRTIVLAQVL
                     RTVHLVMQGFSEHLIPQIYNFIRVLHLNPLEALANELADAGAAQPRSPVGHSGSPVAS
                     RSPASPVSAASTGHGNSGRLSVQQLQRKQEWRDILLESLAEFCSDPRFGSFCFIHYDL
                     SWRYASLLPQLCQVLASHAYPVFHGDSEEVATAAGSQRRGGMAGDRKAAAQRRQRAAA
                     AVDYRRDRRQRSMAARRLPRSTQRTALDATTNMVSGIAIRAIASGTLPSRAAESDTTM
                     GAGSPSTSLAELHRLIQHAQKEKDKLSHFASLFEDSPMKKGIPFLLEHAIRVPAGTEE
                     ASSLKHCTKLVLAEPAGGRELGAALYRLSIVLNKRVLGDYIGEQGRNKPENVATAEDA
                     TVPAALFSVRFFEEQLNGFIHQFEFRNKRLLESIREMVFLLCLPGESQKIDRVMESFA
                     KHWYQQNVAYREDGTVIKDETVNPFHSDSGAFVLSFAIIMLNTDQHSGKVAQQMKRED
                     FVKMNRGIDDGKDIPAAYLGSIYDDVRQHEVVMAEMMDRGFANDTTWRLEMQPCLSFV
                     HHALSAAAEAEKAEAVKAPANIPSHELGAATAAATAGSTVATTRIRDPESGVLQIVDL
                     FLFQSLWKRSLLVFDGMLSSAVDEVSLSIVATGDTIARAIEEAEQQLPTEMAILQSSL
                     RGVCLLVRAAHALPLPVVADQCFMGLLKYVVMSDLTNPEEEVRALYRSVPKLLCMREV
                     FALLVDIHSSLEDSWLPLSRLILDMQFLGLFVEPAQEAARCRPQPRGAGDGDAEASVS
                     RAAQRSVSAPTEPLHVLLQDPGICANVFAPLSAAPAAGDVAAEQKAASERGWFSSLFG
                     GSGAPQVSAVQLSELRDALGRIVSCIPNMRRLLMILQRVSTDPNAAQRCLCSLSAVSS
                     IEEDVAGSGGNDVSSASTEGEGKKENGHPSGLDEASAYAASYELAFICAVVGGAATTA
                     VLQPAHFASFTTRVSRLLREVDVYLRDTRASDGVRAYWCTLGNRVVCASLQLMAVHWR
                     GQHGAVAMEQLWACWMRAAPSTFAIVVARPVAAFLYDQVVALGEAESGSGSGEERDAM
                     QPWASGSEVLVLLAPFAVHAAAVSDVVVQRQIGSLLLHVVQQRRYSVLDDTESIVSLC
                     LLFSVWTRHGRAAGSSTAVGDKPESNEAAFTKAKCGAVATTSLPSGASMAEVLGLCGR
                     NVLLDNAGAAAGGAGAKRGEWCSLWVFVLRSLAALALCSTDARDGSEAILCLQRALLD
                     SEAHDLPSSAVMAVYEDILIPLTERLCAPKARLQTGLQWTGARKAASGENSVAAASFS
                     QSVLGSLFNSLVSPASPERNGHGESMAYVGGASALSRRSAPPTLVFTEVKCRLLSLVP
                     KVLLRYTAALTTQPDLLLSLWRRVLGTFYAVYSAYPVIEDAAGRDMSGGSTFHDDAML
                     VQEAVEETVKNMIYVVASTWHGSSPSTVGGVTGTQQEHAAAFWAAIVGFLQPFAFSAP
                     LVDFMVQAGLVRVEACAEAATAPDTAAPAG"
     gene            complement(<1088264..>1090891)
                     /locus_tag="LMJF_34_2460"
                     /db_xref="GeneID:5655013"
     mRNA            complement(<1088264..>1090891)
                     /locus_tag="LMJF_34_2460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686292.1"
                     /db_xref="GeneID:5655013"
     CDS             complement(1088264..1090891)
                     /locus_tag="LMJF_34_2460"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686344.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655013"
                     /db_xref="GOA:Q4Q2V4"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2V4"
                     /translation="MLQQEAFRIHRKSSDATASVGTGYQDDAVATNTPSCTSTSHLVP
                     PSSLLAPNGCSSTTAVGAGEVAAVSSILSPPTSSSAHGEQMPSLHTLVQETHAETKSQ
                     QQILAERAHASFRHDRRLQRGQMDPRQTDALASSTPHSPPPWTGSPAWVALPESVVAH
                     SEETAPPSLLLDGADEGDCVSTRPTAWMCSSFSVMNSTPPQLLPPSAASKTSSATPDG
                     RVGWLAYQSLTAEDDEGDVEYKWRLTGISPSRFQHLVTQMQFRVSEGHGQCLYELGVS
                     DDGTPRGLTRRDFNESVQTINRMAAQLQLEATLLQCCVVRKTAATPARGSVSSPYDKL
                     KFTAAESAGRDGEQHEPCLSKENEEELLCGEIMLSRRQAGNGGHDLSVAFCGAVGSGK
                     STLMAVLLTSRLDDGCGGTRQSLFNHKHELDTGRTSSLASRIWTVKQEPADTSPEPTR
                     SVSAAQLPSPRDSPAAALRGSACSWSCASSPAAPLPPSTLPFMGASPRSITLLDAGGD
                     ITKTMLFCLMSRKPDYVCVCVAADTADVSDVSLYAEVCCAMNTPLVVVVTKSDLVEEF
                     ELDGLIMELAIALEVVGCESEQVDSTLMAAAYCRAWLPRHRDSAVEGGVGTTTPISTP
                     NTTAGPPRVERLRVPVFCVSSVQGGEGLELFRYCLSHLQRPPPSPLLSPSSWASKPPF
                     EVLLDYAFVVDGVGHVVHGRVARGAVEVGCSCYIGPGSDGRFYAVLVRGIHVDGEHVN
                     EAQVGDEATFALNRLPDAVTVSQKGKVLVRQPETAVWSFQAAVSVLSQSISAHMEPIM
                     YTRNARQAACVTSVTSPGSEEESDAAAATGLRASVLVQCRFLFRPEVVSAGDAVVLHW
                     APRGIAVGRITSVKAPVKL"
     gene            complement(<1092586..>1093020)
                     /locus_tag="LMJF_34_2470"
                     /db_xref="GeneID:5655014"
     mRNA            complement(<1092586..>1093020)
                     /locus_tag="LMJF_34_2470"
                     /product="putative ribosomal protein l35a"
                     /transcript_id="XM_001686293.1"
                     /db_xref="GeneID:5655014"
     CDS             complement(1092586..1093020)
                     /locus_tag="LMJF_34_2470"
                     /codon_start=1
                     /product="putative ribosomal protein l35a"
                     /protein_id="XP_001686345.1"
                     /db_xref="GeneID:5655014"
                     /db_xref="GOA:Q4QHL3"
                     /db_xref="InterPro:IPR001780"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="UniProtKB/TrEMBL:Q4QHL3"
                     /translation="MTTSKVHSQRSKKLHQLSAKTSRVNRNRKAPRLYMKGTLAGYTR
                     GLHGQTKQTALVRVENVNTREDATWYVGKRVCYVYHGKKVKRCVRWSKAPARRSTTRA
                     LWGRVTRPHGNAGMMRVKFNGASVPASAIGRRIRVYLYPSQI"
     gene            complement(<1094064..>1094480)
                     /locus_tag="LMJF_34_2473"
                     /db_xref="GeneID:5655015"
     mRNA            complement(<1094064..>1094480)
                     /locus_tag="LMJF_34_2473"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686294.1"
                     /db_xref="GeneID:5655015"
     CDS             complement(1094064..1094480)
                     /locus_tag="LMJF_34_2473"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686346.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2473"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2473"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655015"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2V2"
                     /translation="MGFRTRSCMVFCYLNGVCAVFISYLFKIGIDSMAITSVINKWDR
                     QEKARACRNAGILYLILAVAVTVKDVIDTCRERRLSRGVGQRMAEYGVADAPAGVEET
                     APLLECSAYVHGEGTRRQSVAGRGGSGGGGYGGAFY"
     gene            complement(<1096998..>1098131)
                     /locus_tag="LMJF_34_2476"
                     /db_xref="GeneID:5655016"
     mRNA            complement(<1096998..>1098131)
                     /locus_tag="LMJF_34_2476"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686295.1"
                     /db_xref="GeneID:5655016"
     CDS             complement(1096998..1098131)
                     /locus_tag="LMJF_34_2476"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686347.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2476"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2476"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655016"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2V1"
                     /translation="MLRESASSSQGGDGGGGRLMGETAFSRSALLPAWVPPEASTLHQ
                     RSASLTPQLNSKACSPLLGVRRSNASKMAGHRGDGLRRAGASASPQPLVGNPRFGLSP
                     PRASTALNMPSPPLSSMHYSPQVPPAQYSGLSIAPTIASFTSSSSSHPPTAARLLMSA
                     AASPSPSRRSVRLTLGAFCMLNAGIAFLFTWMMCTQQTGFALTAAKRRWNLKERSSAT
                     CTAGVYYLIIGLVLLIDRLSSTIAVVVQLGVRFVRAGFRLILRWLLWCVSRIAASRVC
                     VPLLRRLAPHVAIASAENCRVLMRSKSARPLRSSSVAVPAVGAPTALSGHVLLPRFSC
                     SQLGTSFQCSQTNSMRESMADSEADRRPCSATAASLSIRRRGS"
     gene            complement(<1100381..>1101466)
                     /locus_tag="LMJF_34_2479"
                     /db_xref="GeneID:5655017"
     mRNA            complement(<1100381..>1101466)
                     /locus_tag="LMJF_34_2479"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686296.1"
                     /db_xref="GeneID:5655017"
     CDS             complement(1100381..1101466)
                     /locus_tag="LMJF_34_2479"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686348.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2479"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2479"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655017"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2V0"
                     /translation="MRFRVQACFDTAAHELILSSEASENSALLIADDCSVELRVAPVS
                     SGTAGAAGVSPTTHALTALPWDSSRMRLGVNGISYGTGPLVLRDGDELTLHPNHVAET
                     TTSYTYNVKGVPTSADVAGNEMEDEPPLETRASASEEKHRLRVIISNMEQYAKWNNFY
                     SERFTNLAMIGVPPSNGTCTTGQLRKCACGSYVQTEVSTPGAMPCSTHAPIAGQTPLV
                     RDADADVSKALPTAPRAPLPAMCCCCPFTSASSNAALRLSTKNPSYTSAFAPPFSIGE
                     NSDAQQVCETGPSLCVGMRQTSWSVYAQARRNDCVAAPQASNAKKAVDARDSDDFLGG
                     ASLGRPAVELLNRISALEGALMGLRYE"
     gene            complement(<1103036..>1106245)
                     /locus_tag="LMJF_34_2480"
                     /db_xref="GeneID:5655018"
     mRNA            complement(<1103036..>1106245)
                     /locus_tag="LMJF_34_2480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686297.1"
                     /db_xref="GeneID:5655018"
     CDS             complement(1103036..1106245)
                     /locus_tag="LMJF_34_2480"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686349.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655018"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2U9"
                     /translation="MTQQDGGPGPSSAVSLNGDVSDVTHSTAYVVLNELVDEGLISEE
                     RADYLKRKFKELHSRVLAIYRRDNTLLKHARQLRSRLEVERQRIYTFCDAAKKDDEVI
                     QALKRNLMEHERDLAAALERDSVLQVEVLEYDRRKQHLILEREDAIAAEEARIRPKME
                     SMQAEITEMGTHIKELAADLAKCQAEKEELVKEEAQKEEEIANFATTLAQARQQLQNV
                     QNDPERAKKQLDLVQGSLAGAQRELSSTEEKVSALAERIQSMELQRNSRAEDHEAAKK
                     RLQTLRAEMDAKRKTLATMNTSLEVEVETRQATQERVAELDQLVLTTKIALQQEQDGV
                     DRIEREREKCMRIFSALERDTEGSRREEESLREQIGLLHRELEQVTRATAHVEKEIQA
                     HRKDAEVRTKKLLVEQAKSKEFVKKAEQVLAEIREAEETIAVKAKQEDVKRRELAAIA
                     VKRQEFSRASAREETRVSLAQCELQMREVLVKEAQRRHSELERRLGKAIDLFQRVKQE
                     RAQKATQIQAIAQAMAQVAEKTKLLEKELSVLMRESALKDQEMAKAKFQLHELTHLCA
                     NLRLEKNRQRKQMEKAADSEREVKAQVRRLNTDIAATEDTMADLRRTYAAAVENRNQA
                     GIQLIDRNDETALLAARIKAQEAAIVEGTRMTNDRANEVRTLKTKLGTLLHDIEACQH
                     SIPKVSQMELELTRVREEIEAEQWRTQVLEDDITDPKNPHRWNRVPLVLPGSVALPAV
                     SEAQATAAAAAMCTQADSAPAALNASSSPGDAGHADKSGGGARAAPAPALVGGPSEQY
                     VCLQARCQELEARLQKLNAKLREKNLILEEVTELAERVGDQADAGKECTLALAQQVNK
                     YHSSIRNKSRQMMATVAELSLFQASSIQLQQEVQRLESVVEEAEERLEAGEAPYAEAG
                     LHYERERQCQQRYVAARQRQRDAAKESEASLGMQMIATTAVPRPNAYVPQDDDLGLPR
                     PYGPFAPFKSASAPRVALNPPRAEASLPSGAQGPSPAPRSMAAVRGSSVPLSAPSSPP
                     GTSAGVLSKACGPSTPPPLPSATTMNATAFSSSVPKRRQ"
     gene            complement(<1107278..>1108357)
                     /locus_tag="LMJF_34_2485"
                     /db_xref="GeneID:5655019"
     mRNA            complement(<1107278..>1108357)
                     /locus_tag="LMJF_34_2485"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686298.1"
                     /db_xref="GeneID:5655019"
     CDS             complement(1107278..1108357)
                     /locus_tag="LMJF_34_2485"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686350.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2485"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2485"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655019"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2U8"
                     /translation="MPGSLKVQTGRGDARKTVKKTVLSKGNITRSDEPAGVADSAASA
                     SVAKSSSTTASTLTIAVALSMCEQERAVEAVKETIPASASREVLRKDPIYRIMHALPR
                     SDVLEVVRSRFEKPHCERAAAYFDLSYMKNPLRHLRLQLGCDGPTGIYLFFRRIAAHR
                     HTLRVVDFSRNRLSADDAVLICNTLGLGVAGDVATAPGTTKASSAGAVADSTVSTAVG
                     ASAQPASSLELLDLSYNAKLGNDGAVHVVRAVRRLPSIRAVILKSVGIDDAGAVAMAD
                     VVRRWPAPALCANSAAPHALLRPVTASATKFYLNLNENYIGARGTDVLGKGLPHYVSL
                     TLAKQQPDPARDRKRSRDDDGAACR"
     gene            complement(<1109260..>1110870)
                     /locus_tag="LMJF_34_2490"
                     /db_xref="GeneID:5655020"
     mRNA            complement(<1109260..>1110870)
                     /locus_tag="LMJF_34_2490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686299.1"
                     /db_xref="GeneID:5655020"
     CDS             complement(1109260..1110870)
                     /locus_tag="LMJF_34_2490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686351.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655020"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2U7"
                     /translation="MPGFADSFNGVAVGSSTMLTRGTHSSQDAVHHTDTATAAEWRAL
                     YGASADMMNSTAHTYRACGAGVSYMTPIFHLTANDVTILSMEHNNHCRLLGIATSKNQ
                     IFVTWTQVMPVIENMGMLRAPDDDLFGGEQATPVDERLLEWDPATMSILIDELPYTCT
                     ELSWAPWQQGIYLAGLCPGHGIRLYRYSHGNWALDDCIRSTESVSCSISTNFTVACAC
                     RRGRVELWVRGSTASGTAVAPGPSPSLSAGDSTATNGGDGVSHTSWVLCRVLTLPFSE
                     DDNGGSRTHDGDRSGGAGSPSAVAARHRRRDILGVAWVESGALLAAGDQGGSVYVVAA
                     TQDSTRLGEVVYHQLPSALCGPCKQVAWSPSSGRSFLCLAMVFTTCVRLVLFRRPSFM
                     NAAGLPHAARSVGGSGGGRMGWAHSSVAPIAASSLEVLAMTQVPCEEVAKLSWNNTGT
                     RFVTAHLDSSVNIWAVDFRYRHPVKGDGANATSGREEANTLHSVDSARMDRQVETSVF
                     AAAGEERLGIVVSVQCTSAVHPYHAVSK"
     gene            complement(<1120249..>1121424)
                     /locus_tag="LMJF_34_2500"
                     /db_xref="GeneID:5655021"
     mRNA            complement(<1120249..>1121424)
                     /locus_tag="LMJF_34_2500"
                     /product="protein phosphatase 2C-like protein"
                     /transcript_id="XM_001686300.1"
                     /db_xref="GeneID:5655021"
     CDS             complement(1120249..1121424)
                     /locus_tag="LMJF_34_2500"
                     /EC_number="3.1.3.16"
                     /codon_start=1
                     /product="protein phosphatase 2C-like protein"
                     /protein_id="XP_001686352.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655021"
                     /db_xref="GOA:Q4Q2U6"
                     /db_xref="InterPro:IPR000222"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2U6"
                     /translation="MSLRPVHRSVATVLAVDMTHDSRTPQGKSRVSGGSSCFPSGYLN
                     NESFDLNSETDHVSANSSTCHPAESYHLLLPRELQTPAQHFTTPEIPEISSHSPLCSA
                     LFSSVTEMQHQSVLEVGVASDQGIRSSMEDEHVTVVEPEVCFFGIYDGHGGRQCAEYV
                     RARLHEITLAHECLKTDPRKAISDAFAQVEREFLGQNTNDMSSAGCVCAAAVVQGSVL
                     TVGNVGDCEVVLARAGQPVLLTVKHNPSCNDAEATRVKKAGGCIFNCRVGHPRFNPRM
                     CSLAVSRAVGDAGFKLEEYTNGKPSGIIAVADTSEVLLAKDDEFLILACDGLWDTMSY
                     AEAVELATAYMASGADANSVADQLVGEALRRGTRDNVTAIFVRLGGSAQAGLGDANK"
     gene            complement(<1125466..>1126821)
                     /locus_tag="LMJF_34_2510"
                     /db_xref="GeneID:5655022"
     mRNA            complement(<1125466..>1126821)
                     /locus_tag="LMJF_34_2510"
                     /product="protein phosphatase 2C-like protein"
                     /transcript_id="XM_001686301.2"
                     /db_xref="GeneID:5655022"
     CDS             complement(1125466..1126821)
                     /locus_tag="LMJF_34_2510"
                     /EC_number="3.1.3.16"
                     /codon_start=1
                     /product="protein phosphatase 2C-like protein"
                     /protein_id="XP_001686353.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655022"
                     /db_xref="GOA:Q4Q2U5"
                     /db_xref="InterPro:IPR000222"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2U5"
                     /translation="MPAEKKSDATATRKPDSPHSPKSPASAGATTAFASAKKKSILRP
                     KQKPPTVPVNKSSSTSSSTSVGKHPNFLSPLPASSPTRPRDSAKTGIHPQASPHSPGV
                     EDASAPQPACDGSHGKGHQANHVVVPSNASSAAPSRQNSTTLHPLCRHSSLRKTAFVV
                     VDYGATAEQGTRKTMEDQHTMLSEGIPFFGVYDGHGGTQCAEYLRDQLHGLILGHPEV
                     KTNPEKAIVDGIVEADRAFLARSEAETNESGSVCAVALIIDDKLVVGNVGDAEVVLSH
                     NAKPVVLTVRHNIASNPSEEERIRSVGGKVCHNRVGHPNYNPAVVSLAVTRAIGDAGF
                     KLAKYTDGKPSGVIAVPETSVTRLTDEDEFLVIGCDGLWDVMTYAEVVDFCSQRLREG
                     VPAQCIAEELAQAALTKGSTDNVTAMLVHLTRREGPLSTREFVPEAAVSTSTRNLSEE
                     P"
     gene            complement(<1127943..>1128281)
                     /locus_tag="LMJF_34_2515"
                     /db_xref="GeneID:5655023"
     mRNA            complement(<1127943..>1128281)
                     /locus_tag="LMJF_34_2515"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686302.1"
                     /db_xref="GeneID:5655023"
     CDS             complement(1127943..1128281)
                     /locus_tag="LMJF_34_2515"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686354.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2515"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2515"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655023"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2U4"
                     /translation="MHTIVRFYHILLSLFASHLYFPALPSSPLRASVGVCVSVKPEWL
                     QPPLQLATALCLLPFPSRVHRLAKTRQSTVGVREGSSQQRERRRRSEGQEDAEISRRT
                     TKNKNVEVVL"
     gene            complement(<1129586..>1136836)
                     /locus_tag="LMJF_34_2520"
                     /db_xref="GeneID:5655024"
     mRNA            complement(<1129586..>1136836)
                     /locus_tag="LMJF_34_2520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686303.1"
                     /db_xref="GeneID:5655024"
     CDS             complement(1129586..1136836)
                     /locus_tag="LMJF_34_2520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686355.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655024"
                     /db_xref="GOA:Q4Q2U3"
                     /db_xref="InterPro:IPR000904"
                     /db_xref="InterPro:IPR015403"
                     /db_xref="InterPro:IPR023394"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2U3"
                     /translation="MEKGIEEILDACGRLLAEMKSDTRERTILSAVSKTLKRLAQESR
                     QHQDQLSTQSAPSQRANASLPVPSAATPSCSASAPQLSGAKPSPTGGERTEGAEVVST
                     TSRETAEATQSVAALLSAPSSSSTPVPATTTACSPLQRFLCNDEELSKLAYACRMAIM
                     GENGGLARNSVRILTAALEWAAVVLTSGVLPSELVAPVPTFAVPESTAKGAKVFFSKL
                     LGGRKRAPSPSGAGAPDAASSEITSVPADTVGLSQNVRDCLVDAVLAAVDTVQSKESC
                     DRLYFVMIVALKAAAAPRLSRKASTNIQPSAFQPLQLSVHDGRLVSVFRALLELCSRS
                     AGVSPILIDEAQKALHAITRALSEYVEQGVSDGDDGSDADGSSKDQTTASHSASSSSA
                     GPPLMPLPTAVTSISAGKPTGPSFTDPPLECTGTDDGETPDNAREPTAEKPPSTTSST
                     IAAAATPLVVPPVCGQAGTPTAAALTAASPPRRLRGVTDMLLLLELCGHIARLTPLSG
                     ISSILSGSVAAASASEYHRDAPVNCAGGDGAAPAAFRRASGNATEEGASPTSFSAASL
                     DEHMLVTALSFLLHSIVNGGPQFRKSPDIVQLLRQVVVPAAIRTSISADLDIFRLSIN
                     VLLSCCLRFGPQMVSETSTVFRHVYFRVLDSSFTSLEHKLLVLEAFGSYIEEPQLLLG
                     LFLNYDCNTHSQSFFEMMIHYLGALAMPPAQHVCNSNLFAELKRVLTVRLEYDVPEPL
                     RRKALVSLLQVSDSNIQWIERFECDQEEDGHAGTPSNGAACRDGATTDTAPHELAGCS
                     PFVHGLSEDGLRHGRTHALLCGFEVMGSPMSGSGSNGGLAAAAHVDAVLQARRYKDAF
                     KKFLDLFNEKATPDAAIEYLENSALILESADQAVSATPGPPAAIGAQFPMSDRAGVAA
                     IPTTATGTTNTSTSDGLRNDDAEAPSYSNAVSRRKQQVSGDGDVDAAAASPAPVEAAA
                     TSTAAITSDVDDAMLLSARKVAAFLRGKEDYLDKMVLGDYFAKCLRRPSSRVVFEEWI
                     GLHDFTGKTLDEALRLFLGGFKLLGEAQVVDKTMELFAAQYCRQNPGIFGSADTAFIL
                     SFSICMLNTDAHSPHIKNKMTKEGFLQNNRGIDEGNDIDPSILGGIYDRISGEEIVLR
                     SSPKCGTQSSVHASAAAAAGGSAGGRRSSKLTTNLLDSIPLLRHLSPIAAAITDKVLL
                     PMDAAGNALFNSARRKREEMYQQELRATLKEVMSALQEASTNDAAHHAMFVTATSIEN
                     ALPMWEVSVDVVCHIVVLALQQLLEDSEKYVRPQPFSSPSPPGSEREAGAEYEAVTAY
                     LEDTQSAGYFSTILLGLQNTVRVCCAFGNVSHTEKLLEHMFEMTRLTSVVVVKAVPSS
                     RVTIKSTIPFTRLQVLSTFFNLFVQCGSSFNARGWQAAYKAMSLVDALANGIEGMWQR
                     QARRLLDTTPVSKESSLVLPKPPDSATKPAASSASTVLDTSNNNTRSISAATTAPEQQ
                     QQQRADLWFGALDDVPASIVDRASRDNRKAILLGLRSVPTCQVDLWLDRLFDATQYPP
                     RVQLEMTSGLVKVCEMELQYTRTFSLTKLFDFVSICASFLSRLQWRELWAHASEVFTL
                     AGCRRSSEIALSSLDGLRLVALTYLMREELLNYSFQKEVLKPFELILMSNQNVACRQK
                     VMTILSEVIDFRAEHLASGWSVVFSCLSHAAAIPEVAPSAWSICEGVILRHISYVKDC
                     FSDLIFCLTTFACSGVEESMPLRAISYLVACGHWLQYGLEAPPLEVQTADAVTRWATR
                     YLTVEHELAASHMLGKHLSRVTLAAEPLTLDALLQKPMTFTSKTKYHLWMSLFEGMVP
                     IVVVHSSVRVRAHALSSIWALLAQYAGLFDAEVRSSLFSGMVRPMLTTLLTHVPGDAD
                     LVSPPMSGGYEFDRFDYRLLVYLALKGMLLACKDHAHLLELACKVLNELVESTNITMR
                     MLRNDYVDEVLRVCYDFVWAAPSLATMDALDSLPSVPDAPSSKDAVNYAERLYQWIPT
                     EVRQSNPFVAGLVHEIQQAGVVDVVHFKRTAGWVELHQTPAARKTPVQVSLSRLSATS
                     VQLASAIMLQIRSTIFGCLTHGLLGKLQRLLSTCEADRNVCLEVSGAMRHVLLGVSFY
                     FLVTRDARAVRFLKSVMATSHEHGMVGSHDVVSHTEPASPAAAAGAAASAGDGALQSR
                     CSSTAAVAASPAFIATSKNAVLETLLLIPYACVLIEFIAAFDLGEADDNVVRNDLWVY
                     VGRYLEELKRSRLACIELQQTVQAGVRAELEAAETTTTPSTPAKQVFKEYKGCRFTDI
                     FRSARYPIAARTLYLTAESDPSIRQRVFTEWCYLLRIYALKCTAILGSSSVVLQACPT
                     RNLIDVLRVIPSAFEEAAVSAYFNSCWEMDLHCSMPPEPCVELCTRILESRM"
     gene            complement(<1138812..>1151999)
                     /locus_tag="LMJF_34_2530"
                     /db_xref="GeneID:5655025"
     mRNA            complement(<1138812..>1151999)
                     /locus_tag="LMJF_34_2530"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686304.1"
                     /db_xref="GeneID:5655025"
     CDS             complement(1138812..1151999)
                     /locus_tag="LMJF_34_2530"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686356.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655025"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2U2"
                     /translation="MAHLPLEGSVVCYEFLDAEKKWLWGVGTVIRFDDRVCVISQWVG
                     APVDKAMAAKLESEAASSKAEAKTHQERLLAIRDRIESQSCGTLKEEKERTSEELSEC
                     LVLIGKHRNRSRSLLADLETITGPSTAQVKCQQFTPGSCSIAVLRSSILRVISQVTIP
                     SVLLSSEEVDSIEKAVTYTHSQLNGELHKLRSTVEATEIECSELRDQIRDLEEQLKRV
                     KTTSEPVRIPDGGGSGSTLTEKLKEHDPLSLRGAWDTSTALVMTKHTITFPWDDGDTL
                     LHHKPEETKSVFAAEAAFACCVPIQCVMNPKMAAHGKHLSAEFSVSHPETVTTKEIDQ
                     RLASYAFPSMYLLHEEPLGVKTGLDRAIEDLEHALGIPEGKHEGLYFDEFMENIPDTT
                     FSKDKDAYESEIGDLLMLLDKLNNENRSLQYTLDKSAAELKRQVSEAQKDHDALSTEV
                     TWLRNIVSKLKDLAEQQEQELEGNRVQKQRAEEARFHNNLAPLGHDAQDTEYAVTMEE
                     YKRQKEATDDARTALVEQKAKAEQMHHLLTEHEQECAQHANQLRSLQEAFAAENNQNA
                     ENLCTLESELIDVLLQLKASEALSKALRNINSQQQAELAAFRAKRNAALEARDATGTL
                     LVPSRPVPADEAAERALGPQQIADEPLYAVTLEEYLGKDAAVEQLAAELAEQKAEAER
                     VAEEVAAFRAKRNAALEARDAAGTLPVPSRPVPADEAAERALGPQQIADEPLYAVTLE
                     EYLGKDAAVEQLAAELAEQKAEAERVAEEVAAFRAKRNAALEARDATGTLPVPSRPVP
                     ADEAAERALGPQQIADEPLYAVTLEEYLGKDAAVEQLAAELAEQKAEAERVAEEVAAF
                     RAKRNAALEARDATGTLPVPSRPVPADEAAERALGPQQIADEPLYAVTLEEYLGKDAA
                     VEQLAAELAEQKAEAERVAEEVAAFRAKRNAALEARDATGTLLVPSRPVPADEAAERA
                     LGPQQIADEPLYAVTLEEYLGKDAAVEQLAAELAEQKAEAERVAEEVAAFRAKRNAAL
                     EARDATGTLLVPSRPVPADEAAERALGPQQIADEPLYAVTLEELEQAREDAARGVAAI
                     EDNAAALESELLDVLAELKAMKGQNDALKALCEMKDAALADLEKHDVRACNSDKAKPQ
                     TTSRHTKVFEGDEWGAVVETKPHALHDAFVTDVCAACRVGRDDLSEIAFALGSLQATV
                     SVMHDSDMSCDDIARLVEEYHYPNVWALYAKRLAPKNGLDEAKDTISQLQDALAAKAE
                     EAARVANKLEEQQAEAERVAEEVAAFRAKRNAALEARDAAGTLPVPSRPVPADEAAER
                     ALGPQQIADEPLYAVTLEEYLGKDAAVEQLAAELAEQKAEAERVAEEVAAFRAKRNAA
                     LEARDAAGTLPVPSRPVPADEAAERALGPQQIADEPLYAVTLEEYLGKDAAVEQLAAE
                     LAEQKAEAERVAEEVAAFRAKRNAALEARDATGTLPVPSRPVPADEAAERALGPQQIA
                     DEPLYAVTLEEYLGKDAAVEQLAAELAEQKAEAERVAEEVAAFRAKRNAALEARDAAG
                     TLPVPSRPVPADEAAERALGPQQIADEPLYAVTLEEYLGKDAAVEQLAAELAEQKAEA
                     ERVAEEVAAFRAKRNAALEARDATGTLPVPSRPVPADEAAERALGPQQIADEPLYAVT
                     LEEYLGKDAAVEQLAAELAEQKAEAERVAEEVAAFRAKRNAALEARDAAGTLPVPSRP
                     VPADEAAERALGPQQIADEPLYAVTLEEYLGKDAAVEQLAAELAEQKAEAERVAEEVA
                     AFRAKRNAALEARDAAGTLPVPSRPVPADEAAERALGPQQIADEPLYAVTLEEYLGKD
                     AAVEQLAAELAEQKAEAERVAEEVAAFRAKRNAALEARDATGTLPVPSRPVPADEAAE
                     RALGPQQIADEPLYAVTLEEYLGKDAAVEQLAAELAEQKAEAERVAEEVAAFRAKRNA
                     ALEARDAAGTLPVPSRPVPADEAAERALGPQQIADEPLYAVTLEEYLGKDAAVEQLAA
                     ELAEQKAEAERVAEEVAAFRAKRNAALEARDATGTLPVPSRPVPADEAAERALGPQQI
                     ADEPLYAVTLEEYLGKDAAVEQLAAELAEQKAEAERVAEEVAAFRAKRNAALEARDAA
                     GTLPVPSRPVPADEAAERALGPQQIADEPLYAVTLEEYLGKDAAVEQLAAELAEQKAE
                     AERVAEEVAAFRAKRNAALEARDAAGTLPVPSRPVPADEAAERALGPQQIADEPLYAV
                     TLEELEQAREDAARGVAAIEDNAAALESELLDVLAELKAMKGQNDALKALCEMKDAAL
                     ADLEKHDVRACNSDKAKPQTTSRHTKVFEGDEWGAVVETKPHALHDAFVTDVCAACRV
                     GRDDLSEIAFALGSLQATVSVMHDSDMSCDDIARLVEEYHYPNVWALYAKRLAPKNGL
                     DEAKDTISQLQDALAAKAEEAARVANKLEEQQAEAERVAEEVAAFRAKRNAALEARDA
                     AGTLPVPSRPVPADEAAERALGPQQIADEPLYAVTLEEYLGKDAAVEQLAAELAEQKA
                     EAERVAEEVAAFRAKRNAALEARDAAGTLPVPSRPVPADEAAERALGPQQIADEPLYA
                     VTLEEYLGKDAAVEQLAAELAEQKAEAERVAEEVAAFRAKRNAALEARDAAGTLPVPS
                     RPVPADEAAERALGPQQIADEPLYAVTLEEYLGKDAAVEQLAAELAEQKAEAERVAEE
                     VAAFRAKRNAALEARDATGTLLVPSRPVPADEAAERALGPQQIADEPLYAVTLEEYLG
                     KDAAVEQLAAELAEQKAEAERVAEEVAAFRAKRNAALEARDAAGTLPVPSRPVPADEA
                     AERALGPQQIADEPLYAVTLEELEQAREDAARGVAAIEDNAAALESELLDVLAELKAM
                     KGQNDALKALCEMKDAALADLEKHDVRACNSDKAKPQTTSRHTKVFEGDEWGAVVETK
                     PHALHDAFVTDVCAACRVGRDDLSEIAFALGSLQATVSVMHDSDMSCDDIARLVEEYH
                     YPNVWALYAKRLAPKNGLDEAKDTISQLQDALAAKAEEAARVANKLEEQQAEAERVAE
                     EVAAFRAKRNAALEARDAAGTLPVPSRPVPADEAAERALGPQQIADEPLYAVTLEEYL
                     GKDAAVEQLAAELAEQKAEAERVAEEVAAFRAKRNAALEARDATGTLLVPSRPVPADE
                     AAERALGPQQIADEPLYAVTLEEYLGKDAAVEQLAAELAEQKAEAERVAEEVAAFRAK
                     RNAALEARDATGTLLVPSRPVPADEAAERALGPQQIADEPLYAVTLEEYLGKDAAVEQ
                     LAAELAEQKAEAERVAEEVAAFRAKRNAALEARDATGTLLVPSRPVPADEAAERALGP
                     QQIADEPLYAVTLEEYLGKDAAVEQLAAELAEQKAEAERVAEEVAAFRAKRNAALEAR
                     DAAGTLPVPSRPVPADEAAERALGPQQIADEPLYAVTLEELEQAREDAARGVAAIEDN
                     AAALESELLDVLAELKAMKGQNDALKALCEMKDAALADLEKHDVRACNSDKAKPQTTS
                     QHTKVFEGDEWGAVVETKPHALHDAFVTDVCAACRVGRDDLSEIAFALGSLQATVSVM
                     HDSDMSCDDIARLVEEYHYPNVWALYAKRLAPKNGLDEAKDTISQLQDALAAKAEEAA
                     RVANKLEEQQAEAERVAEEVAAFRAKRNAALEARDAAGTLPVPSRPVPADEAAERALG
                     PQQIADEPLYAVTLEELDAVRSEAESRALEVEELGRQVCEKGYECGDLLEKLEDAVTL
                     LAEARNESEDVRGQLSEAARTSERALGAMEKDRAKVAAELSALRLMNDELVSEVRAFR
                     RRRLDAIACRAAEGGFSCEALTEKVEGVGVDAPVSAVIIEREPLFCVRLEELKEQRDL
                     NAQMVLELSALGERIRDAMDPDAVTDPSSEAVLSHLEALLKALEVSREAEQAWRELAE
                     ERERELEQLRKLFKNEEERLQNDLEEAREEVERLQCELDLLTDKLDEACRLFGDADAV
                     SAEGVAKLEAFAEVLAAARDTEKAAMEQLEAKESELEELRTALKDAKVWEEMRENLED
                     EVKQLQKEKEITETELGALQKEMNDLRYDLRAAEDRAAEKAREVERMTLDLDSLNNRI
                     QDLLEELEEKTDQYNQVIKDLDDFANNQSHETEKELLQRLAACEQELFELQEARRGEN
                     DEHEKQVGVLQDQINRLRNQTDQDNTLHNGLQDELARLRKLLLDAEAALRDKSAENEA
                     LKDDMENMIDEHEAQMREMEQELEGKGKEVSDALERLEEMSAMVQEAREGEESALRLR
                     ADSDAEVFRLQKELDKIKRLQSAMAESGDDKSSLFAQIIDTEGQLRDAVAIIRKKDAE
                     LDEVEKEWQKKLNKSEDLNHDLRRLLKRTMAALSKSKDTMGNSAGALDAFRDELKPMM
                     Q"
     gene            <1158257..>1160869
                     /locus_tag="LMJF_34_2540"
                     /db_xref="GeneID:5655026"
     mRNA            <1158257..>1160869
                     /locus_tag="LMJF_34_2540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686305.1"
                     /db_xref="GeneID:5655026"
     CDS             1158257..1160869
                     /locus_tag="LMJF_34_2540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686357.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655026"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2U1"
                     /translation="MSRIAPGDSVKLLKVQLSEKEFRIGELENRVKDLFNEAKELDEK
                     LRIANRNARVLEEENSNYHIRIKNFGKDGDALDIFPLQKEAMKLIQENEELRQSLTEA
                     ERRVREISGRERDSDHDAAKRIRELQSECEKMRKERLREYKELENTRHLCADLQKRLD
                     DDEETLKSAKELWDQERDRYQQKIDELLDFNKRAERPLVTRTARHRDGRADEPLEQFL
                     LKEEVAQLERTLKEVQHKNWEKEKTWVRTETELRHRINELQVSGSSESRNDNALFQAM
                     KDQVRALQDEIQALRSDRRGSRSAQGAPMSLMSTPSTVTPAVKSGAVEEWVARYESVS
                     KESDNLRDQADAAKAKILELENLVDEKVVACKEMELRLAAAQKQRATASQAPLVDRPS
                     SIRSTSERSYGSRATGAPHSRDDARAMIVMRQRVLDLEAELRTLRSAQEQKEAIRHAR
                     VKEYEKQIVELLRENANLRDASMDQADTEGGCTMMDFSDGVMRLTKDKRESVEEVMRL
                     LEFAWDSEDELNRQLRRVKYQNAAMAAQGAAKDDEIQRLQKSVSNLETKLRDMEKWAH
                     DNGGLKDAMGELRKQRRGLTDENDKLRKKIGDLEKVKEEVVQQHNAKQNDAKRRIEQL
                     QTEIDDLTHKLANARKAGSQPVSPRLSTRSPKPGTLSPRPSARRRTPEATALSHLSVR
                     STDELRRSAVPEGAHLAFTVVELTDMLRNGRPITEPGHVIIKLKSIKEKYKTSVKLLS
                     SVIRFDETFVFYLAQPDQDVITLHVFYRPHGGSREFHVGDACFSMATLYRGLPRQRIA
                     PVVQSPGTKEARRAAQVEVHLQTDDFGKTMMHTQEEVEEEKMRFIELVNKFEKGSPEM
                     LHAVDVYMASNELQ"
     gene            <1164214..>1166070
                     /locus_tag="LMJF_34_2550"
                     /db_xref="GeneID:5655027"
     mRNA            <1164214..>1166070
                     /locus_tag="LMJF_34_2550"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686306.1"
                     /db_xref="GeneID:5655027"
     CDS             1164214..1166070
                     /locus_tag="LMJF_34_2550"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686358.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655027"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2U0"
                     /translation="MNSITDRVIAYRLPQNGAGEEAYGLCLRREGNTLRVMLLQEENN
                     YERPLRSVLCKLSDVDAVVSELENRFQSLRSSRLEENDAARQKKCRLQKRMLQWAIRR
                     LEGVEEKEWALLSQQPRPSAMISAVGCTVSSIAAGKSLVSSTWADAQRLLRSGKEMVL
                     QLRQVGEQRMERSLYDSIEETYLSDSTLSYSSVSQESLSLGILHKWITAFMDYQRACY
                     MEGGSVELQQQLISCQSSLESARERRSSLAKQADLIKKGHCYSRTQTIHSVPIEYVLH
                     LMTSEKVTTRQYLLKERVHLESLEEALVKSLVGPQNAHGCRNEKKARMTTLSSPRVEH
                     SVAEARHTDRTPIGASTHPSPKAESARTGTWVSGRHVRRPHASTDDGGNMDGAESRCA
                     AMSSLTDSLREQTEKTHVVREVKGASRKNSGSPLSSGKAAVTRAMTTTTTATGAVAAS
                     FSSTTQADRETGESFPSREPSAPSASADAPHVLADVKNHFKNVQETLLACLEEYEQLE
                     EKYSNTVEQSKQLLQTLEERDDEIARLREDLSRAAQKQLLANRVISLLQRNQLGASSG
                     GRCNGPQNCSDEVRLQLTTSSACDAGTFAKHVEYLLDDTLDFVRGAAAAPVV"
     gene            <1171680..>1180766
                     /locus_tag="LMJF_34_2560"
                     /db_xref="GeneID:5655028"
     mRNA            <1171680..>1180766
                     /locus_tag="LMJF_34_2560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686307.1"
                     /db_xref="GeneID:5655028"
     CDS             1171680..1180766
                     /locus_tag="LMJF_34_2560"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686359.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655028"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2T9"
                     /translation="MIATETAGLQIRFQLVTWGDTQREITFRRRLEMCELQRLTRVYQ
                     SFVTTPMLHPPTDGENIQWPPRSLEDNSHLSEVVLASTANNHRSISEDRRQLVSELET
                     TLEDLQSMLFQKEQELQHLASQLEEERRCSEQNVADLQSQLITMRLDHACMDKELESI
                     SAALLDKQESCNVLRQLITESEERHRFDIQQAEQQYAVLEEERAHLIDYYKAQITSLS
                     DQLRKADNQQPAAQHTSDSAHSTYAPAQEDMENLNTHVSTYHEQNNKHPSLTLSTRGI
                     VDAVRSEYEARAAELVDSAELVEARDALAAAEQRCAALAAAQAEAAAALEAKSAASES
                     ELAAARDAMRAAEARLAEADAEHARVVAALEAKACAAEREAAAALEAKSAASESELAA
                     ARDAMRTAEARLAEADAEHARVVAALEAKSAASESELAAARDAMRAAEARLAEADAEH
                     ARVVAALEAKACAAEREAAAALEAKSAASESELAAARDAMRAAEARLAEADAEHARVV
                     AALEAKACAAEREAAAARAKEEAVVSCTRGIVDAVRSEYEARAAELVDSAELVEARDA
                     LAAAEQRCAALAAAQAEAAAALEAKSAASESELAAARDAMRAAEARLAEADAEHARVV
                     AALEAKSAASESELAAARDAMRAAEARLAEADAEHARVVAALEAKACAAEREAAAARA
                     KEEAVVSCTRGIVDAVRSEYEARAAELVDSAELVEARDALAAAEQRCAALAAAQAEAA
                     AALEAKSAASESELAAARDAMRTAEERLAEADAEHARVVAALEAKSAASESELAAARD
                     AIRAAEERLAEADAEHARVVAALEAKACAAEREAAAALEAKSAASESELAAARDAIRA
                     AEARLAEADAEHARVVAALEAKACAAEREAAAALEAKSAASESELAAARDAMRAAEAR
                     LAEADAEHARVVAALEAKACAAEREAAAARAKEEAVVSCTRGIVDAVRSEYEARAAEL
                     VDSAELVEARDALAAAEQRCAALAAAQAEAAAALEAKSAASESELAAARDAMRAAEER
                     LAEADAEHARVVAALEAKACAAEREAAAALEAKSAASESELAAARDAMRAAEARLAEA
                     DAEHARVVAALEAKACAAEREAAAARAKEEAVVSCTRGIVDAVRSEYEARAAELVDSA
                     ELVEARDALAAAEQRCAALAAAQAEAAAALEAKSAASESELAAARDAMRTAEERLAEA
                     DAEHARVVAALEAKSAASESELAAARDAIRAAEERLAEADAEHARVVAALEAKACAAE
                     REAAAALEAKSAASESELAAARDAMRAAEARLAEADAEHARVVAALEAKSAASESELA
                     AARDAIRAAEERLAEADAEHARVVAALEAKACAAEREAAAALEAKSAASESELAAARD
                     AMRAAEARLAEADAEHARVVAALEAKACAAEREAAAARAKEEAVVSCTRGIVDAVRSE
                     YEARAAELVDSAELVEARDALAAAEQRCAALAAAQAEAAAALEAKSAASESELAAARD
                     AMRAAEERLAEADAEHARVVAALEAKSAASESELAAARDAIRAAEERLAEADAEHARV
                     VAALEAKACAAEREAAAARAKEEAVVSCTRGIVDAVRSEYEARAAELVDSAELVEARD
                     ALAAAEQRCAALAAAQAEAAAALEAKSAASESELAAARDAIRAAEERLAEADAEHARV
                     VAALEAKACAAEREAAAARAKEEAVVSCTRGIVDAVRSEYEARAAELVDSAELVEARD
                     ALAAAEQRCAALAAAQAEAAAALEAKSAASESELAAARDAIRAAEARLAEADAEHARV
                     VAALEAKACAAEREAAAALEAKSAASESELAAARDAMRAAEARLAEADAEHARVVAAL
                     EAKACAAEREAAAARAKEEAVVSCTRGIVDAVRSEYEARAAELVDSAELVEARDALAA
                     AEQRCAALAAAQAEAAAALEAKSAASESELAAARDAMRTAEARLAEADAEHARVVAAL
                     EAKACAAEREAAAARAKEEAVVSCTRGIVDAVRSEYEARAAELVDSAELVEARDALAA
                     AEQRCAALAAAQAEAAAALEAKSAASESELAAARDAIRAAEARLAEADAEHARVVAAL
                     EAKACAAEREAAGALEAKSAASESELAAARDAMRAAEARLAEADAEHARVVAALEAKS
                     AASESELAAARDAMRAAEARLAEADAEHARVVAALEAKACAAEREAAAARAKEEAVVS
                     CTRGIVDAVRSEYEARAAELVDSAELVEARDALAAAEQRCAALAAAQAEAAAALEAKS
                     AASESELAAARDAIRAAEARLAEADAEHARVVAALEAKACAAEREAAAALEAKSAASE
                     SELAAARDAMRAAEARLAEADAEHARVVAALEAKACAAEREAAAARAKEEAVVSCTRG
                     IVDAVRSEYEARAAELVDSAELVEARDALAAAEQRCAALAAAHAEAAAALEAKSAASE
                     SELAAARDAIRAAEARLAEADAEHARVVAALEAKSAASESELAAARDAIRAAEERLAE
                     ADAEHARVVAALEAKACAAEREAAAALEAKSAASESELAAARDAIRAAEARLAEADAE
                     HARVVAALEAKACAAEREAAAALEAKSAASESELAAARDAMRAAEARLAEADAEHARV
                     VAALEAKACAAEREAAAARAKEEAVVSCTRGIVDAVRSEYEARAAELVDSAELVEARD
                     ALAAAEQRCAALAAAQAEAAAALEAKSAASESELAAARDAMRTAEERLAEADAEHARV
                     VAALEAKACAAEREAAAALEAKSAASESELAAARDAMRTAEERLAEADAEHARVVAAL
                     EAKACAAEREAAAALEAKSAASESELAAARDAMRTAEERLAEAGAEHARVVAALEAKA
                     CAAEREAAAALEAKSAAFESEVAAAGDPLCGGGEVCSENPLTSLVICESREYFVAGME
                     YGVEVLRQEFETRANKLVSCTRRIVGASTAVEAARRRCAEVNAELARANAGRFEEKEL
                     LRGEVVAAQSELIAMMERYREAEAAADEEDIEEEHPCEALFSALTRELKDAREKLKTM
                     QQLNRMLREKFRADLQAAERSTRFAS"
     gene            <1182517..>1183962
                     /locus_tag="LMJF_34_2570"
                     /db_xref="GeneID:5655029"
     mRNA            <1182517..>1183962
                     /locus_tag="LMJF_34_2570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686308.1"
                     /db_xref="GeneID:5655029"
     CDS             1182517..1183962
                     /locus_tag="LMJF_34_2570"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686360.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655029"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2T8"
                     /translation="MALAVPQEAITDVQFRLGSLYVTFHVTHDEDISQEEMAHRIEEY
                     PFREMWRLYNQRDGAPDGLDAALQRLKDLEMELKDKNRELDKERGDKEQKVNELKKQL
                     QALQEELAGPVAEREQSLLQQLGKEQGARKKAETQLKVVDDERKKLLEAVKQEKLRTE
                     KSAQRHNDLIAAIIQENKKEKEAKEREHNEQMEVKDYIIENLKSQLRTRTNGSASPRN
                     SIIDFDQTEEFNRLMERMEDMAAVLQRTQESENQARAQIQRLSDLLKESEEARQAESV
                     SYDNNVAALTQQIHSYRDTKIAEDHERRAKEDRQRGRGSVSEALKENATIVRQYTTSL
                     ENLIVSLQDRLHAISEEYNNYLTEAEAGVSHERQILAEQDEDSKKTRQTFRSSSIALQ
                     KIYWGSREPEAQEIIQNLDAAASNAEKSSAAVRVVIAMLDSKARAFGDHRNWMEQQQR
                     MMRELLTSLRDLNQRAFDRQRALMDERVSKA"
     gene            <1187377..>1187994
                     /locus_tag="LMJF_34_2580"
                     /db_xref="GeneID:5655030"
     mRNA            <1187377..>1187994
                     /locus_tag="LMJF_34_2580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686309.1"
                     /db_xref="GeneID:5655030"
     CDS             1187377..1187994
                     /locus_tag="LMJF_34_2580"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686361.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655030"
                     /db_xref="GOA:Q4Q2T7"
                     /db_xref="InterPro:IPR002775"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2T7"
                     /translation="MPPRPSRDEYRRVREGRENRDRPEGAENEVRVTATHGQHSYISY
                     VIAVLNGEDGKTRNDTVKISGMGGAIYNAVNIAEIVKRRIAGLHQITELGSELVRDEY
                     EPIDRTQNPENVVVERKVSTILITLSRNCLDKSNPGYQEPIADSEVTEQERRDPNMSR
                     RGGRGGIRGGRGGSRGGRGGSRGGRGGSRGGRGVAAIDRRDDREN"
     gene            <1193675..>1195081
                     /locus_tag="LMJF_34_2590"
                     /db_xref="GeneID:5655031"
     mRNA            <1193675..>1195081
                     /locus_tag="LMJF_34_2590"
                     /product="putative adaptor complex subunit medium chain 3"
                     /transcript_id="XM_001686310.1"
                     /db_xref="GeneID:5655031"
     CDS             1193675..1195081
                     /locus_tag="LMJF_34_2590"
                     /codon_start=1
                     /product="putative adaptor complex subunit medium chain 3"
                     /protein_id="XP_001686362.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655031"
                     /db_xref="GOA:Q4Q2T6"
                     /db_xref="InterPro:IPR001392"
                     /db_xref="InterPro:IPR008968"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR018240"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2T6"
                     /translation="MLSCIFLLNEHGEVMVELQFSEQIPRSMLEGFWATYMAPSKGGR
                     EAPAAIVAYGGTVFSHIHRNNVFLVGTHPSDDTALVVIEQLCLVARVLTTYLSEVTEN
                     TIRENFSTVYQLLQEMFDYGYPLTTELCSLEELVPRPTLENRVRTILDTPLVSKVMPV
                     GSRTAIGVGSRQASSFFGGVPWRDPETRHNTNEILFDVVESLDYVLDSEGRCVRAAVQ
                     GSIEVNCRLSGMPDVVLRLRDVDTVVDDVAFHRCVRLDRYEHDRTLCFIPPDGKFTLM
                     KYTCKSSLLMPLPPFYVTPQVTFNATGGRFHCMAGIRGGGAGFSSVAEKDKDVQRLSV
                     RLLLPPNTSSLTVTNCSSGTTVFDRSKATLTWSVGNLTHSATPSLGGEFLLEPEGGDS
                     SGERGHDNAAPSRSARATARAAGVGNATMAAVSFQLPNRIMSSLRVDSVQVLNEIGKP
                     YKGLKYLTQSGSYFIRGA"
     gene            <1196100..>1196369
                     /locus_tag="LMJF_34_2600"
                     /db_xref="GeneID:5655032"
     mRNA            <1196100..>1196369
                     /locus_tag="LMJF_34_2600"
                     /product="putative acyl-CoA binding protein"
                     /transcript_id="XM_001686311.1"
                     /db_xref="GeneID:5655032"
     CDS             1196100..1196369
                     /locus_tag="LMJF_34_2600"
                     /codon_start=1
                     /product="putative acyl-CoA binding protein"
                     /protein_id="XP_001686363.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655032"
                     /db_xref="GOA:Q4Q2T5"
                     /db_xref="InterPro:IPR000582"
                     /db_xref="InterPro:IPR014352"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2T5"
                     /translation="MSAEEFERYTKSVSDLRSNLSIPQKIEMYGLWCVATRGKCTLKQ
                     PSRANMVEYGKWAAWKKYEPLGQQKARELFIEKAKTIVAKYPSKL"
     gene            <1199873..>1201324
                     /locus_tag="LMJF_34_2610"
                     /db_xref="GeneID:5655033"
     mRNA            <1199873..>1201324
                     /locus_tag="LMJF_34_2610"
                     /product="putative ATP-dependent DNA helicase"
                     /transcript_id="XM_001686312.1"
                     /db_xref="GeneID:5655033"
     CDS             1199873..1201324
                     /locus_tag="LMJF_34_2610"
                     /EC_number="3.6.1.-"
                     /codon_start=1
                     /product="putative ATP-dependent DNA helicase"
                     /protein_id="XP_001686364.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655033"
                     /db_xref="GOA:Q4Q2T4"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010339"
                     /db_xref="InterPro:IPR027238"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2T4"
                     /translation="MAEGPIRTAEARDLTRVERVGAHSHIRGLGLDDTLEARVSSQGM
                     VGQMEARRAAGVVVQMVKKGKIAGRCVLLAGGPGSGKTAIAMAMAQALGPETPFTMIA
                     GSEIFSLEMSKTEALTQAFRRSIGVHIKEETEMIEGEVVEVTIDRPSTNPAEAHQRTG
                     QLVLKTSDMESTFDLGQKMIESLQKEKVQVGDVITIDKATGRISKLGRSFVHSKDFDA
                     MSANTRFVQTPEGELSKRKEVVHTVTLHEVDVINSRQQGFLALFAGDTGEIKPEVREQ
                     IDQRVAEWREEGKGEIVPGVLFIDEVHMLDIECFSWLNRALESPLAPVVIVASNRGIS
                     RIRGTQYKAPHGIPIDLLDRMMIITTNPYSQEELGKIINIRCEEEDVELTEDAFVLLT
                     TLGQKTSLRYVLQLITTANMVAQKRKSSTVSVDDIKKVYLLFIDLRRSVELLQEHEKD
                     FLFGEEDTHVENSTRVRVRDGQEDCGNEEETVR"
     gene            <1202471..>1204438
                     /locus_tag="LMJF_34_2620"
                     /db_xref="GeneID:5655034"
     mRNA            <1202471..>1204438
                     /locus_tag="LMJF_34_2620"
                     /product="putative RNA helicase"
                     /transcript_id="XM_001686313.1"
                     /db_xref="GeneID:5655034"
     CDS             1202471..1204438
                     /locus_tag="LMJF_34_2620"
                     /codon_start=1
                     /product="putative RNA helicase"
                     /protein_id="XP_001686365.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655034"
                     /db_xref="GOA:Q4Q2T3"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR022192"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2T3"
                     /translation="MSARQHQLHNVCDAIYRSGTAREALRQAVHEPSHESALRLLEEF
                     EKDPGVWRDEAWSTAFLTASSHLSSQMDLLLVRFTQWHTVRKAPTKVAMHKPWDWYPQ
                     ARLMRRRFIFHYGPTNSGKTHAALEALVRARSGVYCAPLKALAAQVWHRVKERVPCDL
                     LIGDERVFGGAAEHVSCTVEMTPVDLPVDVGVVDEIQMIADRDRGWAWTRALLGLPAR
                     EIHLCGEARALPLIQNLLYATHERKNLSTVEHKRLVPLAVSPSLRSRLRPETVENGDC
                     FVCFSKKQVLSLRDNLNRLPGVKSFAIYGAMPFQVREAEAARFNRGVTDYINASTSCS
                     ANAKNNTAGCSTTSPPGTRPRESSPETATPTKHVLVSTDAIAYGLNMNIERMVFTTLR
                     KFDGKGMVELPAATVQQIAGRSGRFGLTRQHAVGRCTVLHESDMAAFGAAMSAQPEPL
                     AKAGLLPTGDILQLFAELESAKSRKASTPTLDLSGGSFFELMSRFAASCAESQNFFPC
                     DIHRSLLRVAELLEPVRNLSLTDRIMFCYLPLSDMSAASLQLIVAYATDHAAGKPVPL
                     RFDVWCTELMQRAEREEACCVGAAPPHQREQQQQLSLSDLATELERCFRQAEMYCWLS
                     WRFGKTFVERERGLELKASITAALTRLNGSA"
     gene            <1205765..>1210240
                     /locus_tag="LMJF_34_2630"
                     /db_xref="GeneID:5655035"
     mRNA            <1205765..>1210240
                     /locus_tag="LMJF_34_2630"
                     /product="phospholipid-transporting ATPase-like protein"
                     /transcript_id="XM_001686314.1"
                     /db_xref="GeneID:5655035"
     CDS             1205765..1210240
                     /locus_tag="LMJF_34_2630"
                     /EC_number="3.6.3.1"
                     /codon_start=1
                     /product="phospholipid-transporting ATPase-like protein"
                     /protein_id="XP_001686366.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655035"
                     /db_xref="GOA:Q4Q2T2"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006539"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2T2"
                     /translation="MRKWVQQRLAKPAKDRSCEQRTVQLNDPHGRTNFCDNRIYSSRY
                     NIFTFLPLNLWEQLHRPINIYFVLVVALQFIPSVAPVSPLTTIFPITVAFLVNTVKEG
                     IDDLRRHRQDAEANERVYQRVRPGTLELEDVMSADIRVGDVLILHPFEVVPSDVVILL
                     TSHDSGSAYITTESLDGETGSKQRFAILHQLFKYSQAAASPVPSLSQCCGLTFGTTTA
                     PDSNAAGVHASAAKTTGKFTDAPVCDLRRCCDSAEDHQLHCLQYAFRSRLVLCSEGPN
                     AQLHSYHGVATVCAPRSSSQTWRESRPSTSSTCGAAGDAVKAGRAAPESLPGCRYGSF
                     PAPAVLPISADMARAGEADMGEAFPRHLPMPMTAPPPLRQHAARTPDSMDADSFPSIV
                     DERSGLLESGGPSQASAPPRQSSLEGQAGAYDYFDGPEQTLSVNIDNVVYSSSRIGNT
                     HFIVALVIFTGCETKMSMTRNVLPTKWATIDNRFNYLTMLIFLVQFILVSACASVSCL
                     HLKAHAPLWYLGGSVDPIKVSEYFPIMPLRYLMMLSPMVPLSFKVMVEISKAYVSYVI
                     RWDEDMRTEVESVSVNNSALAEELGQVEYVLSDKTGTLTANTMTFRALATVNDTVFSA
                     TTEDFIESDLHRPLAEVGKTIKATTARGQHEDYYLMLSMVFCNTIEPTLSPQFSANGS
                     VAYGARSTRNSGVSTNGNTSFSTRWMSSSPDEVALVEGAEQCGFSLRRRSRTHGTVGL
                     WGEAGASLEVEVVRTLPFSSDRGMMSVLVCCPAVAVKGAEAEARDTADGGSTFPPMNY
                     VLLIKGADEKVLPRCTDACSRSHLEDITNRLASFSREGLRTLVYGYRIVAEEEVKEAL
                     CRFTAVEASFASAVVCEAELQRIYALLEHDFTYCGITAVKDELQEGVPQTLAQLRHAN
                     IRVWMLTGDKTETAKQTAVACGLLTSTDRVITLTPPNEDLLAPTDHLAYVSEKLSEIK
                     GILAQEGPTVEMTMLTRWQKVRGWCRRFFWERSGLEDFVHEFTQPATCERIRPVDHPL
                     LTQPLSTVQARYGPVSPSVTDMVPRVCGSARREPGLHFASAFGACSDFDTCGLKRGYC
                     VTLSGKTLRLLEREDVMSHGHGAVVRLFQRCLLQARAVVCSRTAPSLKSYMVDMVRRS
                     GHITLAIGDGGNDVPMLQAAHIGVGVKGREGSQAKLASDFAIGQFRFLSKLILVHGHT
                     AYQRTAMIVQQSFWKTVLISWVQVLFNVSTDFSGVSYWDSLSLTLYNAIPTVPVTFLC
                     VMDMPLSHWLLCTTTQLYTMSQRGRYFNATTFYGYVARALLHGTMMYYLSVALQRGAG
                     AIMTNGWVLDRSGDFYAPYIAVVTVHTYTVWTESHAITIAHWFCFLFSIWTCFLSFWL
                     YARAPASPNETFSMLLRSPSFYLSYLGLLTAVCVSLAIYAIPKMLWFPDALQLERLLL
                     AYMRQTRAWHRGLPVHALRVFFQEDNPSQFWKSISLYHALRYSKPPRQNFTVAAD"
     gene            <1211347..>1215444
                     /locus_tag="LMJF_34_2640"
                     /db_xref="GeneID:5655036"
     mRNA            <1211347..>1215444
                     /locus_tag="LMJF_34_2640"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686315.1"
                     /db_xref="GeneID:5655036"
     CDS             1211347..1215444
                     /locus_tag="LMJF_34_2640"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686367.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655036"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2T1"
                     /translation="MCLRGCGTETKDQQASLPGEVLHITHFSGEASQTPACCTVGTLY
                     DTLAHAQGCSLTAPPSLEVFFVRLASFAPLFLCLTPTSHPGSAARQDSAEMLLEYCAG
                     MTASLYSTLHPFMRRLLRDVRVSWQPWLSSPKIARVIAAAAAGGSADGDWGYERSVPE
                     HVSPSSVCDSADSSLEALRCLPGDGGRSGTRAGKHRYVCTSQDAVTAENAWQPLLEHV
                     PPFFVATARVQASLRRAYSDAKALRLLDAWSSQSRLHATAPLDVVAHAECRNPSRLRC
                     KDSRCDGPYVEASPCGTAIRAPSPEQCLQAGCPAWLLYKPQHAPATLHEKYMLSHCVD
                     DCGPWLMHMALALVCAVVPSTSQPLSVVRQIFSDHQRQQCSLWQQERYSEKAIEAADG
                     LDIAPAAAHAACASFFPCVEVLLDHPQLAFAVQVTERSTGCVCARFPVPSEAGARTAA
                     PSNRLQELQVQLHPSFSHAQRGRADAALSVLEKTHRITVLAEVPRPQHKRDAPFDISH
                     VCAVRFHDARDGVLTESLEALLQLLEKELATTLAAGSVSDAEQAFFLGVSEVAGLGDE
                     APIRRDASTTVHGARYAPESPRLVLLLTAVHSDSRVMDVIAVEGRTLCSQLRRMRADD
                     ATTSGTDEEQVAATKDRLLPVLARVLQSPTLVKVLPSSAFVEDSLCGAHLLRQRGPSA
                     VRWLLDSLRSEALTSVCSLEHIAHYVGYPVDGVMPLTLTSEADSLLASTILSRYRSAI
                     DTTTTPQGSGSGGETRGSALEQSTSARVICGAATVSLAGSLLLQNHAQEHPLHMPHEE
                     RGKHNDGSATESTLGMTLLCALQRWAREPTLARQHGLALRLERFQRWLAHATAGNVDD
                     LIAHSRASSDAAARHLPMGFAAEQRCLGGREVTLRDLVSRFGPEPLPSPCWMRGRQTA
                     HSRKVKRGCCDAGVATVKDTGDQIVKAKRSDSEERPSLPFPAELSASEGHVDVDALVH
                     DALVREAAAVLQAVARHASPTKIADSDAATSTPLHNDAGLPLTPKEASTDAACSRLPS
                     PPCSPRSDACATSGAGAPVEEDSLQSYLSTLFDEADARPTATTSLQRPGPAAQSSALT
                     SSAQRPEGETTGADPVGAPNMVPSLRSTTAVSGATDLSTDHLPAAPASHPAACGFEGS
                     GRDDPPTAKAPVSSTLALPMGFLYGPASVITTSKSFAAPRLASAKSGAGELSHPLNFP
                     VSPGLYGSREAPRQGWPPPPNQSASIMESAKSAPSSRQSPSEVLTTYHPPSLDANFAP
                     VARFDRFAPWRQSAPSAPNPQDSPPSPPPQSPFSSPCAMPSTCQNESAQPPRPASLSS
                     ATPTGSSLQTFFSFDSKDAERLRLRSLLVDTLRGTTKRPPPSPRR"
     gene            <1216189..>1218015
                     /locus_tag="LMJF_34_2650"
                     /db_xref="GeneID:5655037"
     mRNA            <1216189..>1218015
                     /locus_tag="LMJF_34_2650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686316.1"
                     /db_xref="GeneID:5655037"
     CDS             1216189..1218015
                     /locus_tag="LMJF_34_2650"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686368.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655037"
                     /db_xref="GOA:Q4Q2T0"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR002550"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2T0"
                     /translation="MMLFSAGQSRMRLKLPFMSGRRAAATLSLLQLLLALVLALAAFQ
                     ATAAATVRGAKRTSTNDADDKMTVEESDENLDASGWVSLIVVDSILLLFAALFAGLTL
                     ALLGLDTLSLEIIADSGSEPDKTYAQKILPIRHLGNQLLCTLILGNVMVNTLIAQITD
                     SHIHGWVATVVSTALTTLGGEVIPQALMSAHALQVGSKSAPLVKFFVFIFWPVCKPLS
                     MILDKFIGKDPGQIYERNELKKLMFMHAARSAESGIGAGEVDLMVGAMELHEKTVMEV
                     MTPVSDMLMLEANERLSEETIQLISDRGHSRIPVYQTTKNNVIGVLFAKDLLMANPQE
                     NTKVLLLVKFYNRRCHVVPSETKLISMLKYFQTGKSHIALVQEVQQRPYGDPYYEVKG
                     LVTMEDIIEELIHSEIFDEYDIDPHEIQHTALGNASNLAKRQVGLTSKCSRRVHLNYN
                     ELRAAALFLCESLPELSMEDVSALMQGMIECTTVYRVRAPKDSRGMADDDKQNVWLYR
                     EGVPSSVFTLVVSGRVEVFAGKESIALEMGSWSLLATDALSSDLFVPTFSCRVIQDST
                     LMQITREAYAEMLHICNNPVSDTSRTASLAANAGRKASMESI"
     gene            <1220134..>1222866
                     /locus_tag="LMJF_34_2660"
                     /db_xref="GeneID:5655038"
     mRNA            <1220134..>1222866
                     /locus_tag="LMJF_34_2660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686317.1"
                     /db_xref="GeneID:5655038"
     CDS             1220134..1222866
                     /locus_tag="LMJF_34_2660"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686369.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655038"
                     /db_xref="InterPro:IPR007258"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2S9"
                     /translation="MSGGGSEAETAELVLYRLEEIDELLAAVNGDEDDSQAATLAQYL
                     RGGQDLESALSLQEERLRGFRDTFIQAHVSQAEKIAQLYHEFGACERHIVDFEEEIVA
                     FQRQLEGSANDIVHMQQQADALARKVSNRRQVSKKINEVYTALQKCDAFCDVISNKSV
                     DASYLANLRELNRRLEFLSGNKALQFSAVGNEIRPKLTAAAYKAGDKLQRFLTKKILA
                     LAEDPSRTVDEQQSLEESAQFAFRFLQLYNPPVAIDVTKLYIRYMSQSYVRQFRLLIA
                     QFSEVSAVHADPLEPLVSAEEARDITSNRDIGAPSGNQVNPALVNFPGRTLARRQRSV
                     SQHMRGFTGFMSSGAAVSRTESLRLLRAATFEDSVKAVNALRVRHGKLYVDDAVSEQL
                     DECNSWTWQFVRCFQTLVNTCESECRFIGNFFCVAGDVEGGEDFTSAERIARAVLGSA
                     VHSVETSIMDDLSIVMERTEVLAALRVLETVKQHLCTSLDPIPLLLLSGVLEMSKSAL
                     RNSLRTAFENDGLALAFLPTLKLSPFYRAAAENSSWAGILGNKPYCATLGPHPVVYRV
                     CGVLGQLEYLNTAAVRASAFTGGTGVAFDPSVATFVKKCLAHMMAFVDQLKRRHTSPL
                     AQQVFACTNVYTVMATWRELMSLSGDGEPSSSTGSRLASPEARNRSASGGHSHFDTGV
                     SELPKVSHAEPLAADGGAATSSISHHTQYLESQLQNAIQGWVSAEQKNGKSPWNYLHA
                     FVDEAAKALGEGFFGSASQPPSTTCAPNSTSAAPPPAPPPPPFVLPAELSECAALRVV
                     TQVHSQWQSQAKAVAEVVRKAVQQSLGRTVSNGSGDGTTAGCSAAATAVRQRQCDELS
                     TLVMSAIFSTLTESNRKLAVFVAHYYSGNRELLSKLVSNTMMLHVLSRLLESSS"
     gene            <1224464..>1226338
                     /locus_tag="LMJF_34_2670"
                     /db_xref="GeneID:5655039"
     mRNA            <1224464..>1226338
                     /locus_tag="LMJF_34_2670"
                     /product="NADPH-cytochrome p450 reductase-like protein"
                     /transcript_id="XM_001686318.1"
                     /db_xref="GeneID:5655039"
     CDS             1224464..1226338
                     /locus_tag="LMJF_34_2670"
                     /EC_number="1.6.2.4"
                     /codon_start=1
                     /product="NADPH-cytochrome p450 reductase-like protein"
                     /protein_id="XP_001686370.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655039"
                     /db_xref="GOA:Q4Q2S8"
                     /db_xref="InterPro:IPR001094"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR003097"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR023173"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2S8"
                     /translation="MTGLTILYGTQTGNAERLALRIARLALCQGFERVSCLPADDLPI
                     AEWPHTGGPVVLICSNANQGDAPNTLRRSWASLLQPTAAGSMEGLQYAVFGLGDSLYL
                     KFNHMAKMVHNRLRQLGGTPIVMRGLGDESDAKGVEEALQPWLAELWTALEKPGKCGA
                     AARTPAYPQEDLPFFPLFSIASASACDEATPGTPSSSANAAVVPLPYFDDSVFSCEVV
                     ANRRLTSAACEQVVHHLELRAGPDSTDAAAYEVGDALGIYCPNREELVERLLRRLQRD
                     GAEMVVVTPDSSHGLVRQPTRPFFGRPLSLHSLLRHYFDLDAVVSQEFLWMLAHGVTG
                     EDEVAVDVRERLYELADPSNVNDYLQYAHREKRNLCEVLHDFKDLHPSLELVLSFATP
                     MLPRYFSIASAPAMDGAGRFDLCVGLLDWHTPLKRHRTGLCSSYLVGAAPGTRLTCFV
                     WQGSLALPATPTPLLCIATGTGVAPIRSVLRQVAGLSTQGWADVPVVLVFGCRRETED
                     YLYREEWATLKEMGALPTLRVIPAFSRDTDKKVYVQHKLGQHARLTSSFLQPEGAGVP
                     PGVVYVCGNAKQMPKDVQHTLEQIVEATVAGVQDEAGAAAHIRALGRVGRYQVDSWSA
                     "
     gene            <1227331..>1228947
                     /locus_tag="LMJF_34_2680"
                     /db_xref="GeneID:5655040"
     mRNA            <1227331..>1228947
                     /locus_tag="LMJF_34_2680"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686319.1"
                     /db_xref="GeneID:5655040"
     CDS             1227331..1228947
                     /locus_tag="LMJF_34_2680"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686371.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655040"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2S7"
                     /translation="MADHSAASAASQGAASASQHQRILLQKQLTEVRMENAILRQQLY
                     QVSTLLDIAVSKLGTMGVSLETPIDIRALRTEALQRAHAETAQAQYNAIGASPESGKS
                     PAQHYNKKFQMRQQLREHTKAVQCCAFSDSEDLLIATGGMDCRLIVQNYLSGAKLWDA
                     TAHEEAVSDVAWMNHNCLLSASYDNTVKLWDVNGGTTNKDVLYQYTTHGFVLSAIPLG
                     PSLFACADSRHKTAIVDVRVGGKGMVQEHDYRINSLSYDEAAQQLLMGQSNGVVSIWD
                     MRRPDQALSTASSSIAGVLPGSSLPPLQHQRCGSMNMNGAVEGDATPMTTLEDGAAGG
                     TNTPGLNSGLMAGGSVSSVGGPPRFTCATEIENEPSRSPISFIAHFYSDDDTCRLLCV
                     SGDNMVRLYRGNFSAFTGGGRKDGIGLYVLRNVLAGVPTRGNVMRCGFWKGERDKTEM
                     SVFFDDGEMDGVARPPRRLTECDLLVTGGPDNTAQVCDVTDDGGAVVLERLEGHRDRV
                     TGATVRRSRKPIIATMSADSTVRIWMPVKS"
     gene            <1230194..>1231909
                     /locus_tag="LMJF_34_2690"
                     /db_xref="GeneID:5655041"
     mRNA            <1230194..>1231909
                     /locus_tag="LMJF_34_2690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686320.1"
                     /db_xref="GeneID:5655041"
     CDS             1230194..1231909
                     /locus_tag="LMJF_34_2690"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686372.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655041"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2S6"
                     /translation="MTSAREAHHSAPNILAFHQSHHDLIKGTFAPDLHGNLPRHLHSE
                     ILQTNPAPFRLPATGAPRSSPYRTPQWTELSECIREVSPLPFPDDDVRRVAGSRAEPH
                     SRSPSTTTSLPGYAVLRRLADLSQASDVDPAAVAAALREAERMLEVPTDAGANREYAR
                     RSGALIAESTTDEDRLPLSRVRATSSVASSASAGLRENVQSRCPRHNHEHRRHQRHHC
                     DGGRALSPADVTAASGLGAASRFHSSSSWGWPAPAPVLSGSPAPPRPAPTATTLPANN
                     HAGPHASSITAGVLDPTLRWYDVYYTWMLYYQQLYAAQVLQERQRQRAKRGERGKRES
                     HRSLQGRRAVSRAASSGPEASMGNQEDDTHCAHALRQPRAVARVERGGVPEGGVRSMS
                     KASVSMSAQPTRHHCPVSPPKPSTRSCAWQTPRVSGEKNTKGDDRAARLRAELRRLEE
                     EYAVLSSSLADVEDDGAQPPTCADGRIRHFAAASAAGATIARPQPAWSPAPAEPRAQR
                     GKWLGSRDHAGPTSHRGSAAPAETWQALSERQRNGTFHSMARVCTSRGRSQQSFSRQR
                     PQWRH"
     gene            <1232666..>1233433
                     /locus_tag="LMJF_34_2700"
                     /db_xref="GeneID:5655042"
     mRNA            <1232666..>1233433
                     /locus_tag="LMJF_34_2700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686321.1"
                     /db_xref="GeneID:5655042"
     CDS             1232666..1233433
                     /locus_tag="LMJF_34_2700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686373.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655042"
                     /db_xref="GOA:Q4Q2S5"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2S5"
                     /translation="MSNWADAAQDEEQYQAAYGSDDNDSYSEHEEPKPSWDTAKTEIT
                     FEVDADGNRFEVMRKVRSYHVDRPITMADIRAKLAHFGKGKGDQSTLVSAEPPLALEM
                     GSVDQFERESRAEVKRMIHEASGIDVAVKDEHLRVVREMEEKAKKDPRVVRSGAGSTW
                     GAIASKSTDNREQSTTGIRIRNLSDDITQENLSRIFEGRGWITKNVRIPRGDNNQTRG
                     FAFVIFEEAWMADAAIKEGKFHFKNVVLDVSRAETRT"
     gene            <1235664..>1236521
                     /locus_tag="LMJF_34_2710"
                     /db_xref="GeneID:5655043"
     mRNA            <1235664..>1236521
                     /locus_tag="LMJF_34_2710"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686322.1"
                     /db_xref="GeneID:5655043"
     CDS             1235664..1236521
                     /locus_tag="LMJF_34_2710"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686374.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655043"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2S4"
                     /translation="MRQEAKSSQPTPLGSARYPLRVTPTGPPPLDAPPPSAIRWVDDG
                     RRGREVHRGENESKASSLPRHHTDADEQDAAVMKPAASLRPLLSARTPSLQPTGMLRR
                     VIASVAYYRGVPPPPSVPPEVILAFDEYVSCGSVMLKFASRGPPHQRFFVIRFLDVVA
                     GSMRIGRGRAYYQGPSILHAVLSWYRNASSRRMIRFLPLHDLIEVKADGTDHRYVCRR
                     TVQPGILRGPRSGLVTKYVRADFIVQFRFCSRLSRAEETLALMAENRTQYLAWLVVGS
                     FISQIGENY"
     gene            <1238011..>1240065
                     /locus_tag="LMJF_34_2720"
                     /db_xref="GeneID:5655044"
     mRNA            <1238011..>1240065
                     /locus_tag="LMJF_34_2720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686323.1"
                     /db_xref="GeneID:5655044"
     CDS             1238011..1240065
                     /locus_tag="LMJF_34_2720"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686375.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655044"
                     /db_xref="GOA:Q4Q2S3"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2S3"
                     /translation="MEHQHEHRETKMQTTAANAVEAARHYTANLRAYLTIPPLSESMA
                     GVIILFVFMNSMATSIWMSNAWPPFVYLVFNNSNLAVGVVAGVNGFFELSCAIVSGHI
                     ADKVWGPSRTLIFAVRLGMAKLCIVALAIWLKHRWLLIVAQMFEGCYMGLSLTCVESV
                     FAQCLRTGERDRLYSLKFSVESVGPIVGLVSSLFLYLIVDTEWNVQVLQIVMTCGVVL
                     HLISMIIFSKLFVAPPSHLDQKRKAATATDVVLIDDVHSEGGGAPSAPVRTYDVEERR
                     AMDAAGHEGEIDEELSPSNLVQSDKTNTMDCARSFIAHPTNDNCSPPIVSNYGPSVCA
                     ARSTDVASLRNKQSTTAAGMEPYQQAASAGEGATSVAVGLDSGDNPASIIPTWQGGPS
                     SLVDIHNIPSGAHIEYVDHEYEEASACRRRVMDCLPLRIYPMTIVACDVVLVLGSGMI
                     TRYLPLFLMKDYNASLATICVLNLFNSVVIALMAIMNGFIGKRYGRIRAAMPPKVIGT
                     FLLLYMALAQKTRHSSKFWMYLAYVFRNALMNCTVGLSRALIMDLVPEHRHSRWNALE
                     SVQSAGWSGSAILGGLMADKFGYGAAFIFTFFFHLFSTSALVPFTVRNDARLPQPVLV
                     YDGLLSQTSEREKERGGILSPTQTPAPPPMATTRKVAMPELATENVRRIASCTLVNRD
                     AE"
     gene            <1241267..>1243498
                     /gene="GPI16"
                     /locus_tag="LMJF_34_2730"
                     /db_xref="GeneID:5655045"
     mRNA            <1241267..>1243498
                     /gene="GPI16"
                     /locus_tag="LMJF_34_2730"
                     /product="putative GPI transamidase"
                     /transcript_id="XM_001686324.1"
                     /db_xref="GeneID:5655045"
     CDS             1241267..1243498
                     /gene="GPI16"
                     /locus_tag="LMJF_34_2730"
                     /codon_start=1
                     /product="putative GPI transamidase"
                     /protein_id="XP_001686376.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655045"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2S2"
                     /translation="MTYGDMHLLERRPSASGVLLAFAVVVLTWVAAAEMAPSHPYAAN
                     TSRRYSMMVEELTGSLDERGTTPTLVSVAMEMSLTLPAKPGAAAVWEGDAEANEIDDA
                     AAQHLTFDEDFDPIWYYVLRRRGFERLDWCGCGGKWRPEWSIPKAHQRRGGDAAALSA
                     ENESNSVLFDRLRRLLAHHAVCTYSSVSFCGASHERGAASQFQWAAQFVSTLTSSPLS
                     WTSATPRHSRPNGIVIQRDSSRAGGGEDAYWCSYHLVYHDTLCTQHVSPLLNGGRSGR
                     GVQEGLPRGIFKAAFPSFVKYFGAPFQHFTVKATQERFPRNSAAAQPPTVRLKVEVRM
                     SMVVGEASDLEALSEVWSRELPAYARDDRLQVHIGPGGLSQQLRSALPTAAIVSSPKE
                     RQAKATPQRQASASASPSSRIGRSPEVLYEVRTHGKDHGYLTVNLQPALVLLDAHAGV
                     DAEKREGSDGADEESALQHSFLLREGDVVRTLLLFPLHLVRPSLYNMESLLGTTRIVH
                     AHADVVSNTLAVLLETTVTPVHIAAYEAAYAHARQCHEMAGGGGAGGRACRAHDGVLL
                     GRFQLFFGWSTLGEMPPDDNSNRLVPQPVVVIHRAMSPADLGAAEVSSQLDFCHVQRR
                     HAASVGSIPQIDHEDSLAAVFQLLNRSYAWPDGKRESLSAALATLKEDDACVYWVRST
                     VASGTTIPGPDSAMIFNVLSLGLFFLAVAAGMLTRLTRRLTCKREDLVNLLAQEGATT
                     VVK"
     gene            <1246288..>1246842
                     /locus_tag="LMJF_34_2740"
                     /db_xref="GeneID:5655046"
     mRNA            <1246288..>1246842
                     /locus_tag="LMJF_34_2740"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686325.1"
                     /db_xref="GeneID:5655046"
     CDS             1246288..1246842
                     /locus_tag="LMJF_34_2740"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686377.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655046"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2S1"
                     /translation="MMPLSAACVAYCSSSLDSHVFANPFTPGSTPYRNDPYSPCLLKS
                     SCTPEESFYACYSEVDETPAVLAVNPANTPIRSHVVGQKAALPTETQALLKLLSKATA
                     SSSPFMSPMATPLKTADSMEQSPASLIAGGGLTTAPSLSSTPERAASPSSRQPPATSA
                     RVIRKVVSCGVDRTSGRPVPKPKD"
     gene            <1260899..>1262182
                     /locus_tag="LMJF_34_2750"
                     /db_xref="GeneID:5655047"
     mRNA            <1260899..>1262182
                     /locus_tag="LMJF_34_2750"
                     /product="methyltransferase-like protein"
                     /transcript_id="XM_001686326.1"
                     /db_xref="GeneID:5655047"
     CDS             1260899..1262182
                     /locus_tag="LMJF_34_2750"
                     /EC_number="2.1.1.-"
                     /codon_start=1
                     /product="methyltransferase-like protein"
                     /protein_id="XP_001686378.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655047"
                     /db_xref="GOA:Q4Q2S0"
                     /db_xref="InterPro:IPR022238"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2S0"
                     /translation="MPAPRPELENPPEVFYNASEARRYTVSTRVRKIQRDMTLRALEL
                     LNLPKDDTAAATGVNCSALLLDIGSGSGLSGDVLTEQGHVWMGVDVSRDMLRIAKEDE
                     LNYYDVGAAQKSAEAEEAYLTSSSNARFDTSHVKWGLITSEDDQEEVSEPEGGKGVAG
                     EDDDGTSGDLAGGAAAGSGAGGAASGPRMVEVLQNDIGAGLPFRPGTFDGCISISVLQ
                     WLCHSTKKGEVPQRRLMALFQSLYNALRRGAKAIFQFYPSNPEQVHMITRAAMKCGFD
                     GGVVVDFPHSARAKKYYLVLQAGQVQGGFVPPPALTGEVEGDGDDDDDGSNGDPEYDG
                     EEYYGSGEDGDDDDDGLHNPNSRKRVRVGGRDAHHDKRARASSAHGQKRRRKDNRPVT
                     GTREWVLLKKEERRRRGYQTTADSKYTMRQRKPRF"
     gene            <1263204..>1264109
                     /locus_tag="LMJF_34_2760"
                     /db_xref="GeneID:5655048"
     mRNA            <1263204..>1264109
                     /locus_tag="LMJF_34_2760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686327.1"
                     /db_xref="GeneID:5655048"
     CDS             1263204..1264109
                     /locus_tag="LMJF_34_2760"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686379.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655048"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2R9"
                     /translation="MNPDDGSEAGSIAETLPQEQIKMLLNVQDFQEKVAQDPANLCCV
                     IVTSTLCRHCGIRRIPYPRAAHPHGKSSSNEDGESEDEDADADGDDGYGDEEDSQADG
                     GAGHSIHAGHFYRDIETHLVHNRDTAAQRRHTRFFHVCACMEEETCVDFLIAADPAYS
                     LLNKQPTAHEMALLHKKAHHQLKELLNLLEVRSTPSMRFYLAGQPLRYSAMLSSCNDA
                     AAPKDVTAETDVLQVSGANWIKWFQVLQNAVVVRNEVMRSYDTEEREKARAARAEARR
                     QARRQRKKQAVMDEEEEDEEGEEDG"
     gene            <1266725..>1267756
                     /locus_tag="LMJF_34_2765"
                     /db_xref="GeneID:5655049"
     mRNA            <1266725..>1267756
                     /locus_tag="LMJF_34_2765"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686328.1"
                     /db_xref="GeneID:5655049"
     CDS             1266725..1267756
                     /locus_tag="LMJF_34_2765"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686380.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2765"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2765"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655049"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2R8"
                     /translation="MVKQPAAQVLLRVPSTRVRNKSHAIDADRKHTCCPGLKVVGAAA
                     RKPSAALADAPLRCKRVPAVPTTPKGAGGWNAPWQPRRGSSGVTPDEDSREAREHLRH
                     SPPDKKRGNSIEHRSHSAGPSRHAQHPASDKVTVGLPRMHSSPQAVPSVHENGLTGDD
                     LLLLCGVKPGSSKALWYTTMRAQLEARALAMRAEKSDRGDSATSNRPRTGVGSSSLSS
                     HSPMHRAEASPEPLVLPTALLLLAEPSDLNARTMGASKSAAQPIGKIPRTRSGEDEAE
                     KVEADDGASSLGTRSTSLCSEKVANTSVMQAAPNAAPLVPLKRLRLSPKQLTQMRVSV
                     LSLQALVDL"
     gene            <1271830..>1273716
                     /locus_tag="LMJF_34_2770"
                     /db_xref="GeneID:5655050"
     mRNA            <1271830..>1273716
                     /locus_tag="LMJF_34_2770"
                     /product="serine/threonine protein phosphatase-like
                     protein"
                     /transcript_id="XM_001686329.1"
                     /db_xref="GeneID:5655050"
     CDS             1271830..1273716
                     /locus_tag="LMJF_34_2770"
                     /EC_number="3.1.3.16"
                     /codon_start=1
                     /product="serine/threonine protein phosphatase-like
                     protein"
                     /protein_id="XP_001686381.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655050"
                     /db_xref="GOA:Q4Q2R7"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2R7"
                     /translation="MSGLGSDDVLYYLYDPNLVPPARDKYIQVISELLAGYYDSSYVD
                     KINIMDILRGGAMEAVELCEDAKSILSKEPTVLGLCVGDVDDFVFVGDIHGQFNDLLH
                     SVLSVQLSRSAPVSRKGTKVATQPTQRMNDEEARGERSSPLPIVATPTLSSSLAPLPS
                     STAMPRHRDDSRGFGRDAGKIIRFLFLGDYVDRGPRGLEVIVLLLALKIEYPQHVFLL
                     RGNHEEAQTNRLYGFFDECRAKLFMAHHARDHMSYVEPGCDGAYSSLIQRSPINVAKE
                     AIGSECHNSHPHFLHLDGECATHLRGTSGSSRSNSSSAEVQSSLVETDADAWVSFNAT
                     FCWLPLAAVVCCCAGSFFCTHGGLSPPLRRITQLHRLKRETYGAGLCETITPPLSSSC
                     SVTSSPERSPRGVYGSPASKREPNQIIDGLLWSDPSDHHAGCQVNVRGCGYSFGVDVT
                     RRFLDANCGYAASQTPSLRAKVSKDNEEEKRSCPGSTPPRNAQHGKSQRMHFIMRAHQ
                     CVTAGFQWTQEGLMVTLFSAPNYCGMNGNKGAIAMLHGAAQTSGESIRLEFKVYDSFK
                     CASFTGGSKLTHGKLEHKKSGSNFLATGGAQPRCPAFPLRDRNVVNNPILEAYFGSIA
                     KSEN"
     gene            <1276029..>1276547
                     /locus_tag="LMJF_34_2780"
                     /db_xref="GeneID:5655051"
     mRNA            <1276029..>1276547
                     /locus_tag="LMJF_34_2780"
                     /product="putative 40S ribosomal protein S19 protein"
                     /transcript_id="XM_001686330.1"
                     /db_xref="GeneID:5655051"
     CDS             1276029..1276547
                     /locus_tag="LMJF_34_2780"
                     /codon_start=1
                     /product="putative 40S ribosomal protein S19 protein"
                     /protein_id="XP_001686382.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655051"
                     /db_xref="GOA:Q4Q2R6"
                     /db_xref="InterPro:IPR001266"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2R6"
                     /translation="MFFRRVTNPSCIMAALKNKIHRIGKRKGATLKDVSAWRWIKTAA
                     RHFKQEGKIFVPNCTEIMKSSHGRERAPQNPDWYYIRCAAVLRAIYLRPGVGYGGLSK
                     RFGNKKNYGSRPEHTVTSSTGPLHWACKSLTKLGLVEPGAQSGQRLTRKGHKFADSLA
                     FQVQIRKFGAST"
     gene            <1277649..>1279451
                     /locus_tag="LMJF_34_2790"
                     /db_xref="GeneID:5655052"
     mRNA            <1277649..>1279451
                     /locus_tag="LMJF_34_2790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686331.1"
                     /db_xref="GeneID:5655052"
     CDS             1277649..1279451
                     /locus_tag="LMJF_34_2790"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686383.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655052"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2R5"
                     /translation="MAVDFDLTLFIKETQLQHGLRAEDYVRYHHYTTNRLATLRRQLS
                     LSNDKKKFLYKEVTPQNATDARHLMLLALYAERCWAEAEAMQAQLQAKKESRSTDANK
                     PKGGVPPQDQYRKRLNKSVKWASKLHEVAKEVASDRVTKECSAYLKDTAGRCYASHGK
                     FKEAKEAFLEARETYATLRSVSSESGWVVIACKMSELDDRVTYCMQRLGEEPTAYRPA
                     PIFVTASADGAAVDRAVPMGRASQLSWNGRTLNVYSIKVKDALREAQAVEVESTEAKL
                     EETRGVVPVGQSNRVLDLMDRRINYYNDALAHARQDLRAAPEGTGKTEYQLIVHCILF
                     HVAQETLRRTLFLADLYSRRFEATERTLKSTAASSTSPSFPRGHKQQQHRRKKAEVAP
                     TQYVSPLEVVRLYQAAAGSVEEMELLPGVAGREDVEALHAVCSAGKLFFTGESWRLSE
                     AWSTAMKYYCDALALLREVKGSLVASMQEHIEQRLMQGAAEVVLAASSMGAGGNARRS
                     TPLMTYLVDAGEETTQVAQGVVRFPPDYRAAPCKPVFVDVASTFLDYPVDSGDEADSD
                     DRSGAKTATVPAMKNASAAAGQPKKKDWMFGWRS"
     gene            <1280924..>1282603
                     /locus_tag="LMJF_34_2800"
                     /db_xref="GeneID:5655053"
     mRNA            <1280924..>1282603
                     /locus_tag="LMJF_34_2800"
                     /product="putative tuzin"
                     /transcript_id="XM_001686332.1"
                     /db_xref="GeneID:5655053"
     CDS             1280924..1282603
                     /locus_tag="LMJF_34_2800"
                     /codon_start=1
                     /product="putative tuzin"
                     /protein_id="XP_001686384.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655053"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2R4"
                     /translation="MAVNAFFAKSASAVLAPIAEGSIKSKIAGTVYAVHLQHLFLSPI
                     IEVGSRVYIEYGKGEEYAGAVVGGVVVRVNGNGTYGVLLDNNSFDMAVSADMVVFSEG
                     RGKLASDAGHREVVEWLRRAGVARRAHQESIACVLFHRGWRAHRLYLLQASDVHCLTH
                     IPKAVRMRVLAESEWQRDHHRQMRQLLKERVMERDFRYKLTKYSGVVSASMALLGIAF
                     AFGWNLKNSRTQQREHQLKVAVKALMQTLNQRHNTLQGTTSVAQHCVQREREESAVRQ
                     ALRRLDVAHPRIIVFTGFRGCGKSTLCRNAVLKERMPAVYVDIRGTEDTLRSVAKALG
                     VNRLEACGDLLEFVADTCRTAKAANGDTPLLVLKLREGSSFERVYNDAVALACDRRLC
                     HVAIEVSIESLSMATVALPLLDFCMIAVFSREQAFAYTQHTIDAVSLNHFVDIIGTNS
                     NDVDELFAAVHQRRVSAATYTNEKLLKAMRQLQATCAGRPQLRSALQQLSAVPYGEGQ
                     DVGGDAAALRSAALRDIVLYDPVQDVWLFRNKLFHSASRCCWPQTRGEMRR"
     gene            <1289914..>1292424
                     /locus_tag="LMJF_34_2810"
                     /db_xref="GeneID:5655054"
     mRNA            <1289914..>1292424
                     /locus_tag="LMJF_34_2810"
                     /product="putative zinc carboxypeptidase"
                     /transcript_id="XM_001686333.1"
                     /db_xref="GeneID:5655054"
     CDS             1289914..1292424
                     /locus_tag="LMJF_34_2810"
                     /codon_start=1
                     /product="putative zinc carboxypeptidase"
                     /protein_id="XP_001686385.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655054"
                     /db_xref="GOA:Q4Q2R3"
                     /db_xref="InterPro:IPR000834"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2R3"
                     /translation="MNGLDRDASLHGADDAARGAASQTAAGPEVDDAHWVFQRPPNNQ
                     RTFYFQEDDLEFSSQFDSGNLIQVERVGTFQYRMYTAMDCGNAPWQTNNRQWFHFSVR
                     GGSKGVVVTICFVGMAHSNMFTYDWMPVMAVVPTRPQYTRIAGKAHVEALEKMPETPG
                     YPLLVHKPVSKDDADSDGGGDEGDNDADAGAAGANNNGGTGGIAFSISPTGKSSGTSK
                     KKKTKKKNIAMNLTFDFKIETKIAVTYTPPQGRPDSPAIYIASNHPYTYYTLQRNLAM
                     WQEAARRSNAVREMSLQAPDHQVQRSSSEQRSGPDSYAVHGLATAQPGSNGRSKKGVG
                     SSNTGNAAVPCSAEFSEVYFHREVLCKSLEGRDVTLLTISDCSRMTVERAPLLSKEAG
                     LPHSSALGFTQRPYAFSGKQYVVLTARVHPGECPGSHLMHGCIDLLMNCTDYRAAALR
                     HNFVFCVVPMLNPDGVVRGHSRVDSNGVDLNRMYRDPSRKRHPAPYAVRALLRSLGSR
                     VALFIDMHAHANKRGTFFYGNSMDWANQIENLLYAKLVSLNTPYFDFRSCNFSEANMF
                     AVSKSGKRKDSSSRVVAFTEAGIVHSYTIETSHVMADALNPVAPLTNNQADQLDAALS
                     SPPSVMHSPATFRDTARAMLLGLLDLKGMNPTSRLPLTQFHSTRGLALWLQRQLQIES
                     AETLFAQAFKLHGKEAQASTSESANTLLATIMKSMAAEEYPEKITIKEARLLPRTTFS
                     GVRSFVPLDTAIVLLSQTAPTGPPRSLLYSSGNCGAASGAATAGGAGSKGGGSAQRRG
                     TSPSFGWNSCPTAIPPAVIATRRRSKPILLPSDTTVET"
     gene            <1294882..>1296828
                     /locus_tag="LMJF_34_2820"
                     /db_xref="GeneID:5655055"
     mRNA            <1294882..>1296828
                     /locus_tag="LMJF_34_2820"
                     /product="regulatory subunit of protein kinase a-like
                     protein"
                     /transcript_id="XM_001686334.1"
                     /db_xref="GeneID:5655055"
     CDS             1294882..1296828
                     /locus_tag="LMJF_34_2820"
                     /codon_start=1
                     /product="regulatory subunit of protein kinase a-like
                     protein"
                     /protein_id="XP_001686386.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655055"
                     /db_xref="GOA:Q4Q2R2"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2R2"
                     /translation="MSSFDKYVVQLVCRMGDSVSKGMREVILLNIKDSIDDYQRLRDP
                     AEAQTRKKAAAVKKRRAAARKAKEEERCRRMERQANLPPFPPSSSNNAIQPAATDSKS
                     NKKAHKGKSAAKSNTVNSSAPSSAERAGAMTAATAAAKAPARPKMPSVQLKDIDFLFV
                     KEVEAQLRDLGRRPRAMYSLAGSTQECVASNGFGAETPLGAASAPKPAGVRETAARNK
                     KSESATPPKRMSPPPLDHTAMKQSDRENLLICGSDETLPLPRSDTISYQETFKTFKFG
                     RQDVDNESDSIAEKDSQDGEQRQREAEEDEFIDDCEDARRRTIQMQRPSRGAISDSSL
                     DIDEARIASFPTTPKSQEKMKTISRVLVRHFLFSTLDDSDIAKFASIMDVEKFEAGTQ
                     ILEKGHTNDTFFIVLDGEAETTMMNEDGAEVVVPLVRGSTFGDLGLMYEISNGAAVVA
                     RSSVQCASLERRTYKMITSRAMEDKRRRYVDFLSSLPVFAGVSSRQLQDVAERLKEDS
                     YVEGQRVIAAGVPNHWLHIITEGSVCVMAPDAESGDMKEVALLHAGDFAGQIEFLYHH
                     VAVADVVAVSAVVKTAKLSRRSFEFFPEEARERLIRAVEEEETYATYQKRMHSGTRPP
                     LDTTPPFDAPPSHLWHTLQQHESA"
     gene            <1300333..>1300644
                     /locus_tag="LMJF_34_2830"
                     /db_xref="GeneID:5655056"
     mRNA            <1300333..>1300644
                     /locus_tag="LMJF_34_2830"
                     /product="ubiquitin related modifier (urm1)-like protein"
                     /transcript_id="XM_001686335.1"
                     /db_xref="GeneID:5655056"
     CDS             1300333..1300644
                     /locus_tag="LMJF_34_2830"
                     /codon_start=1
                     /product="ubiquitin related modifier (urm1)-like protein"
                     /protein_id="XP_001686387.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655056"
                     /db_xref="GOA:Q4Q2R1"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR015221"
                     /db_xref="InterPro:IPR016155"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2R1"
                     /translation="MEMRHRQIKVALSGGCELLFDKEVTITLADVVPVGATVAQLIDM
                     LRRGYIKERPELFVDATGANVRPGILVLVNGCDAEVLGGVEHVLEDGDEVEFVSTLHG
                     G"
     gene            <1301246..>1303282
                     /locus_tag="LMJF_34_2840"
                     /db_xref="GeneID:5655057"
     mRNA            <1301246..>1303282
                     /locus_tag="LMJF_34_2840"
                     /product="putative selenocysteine-specific elongation
                     factor"
                     /transcript_id="XM_001686336.1"
                     /db_xref="GeneID:5655057"
     CDS             1301246..1303282
                     /locus_tag="LMJF_34_2840"
                     /codon_start=1
                     /product="putative selenocysteine-specific elongation
                     factor"
                     /protein_id="XP_001686388.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655057"
                     /db_xref="GOA:Q4Q2R0"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2R0"
                     /translation="MLNVNIGLLGHVDSGKTALAKALSSTASTAAFDKSPQSQSRGIT
                     LDLGFSACEVSVEDGNEDATQVLRAAELTKVQCTLVDCPGHASLIRTVVGGAQIIDAM
                     VLVVDATKGIQVQTAECLVLGEVLAKPLVVVLNKIDAIQGVSPAGKEAALAALKRKLQ
                     QVFRRTRWPTVAIVEVAAAPREVAGGIGHPVNTEAVLPQVLRAVDLAALKSAKESEAE
                     RPAQFYMLVDHCFAVRGQGTVFTGTVVAGVVRVGDTVLVPELQTTRKVKGLQAFHKPV
                     ELAQGGDRVGLCVAQFDPTWMERGVVCSAASSGRTLVSSSQLIARVHRVRYHPLPCDT
                     HTRFHITIGHATVMGTMRYFARLPHANESLDVPGTVAAFDPSIESAYVEELDDGVVAR
                     YTSTDTTAGVPGRPLPVAPAEQDYYAVLLLERPVLAAPGLSLIAMRLDVERENFCRIA
                     LAGTVCHVFMEDGAAARTATAVPGSSDQSASHGQVPAWRRLPVVRYRYRVLRVDRVLD
                     SRSCIADGVVSLQTAGAGGSGNRPAGASAGARRDKGCVNVEARQRAELFAEVQKFLRL
                     VVVFEPEDADAAVTTPQASNPDAVKGIIDSSFGKTGKVKLVFDGPVFADPAANADTAP
                     IGSFMSAARKKRSKSTKGPDSADAGCSGSVFRRPGRILLILKKYPFALHSGLEQ"
     gene            <1304730..>1305965
                     /gene="SAT"
                     /locus_tag="LMJF_34_2850"
                     /db_xref="GeneID:5655058"
     mRNA            <1304730..>1305965
                     /gene="SAT"
                     /locus_tag="LMJF_34_2850"
                     /product="serine acetyltransferase"
                     /transcript_id="XM_001686337.1"
                     /db_xref="GeneID:5655058"
     CDS             1304730..1305965
                     /gene="SAT"
                     /locus_tag="LMJF_34_2850"
                     /EC_number="2.3.1.30"
                     /codon_start=1
                     /product="serine acetyltransferase"
                     /protein_id="XP_001686389.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655058"
                     /db_xref="GOA:Q4Q2Q9"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR011004"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2Q9"
                     /translation="MKRLDRIREALEQLNPQRADSTLPTFHPRISLHKLKELVECLFY
                     VFFPECTNPPSEVTPTFAEADSLMEWVIGHIADILVTQIYVAFVLHGDAHAVEDTKPF
                     KPLNTSQRTQLEWNGQRCATLSLLAMESRSTKGGFAVAAAAEQDALKASLEELSCTGN
                     RARLPSTEVSSKSAASKANAMRVTADINSSANQDFLTNCKRRADAIVTKFVVERLAHV
                     HWLLHTDVEAIFKGDVAASSPSEVVLCYPGLRCMVHQRVAHQLHLLGVPQNFTRMLTE
                     LAHSETGIDIHPNTAIGHHFFIDHGTGVVIGATAVIGNDVSIYQGVTLGARSFPTDEK
                     TGERIRDLPRHPIIEDGVTLYANAVVLGRVTIGERSTIGGNCWVVRDVPPFSAIVQRS
                     HHVLQPHERMFLEGDGSGI"
     gene            <1307749..>1308105
                     /locus_tag="LMJF_34_2860"
                     /db_xref="GeneID:5655059"
     mRNA            <1307749..>1308105
                     /locus_tag="LMJF_34_2860"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686338.1"
                     /db_xref="GeneID:5655059"
     CDS             1307749..1308105
                     /locus_tag="LMJF_34_2860"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686390.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655059"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2Q8"
                     /translation="MFRASCTLLGHGQYKTRLKKRMVGFIPKVIPRKIRNNMVALRSE
                     ANTGHMEGYIKTEAERLDATGRKLQKTMWDPVLQRYTLMKETKVRGPFLTKSNIARKV
                     DFPVGALHGTKLGGKK"
     gene            <1308898..>1310157
                     /locus_tag="LMJF_34_2870"
                     /db_xref="GeneID:5655060"
     mRNA            <1308898..>1310157
                     /locus_tag="LMJF_34_2870"
                     /product="putative ribosomal protein L3"
                     /transcript_id="XM_001686339.1"
                     /db_xref="GeneID:5655060"
     CDS             1308898..1310157
                     /locus_tag="LMJF_34_2870"
                     /codon_start=1
                     /product="putative ribosomal protein L3"
                     /protein_id="XP_001686391.1"
                     /db_xref="GeneID:5655060"
                     /db_xref="GOA:Q4Q2Q6"
                     /db_xref="InterPro:IPR000597"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR019926"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2Q6"
                     /translation="MSHCKFEHPRHGHLGFLPRKRSRQIRGRARAFPKDDATQKPHLT
                     SFMVFKAGMTHIVRDVDRPGSKVNKKEVVEPVTILEAPPMVIVGIVGYRQTPVGLKTI
                     GTVWAHHTSVEFRRRYYKNWKQSAQLAFSRQKQFANTKEGKVAEARTLNAFAKKASVI
                     RVIAHTQLRKLRNHRVGVKKAHVQEIQVNGGSVAAKIALAKSLLEKEVRVDSVFQQSE
                     ACDVCSVTKGHGTEGVVKRWGVACLPRKTHRGLRKVACIGAWHPARVMYTVARAGQHG
                     YHHRTQLNKKIYQIGRSVAVEPNQATTTYDLTAKTITPMGGFVGYGTVRNDYVMLKGS
                     VSGPRRRVMTLRRPMAPQTSRQLKEKIVLKFIDTSSKIGHGRFQTKKEKNQWFGPLKK
                     DRIRREERLRKERAARAVERKAKAAKK"
     gene            <1311033..>1312292
                     /locus_tag="LMJF_34_2880"
                     /db_xref="GeneID:5655061"
     mRNA            <1311033..>1312292
                     /locus_tag="LMJF_34_2880"
                     /product="putative ribosomal protein L3"
                     /transcript_id="XM_001686340.1"
                     /db_xref="GeneID:5655061"
     CDS             1311033..1312292
                     /locus_tag="LMJF_34_2880"
                     /codon_start=1
                     /product="putative ribosomal protein L3"
                     /protein_id="XP_001686392.1"
                     /db_xref="GeneID:5655061"
                     /db_xref="GOA:Q4Q2Q6"
                     /db_xref="InterPro:IPR000597"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR019926"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2Q6"
                     /translation="MSHCKFEHPRHGHLGFLPRKRSRQIRGRARAFPKDDATQKPHLT
                     SFMVFKAGMTHIVRDVDRPGSKVNKKEVVEPVTILEAPPMVIVGIVGYRQTPVGLKTI
                     GTVWAHHTSVEFRRRYYKNWKQSAQLAFSRQKQFANTKEGKVAEARTLNAFAKKASVI
                     RVIAHTQLRKLRNHRVGVKKAHVQEIQVNGGSVAAKIALAKSLLEKEVRVDSVFQQSE
                     ACDVCSVTKGHGTEGVVKRWGVACLPRKTHRGLRKVACIGAWHPARVMYTVARAGQHG
                     YHHRTQLNKKIYQIGRSVAVEPNQATTTYDLTAKTITPMGGFVGYGTVRNDYVMLKGS
                     VSGPRRRVMTLRRPMAPQTSRQLKEKIVLKFIDTSSKIGHGRFQTKKEKNQWFGPLKK
                     DRIRREERLRKERAARAVERKAKAAKK"
     gene            <1313168..>1314427
                     /locus_tag="LMJF_34_2890"
                     /db_xref="GeneID:5655062"
     mRNA            <1313168..>1314427
                     /locus_tag="LMJF_34_2890"
                     /product="putative ribosomal protein L3"
                     /transcript_id="XM_001686341.1"
                     /db_xref="GeneID:5655062"
     CDS             1313168..1314427
                     /locus_tag="LMJF_34_2890"
                     /codon_start=1
                     /product="putative ribosomal protein L3"
                     /protein_id="XP_001686393.1"
                     /db_xref="GeneID:5655062"
                     /db_xref="GOA:Q4Q2Q6"
                     /db_xref="InterPro:IPR000597"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR019926"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2Q6"
                     /translation="MSHCKFEHPRHGHLGFLPRKRSRQIRGRARAFPKDDATQKPHLT
                     SFMVFKAGMTHIVRDVDRPGSKVNKKEVVEPVTILEAPPMVIVGIVGYRQTPVGLKTI
                     GTVWAHHTSVEFRRRYYKNWKQSAQLAFSRQKQFANTKEGKVAEARTLNAFAKKASVI
                     RVIAHTQLRKLRNHRVGVKKAHVQEIQVNGGSVAAKIALAKSLLEKEVRVDSVFQQSE
                     ACDVCSVTKGHGTEGVVKRWGVACLPRKTHRGLRKVACIGAWHPARVMYTVARAGQHG
                     YHHRTQLNKKIYQIGRSVAVEPNQATTTYDLTAKTITPMGGFVGYGTVRNDYVMLKGS
                     VSGPRRRVMTLRRPMAPQTSRQLKEKIVLKFIDTSSKIGHGRFQTKKEKNQWFGPLKK
                     DRIRREERLRKERAARAVERKAKAAKK"
     gene            <1315303..>1316562
                     /locus_tag="LMJF_34_2900"
                     /db_xref="GeneID:5655063"
     mRNA            <1315303..>1316562
                     /locus_tag="LMJF_34_2900"
                     /product="putative ribosomal protein L3"
                     /transcript_id="XM_001686342.1"
                     /db_xref="GeneID:5655063"
     CDS             1315303..1316562
                     /locus_tag="LMJF_34_2900"
                     /codon_start=1
                     /product="putative ribosomal protein L3"
                     /protein_id="XP_001686394.1"
                     /db_xref="GeneID:5655063"
                     /db_xref="GOA:Q4Q2Q6"
                     /db_xref="InterPro:IPR000597"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR019926"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2Q6"
                     /translation="MSHCKFEHPRHGHLGFLPRKRSRQIRGRARAFPKDDATQKPHLT
                     SFMVFKAGMTHIVRDVDRPGSKVNKKEVVEPVTILEAPPMVIVGIVGYRQTPVGLKTI
                     GTVWAHHTSVEFRRRYYKNWKQSAQLAFSRQKQFANTKEGKVAEARTLNAFAKKASVI
                     RVIAHTQLRKLRNHRVGVKKAHVQEIQVNGGSVAAKIALAKSLLEKEVRVDSVFQQSE
                     ACDVCSVTKGHGTEGVVKRWGVACLPRKTHRGLRKVACIGAWHPARVMYTVARAGQHG
                     YHHRTQLNKKIYQIGRSVAVEPNQATTTYDLTAKTITPMGGFVGYGTVRNDYVMLKGS
                     VSGPRRRVMTLRRPMAPQTSRQLKEKIVLKFIDTSSKIGHGRFQTKKEKNQWFGPLKK
                     DRIRREERLRKERAARAVERKAKAAKK"
     gene            <1318537..>1319835
                     /locus_tag="LMJF_34_2910"
                     /db_xref="GeneID:5655064"
     mRNA            <1318537..>1319835
                     /locus_tag="LMJF_34_2910"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686343.1"
                     /db_xref="GeneID:5655064"
     CDS             1318537..1319835
                     /locus_tag="LMJF_34_2910"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686395.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655064"
                     /db_xref="GOA:Q4Q2Q3"
                     /db_xref="InterPro:IPR002641"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2Q3"
                     /translation="MSSMHSPAHDSYTSSSTGDDSHHCQRQQQEDDEERWDITISFSC
                     GGWFQMYFFGVAYALIDSGVLQRWYTEGKRVRFTGVSAGALAATCLASGQYDILSVKQ
                     FASAAAEDYRSSVFHWFRVGKYLTTAIDNFGTNLRAVDTDPHMRHVLMSGSLEVGVTV
                     LPKLKSRLISSFSSYAAIRETLLASCCLMPLVGMPLKMESTGEWCVDGGISNFTPRIE
                     EESTISVSGMYFQDASVRPRVFVPSWWALHPPTAQKYNNLFWMGYNDMIDYLVSAGHL
                     SVPDGNRLLKQDVDFRIHDSYLEVAFTFFMELMMLMYIRPVVIVFVYVELTISMMWWA
                     AKGILTWDGASFRNLYEGFRNTISLRTLGRLIFGSKISSNEDRLSRQSRVFRVFQPVV
                     LGVSKKTGRKCCSSSGAVLLDRVPTLSPNARRTAPTPLSK"
     gene            <1325815..>1326084
                     /locus_tag="LMJF_34_2920"
                     /db_xref="GeneID:5655065"
     mRNA            <1325815..>1326084
                     /locus_tag="LMJF_34_2920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686344.1"
                     /db_xref="GeneID:5655065"
     CDS             1325815..1326084
                     /locus_tag="LMJF_34_2920"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686396.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655065"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2Q2"
                     /translation="MLCLTRRALMERSRTMLETNFKSHSAAANPATDSSVTGKVKAEL
                     KKMIKIQLVLIPICVVFMVWMYPTPTEEDERRMRLEYERNAGWKT"
     gene            <1326889..>1327461
                     /locus_tag="LMJF_34_2930"
                     /db_xref="GeneID:5655066"
     mRNA            <1326889..>1327461
                     /locus_tag="LMJF_34_2930"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686345.1"
                     /db_xref="GeneID:5655066"
     CDS             1326889..1327461
                     /locus_tag="LMJF_34_2930"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686397.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655066"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2Q1"
                     /translation="MFHRSFTSLFLKGVFKVNKPPVTGYEIAELPNEKVLHDFMQFYR
                     TKGVVVILHSGASYAAAAASSSGGSHSPLTSASASSSRKASATATAKSTSTSKPKTEL
                     LQDPLTRSFISSINAVNLGNPEEVKLALVPGPKAPCFVEEHNIITYPTSLLFLNGQCI
                     YRVVGARTRELSIKSLFMLRNGGRNIFSRE"
     gene            <1331394..>1332281
                     /locus_tag="LMJF_34_2940"
                     /db_xref="GeneID:5655067"
     mRNA            <1331394..>1332281
                     /locus_tag="LMJF_34_2940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686346.1"
                     /db_xref="GeneID:5655067"
     CDS             1331394..1332281
                     /locus_tag="LMJF_34_2940"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686398.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655067"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2Q0"
                     /translation="MMSSTKDQGRRPLIASYRCEERVFPELPATHPLSVRRREVQRFL
                     KGDGTLGRRAWNPATKDELHPFPQPALNNTTTCYNGVEVVATHFPETVKGTAFLKMQE
                     TVLPAVWTRNRDRARASTTRHTYRCEALERQEAPLSFLATVIRDDNNPEKRRRQEGWC
                     ASTTLEGFRGNRHAVPAAEGVFDAKAHRELNETLTARLSGGYVKPCQRVKQLNSSRKE
                     RKELQQKAAAESLISLYASQPGPAAFKMSNADEWWSIDPVAVTADMMKRIDEMKANPY
                     STIFRSTTLATTPPRSPHV"
     gene            <1333100..>1334368
                     /locus_tag="LMJF_34_2950"
                     /db_xref="GeneID:5655068"
     mRNA            <1333100..>1334368
                     /locus_tag="LMJF_34_2950"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686347.1"
                     /db_xref="GeneID:5655068"
     CDS             1333100..1334368
                     /locus_tag="LMJF_34_2950"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686399.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655068"
                     /db_xref="GOA:Q4Q2P9"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2P9"
                     /translation="MNRDPQNALLLEQMAQKTKRLLLQRSPSTVNGIRSFSRSLGIAD
                     DLGSTQVTAEELQHALQENNVSLEEHELQNIFTVLDRTGKGTIDPTDFIAVMCNNLGP
                     LRKVWLRRVWRMFTKDPDDGSVQVCELQRQFIAEGHPAVVRHETTAAEVRKDFESAFN
                     ESTNPDGKISAQEFAEYYAGVSVSCSNDESFVALLRGVWPLPGVSRDFSLSLAKGEAQ
                     YQGSYHTEQSLAEKTAVASREAVRSALMRMIRCDHAPVALSSGAAARALCLSLAQADE
                     AGSGFVSEAVFVGALRTHRLYVPNTSVLECLDTNGDGTVDIKYYEELLLPSPSAARLM
                     LLARLWSRCFENKDAAYRVPVQDLHRKYHASSPADKDAFLTAWDVRTAVGGKVELEEL
                     VQWYVPQSAAVQRDKDFEALLHRQWGKYDE"
     gene            <1335219..>1335911
                     /locus_tag="LMJF_34_2960"
                     /db_xref="GeneID:5655069"
     mRNA            <1335219..>1335911
                     /locus_tag="LMJF_34_2960"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686348.1"
                     /db_xref="GeneID:5655069"
     CDS             1335219..1335911
                     /locus_tag="LMJF_34_2960"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686400.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655069"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2P8"
                     /translation="MLTIIMEGLTQPLQISSNGAYSLGLLLALSTGPLPLISEHIIGA
                     YLALQLLWWLLLCIRAARAAGSQSARRELRERAKQAYLKWMDGLRFSVAELICHHLLH
                     FEFGAQVCMLYCGTGALRTVARPLLYVILRLSAGSEWATRLTGYSPAYLLESVGCGDR
                     TEFASGPAWKQHGHASGAGVKATSAQVRMSSLAPTKHSDSAKNNNNRCTVVDEGPHFN
                     RTSRGCLLKYTE"
     gene            <1336689..>1337237
                     /locus_tag="LMJF_34_2970"
                     /db_xref="GeneID:5655070"
     mRNA            <1336689..>1337237
                     /locus_tag="LMJF_34_2970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686349.1"
                     /db_xref="GeneID:5655070"
     CDS             1336689..1337237
                     /locus_tag="LMJF_34_2970"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686401.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655070"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2P7"
                     /translation="MYSEGERVSLVDQQFPEGADVEEDDRVRHSECVNMNVVALHDML
                     RQLGCEGDSGSFTSLSASCLPPEMVDALLHYLVKLQEDVRKLDARAQLLDEQRSRDTQ
                     KAELLNERTERLRDAVANMSAKSSAEMKEFRDYLQQNASANKQRQRELVDLTRKREKL
                     ELEEKRTRMEMDRLRKIAKRVR"
     gene            <1338350..>1339381
                     /locus_tag="LMJF_34_2980"
                     /db_xref="GeneID:5655071"
     mRNA            <1338350..>1339381
                     /locus_tag="LMJF_34_2980"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686350.1"
                     /db_xref="GeneID:5655071"
     CDS             1338350..1339381
                     /locus_tag="LMJF_34_2980"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686402.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655071"
                     /db_xref="GOA:Q4Q2P6"
                     /db_xref="InterPro:IPR001564"
                     /db_xref="InterPro:IPR006602"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2P6"
                     /translation="MATSTLDPRMAFRAQQQDPGAPQPRQLILRYFYESSTVELMEVP
                     SGRLYLKRTAVGIPASAFTVGSTVMLFGKATTITAFADEVTRQLCAQCSESTTVLIAE
                     EAFPFLGRYLAMLTEECCFAITDVEMVWVQAETVSAFDLPEKLSNTRMVVVLCTRKKA
                     VEKGFAFVERTTGTCAAKDAEQAALWGQLGQLAKAKPLAILNEANTSVVVLKPHLVSA
                     GRGGSAIQQLLDVGLEPTALTTVTMTSAAAREFMEPYCGVLPNLEGTVSSFVGTNWVL
                     QLASLHEAVNAVDTVRNICGPYDTVVAKKLYPKSIRACYGDSETDNAVHCCDLPGDGP
                     IYTKFFFQG"
     gene            <1341226..>1342485
                     /locus_tag="LMJF_34_2990"
                     /db_xref="GeneID:5655072"
     mRNA            <1341226..>1342485
                     /locus_tag="LMJF_34_2990"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686351.1"
                     /db_xref="GeneID:5655072"
     CDS             1341226..1342485
                     /locus_tag="LMJF_34_2990"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686403.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.2990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.2990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655072"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2P5"
                     /translation="MATSQRIPAEFSLLRYSTGDALHFVFENGVCRRGNEEGASLLPG
                     LSKVVELQEKQAVRDKVHTCGITDDPLNLENLTRIGTHEEWCAHSQTACALAKNAVAQ
                     CLQRRSEVRVRRYGEAVMRLSEASPTLRDREEQAPATAADIPYVTTALSTPSCASSAQ
                     DHTQLSVKADKLAEAEASLTTDDETSDVAEEEEEEEELETYLLQHPAFGADMAAAWLR
                     RRYLRCCNVINVRPSAAVRHRFSRGVQATLSSTLGSFAAQKPVSPLSPIADTPTSFLC
                     SPGGRTWMSFPGTMVLLRELRTVPFEVNADFSGCAEIGHQQRHFIALLGVLEGCRNTV
                     VSLNLAKTCLNDDEVRVLCLFCRAYLRRLQVLDLSGNKTVTDKVAVWIKQLAASSPLL
                     FRLAVRGTSLSRSTMRSVAGILCRKAL"
     gene            <1344562..>1346445
                     /locus_tag="LMJF_34_3000"
                     /db_xref="GeneID:5655073"
     mRNA            <1344562..>1346445
                     /locus_tag="LMJF_34_3000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686352.1"
                     /db_xref="GeneID:5655073"
     CDS             1344562..1346445
                     /locus_tag="LMJF_34_3000"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686404.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655073"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2P4"
                     /translation="MRSGTGTPYALTQGTPGVSMYQNVSRSVSPSVQSRRAPVVDLET
                     IEELQDAWSRRYETLRDPPPPPLLNSPRSLRTCELANVSPQSTLQKLSLKQHLFCVLG
                     NPHALSSLPDSTTAEYQVLMQSALRSFSEAAVGLGTSQEKLAAFIAFTNQEKLRVPQL
                     ALLRELRRQLVAEEAIAERGRHHQQPDYGVSKRSSNASAAYQDSGDQNAHLSDLRKVN
                     VLCSSKTEKSLQCSKTLSLNHQRGDSTTGAHKTRFQSPRFSSLKSVPFAQAGAANDEY
                     DEDIRGFGARDFAPTPTPSGKLPYKPRDVCLLNSSYFANRSIRSDGSNPCGAPLPTSS
                     PGTPSPSWRGAMTATAFAKLPAPSQQPLLAVDSSLGTVIDVDSEFSLVREAEDTAESR
                     FAPKQDLSIVSMNSSQLELLNIAELAASSSEAALAQPPAAAVLTGIREKVADGSLSKH
                     TVTLFHESNEKRSRGVAASTAAEVAVASVTASIAERKPAPSSQPSTQRGLCGYTNPGN
                     FASLLVPNVLARPVSPPAERTVAPFSLRVAPASTSPSDKEKAVTLEQQEGMASTTAVT
                     IGSTDSAGPAAASVASRLPSPPLITQAEENDGFVYYCANPSHSVIDSYAGRRKLLAVT
                     VKL"
     gene            <1347544..>1348293
                     /locus_tag="LMJF_34_3010"
                     /db_xref="GeneID:5655074"
     mRNA            <1347544..>1348293
                     /locus_tag="LMJF_34_3010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686353.1"
                     /db_xref="GeneID:5655074"
     CDS             1347544..1348293
                     /locus_tag="LMJF_34_3010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686405.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655074"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2P3"
                     /translation="MSINPAIGDKDILQRRTSANPKYDCVQAVVESGMTAPLAEYMRN
                     IKIKTKRQPGELFQRLRIDVVAAFLSRQEPKSVLEDGGFARPMDEYGGPENAVDKAAT
                     SYLLIDCREAEHYEACHIKRALHYPKIKVHHSTNPFLPEMYAYKNKENKYIVLYDLEE
                     EAVVNLANTMYQKGVDNVAIIAGGLREFAQDYANFLTAKPPVPIVPRDWRMKRRADEA
                     TQARSEARTSMSHRPKGLSSSLARSSRKGTF"
     gene            <1351162..>1353984
                     /locus_tag="LMJF_34_3020"
                     /db_xref="GeneID:5655075"
     mRNA            <1351162..>1353984
                     /locus_tag="LMJF_34_3020"
                     /product="putative protein kinase"
                     /transcript_id="XM_001686354.1"
                     /db_xref="GeneID:5655075"
     CDS             1351162..1353984
                     /locus_tag="LMJF_34_3020"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001686406.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655075"
                     /db_xref="GOA:Q4Q2P2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2P2"
                     /translation="MQVDIGNNTVRQNFSSIVSSAEIRQLNVRLQQAYAGAASAQATA
                     AGHQEGGGPGAVLSQRRVYHNAVEGAAGVPSSHQNASRLHRRSSFNLSRSSAGSRHSY
                     RHHQGRQHGSTPRSGSGHSQSPEQPALRPQQATLGVSHIAPAARTTTPANSSTAVNNA
                     SVSSRASIFGVPRSLNSRIIQPPHLQLLPPPLQAPAVFVGAGPSPVPMATVISTPHCQ
                     QGHPDAAQDKGGAASPAGAVDGAPVYAGDNRSKGMVGNEGDGNCGRAEGSGPHGGGDA
                     GSRNCNDKPAAAASPKLAHTKIQVGMRLRRWIIINRIGAGSFGETFAAMEVDGPAEEA
                     DSLTVAAENLKLLENLPPAEERNEVCIKVEQENKNVLRLEALALKKVQPCPQVVRYLG
                     SGCTNGMNYLVMEKLGSNLAELRRRSQHGTFNIYTTLKAGVSCLTAIRGVHDLGLVHR
                     DIKPSNFVTGLPGTPDHTTCYLIDFGLARRFRRSNGEIRPPRENAGFRGTSRYASVAS
                     HHHRELGRVDDLWSLLFMLVEFATGTLPWRKYKEKDDIGRCKEESISPHLVRNLPREF
                     QPFLAHLQTLRYEDEPDYDLLLTLMHRALERRGYPPNKPVEWEIDSSMADSCIDADGA
                     PVVDAGARAVQGSAAHLRDVGPAPDAAGNGHSMDDNASSRPLQPPPRRAAPLPGAVEM
                     GSRELQHTPLHPDAAQPNSVASRVGSGNGAAGNGATMSGYPADALHPHNSGTLRMSEV
                     DIGGSGAGEDCMHGNPPVGVDASVQYCGPPPQGGSADIPITTACLAAEGSESPRAQAS
                     SGEYDHNEYSLRENGSGAYSPLMAPVSHFNAAVASGADPPGSCPAAGPLANSALEPNN
                     ATQWRETAAERNGLKRRAGHQQHENECDGPDIAKREAGRSHQQMGGPTADLDASVAAD
                     EHGEVHYGKDGKTSSKKKLQCECVAM"
     gene            <1356952..>1358004
                     /locus_tag="LMJF_34_3030"
                     /db_xref="GeneID:5655076"
     mRNA            <1356952..>1358004
                     /locus_tag="LMJF_34_3030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686355.1"
                     /db_xref="GeneID:5655076"
     CDS             1356952..1358004
                     /locus_tag="LMJF_34_3030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686407.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655076"
                     /db_xref="InterPro:IPR029239"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2P1"
                     /translation="MSELDSLIDELFPEKHTNGCNSASAPGPSRRRSEWDEEIDDGQE
                     IRTFTGAKMHALQQRNPTSVSSSRAEPSTSATTVAPTRCSVGHSFDEDGDADGDVGHA
                     VASHNVPGELVDKDLSGRSLTSMSKSALFPVPFPSLSGSEGSYACASRCSLTNLGTPL
                     IRDAGHPTLHQLRAIAANEQASLDTSRIQAMLRKGAFHAAIAKLGNGCLDHHGDFTVD
                     GGCPNILCRQCNYMIVRLQGAEWADSGVNLYLTLRNYYPDWCRLASATPVGVEAGAEA
                     TRSVLRSSSAAAAYCCQCSWVTVRSAKVFIETRLTDITMAKPAREGEHPFATELPLPL
                     GETRRPPLWVCHGHTR"
     gene            <1359019..>1360812
                     /locus_tag="LMJF_34_3040"
                     /db_xref="GeneID:5655077"
     mRNA            <1359019..>1360812
                     /locus_tag="LMJF_34_3040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686356.1"
                     /db_xref="GeneID:5655077"
     CDS             1359019..1360812
                     /locus_tag="LMJF_34_3040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686408.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655077"
                     /db_xref="InterPro:IPR011050"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2P0"
                     /translation="MPAKKKSSKANSSKEVLPEPATIKSGASTVFIGGWSSYDTIESV
                     GQASRSVIAANTDADGVVAAPLPRTNVLVLPTEEADDDADSGAAQAPLVVEVADQFFV
                     EGVSRRQCAQAQSLVKTWEPAPAQPTEATAPSERPVAPAPKEELVNPYADALSDQRYT
                     KEVSVGASYAARDVVIRGPCSIEGVAPIIVVPPQLPAKPDLDAVTLDPPADNAAAAAG
                     ASTKKKMVKSKKKSKPKLTPEQVEELARKKAELEAQYMQQTEEAVQRAKQESDYLMTF
                     AHPDRWANVVVRHMTFAGPVQVHRAHVSFQNCRFVGITKTTMSDRPLLLVSQYCRVQC
                     TKCSFEAPQRCGIYALPSAQVEVRKCLFTGVTQDILWAAALPGVSPQNAGAAASLDVD
                     GGDEDSAGHGRPLSPTDAADNHTANHKTAGVLSFPVALGGELQEAARAALADRSAAVG
                     ILSDCAKLMVHGCDFLCLGVGVYVKGSYTVYVSHDKAAPKTPQQLTPEACDTSLDSNS
                     FHHFANAALLLDRSSRLVSIRRSYVEGSAHYGLDCQGGASSVLVRQNYFAADATVRIR
                     EGAKVAMLHNDFQSIPLNDNSYDNPCLQPVY"
     gene            <1362077..>1362613
                     /locus_tag="LMJF_34_3050"
                     /db_xref="GeneID:5655078"
     mRNA            <1362077..>1362613
                     /locus_tag="LMJF_34_3050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686357.1"
                     /db_xref="GeneID:5655078"
     CDS             1362077..1362613
                     /locus_tag="LMJF_34_3050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686409.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655078"
                     /db_xref="GOA:Q4Q2N9"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2N9"
                     /translation="MSSDGKRQLLVVAIVSAAAATVSVFYLWRNKDFAKKLGMLGHKI
                     GVAVHKRTSSSAGEAPGSGIRPVSGIVKKGYTREQLSQYDGVKNERIFMSVKMKVYEV
                     APHFYGPGQHYHVFAGTEASRALAKADLTGKYLNQYWVNCSEEELEVLEEYVEKFNSK
                     YPIVGWYVPDDQFYKVTE"
     gene            <1366541..>1367617
                     /locus_tag="LMJF_34_3060"
                     /db_xref="GeneID:5655079"
     mRNA            <1366541..>1367617
                     /locus_tag="LMJF_34_3060"
                     /product="mitochondrial carrier protein-like protein"
                     /transcript_id="XM_001686358.1"
                     /db_xref="GeneID:5655079"
     CDS             1366541..1367617
                     /locus_tag="LMJF_34_3060"
                     /codon_start=1
                     /product="mitochondrial carrier protein-like protein"
                     /protein_id="XP_001686410.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655079"
                     /db_xref="GOA:Q4Q2N8"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2N8"
                     /translation="MIKADGGWKAFWRGNTINCFKAGPEFAIVFSIRRYLSSLYEDCV
                     ERERVRKKILLARWKAMDERNDSISCRAQKTRDFMKVRTEEPRTCTGAMGVPSIVDDT
                     HSSYRAVHGTLVSPVSSAASVTPMLTSDEVRQRERAISVEASILTPPFHRLGCISTVP
                     QLAVNCTIGALAGLGAQGILYPLEVVKTRVVVSRSHEYKGGVAEIVRVAYHKGGVMEF
                     YRGFVPNMIGIVVYRGLEMGLYSSAQQSIMMYRMQVKKMKRHEASLNSAEVGVVGMFS
                     STVAQTVSYPLNVIRTRLQTQGTNGRAKKYSGMVDCMVKMIRNKGVTSLFSGLTANYL
                     KAVPASACTFVVFEYAQRLLVDDD"
     gene            1370520..1372430
                     /locus_tag="LMJF_34_3070"
                     /pseudo
                     /db_xref="GeneID:12981315"
     CDS             1370520..1372430
                     /locus_tag="LMJF_34_3070"
                     /pseudo
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /db_xref="GeneID:12981315"
     gene            1376169..1376243
                     /gene="LM34Cs1H1.1"
                     /locus_tag="LMJF_34_snoRNA0015"
                     /db_xref="GeneID:12981316"
     ncRNA           1376169..1376243
                     /ncRNA_class="snoRNA"
                     /gene="LM34Cs1H1.1"
                     /locus_tag="LMJF_34_snoRNA0015"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461080.1"
                     /db_xref="GeneID:12981316"
     gene            1376345..1376438
                     /gene="LM34Cs1C1.1"
                     /locus_tag="LMJF_34_snoRNA0013"
                     /db_xref="GeneID:12982065"
     ncRNA           1376345..1376438
                     /ncRNA_class="snoRNA"
                     /gene="LM34Cs1C1.1"
                     /locus_tag="LMJF_34_snoRNA0013"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461078.1"
                     /db_xref="GeneID:12982065"
     gene            1376499..1376570
                     /gene="LM34Cs1H2.1"
                     /locus_tag="LMJF_34_snoRNA0011"
                     /db_xref="GeneID:12982063"
     ncRNA           1376499..1376570
                     /ncRNA_class="snoRNA"
                     /gene="LM34Cs1H2.1"
                     /locus_tag="LMJF_34_snoRNA0011"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461076.1"
                     /db_xref="GeneID:12982063"
     gene            <1377722..>1379950
                     /locus_tag="LMJF_34_3080"
                     /db_xref="GeneID:5655083"
     mRNA            <1377722..>1379950
                     /locus_tag="LMJF_34_3080"
                     /product="putative exosome subunit rrp6p homologue"
                     /transcript_id="XM_001686360.1"
                     /db_xref="GeneID:5655083"
     CDS             1377722..1379950
                     /locus_tag="LMJF_34_3080"
                     /codon_start=1
                     /product="putative exosome subunit rrp6p homologue"
                     /protein_id="XP_001686412.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655083"
                     /db_xref="GOA:Q4Q2N6"
                     /db_xref="InterPro:IPR002121"
                     /db_xref="InterPro:IPR002562"
                     /db_xref="InterPro:IPR010997"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR012588"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2N6"
                     /translation="MPSTPADGALPVTKDVVSVVFGPVKEYSRLSAQLPLDDYDYHLA
                     FPGFRKHIRDYSETLVALMDACTQMLPKRRRTSLSAEADPRSGALHLLEAERTTVMEA
                     VDSLLESVDSLLDEVKGRKLDAQEQLSVTFGSELAASPSREGGVVADAASTRAGVLRL
                     AHIRRPQLLFDTPVDNSAAPFVPHYYDASGQYHVGVAGQHPFESVIKAFSIPASQILP
                     RAEVPPVPLDACPLTFVDTSAAMQAMIEKLLLSREIAVDLEHHDFYSYQGFTCLMQIS
                     TREEDFIVDCLKLRSSMGALAPVFLNPSILKVLHGAREDIRWLQKDFSLYVVNLFDTG
                     VALQTLHMPYSLAFAVDHFCQVKLNKKYQTADWRVRPLSAEMVHYARQDTHFLLYVHD
                     RLKALLLNSEGRASIGSVLVHVYNESKQLSLQIYEKPNVVPEETYKMALGRSLSGLNK
                     VQEKVARDVFNWRDSAAREVDDSPTAVLHLSSVLSIASKLPTTAKALLRCCAPATAVV
                     RDNVTLLVDLVKDAVASGEDDVAANVRLALTKRESAADREAGAMTAASKEWNFYRSLC
                     PMGVHRPMTGTLPSLASVAKTLAPAEVSQEERSALLSDTTPSPWFTSMQALSRVLAAR
                     PPQQVNLPGADVFAARQAAAAAAAVSVAAAEASKTAAEEYNESGAVANSRSCSVSEAS
                     QQAEEDESTADATTSAPDPDTMSKSIIPLDKGAFSIKQEYGIGAKAQAKKGGKAKTWP
                     KK"
     gene            <1381695..>1383335
                     /locus_tag="LMJF_34_3090"
                     /db_xref="GeneID:5655084"
     mRNA            <1381695..>1383335
                     /locus_tag="LMJF_34_3090"
                     /product="phosphatidylinositol-4-phosphate-5-kinase-likep
                     ro tein"
                     /transcript_id="XM_001686361.1"
                     /db_xref="GeneID:5655084"
     CDS             1381695..1383335
                     /locus_tag="LMJF_34_3090"
                     /codon_start=1
                     /product="phosphatidylinositol-4-phosphate-5-kinase-likep
                     ro tein"
                     /protein_id="XP_001686413.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655084"
                     /db_xref="GOA:Q4Q2N5"
                     /db_xref="InterPro:IPR002498"
                     /db_xref="InterPro:IPR023610"
                     /db_xref="InterPro:IPR027483"
                     /db_xref="InterPro:IPR027484"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2N5"
                     /translation="MPLNRELLASVKLEPVSDSDWVEEGHDKMNDGRSAGADGSLHPA
                     SDADENEDQNAATKNVIHCLKIALERGITSISLPEKQRPLNPQKDFSIESTMHFSASR
                     PAKGITCCGAEATGVKKAPNPQMRDARSSMIGGVYRQANRPRNEMSQVLTTDNAVLTS
                     DADMDRDCSGLATSGANFDTPAARARRAYRSLTRTQTFADFSSDDEDDEDEENMPPVS
                     FTFTDFSPMCYRHIREFFNVDPKAYCDVLRNSRWHSIPTPGKSAAQLFFCGRDWVIKT
                     MTEQESDFLRKILHRYYYHVRDNPFTLLPHFVGHHRLRIGTKTQNFIIMQNVFATTNT
                     IHEKFDLKGSTIGRFASEAEKRRTTFTQKDLDINSPMHIGPERRNLLIEQIKKDCEFL
                     KRSMIMDYSFLVGIHVLPSVSDTLSFSTSAGSLGMLTRTVTDGTLRTNLGLGYSMGGE
                     RPDNSGADASEFTRNGSRLDGRCFTADQGGMMSNKVPGLRQEIYYIGIIDILQEYNAR
                     KALENVVWGSLYDRKRISCVHPNDYAGRFIAFMSSIIV"
     gene            <1384819..>1386012
                     /locus_tag="LMJF_34_3100"
                     /db_xref="GeneID:5655085"
     mRNA            <1384819..>1386012
                     /locus_tag="LMJF_34_3100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686362.1"
                     /db_xref="GeneID:5655085"
     CDS             1384819..1386012
                     /locus_tag="LMJF_34_3100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686414.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655085"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2N4"
                     /translation="MEAPSTLNNYLSLVDDFFRKTFRDEMCLFVALKSRQYSESILGV
                     NMFAKNAASVSADAPPAAAMESASKLAAADVLSAADKPPTYVSNFLSISPRMALHRDG
                     RADGKMKVAYEFSVPRVCRLQQALTLNSRGAVTVVGSVKDLIEGLTAGVRASVNTLMP
                     ASEDVTVGHVHYQRGDKYSSLRYQRNGLGSSNLLLDCGITFFNLLLGAGFERRQLSFL
                     EHKEGSGQLDVMYVGAGFTGVNWSVATKIVRLNDAWSNARLTMLQRLSSTTAVACQYN
                     FDLIDTVAKVSLGFTQGIQLRVPMFIHTKSSAPVSASASRASPSSPSSLQMDGSAVAT
                     IPAWSTPLPLLLAAKAESDGNCSATLRGLFSNSIRWGIVMHTNLLEDKPLVKYGLTLS
                     MEYES"
     gene            <1389133..>1389912
                     /locus_tag="LMJF_34_3110"
                     /db_xref="GeneID:5655086"
     mRNA            <1389133..>1389912
                     /locus_tag="LMJF_34_3110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686363.1"
                     /db_xref="GeneID:5655086"
     CDS             1389133..1389912
                     /locus_tag="LMJF_34_3110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686415.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655086"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2N3"
                     /translation="MISQAKRHRIMSGVVTALVKRHPILTESRVRTVVVSVFCFLLAV
                     ALRLLFRYAQLSSNDAKRISGRRSRTAKDKKEHSKSHGGSRSRGGGGSSSKRKKTDPS
                     LPTLLMLIGIHGSGKSFWAKRYTEIVHKSYVLISSDAIRSRLTGTINNYTREVEVEEN
                     ILKEVTHTLELRRSCIVDDCQHNLSPEFRARLRALAPDGKVNRVVKIFSVKPSYAMMR
                     IQSDIEEGTARYAPTMVELEKQGEQVAEFEATNKDDDWMQN"
     gene            <1391743..>1392768
                     /gene="LPG2"
                     /locus_tag="LMJF_34_3120"
                     /db_xref="GeneID:5655087"
     mRNA            <1391743..>1392768
                     /gene="LPG2"
                     /locus_tag="LMJF_34_3120"
                     /product="lipophosphoglycan biosynthetic protein (lpg2)"
                     /transcript_id="XM_001686364.1"
                     /db_xref="GeneID:5655087"
     CDS             1391743..1392768
                     /gene="LPG2"
                     /locus_tag="LMJF_34_3120"
                     /codon_start=1
                     /product="lipophosphoglycan biosynthetic protein (lpg2)"
                     /protein_id="XP_001686416.1"
                     /db_xref="GeneID:5655087"
                     /db_xref="GOA:Q9BIR6"
                     /db_xref="InterPro:IPR004689"
                     /db_xref="InterPro:IPR004853"
                     /db_xref="UniProtKB/TrEMBL:Q9BIR6"
                     /translation="MNHTRAVMEAILAVITYSFCSVSMILVNKLIMNTYDMNFPFGIL
                     VLQTGGALVIVALAKAARFVEYPAFSFDVAKKWLPLTLLFVAMLFTSMKSLATMSVAA
                     QTILKNLAVILIALGDKFLYGKAQTPMVYFSFALMILGSFLGAKGDKWVTAWGLIWTL
                     LNIVSTVSYTLYMKAVLGSVSNSIGRYGPVFYNNLLSLPFFLIMGVGEIMPFSAAIGE
                     TTTLGKLVLTFSVLVSSVMTFSVFWCMSITSPTTMSVVGSLNKIPLTFLGMLAFHQFP
                     TATGYLGIMVALSAGFLYTHLNIRANRAKASSDLEHQMQQTGKTTTESIVLVRTDENS
                     SDNFKSE"
     gene            1395294..1395368
                     /gene="LM34Cs1H1.2"
                     /locus_tag="LMJF_34_snoRNA0016"
                     /db_xref="GeneID:12982067"
     ncRNA           1395294..1395368
                     /ncRNA_class="snoRNA"
                     /gene="LM34Cs1H1.2"
                     /locus_tag="LMJF_34_snoRNA0016"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461081.1"
                     /db_xref="GeneID:12982067"
     gene            1395474..1395567
                     /gene="LM34Cs1C1.2"
                     /locus_tag="LMJF_34_snoRNA0014"
                     /db_xref="GeneID:12982066"
     ncRNA           1395474..1395567
                     /ncRNA_class="snoRNA"
                     /gene="LM34Cs1C1.2"
                     /locus_tag="LMJF_34_snoRNA0014"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461079.1"
                     /db_xref="GeneID:12982066"
     gene            1395628..1395699
                     /gene="LM34Cs1H2.2"
                     /locus_tag="LMJF_34_snoRNA0012"
                     /db_xref="GeneID:12982064"
     ncRNA           1395628..1395699
                     /ncRNA_class="snoRNA"
                     /gene="LM34Cs1H2.2"
                     /locus_tag="LMJF_34_snoRNA0012"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461077.1"
                     /db_xref="GeneID:12982064"
     gene            <1396688..>1397845
                     /locus_tag="LMJF_34_3130"
                     /db_xref="GeneID:5655090"
     mRNA            <1396688..>1397845
                     /locus_tag="LMJF_34_3130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686365.1"
                     /db_xref="GeneID:5655090"
     CDS             1396688..1397845
                     /locus_tag="LMJF_34_3130"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686417.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655090"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2N1"
                     /translation="MDEAETASSYSDSVTSVPTNRLQLHMMHRRRLYKQYAMDLSMWA
                     DTHSYYQLMMWCHDHHVFVHPTVEMVRHRSAFREHVFEVKEDVDAFTPLLAIPEDLII
                     GFKDANTESSDPSASTDDRNNLYDAKREAEFHKLNTGENSNADICQFFFASLGMIVSD
                     LITAKSSPLTDPRHLFAELLSKVPTLQNAPYFDEEVVFDSNETCLADVLLQMIRNYIN
                     GGPLVNKVPLHELRWAVSVSLSHSTPLSIGAVRSIGIVPVVHLFPHGGTATNAYVVAR
                     TSRDKSAEKMAIFFREKFGYDFQGQANAKWIYVVPERPLKAGEAINLQVMAPVCEKDS
                     EAEQMWRLSCGTVPESYMSSAQASARQEAATRFIVEQGEALWKASRAKRLL"
     gene            <1398724..>1399491
                     /locus_tag="LMJF_34_3140"
                     /db_xref="GeneID:5655091"
     mRNA            <1398724..>1399491
                     /locus_tag="LMJF_34_3140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686366.1"
                     /db_xref="GeneID:5655091"
     CDS             1398724..1399491
                     /locus_tag="LMJF_34_3140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686418.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655091"
                     /db_xref="GOA:Q4Q2N0"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2N0"
                     /translation="MSHSRHSERRESRRERRKESRHSVKKHRHHRSSGGSSRHRHNVI
                     NEKNPVPRDFHCHICGKTHWTVYCDRLQQHPENYPLMDAERGCRQCGQQGHSASQCRI
                     KKYLCRDCGGMHDTRDCIFSHVGEDWYEFYDPKTRHVYYANSDESQIQWNPPTHELDT
                     IYWYCSRCQVMISAKFRECLLCHSIRPESKQQETLTTDSNSDSSSSSSTSSSSSSTDT
                     SCISRSSSSSGSASSSDSSSNDDDKRSAAGRLRDRAP"
     gene            <1400660..>1401940
                     /locus_tag="LMJF_34_3150"
                     /db_xref="GeneID:5655092"
     mRNA            <1400660..>1401940
                     /locus_tag="LMJF_34_3150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686367.1"
                     /db_xref="GeneID:5655092"
     CDS             1400660..1401940
                     /locus_tag="LMJF_34_3150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686419.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655092"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2M9"
                     /translation="MELVSTNSAAQRRPVGVSPYRVPPLSGLYRMRYYPPTPGGTSSD
                     CLRTESGAEGSRDAVSGARPACSATTGPLAQAGASSVAALHEAVHQQLLRTSSLLDDG
                     IDLFALYSLCEVEPVPCKLCTLHMQTTLNTCSYRLRQSYELQKRGADPSLNCLMRDAE
                     TSNEVAASSATESSPLIRILQQGWYVFFFPMSECGRLKDNLLVYVGEALIAGDVAECD
                     LTNARCLRPLKTATTASALPGAVNGPLRGTTTAGASKSTSATSQRWKSLFYYVVSPIP
                     VHWGTRESADVHLTILWRSIPAAYPEHHQRKRNLTILYSYYCSPRAPDTFTCRAHFPS
                     HTRLRLVRSPNCDTKVQLRSNVTERMATVHVETKDGKPLEIHRHRRDYVFVLQFLLGE
                     DSGILEESSVFAAAVVAIVFLLLLWLLLTKDLIL"
     gene            <1403079..>1404845
                     /locus_tag="LMJF_34_3160"
                     /db_xref="GeneID:5655093"
     mRNA            <1403079..>1404845
                     /locus_tag="LMJF_34_3160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686368.1"
                     /db_xref="GeneID:5655093"
     CDS             1403079..1404845
                     /locus_tag="LMJF_34_3160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686420.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655093"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2M8"
                     /translation="MSSDYSRVCAAEKASESHPPGYSRDALETELREGFRKQQQQVNK
                     NRQVEQMALAKGLGESATTSLKDGFYIPHKVLPPLKPEEKKLFERIDIMKWCGRAGRK
                     LEDSAVAPPPTLGEVPAEHQPMQVQEHQASTEADAEDALSTSVSSTASSLAALKDNSS
                     EDVRHLLHQLRSTSRATSSLRDARAEVDDNIQAVEEALLRQSSPLSFEDLLDTAARLL
                     AAMERGELTEDVVVPRGADVSTEKDEGSPGSPADSAEAPLSASGSTTRVLHGAVEVET
                     YTRKHLLPRAYQVVAIAHTAEWILQYTMAYLRTTVAVNQDEAFTRLTLLARCVRLLGD
                     IENFSSILLSLETKCEEYAGFAALKDTAEKHLGTLLDDVETSLDAILSAPFPSRRSRL
                     LLLEGGIQKKLQRALLFLNEIDYSWTPHVRFHWAWKVQLLSASFHRIHGLISRKHMQC
                     SMGFVDDSLYERVADTRITGRYMGASPVQPKVLRAQQVEYEKITEGLTFQQIGMSIKG
                     VASLLIGEQLCMGARYILCQSTKQFDPVWGFHMDEISTAPTQEELSAMAAKIAVHAKE
                     QLTARPTIARKEHSSSTFLTQM"
     gene            <1406581..>1408287
                     /locus_tag="LMJF_34_3170"
                     /db_xref="GeneID:5655094"
     mRNA            <1406581..>1408287
                     /locus_tag="LMJF_34_3170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686369.1"
                     /db_xref="GeneID:5655094"
     CDS             1406581..1408287
                     /locus_tag="LMJF_34_3170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686421.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655094"
                     /db_xref="GOA:Q4Q2M7"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR010261"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2M7"
                     /translation="MESATAAAAPTACVYVLSDVDGYKYKLVMQGDLQLLTVRKVKRY
                     LQRAAGIDPAQQLLTFNSVALDDTMSGKEAGFFDGAILRLQQVYSSSAALAQCISADG
                     SSPFHSAHGGPGCASSFTAPPRGAQDPGTRTSPRGNGSFFAEASPRLSAPATRGAVGA
                     SQLISSPHALPPLLRCLSPNQLAGGAKREAHDAVSCTRRDVVAGMAYSSPPELAGTTG
                     TTASTPQVIPGRTSSASSADGDGVHVYYRELEERVAALSLDNVRLREQLQAVARQAAE
                     ACTDGRHEEELKRLKAAVAVAQESVKDAERAAANRWRVKEEELVKELDLLREERRRFH
                     EESTAQEAKLRELVHSMEGEIRGLKYELHDKDEALQAARLSLAELRSEKRSWTDAVRR
                     GVDICPRGEASHPFAPAASRHARIPLQQRQHGCSANIDELAETAMEYLTQAFESATPL
                     ELEPENDTCVVPVADDLNVLVTLDRETERLYLYVTLLNHLPSSPTQRMRLYEMLLEGA
                     LLGKDMAGGGVGVSPESNLVLMSVSANLRHSGASALAATAAPFVIAAQAWTKSIDVLL
                     NT"
     gene            <1410013..>1411227
                     /locus_tag="LMJF_34_3180"
                     /db_xref="GeneID:5655095"
     mRNA            <1410013..>1411227
                     /locus_tag="LMJF_34_3180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686370.1"
                     /db_xref="GeneID:5655095"
     CDS             1410013..1411227
                     /locus_tag="LMJF_34_3180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686422.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655095"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2M6"
                     /translation="MTAVPTALWFAGLYEWSAVPKFLKSKMLQEAEQLTLYMHERSAY
                     RLAKAAADTASISELNRLRYDSSDSKGMRGTAIRVAPLVESERCTHEEEVLMTASPHC
                     SEFGYSSSAASEEREMDAAKPTTRSQQQQPQQQQLTLWTASPPSSIPAEWGQTRNAPV
                     QTASAPSLSAAREGGSVVAAVSLARFPSQPQQKDSYGSEAAPRPTAPPPLRASPLHRR
                     NCGSTVYSLTTLSETMDDKLNEALLYLEDGGNEVGEALVERREKEALLLIVTEDDLSG
                     TRISSAEEPMASASQRAGLDDGAEDRDDVLGNTPASKRWSLKRGREEATRGGRTSRSG
                     NRRVFREGGDGRRLSRGGCPKSTCAAELLQSLRDDAENAPPPQHLTRADIRRAHSNQP
                     PQEDSQVVFFDH"
     gene            <1413910..>1415442
                     /locus_tag="LMJF_34_3190"
                     /db_xref="GeneID:5655096"
     mRNA            <1413910..>1415442
                     /locus_tag="LMJF_34_3190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686371.1"
                     /db_xref="GeneID:5655096"
     CDS             1413910..1415442
                     /locus_tag="LMJF_34_3190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686423.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655096"
                     /db_xref="GOA:Q4Q2M5"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2M5"
                     /translation="MFRVFSGSCMSLEDMDTVLRSNLVEHPHLLGPGADFFTESGEPV
                     RPQPGAHTFQKVFSGSALDLNAGNAEVSDEEVTATSPLGQGPRPIPPSSILNQISTEN
                     EKEKARAAKMKIHVLVIGESGYLASHVVAKLLDAGYSVRMTVPDAARQQKQIDLYGAS
                     RDVAQRLTILQADVTNSNSLRDAIRGCRYIIHCGCSSASPQAKDLVVLYTKAIRALFD
                     GIRLSGKSTVKRVVLTGAASSIVHITECDPPSGLFDESNWNSVATPEDDPLPFAKLVF
                     EREAWRLRQMMGVELVVLLPSISIGPSLTDETSEAMVTIEGLANSSKYFPFCPNLSWN
                     FVDVRDVADAHVRALEVAEARDQRIIISNECVSLPELCRMMKQLCPQLTPPTHTAWTF
                     VTLGIATVVLWNSVNLRFLWRSLGVRKRLDNRRAKEQLGVSFTPMQQTLRDCLDQMSR
                     SAKATADAEAAAAAQHTSTNGKRKAAAAPSSLRLVSPAVILSLLTLAAASAAVGRYVK
                     RK"
     gene            <1421100..>1424309
                     /locus_tag="LMJF_34_3200"
                     /db_xref="GeneID:5655097"
     mRNA            <1421100..>1424309
                     /locus_tag="LMJF_34_3200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686372.1"
                     /db_xref="GeneID:5655097"
     CDS             1421100..1424309
                     /locus_tag="LMJF_34_3200"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686424.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655097"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2M4"
                     /translation="MWGGLKKRTHYGDVFRRWSASQGLDVLRTALYKEPRPWYIAYTL
                     HQANHLLQDHHCARLLAWSTSIVELRPSLAGKQEAYRYTQEMFSIFVRRHKVGQQSLY
                     EYMRLCAVGKDLSSAFDWFKYWQEAQLGAHDTLSSLSWLLRVAALSPNDERVEDMALT
                     VLELYTERFALPSADTTAKNAAAATTAASPSFATTSRHFQPTTPVEEAELRRFFCLFQ
                     QLAPRVEANAQIRAFLETLPVCATEALADCAAAGWPTDSAHRVFPQLEQHISSDLTKV
                     GLGKGSNASEDESRRIGRDSLPRLRDSLLHPSFIAKLEDSAAQHNAAAVVALVEDYEE
                     HVRHERERTGSDRVPAVRKRTREGELWRLYADPTAMAFRRRLVEEGGVTPELYHYLIT
                     ALAATQPSAAVRTLTRMEEAQLRPLDVTRATVLVAVQDCAEVRLRLFQQQLEEMRLRA
                     RLDEDYDTVKVVEAYWKYDYVDFFHYRNALEKKEFYEFLLHRIGPQALQQLLLDAQAH
                     GPTATPEDLVLLDEDLCTASYRYFRAQVGRSAVERALDGISTHMPKLDMGLVGTLPHF
                     GDYCMDGDDSIAHSTAALQGLVQPYETIYVLDTSFVETSEAFFTVGAASPSLVLVPYL
                     CLLQLAESVANADRFVTFDPALQQMTRTEPFLASQRLRGLFAMISAPAASRPAGAGRR
                     TRVLHFTECICANQVDQQVLDALGLSPSSSDNDQLLLILAMLSSLKAPKTRLVLCTDD
                     AQLVEQLECLRSSSLFGSAVDVIRTAPPKQLDLEKNLINDNPVLNGADEWGSAEAFEP
                     RLRIAADLRALSEDKAGSVAGEPQTVADSSVTGRDAVCSSHGEAAAGVERGASSNVPM
                     KVPVAVSSSMDSPWLELLKEEGEEEEDTVEVARAAPASTREVASTSATAPPPLPAMSP
                     VEQERRARLMDLYESPFDVVPVGVRMEEASTVGSVFTEFDSLEPELREARAADRAAAR
                     SSLSLEDGKANKRGGGKTRRRRLSVLEEEVLANRGASNKDRFQMARQLSNWSGGRVPF
                     NLRYRVVEANVRDPRNSHLRSAYEAALAKKRFSFKQKHG"
     gene            <1424908..>1425543
                     /locus_tag="LMJF_34_3210"
                     /db_xref="GeneID:5655098"
     mRNA            <1424908..>1425543
                     /locus_tag="LMJF_34_3210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686373.1"
                     /db_xref="GeneID:5655098"
     CDS             1424908..1425543
                     /locus_tag="LMJF_34_3210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686425.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655098"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2M3"
                     /translation="MAEQLGASLPTGSAAAAEGPATAAAAASVDWSYVPLLSSTTFDY
                     FTERYYHQFSIRDCKKVKGNDCRILQHSNGLCVLCLDPNHELVRRCAPADTGVTVTKV
                     AFFKGRTAIVPESIQVVGKKKKNALVCQTDTKLCGIVLSDGTEYTIPACVNGFVLELN
                     ATLLEQPWMVAMAPIAEGYLAIINPTSKADFSGYEKIWTATGGDAVGEDED"
     gene            <1426577..>1430050
                     /locus_tag="LMJF_34_3220"
                     /db_xref="GeneID:5655099"
     mRNA            <1426577..>1430050
                     /locus_tag="LMJF_34_3220"
                     /product="putative aminophospholipid translocase"
                     /transcript_id="XM_001686374.1"
                     /db_xref="GeneID:5655099"
     CDS             1426577..1430050
                     /locus_tag="LMJF_34_3220"
                     /codon_start=1
                     /product="putative aminophospholipid translocase"
                     /protein_id="XP_001686426.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655099"
                     /db_xref="GOA:Q4Q2M2"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006539"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2M2"
                     /translation="MRRIRYRALHSGADEEDTRSCNSSTPNVFTSSAHGPQLPQQHCC
                     RSRDLVIVDSLGTGAAASVLTIPQQKKHSLRRWLRELLHLAIAPSPDTRQIPFGYFPG
                     EWSPVGYPSNAVSNRRYTLSTFLPLALLRQFQNFFNFFYLFLAFSQVIPVLKVGFIFT
                     YFSPLILVVCLSLMKDALDEWKRFRRDRIANVEVFEKLTGGGDVVTVRSAHIRVGDLL
                     ILHQDQRVPADCVVLHTSEKSGTTFVRTDQLDGETDWKLRYPLNSTKSLGYTELAALR
                     FNVRCGAPHKDIYSFAGTLELANGQIESITMENAVWSSCVVATGTLVVAVLYTGRETR
                     SALNSTSPRNKRGLIEGELNLIAVLCFALLLILSFLLVAQQQFRGDFAVMFVRFFILL
                     SSMIPISMRVNVDVGRLWYSYDMSHDPNIPGTVARNANLPEELGRLRYLFSDKTGTLT
                     KNKMKFRVMQVGPDTVLTDRFTDQLSCALQEYFGTGNGGAGARLMFGNVSARLSMRNS
                     KQWSRDVQRVGDLIRAIVLCHNVSPVVVEPVVLGTGNETTAPGRSAAAAAPDTADMTS
                     EPTEYQASSPDEVALVKFCRSLGIVLTYRDLTSIAFTVGGGAQLHTYTIVKTFPFSSE
                     RKCMGIILRERAGSCSGGSAQETVKFYMKGADEKMASVVRQSEWLDECCQELAQMGLR
                     TLVFASRTLSEEMLGAFLQQYEAALSILGEGRAAAIEAAMKLLETDMILTGVTGVEDE
                     LQDDVVVCLETLGMCGIKVWMLTGDKVETATTIGRSTRLIPRHCRIEYLCGMAPADIG
                     RRLHELQEEFCWGATCGSIVPPWTLVLDGNALAYCLSHASSFADVARTAYSVIVARCS
                     PTQKAAVVTVMRDSCRDARVAAIGDGGNDVSMIQAANVGIGIEGVEGKQASMAADFSI
                     TKFSHCLRLIMWHGRNSYQRTCRLSQFIMHRGIVYSVVQTVFSVLFAGTTMSVFNGYL
                     LMGYSTVFTMAPAFALVLDEDFNESDVHEYPFLYKDLLKARSMNTRTFLQWVWASFFQ
                     GGVMMLMALQLFKSDMFQIVTIAYTSLLITELVIVGATAHLRILWRERRARFFLFLCS
                     EVVSLLMFFLAVVVLPDTFDRDFFFSWSCWWRVAVICLASIAPLMIFQMVGKYILFNP
                     RVAVSCMGCRT"
     gene            <1432359..>1439057
                     /gene="REH2"
                     /locus_tag="LMJF_34_3230"
                     /db_xref="GeneID:5655100"
     mRNA            <1432359..>1439057
                     /gene="REH2"
                     /locus_tag="LMJF_34_3230"
                     /product="RNA editing associated helicase
                     2,putative;with=GeneDB:Tb927.4.1500"
                     /transcript_id="XM_001686375.1"
                     /db_xref="GeneID:5655100"
     CDS             1432359..1439057
                     /gene="REH2"
                     /locus_tag="LMJF_34_3230"
                     /codon_start=1
                     /product="RNA editing associated helicase
                     2,putative;with=GeneDB:Tb927.4.1500"
                     /protein_id="XP_001686427.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655100"
                     /db_xref="GOA:Q4Q2M1"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2M1"
                     /translation="MSAAGGSGTPRALWAHGVANTAKEAELLAAMHAEQMADLLGYHV
                     FSLPSRQHKHAEAARAAGRYASSPEDKDSGPSTEQRLAQWPLPLRRVLTDEETEGGEW
                     QLVNTATSLRHYISKEHTLLSPCLLDPKSRLRIEALFARAPHGCPSFAQQLRTERVRT
                     LTASSAAGGGEEAIVARLLLPSQVTGITNSSIDLVASGKAMERSTAVLLACMHAELLL
                     DAVGVAIFDDAVTQKAHAMAAWSHGRPAPLPGAKPKNPSHVHLPQPLKELVVAAAGDG
                     RSRTSSRSAEEDWFHRHTIVTEQSGTFVETVVGESTAMEDITAFLHTHGAMRAAAPFL
                     QVAIGSRVKSTVLLPLPDLYGIRGGVGIASNAQDADTLAAMHALDVLCMLGVPVKATA
                     AMDAAWKRVRRERIPDVPCESADVSTPSPPARRCTAKKLATQVAIAAAALSEDFVSVD
                     AAQASSCNHASTSTLPRRRAVKRARLASDASAPDDSIPQANATDTTAASPPNVPVVAT
                     LRETGEKRLAAVRAVVPKEFWDMQADSPDGYIMIAPGVPEGSAVAAYAITSPRKMDKS
                     AKGRVLDYLATVGRRLDDVTVVRQALSEEETEGPPRHRCALKVPVPAVCGEARLALGE
                     ADTVADAENAACMHAELILDTLGVCLYTDSVKQKRHAAACAQWGRWAPSTPGEEQPSS
                     TPSPPPLRREPAGSLHRERQKERQKKRGGRFGTSQRAAKTDASAAEVADQAALVVDTE
                     VFDNVVESQLDTVSKTRVQYYLRYENLKAPSITFTANMGHSVLLHIATWSLPVPARYG
                     SETEAPKCLEYAVKGAASTRRDAELLSWMHAERTLDFLGIPLFPNLPKLQAYHAQRAQ
                     VEGRVAPAVVTGPTAPLPHPSEVTVKPLRLHMSFCRVDLTIPPPPCPSTDMEGNSCVP
                     PHEWEAYVEACAVYVLAKQMALKNSFYEEQRVPPTGDVVIDAALAEAEAKPVDTDARL
                     RFAAYCMATLGKFVQRYDAYVVGPIHHRVTYATIPLPGFDYLLGRGVGPNKVVAKRRA
                     AMHALAILRRVDESYDDTFQVVKSFVQRAKAANKVKGDAQAHADDEFDLDTFSTLPLI
                     NADAESSLTRQERRHLDRFSSLFVAQSAWYSKSSCFTLDGKKRAVRMYTVCFDLPAPE
                     ERQLVRLLPREEGESVWRRQPLADTVKLEVESVEATAPDATRVKTGAIFSACVSIVDE
                     DGQKLTASCSGGGRVDNMLSAYEKLFTMMDRQFPAMMSIVELLKQNPYLMPELIPSLA
                     IPDAVRQRMQACLSNQKDLTTAMTCSDRKASSKRHKPNLAASDEEKTGGEAENSSAVA
                     HQASYSEAEESARLVEQLQRRITNPVYLEKFATRRAELSIAEHKREILEAIRSNPITI
                     ICGTTGCGKTTQVPQYILDEETLRGNGGRCSIVVTQPRRLSAVSIAQRVAAERLEPLE
                     ESTGYMIRFDSRKGRHITFATTGLVLRLMQSDALLSSYTHVIIDEIHERDMNSDFILM
                     LLRQVLEKRRDIRIVLMSATLQAGDFQAYFGGAPLIQVEGHIFPVKEFFLEDLVPFAR
                     EHNCMTPLLKEAAGVVGSDGEREGNAATQPEVGGARVPVVVSNVDDAAASIPPTRYGF
                     LEASTAIDYPTIQFAIEQALRMIDIADSSILVFLPGWEDIRKARDVLERNTSFYVLPL
                     HSAVSAESQLKCFLPPPPGKVKIILSTNIAESGVTIDDVGVVIDTGRMKQVAYSTRMR
                     NVLSKTDSRGYDSSRVQDALDVTSTPGVPEDAQGKFSHLMNIYASRANCVQRRGRVGR
                     TRPGLCIRLFSREHFRTLHEFQTPELLRTPLDRVCLTILNLEVGSPQQFLKTAMEPPL
                     ETEVEGAMKRLYDLGATDEDGHLTPLGRRLAKLPLDPATGKTILLGAVFRCLDAALTI
                     AATAENGVFSRSFDVRVSSRLHREDLSCNTLSDILASVNGYNYWVSLHRGGLGGQAAG
                     QIKARHLSVSALMQATLLKQQYCNLLVEDGFIGEEAKVLPSTNRSRFGSDDMVFIESS
                     EHSRNSMDVGLLKCLLSASALPKVAMITGPFVLRTLFENYIPMMNDSVLRMSGLTETS
                     NPFVIYGGLMKIAEKETLMAHHLTSVPLWSVLLMSTRATRMDYDQELKLGIVSNWIFF
                     RSSYATIELVRRFKALLDRRLSRKFDDPTDAVNNAQLDELCEILRELANMRYHPNRLQ
                     PPSVVWGEQGKLLSPDSNADDDAAGATSETGVESSTESGLTE"
     gene            <1440355..>1442220
                     /locus_tag="LMJF_34_3240"
                     /db_xref="GeneID:5655101"
     mRNA            <1440355..>1442220
                     /locus_tag="LMJF_34_3240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686376.1"
                     /db_xref="GeneID:5655101"
     CDS             1440355..1442220
                     /locus_tag="LMJF_34_3240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686428.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655101"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2M0"
                     /translation="MDYLRSASSGTLAASPHYLGGVSDSLAHLPPLYQLLSLGGVFCV
                     IHLRNNAVVTWLVVQLHSSIGTEAMWPEEYKATLRAMTFTERLCFTLYGAALAAVAVV
                     LFRVFCQDTWKIGLSAGQMFPDKKLPTIAMVVFMCVAEGIRLQQVIVQELYTPGSLAR
                     LAMHGFDGIEESEYDQRVSESNTHFVIQFELLRAYLAQACVHRVPVILLAGAYRLFRD
                     VPNKAHVALRWYMATMAGFTVAQEMLRMYIRHVWTDWSLWVMVIWSLVFLGVVNYVYG
                     LSKRAGTVVTISSTNCVKEALRGLVTCGSLWLIASLIVLAFVVSVHEELVLIWLFMSL
                     MILWTPAIIDACATDYMAFLAIGAGCMVYAMDGVSSVWASVRFGVLHFLWWFFPSLLY
                     NATLHLFASRYIAMTVAASWFLWSLAPPSELLKNAESAAELGLEDGHGVVHLFTARVL
                     WLRAVADFRTLPEGSWIYGLTQGDGERAFDLILHAAASACAVCIAISFAVERRFTAEA
                     RLAWRQRDIVSATPAVLLRKMIRTVVVVGCVAASAGMWWVVRHYVLPMWTQLLPDIIS
                     KLLATVAAVTVLGNLMDMHDSMYIACMRILGLPDPLFRIDEQAAASDDMASSATS"
     gene            <1443491..>1445143
                     /locus_tag="LMJF_34_3250"
                     /db_xref="GeneID:5655102"
     mRNA            <1443491..>1445143
                     /locus_tag="LMJF_34_3250"
                     /product="putative pyruvate/indole-pyruvate carboxylase"
                     /transcript_id="XM_001686377.1"
                     /db_xref="GeneID:5655102"
     CDS             1443491..1445143
                     /locus_tag="LMJF_34_3250"
                     /EC_number="4.1.1.74"
                     /codon_start=1
                     /product="putative pyruvate/indole-pyruvate carboxylase"
                     /protein_id="XP_001686429.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655102"
                     /db_xref="GOA:Q4Q2L9"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="InterPro:IPR012110"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2L9"
                     /translation="MPFNGYTVGCHLLDRLVEAGCEHLFGVPGDFNLRFLDDVMAHTR
                     MKWVGTANELNAAYAADGYARQRGLGAVATTYGVGELSALNGIAGSFAESVPVIHIAG
                     AASTKSQGNRELLHHSLGDGNHMHFLNISAEVCCIAVMLTPENCLTEIDRVITEVLYQ
                     KKPGYVALPTDVAEMIVPPPAAKLTRRLPEVSLESVSAFKHTIASRLHSARNPAVLTG
                     HLIHRHQCGPQVNHFLENIRIPYAPAVLGKGAVNEHLENYVGTYIAGDEPCPSKSIIE
                     SADVCISIGVQFVDTVTSVFRHKIDPLKMIDIQPFFAKVGDQVFYQVPMEMAVKAVEE
                     AAMEFHTNWSTEYPEPERLRYPESPDTFDLCHVWQEINNGLRPNDVLLVDLGTSSFTS
                     ALLRLPQGCDMLCQQMWASIGYTLPAAIGAQIADESRSVVCILGDGAAQMTVQELGTA
                     ARYKLKPKYILINNDGYTIERYIRGWDSSYNDISVWNWTGLARNLCKGAEPRTCVVNS
                     VGGVEATLHEKQDNMVFVEVLVGKYEGPLRSPVLLPGKPASK"
     gene            <1449793..>1451787
                     /locus_tag="LMJF_34_3260"
                     /db_xref="GeneID:5655103"
     mRNA            <1449793..>1451787
                     /locus_tag="LMJF_34_3260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686378.1"
                     /db_xref="GeneID:5655103"
     CDS             1449793..1451787
                     /locus_tag="LMJF_34_3260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686430.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655103"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR011084"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2L8"
                     /translation="MDLGQSYIFSLSTGVCLARVPETPHHPRVQALLSPPAASSKGQA
                     QEKAGDGMFVVRLIPANHCPGAVMFLFVSPVFGTVLHTGDFRFNGSRETWEQFVRSSN
                     RRQTYVPPSPCLIKREEEQHASTAAPPAPVYEQFIADDEALRDVAQRQLLDVLLLDNT
                     FCAPAYRFPSQWEVTQRVIEVLRSLFHRAACRARVPAPSAGHPQHRQVRCAVLIGCYT
                     IGKERVALALRDAFPLVRSSEQSHARDPLKGSQRHANTSEPASWRIHVSPSRYALLSS
                     IGFFEECFEPLKASRSSGKVVTPRDADKGASSRPPTETAHVEDVPVLLPVLLSECNAQ
                     GAQRKSVASGLACKPEETRSSAAPPVRPSLAVALDTVDGAGNQSAAEGRVEEVEHLLS
                     VFLVPMASVGYRAVAALAHADGPAVMDMEDGLALNLDRYDQVLMVEPTGWSKRCVARE
                     VSEKYTLLRVPYSEHCAFHELLEFVAFVNPARVVPTVSEEGFKQYEALFVERSPRLRS
                     RVSNVQPITRFFSVLPVHQAEAPTGERREDTAATVASSAARMVLDGSSVSLAGAIPVE
                     EPAVDDAQTATTASGVARKRARAQLHVATVAVPTSTTSTTATTSSITCTLEHLFQKVK
                     RDAAHRSPERQPLEEVVAGEDDDCQVVGVVQAVVEISDDD"
     gene            1452743..1453609
                     /locus_tag="LMJF_34_ncRNA1:ncRNA"
                     /db_xref="GeneID:12981317"
     ncRNA           1452743..1453609
                     /ncRNA_class="other"
                     /locus_tag="LMJF_34_ncRNA1:ncRNA"
                     /note="slpiced leader RNA (slRNA)"
                     /transcript_id="XR_002461075.1"
                     /db_xref="GeneID:12981317"
     gene            <1454643..>1455197
                     /locus_tag="LMJF_34_3270"
                     /db_xref="GeneID:5655104"
     mRNA            <1454643..>1455197
                     /locus_tag="LMJF_34_3270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686379.1"
                     /db_xref="GeneID:5655104"
     CDS             1454643..1455197
                     /locus_tag="LMJF_34_3270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686431.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655104"
                     /db_xref="InterPro:IPR025487"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2L7"
                     /translation="MSGIACAASVRVSVGPSVSSSLDHSTQAALRTPARHKASTIRIA
                     NRKKVEMFVGKRYYLPTRLRVAAPDIAAEWDHEKNPMHLYPDIVSIGYMHPVYWKCRG
                     CASSYQMSVEKRVVRGGGCPVCEDREMSRSMAFNTAAMGTGSAHAREADVECGGATPP
                     LLPGEENRSLRPKRTTMLNLRTKY"
     gene            <1456728..>1458161
                     /locus_tag="LMJF_34_3280"
                     /db_xref="GeneID:5655105"
     mRNA            <1456728..>1458161
                     /locus_tag="LMJF_34_3280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686380.1"
                     /db_xref="GeneID:5655105"
     CDS             1456728..1458161
                     /locus_tag="LMJF_34_3280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686432.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655105"
                     /db_xref="GOA:Q4Q2L6"
                     /db_xref="InterPro:IPR001607"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2L6"
                     /translation="MEHIPFCVADAAACSFSGCAIVVLACQSMQDVLSVLQVCTEVAG
                     QGNDVRTSSMYIKAFPCLEGAPTTVDAQVLASYYYIPTCPMCGDRLECTITGYGSQTP
                     MCTCAQSGSASQCTCFLCSSCHLCRRFADSLEYAQQQPTAPAAIKCEACAKAGDPWIC
                     LICGYVGCSRYQAMHAKDHCVAQQHFFSMNLLTQQIWDYDGDCFVHRVVILLDSSTGT
                     STWMQFPGRDEPMLDDAVAGENAVMAAAVGDTPEAWKAEKKSISAKYDKKLTSSHAQY
                     AMVIKSELDAKRALYESQLAREAGSGDDDEEGLEETELDTGTASTRAEELERCEYMDL
                     ATAFEPLESVMMDLGEKRRKTTALLYAVKNLKHELDTRGEETTRLEKQLESCTTALRS
                     VIQQNVATDLRLSSSIRELKETLQDIALNAETQRRLAAQLGEQGVSRVVLVGGSGGSG
                     GAGKARNGAAAAGRRSNENAPPSDAAK"
     gene            <1459629..>1461065
                     /locus_tag="LMJF_34_3290"
                     /db_xref="GeneID:5655106"
     mRNA            <1459629..>1461065
                     /locus_tag="LMJF_34_3290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686381.1"
                     /db_xref="GeneID:5655106"
     CDS             1459629..1461065
                     /locus_tag="LMJF_34_3290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686433.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655106"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2L5"
                     /translation="MTAHHALLLGSLVDDVDLSVRRGAQADTLTVDGAADRLLSAIAS
                     YTKSAAATDVDVEDNGEAAQETAALSLMAHMQRLSLLCNAARTPETSCTSAGEDNIHK
                     CVDDWAKWLLGLESKPIVLASKVALCLPPLQACWRGGSALDGAGSAHIDRIEEAIGSF
                     FAHAARRCVTEWTTHGAPLRTLLPPLALLTTYARFRWAWSRFTELRHVGGGEHLGEAE
                     GGIAVVGSSDTVQRQENRDIDFLGIAGEVESCHAAKLTREVLLHSLKTIDWRVGSAVP
                     AVKEVAPLFWCVFLRCRSYALHSCSQCRSSSSDFFAHEASARLVAQVLRCTVDGVRLC
                     IERQAADMHVARARQLCTCDIPCLVLLTRLWFSWIALATDAAAVLLPRLERSLRQLVS
                     SVVKLRGGAETKPPPSSVAAALAENSAEASWTEQETLFVEVAWKVAPLSMSEIASATA
                     AVPWTSEFVRASEVQAVLEKRTLVAPVP"
     gene            <1461820..>1462461
                     /locus_tag="LMJF_34_3300"
                     /db_xref="GeneID:5655107"
     mRNA            <1461820..>1462461
                     /locus_tag="LMJF_34_3300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686382.1"
                     /db_xref="GeneID:5655107"
     CDS             1461820..1462461
                     /locus_tag="LMJF_34_3300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686434.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655107"
                     /db_xref="GOA:Q4Q2L4"
                     /db_xref="InterPro:IPR002036"
                     /db_xref="InterPro:IPR020549"
                     /db_xref="InterPro:IPR023091"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2L4"
                     /translation="MKTFRYLTITGDTITLRRGARHVMHLLLTLERAPYDTRLNLEFV
                     SLAHMRQLNYKYKGLDRPTDVLTFAPAGEADSFVNDLLFGDFLERGDGDKGTGATLTA
                     SPTCAAAVGAGPNALTQSIIRGELVDLGNIFVSLDYMRLRCRRYPSTTLPLAPYLHAA
                     LVHATLHALGYDHTSRALLQQMARREQQLGRQLAMIARQHPRCLPPLNIWDSM"
     gene            <1462935..>1464506
                     /locus_tag="LMJF_34_3310"
                     /db_xref="GeneID:5655108"
     mRNA            <1462935..>1464506
                     /locus_tag="LMJF_34_3310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686383.1"
                     /db_xref="GeneID:5655108"
     CDS             1462935..1464506
                     /locus_tag="LMJF_34_3310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686435.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655108"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2L3"
                     /translation="MDAFRSAKLTCHTTLAPSIAREENEHVLRIFNAPAQCAEREAES
                     RLHRFHGRAGFLRRQHESAIGFHPLRFLERMSTEAMTDTDAEKMAYAMRTHSTSFEQL
                     LRFLIAKLRETVPGVSWNRPQAHQEWDSDLRFYGPWWLVVRSKRHLRQPHGSTRSILT
                     QSTSASSTAKARRSVSAAPRSDLLFLVHEGKPENQYTPLLVEQSIAAENQLIADIALR
                     LGGHTFQLNLFHLSGVFLGPDRMHVLVFDGFRRLCAGTATATATASAMQPDFMDDEDS
                     LLSTLSLSSCHIASAGLLILLTGIVYLSKHHNCHVHSLDLSYNELTSNSLWCLIQTLP
                     FTKIRRFSLRGNVLTSRDPSTLCELLSDGCSREIEELDLSYTALSAAQTSALIDYLPR
                     LLKLRVLLLEEVPVPSAKWPAFALAVAKTHLLRVQLFAGPPSSAMAGYAKTIEEMCLR
                     NRQRAMECCGGEALRKGMKTYFGLKNASFFQEFFQVSLLRGGLAFGETTAALPDGYGV
                     FSDNDPSLHVGDALE"
     gene            <1465842..>1466303
                     /locus_tag="LMJF_34_3320"
                     /db_xref="GeneID:5655109"
     mRNA            <1465842..>1466303
                     /locus_tag="LMJF_34_3320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686384.1"
                     /db_xref="GeneID:5655109"
     CDS             1465842..1466303
                     /locus_tag="LMJF_34_3320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686436.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655109"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2L2"
                     /translation="MLRCAALRLAATGCSGTGVTAASGGARGSGQHMNSQQRVLEINS
                     PMSLLRMCYRSIDITVKSRHARTFLKKRLMEQWAAKCKEPNPEKQRFYMDLAGSFLQA
                     LHTERNPKPGKVVNFQLSRQVAYEQKLADREKSAGARRVRRMSKEVKTQDH"
     gene            <1467598..>1469199
                     /locus_tag="LMJF_34_3330"
                     /db_xref="GeneID:5655110"
     mRNA            <1467598..>1469199
                     /locus_tag="LMJF_34_3330"
                     /product="cytochrome p450-like protein"
                     /transcript_id="XM_001686385.1"
                     /db_xref="GeneID:5655110"
     CDS             1467598..1469199
                     /locus_tag="LMJF_34_3330"
                     /codon_start=1
                     /product="cytochrome p450-like protein"
                     /protein_id="XP_001686437.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655110"
                     /db_xref="GOA:Q4Q2L1"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="InterPro:IPR002401"
                     /db_xref="InterPro:IPR017972"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2L1"
                     /translation="MTPTVSPVQAAAAIATVGFLAYATTRMLQALYSAPPNIPEPAIP
                     PNSEDGLVWSVIKRVLYRHFYVVRKGDPLKTLQRWCVEFDYKPFVMKIFFRPHVVLSS
                     PVDIEHVLLRADTKFYKDTGYDIVRIVVGRVGLLAVGNKAQHAVHRRILMPIFRSQNI
                     RGVANEIIRMHALRMMGGLFHLIQCGGEQDAVVNLSDHVFRMALSAIGEAAFRASRSE
                     SLRVRGHFDVMMKMSRVNYFCPYLKSSAQRNARNTLKEMSVELLDKNMQINQIGTRRC
                     VMDALIDELYVHFSMDDVLDHVVTFLFAGHDTVSHTLEFLFALLGTNTEVQERLYEAL
                     EDLMPSICTCPTVQELMECDYLVAIVKEVLRMYPAAPIIYRDAAEDVYLPGSAVVIPK
                     GMTVVITLSALQRNTHVYGDDVDVFRPERWLGEEGEALRKRCGRCGYIPFSCGKRSCI
                     GQELGYLELLVVTALMGRHLKMELVGKFPEARYNITIAVSHSVSMRITARDGIPVSEV
                     YERIANVLDLNDEDAGSARNVTRGV"
     gene            <1473633..>1475822
                     /locus_tag="LMJF_34_3340"
                     /db_xref="GeneID:5655111"
     mRNA            <1473633..>1475822
                     /locus_tag="LMJF_34_3340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686386.1"
                     /db_xref="GeneID:5655111"
     CDS             1473633..1475822
                     /locus_tag="LMJF_34_3340"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686438.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655111"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2L0"
                     /translation="MQAPDMMLVHTVPIFDNDLRCTHSRDPTRSQMVGKRTADSQCTS
                     PATDAAETGVLMEAAWTGKHSLLPPSTGTVQSTTSSLVEVEQVAWVGLRFLAVKTRQR
                     QLLLVRSGLTESSSSPSSEGDDDAQCAALEGPDGRHRDSSAVCASFARVTDFCTASTA
                     GRRTSARTECSPVSVMIVAGLKRVTGVVCCGGAGQAADPARKAASPQPSQVNRQPLLK
                     EHTWNIGPFNRVAATARDDVQVYICATSLRGSVEVYAWTVHSTGEDAVPVCVHQVLMS
                     PGHFFYGIAVAAAVAPARETAKQAVQDVSFWVMGGEFAVAQDGRTALSCDAEGTNSAL
                     PALRGLDGRVIRVNSKSPERAGKNPSSGASHASLAAGNAAPRTLNSLWVAPSNGSAQA
                     SDGIAQHTAVSGGADPAVWGAALSELEAVSSLRIEAPCFLPRERRGALKDDGAYVHTR
                     SGCALTRRYALLVHASAKHASSTNEGALSMPASSPRCVDDAQTVAWSSAVMSLDSADG
                     AAALDWLAGAPTEAGTPPPFGLASVAPTLATDGERRGSSTTVVQHMHGLILFTPRRIL
                     QFGVSHRREPTGDSITWLGFEVNGTYEVHRPQRIVGLAPLLSPKAPAPLLFFYGSASS
                     IRTNGGGSGEDTRSLYGQQRRKSTWADVVDIQASLLHRLTTWSSPATAKATLLSSSDV
                     QTHLCESELFEKVQAIVQAEGARIQRHLDDRMDRLEAILQRLFRLWE"
     gene            <1476310..>1477920
                     /locus_tag="LMJF_34_3350"
                     /db_xref="GeneID:5655112"
     mRNA            <1476310..>1477920
                     /locus_tag="LMJF_34_3350"
                     /product="ATPase-like protein"
                     /transcript_id="XM_001686387.1"
                     /db_xref="GeneID:5655112"
     CDS             1476310..1477920
                     /locus_tag="LMJF_34_3350"
                     /codon_start=1
                     /product="ATPase-like protein"
                     /protein_id="XP_001686439.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655112"
                     /db_xref="GOA:Q4Q2K9"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2K9"
                     /translation="MRAPHTRDVMEAKKVEETRALVCHARDLLRYQLVAAPHRPLCID
                     EESELRLALQQLLPCLSIIRSYEQEYTYLSTYELTISAVGQVLGSLAAAATTVNAEDR
                     QLVKARHDAEHHRKEDTPEASATLSTPTAPLGAAAAFVPASCARQAAATASSVTWKNT
                     YGCDDAILALRQATTLPLQHPSLFTGPRQPWRRLLLYGPPGTGKTRLAAATAAEYGAM
                     FLSVSAADLLSKWVGESEKQVRQAFMQAAASAPRCVLFFDEVDALCSARGGHGESELA
                     RRLKTELLLHLQMDLPAVTVLAATNLPWELDAAFLRRFDRFIHVSLPSDAVKRRLLGS
                     ELRGVAHTISDDALDRIVAQTDRFSVVDVRRLLLHAVMAPVTEWLRLTRATVDDRSSN
                     SRDSAEAGSDGIDVLCTAAAATAPAPLLHRTSPSRTHTELKHRSVYCLADTEVLGAGV
                     RSVTSGTESIPSPCSSPRPSSPVSPERCPSKHSSSLPHCRLPGRHASDVPFVEYRHFE
                     SALQAITATTSAEEIARYATWRCRGAGV"
     gene            <1478516..>1479151
                     /locus_tag="LMJF_34_3360"
                     /db_xref="GeneID:5655113"
     mRNA            <1478516..>1479151
                     /locus_tag="LMJF_34_3360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686388.1"
                     /db_xref="GeneID:5655113"
     CDS             1478516..1479151
                     /locus_tag="LMJF_34_3360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686440.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655113"
                     /db_xref="GOA:Q4Q2K8"
                     /db_xref="InterPro:IPR003732"
                     /db_xref="InterPro:IPR023509"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2K8"
                     /translation="MRLFAHVLQAGLFIHYGKIVCARHIMTIRVMLQAMDQGHLLVNN
                     VDKYVRAGRGVMVYIAFLSDRDSAPITDEALRHAVGVLLHTKIFTHFSPEKMINQPQS
                     LEECPEMDILIVPQASLGGKVKGRSVQFHQLVAKDVGAALYDRFCHFVRVARGVDESR
                     VDANGAPRSEGDAPKAEGWIKYNSRVISGTFGNRQGLRFESEGPFTHMFDI"
     gene            <1479966..>1480418
                     /locus_tag="LMJF_34_3370"
                     /db_xref="GeneID:5655114"
     mRNA            <1479966..>1480418
                     /locus_tag="LMJF_34_3370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686389.1"
                     /db_xref="GeneID:5655114"
     CDS             1479966..1480418
                     /locus_tag="LMJF_34_3370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686441.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655114"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2K7"
                     /translation="MALSSSGSAALGDRIARAAAAAPQWTAQQRCFRQLLKSLRGAYF
                     HDRSKLFWARHRILVEFYKYSRVEEERDVLLLVGIGNEIATFVAEYMKVDVGAIMEHN
                     KKIQSLPVAKAKRYREEYLLHEKQHESWCKQKIRLMMDRRPPPPYPFS"
     gene            <1481569..>1482474
                     /locus_tag="LMJF_34_3380"
                     /db_xref="GeneID:5655115"
     mRNA            <1481569..>1482474
                     /locus_tag="LMJF_34_3380"
                     /product="aldose 1-epimerase-like protein"
                     /transcript_id="XM_001686390.1"
                     /db_xref="GeneID:5655115"
     CDS             1481569..1482474
                     /locus_tag="LMJF_34_3380"
                     /codon_start=1
                     /product="aldose 1-epimerase-like protein"
                     /protein_id="XP_001686442.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655115"
                     /db_xref="GOA:Q4Q2K6"
                     /db_xref="InterPro:IPR008183"
                     /db_xref="InterPro:IPR011013"
                     /db_xref="InterPro:IPR014718"
                     /db_xref="InterPro:IPR025532"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2K6"
                     /translation="MVTFTPDSRGRNCVTIHSEDGSSITVYEQGAHVSSWKTKDGKEH
                     LYLSPTAIFADRTALRGGVPLIFPQFGAYGPLQPSHGFARIRSWNMEDAQSGRASFSL
                     RVPLCELLPKDSSLTDSPQNAVNLLYTICFSNTELKLRMKVTNTSEEQSAPFQFAFHT
                     YFAVSDVSRTVVSGVNRSPFVDNCKARGNPDAPPSPPEQLWIIRGEHDRVYPDQACAI
                     VLQDMGAKTTLQISSPNLSDVCLWNPGESKCAAMKDMPPDGYKHFVCVEHGKMLKKVV
                     VPPCSSWTGTQEIAIIAESPHESSI"
     gene            <1489211..>1491400
                     /locus_tag="LMJF_34_3390"
                     /db_xref="GeneID:5655116"
     mRNA            <1489211..>1491400
                     /locus_tag="LMJF_34_3390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686391.1"
                     /db_xref="GeneID:5655116"
     CDS             1489211..1491400
                     /locus_tag="LMJF_34_3390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686443.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655116"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2K5"
                     /translation="MYLCWNDTFLTSFALDTLLSKLVAEVCEKRPVSSRQVLELMREA
                     LETQKMQQWYYSETVRSFNDAVNSLSRRGFPLQMACPLYFRIPQEDGGVHELFRYGSE
                     IAVTPNNYDHFEHMLKRYQAVVNGELSQEGYYDAVRHLLPISAHCNLLNSSYTPIINF
                     LQECLLNPRSQWAIQSSSVWDQLGVTYAVPFAGRLFAVDPTKPVTALVSFEDANRYVE
                     MASERCRTLSSLLTTGASLNVVRRAAAAAASPPSASSGRAAVKLAPSTIPVASSAATS
                     EEARKWEAFEAIGLRPEVFSDMSPAEIEFWKYILRLRESPSQIHDISFHLEFGPHHMD
                     LKENGRFIPVTRLNLNQFIEAVVAKQDEVHRYINEVALVTPTHSNASRDAGGGGEGSA
                     GPPPPPVAASNTAAAQAMPAPQQDIKIPAQPPPRTIGSEATSPVGHAQSEAHRDNEAH
                     LTLRDVDSTVVRSIMELRSQYQLGRLTKTELNARQLRFCLPCRDGVYNLIPNGRHIQV
                     ATGNIGIFLQYVEEEKKRVEALSGGKSEDSAARACSHAPEATTGGTGSLNVIQRDRER
                     VYGAVEAADADAGYWTDKNVLDIWTYECTTACLLKSSMSPEEIVRQTQLQWDTNFLSR
                     KDCPYANASEDGCVILPKDVKTYLRLLRRRLQSIRLAILDAGKCPQEPSEWDVGEWDV
                     VNPSTPPLEFEVPASVHAIPSAPENLTMFSPTHNTGGLLAPSQSLYL"
     gene            <1494552..>1495529
                     /locus_tag="LMJF_34_3400"
                     /db_xref="GeneID:5655117"
     mRNA            <1494552..>1495529
                     /locus_tag="LMJF_34_3400"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686392.1"
                     /db_xref="GeneID:5655117"
     CDS             1494552..1495529
                     /locus_tag="LMJF_34_3400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686444.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655117"
                     /db_xref="GOA:Q4Q2K4"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2K4"
                     /translation="MNEAAPFCVAPQTWQGGLARYPVSQSHVWNNNIILQPEDIDVEV
                     FNAMSQVESQYNKNEISVEDFEMLQLTFCLFTVNQSCYDLIPNGREIRVTQANAFEFF
                     QRVHAAYDNMKQRPALNQPTQSNHRPRLRTSGTRLRLTGQDTDSLEWIRWTAQNNPAA
                     LAFHPDEPLRWAVVPRSRDFMIRVQPEGENTFVDPDHLTLFLDMLAVLLTEIERAISV
                     FGYYPPNCVSAAPVECADEYSIYTSHTTRATRLPFPSQRVNSRGFSALHKFPMPVTAA
                     AAAAAAAATEQNRRTVRRASSADLENQRALCSPTHDTGGLLAPFQEWNV"
     gene            <1497723..>1498187
                     /locus_tag="LMJF_34_3410"
                     /db_xref="GeneID:5655118"
     mRNA            <1497723..>1498187
                     /locus_tag="LMJF_34_3410"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686393.1"
                     /db_xref="GeneID:5655118"
     CDS             1497723..1498187
                     /locus_tag="LMJF_34_3410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686445.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655118"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2K3"
                     /translation="MVVSQLGVIAIALSLSVSVHPSSDRGAFDMEREARWYFVCFSAL
                     ICLPQLLVFSGFALSRIQEHLRACLAKVSLVFGYTLASLSSSFISFSQPFSEARLTQK
                     TLLSLSAHPPMAQFHPLLLFFFAAGPRIGAQVEVRFTYPKRTHSHTRAWKEE"
     gene            <1500883..>1502439
                     /locus_tag="LMJF_34_3420"
                     /db_xref="GeneID:5655119"
     mRNA            <1500883..>1502439
                     /locus_tag="LMJF_34_3420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686394.1"
                     /db_xref="GeneID:5655119"
     CDS             1500883..1502439
                     /locus_tag="LMJF_34_3420"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686446.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655119"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2K2"
                     /translation="MSSLLSWTGPVAVAASVAYAYASNHPSAAQLESGSAYQFPLTTL
                     RYCGLLFLVYASGTMPRNPFFPSFAFRSNIFPLLYKVYCSYTIGYLVLRPFMHKPVAY
                     PHSDYRIGIRCIDAGSPLRLKPAPPVTPGTAPFLTRFYARAGGVVDAALWTGSVMRGV
                     AVVPIPIFGDNYAYLIVSMQTHKVAAVDPADPEMVLRIMESLRAQLRVPLQLTEVLTT
                     HKHWDHAGGNELLGAFSKKEVPVPPHEEGGVDCAPNTPLLHPKLRFIGSAEDAPLCCN
                     VLVNDASPVFEIMDGAAKVQAMAAPGHTKGSLVFVVGSAEEGVLTATPARVAVFTGDS
                     LFCGGCGAPFETVSVAQIMKTRATFLEDPRMRTQPGTGQEVADEDVLLYVGHEYTERL
                     LAEVVTLMTRVTTRSRTPSDPRGKEYVREVADALRGVKMLRTESDGLKDVAHMGCEAD
                     RQKPPFLLPSCTVPSSLAVEKAVNPLLTVDNEVLAALKEAEKHGPMDSNEVERAIYCS
                     DRRRLPTPAK"
     gene            <1503739..>1506009
                     /locus_tag="LMJF_34_3430"
                     /db_xref="GeneID:5655120"
     mRNA            <1503739..>1506009
                     /locus_tag="LMJF_34_3430"
                     /product="putative cleavage and polyadenylation
                     specificity factor"
                     /transcript_id="XM_001686395.1"
                     /db_xref="GeneID:5655120"
     CDS             1503739..1506009
                     /locus_tag="LMJF_34_3430"
                     /codon_start=1
                     /product="putative cleavage and polyadenylation
                     specificity factor"
                     /protein_id="XP_001686447.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655120"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR011108"
                     /db_xref="InterPro:IPR021718"
                     /db_xref="InterPro:IPR022712"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2K1"
                     /translation="MAAPFLPEAESTAAPAALRSNAPDEVEVLPIGSGGEVGRSCVVV
                     QYKGRGVMLDCGNHPAKSGLDSLPFFDSIKCDEIDVVLITHFHLDHCGALPYFCNQTS
                     FKGRVFMTSATKAFYKMVMNDFLRIGAGASDLVTSEWLQSTIDRIETVEYHEEVTVNG
                     ISFQPFNAGHVLGAAMFMVDIAGMRALYTGDFSRVPDRHLLGAEVPPYSPDILIAEST
                     NGIRELESREEREHLFTSSVHDVVRRGGRCLVPVFALGRAQELLLILEEFWDAHKELQ
                     NIPIYYASSLAQRCMKLYQTFVSAMNDRVKQQHANHHNPFVFKYIRSLMDTKSFEDNG
                     PCVVLASPGMLQSGISLELFERWCGDRRNGIIMAGYCVDGTIAKDVLAKPKEMTKPDG
                     KVLPLRMSTIEAVSFSAHSDGRQTRDFIQNLTKVKHTILVHGNPGAMGQLKNKLLQDF
                     RDRNMSVYTTMNQESIRIPFVQERTAKVMGKLANMSLREGEFVSGVMLVSGQHQYSIV
                     HPDDVPVFTDLSVNRIQQAMVLPLPRHRSPLEVLHVLQRYFAQSKLFEEVVPRQSSHE
                     EAAEAHQAAAERGEARDPDSTLLFVSKDVTVDVQKSSQAQTTLTITWYSSHYNDLLAD
                     VTCIALAKLAEEPQEAEGEDVLVPADVSGQDRIFRVKCFHYMISQFYPSVKTNLSSGS
                     CSVSLADGQVANIVDCIEVYLERSAGKKDVDYDAPEVQKLKQILKRIYLTLFPIPADN
                     GWCDCGMIHGEEPVAE"
     gene            <1509314..>1511218
                     /locus_tag="LMJF_34_3440"
                     /db_xref="GeneID:5655121"
     mRNA            <1509314..>1511218
                     /locus_tag="LMJF_34_3440"
                     /product="DNA topoisomerase IB, large subunit"
                     /transcript_id="XM_001686396.1"
                     /db_xref="GeneID:5655121"
     CDS             1509314..1511218
                     /locus_tag="LMJF_34_3440"
                     /EC_number="5.99.1.2"
                     /codon_start=1
                     /product="DNA topoisomerase IB, large subunit"
                     /protein_id="XP_001686448.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655121"
                     /db_xref="GOA:Q4Q2K0"
                     /db_xref="InterPro:IPR001631"
                     /db_xref="InterPro:IPR008336"
                     /db_xref="InterPro:IPR011010"
                     /db_xref="InterPro:IPR013030"
                     /db_xref="InterPro:IPR013034"
                     /db_xref="InterPro:IPR013499"
                     /db_xref="InterPro:IPR013500"
                     /db_xref="InterPro:IPR014711"
                     /db_xref="InterPro:IPR014727"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2K0"
                     /translation="MKVENSKMEVKREQSYSNEDEEINEEDLNWWEQENLRIAMKGER
                     RWETLAHNGVLFPPEYEPHGIPIFYDGREFKMTPEEEEVATMFAVMKEHDYYRMEVFR
                     RNFFESWREILGKRQHPIRRLELCDFEPIYQWYLVQREKKLSRTKEEKKAIKEKQDAE
                     AEPYRYCVWDGRREQVANFRVEPPGLFRGRGKHPLMGKLKVRVQPEDITINIGETAEV
                     PVPPAGHKWAAVQHDHTVTWLAMWRDNVAGNMKYVMLAPSSSVKGQSDMVKFEKARKL
                     KDKVDDIRASYMEAFKSNDLHVAQRAVAMYFIDRLALRVGNEKGEDEADTVGCCSLRV
                     EHIQLMPDNIVRFDFLGKDSIRYQNDVAVLPEVYALLQRFTCRKSPGMDIFDQLNPTQ
                     LNDHLKSFMDGLSAKVFRTYNASITLDRWFKEKPVDPKWSTADKLAYFNKANTEVAIL
                     CNHQKSVSKNFKLQMMQLTTKSEYTRKTLELLEKAEVTAKKKSVEEAAKEFLEEQDRM
                     QREWLESYGTEEQKKEFEEIVAKRAAPRVRSEKKSSSGTKKAKSASGKTRAATKKKSA
                     KKSGKASSKKAARKSSKKAPKRSKEEDEDDVPLMSMAAKTKKTAGVKRQRAVKVASDD
                     DDVPLAALRV"
     gene            <1512884..>1516510
                     /locus_tag="LMJF_34_3450"
                     /db_xref="GeneID:5655122"
     mRNA            <1512884..>1516510
                     /locus_tag="LMJF_34_3450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686397.1"
                     /db_xref="GeneID:5655122"
     CDS             1512884..1516510
                     /locus_tag="LMJF_34_3450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686449.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655122"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2J9"
                     /translation="MSSVTLSSAVRANPRLVSSSLEKMTCNAQGITVVDIYPSVLSAL
                     TAKGAPVSVAESARVYVQAARCSRRAQRLSTEGDGDCVQHKHATSPGPAVTTGVGSSN
                     SPVGQKKTAANEDSHLNCFNVGIAMSLHTVLLSRNRISSLLGIVQFRHCVCLSLLGNR
                     IRTIEDCEPLAMLPDLQYLSLEYNPVTRLPHYRAHLLRICSWPQELSPSTCRLRKLDS
                     AAVTTAELKHAALCLLRESAVLPELLYRMQLLAFLVDIENRQRLHRELRLRGHVLHDL
                     SEHASMELLLERGVAHALSRVGIAGAAHMARQLVRDHRCLRTTSLPLSKHNSAHPAPA
                     QAPHAHTHTSVTVDKGVCEAVDEKSGGVADLTTTRVTNFASDTIDPSEIASVSTVSSC
                     SLFSSTSSSGASVLQSLSHLLASKELDWSRRSLRRADATEVADTCQAWSKDAFRQTIV
                     SLDVRLCTLLLRISSAAGQTLTSHDVDRLCGVWLHAVAHCTPAEAAEVNATGRRRLVV
                     EVGAAAAERKSTKRRGAAEGQVALKQRESSLGTAVTGRIPMGTVAPVETSIKDALGKE
                     SRRLSSTSPSPPQLEHRDAEDVTMDSTTISMTSLSSDAALLPRDAVPLPTTRSRTDPT
                     QPSVPGREATGSTAARAALGAIAHDSAYLKTSACAESIHAFEALARGRYKRRAFQQWC
                     SALRHRWQTRIVAAYIREKVSDGAAASIRSPSWGGLLAQVTYVERKRGFFTVWRRRAQ
                     LHCDCRTRRLRRLWNLWREKAAVLSVLRVRCEQTSALVAQHMRDVAFRTWKSKAEKRA
                     SERCTAAQRRIFAEGPHSTDTFRALASPTPVMAHLAARTPSPRTTVMCRTLADALTPR
                     RETCTTAVEVPSVTSVPDEILSDTSAAVAVNPVIMSVWRHVAALERRACPSHASASVS
                     DNEEQHDCCARSSSDEEAGLSAVGASPSPGVSVASGTATPFVGVTSPEWVQQPQPLCD
                     AARAQAQLSGPSGELSPPPAMRMLFSPESRSQSAGLNGCSHTGAATVQLRALQPSPAQ
                     FPLARAHARPSTVVLVPSVKSTTCRFYGSSKPSCLPSITAARRAIVQSLSTTEVAAAP
                     GDVDSPYPAADVEALVERAKQLEIDRDYLIETLRSLHLSQQKHCTQERPQPPHAASTA
                     DSVLLPSSAPLAPSFAVAEQLEGRCASLEKEVHRLEKFVVALQDERHQLLENMKRSMF
                     RYRA"
     gene            <1517160..>1518587
                     /locus_tag="LMJF_34_3460"
                     /db_xref="GeneID:5655123"
     mRNA            <1517160..>1518587
                     /locus_tag="LMJF_34_3460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686398.1"
                     /db_xref="GeneID:5655123"
     CDS             1517160..1518587
                     /locus_tag="LMJF_34_3460"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686450.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655123"
                     /db_xref="GOA:Q4Q2J8"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR001876"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2J8"
                     /translation="MFGGGEEYFQDPPEIDRDTLGRYATFCARLRAIEKPGKRTITEA
                     ATLAREVGDTLLDYELVVGALFRHIKTWTGQKQLACWYILDKLCKEDRDKYGYTAGKY
                     ILEVGRDHIPYEDADLAGKYESLVEHWENVFPRHVVDALWIAKKERLWAVDHPNEVKQ
                     QQQAEEEEWAREEEVMQDEDGLNDFGQPCIDYLQGHCSWGDSCRLYHPPGEEGSLPAE
                     CRMGDWKCSACGVINRHFRRRCSNCVREKPQYKKGRVPSAEDKLLCTPDPAVTAAFHQ
                     QFGYNPYAPAEAVAHFKLRLEGVSAEEYRKERAAAYRVRILGKAPTNPVEERCKATKH
                     FPDVDMEPDEEYEVGTDGLVAKRQRTESLVPANASPNSAIALLAQLVMERGILDPTVP
                     QIFGELSRYIRQAAGDPTMELNETQAEVLLSACKLGFTAWNANKGAVPSVATFFKAVR
                     HNESKLGLSSEQVEQLESMASMFLA"
     gene            <1519787..>1520863
                     /locus_tag="LMJF_34_3470"
                     /db_xref="GeneID:5655124"
     mRNA            <1519787..>1520863
                     /locus_tag="LMJF_34_3470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686399.1"
                     /db_xref="GeneID:5655124"
     CDS             1519787..1520863
                     /locus_tag="LMJF_34_3470"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686451.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655124"
                     /db_xref="GOA:Q4Q2J7"
                     /db_xref="InterPro:IPR003198"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2J7"
                     /translation="MSSVILVNPIAFGPNPKTKDNALIQSMHVGNAKADMDRSQVCAL
                     VTELESFFKVDCGIRTVVVHQSREPKLYRVPLEERGESVCVADSLSVHNVVDNNGVIQ
                     RHLVVFYPMNPYRQGELARKQLVNHITKAAEENAAIELIDLRPFEEEGKYLEGSGSLI
                     FSPGGRYVYTAVSQRSHPDVLEVLCRPENLNIPPQNRFLLRCKNAVPHTNLLGWCGMG
                     ICAWAISSLVFDVEEEEVAFYDHLSAAYSCVLELSEAEVEKFAASALEVPVQPQSGSA
                     GKAHYVLVISETALAGLTSKNRELLMDWYGKENVHTFYGEVLERRCGTSLPSCIAASY
                     TLGSRPPLPSQPSTIELLRLGVNN"
     gene            <1523175..>1523888
                     /locus_tag="LMJF_34_3480"
                     /db_xref="GeneID:5655125"
     mRNA            <1523175..>1523888
                     /locus_tag="LMJF_34_3480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686400.1"
                     /db_xref="GeneID:5655125"
     CDS             1523175..1523888
                     /locus_tag="LMJF_34_3480"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686452.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655125"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2J6"
                     /translation="MSTQEEPPQHTRLLLRRTLSTRSPLLLDEMRLPSMTPSPSIPYD
                     VLLRRYIDVRDAARDLISADPRQSLNVRDTYLRLCQTHGYPLDNHYVGYLTRYVTVQA
                     AIASGSARDMVDKVRHLDFLPTYVGKLAWLPIFVTLSDCVLLHSLSLSSQQLDSDLVL
                     LLAHSLPPLVQLASLDVSGNPIGCTGVQALIRLVKSSPSLTQCNIHGAASIAPLTRRL
                     EAALARNQEHTSPTAVASQ"
     gene            <1524638..>1525915
                     /locus_tag="LMJF_34_3490"
                     /db_xref="GeneID:5655126"
     mRNA            <1524638..>1525915
                     /locus_tag="LMJF_34_3490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686401.1"
                     /db_xref="GeneID:5655126"
     CDS             1524638..1525915
                     /locus_tag="LMJF_34_3490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686453.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655126"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2J5"
                     /translation="MFARLAWPTSRLAIAATSSSVSLCRGRLASVAAALGAPSFVSAA
                     LVSQRWASSDGSGNNAGTGDSSTGTAAIAYLGEKELIELNKEAAEAFEKGDFSSAIEA
                     WEKVAHSKQHTPNSPTLMSCLNNLACAYGETGDNIRKLKLLERSRDLVEAVYGTDHPQ
                     YGMVLYNMACAKEEMGLYADMKQLLEQSLALHEKRFNPLHAKVGRVLLLLAAAHGHLG
                     EHEAQLRTAERAYEIVKRHCGPEHVQTTIAMMTLGRAYGAAGQVERQLQLAQAAYSIQ
                     ERRLGPMSPQLAMTLLEVADAHRVNGDFYNQKALLEQAVELQQRAFGQQHAQLIDTYV
                     ALGDACGQLENSKLQAQYYLEALKIARQRFQGRHIAIGKAAVNAARAYLSHGNKAKAQ
                     ALLDEARSIVERNVSPEHPLSKQLDKVAKEVVR"
     gene            <1526825..>1528204
                     /locus_tag="LMJF_34_3500"
                     /db_xref="GeneID:5655127"
     mRNA            <1526825..>1528204
                     /locus_tag="LMJF_34_3500"
                     /product="putative ruvb-like 1 DNA helicase"
                     /transcript_id="XM_001686402.1"
                     /db_xref="GeneID:5655127"
     CDS             1526825..1528204
                     /locus_tag="LMJF_34_3500"
                     /EC_number="3.6.1.-"
                     /codon_start=1
                     /product="putative ruvb-like 1 DNA helicase"
                     /protein_id="XP_001686454.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655127"
                     /db_xref="GOA:Q4Q2J4"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010339"
                     /db_xref="InterPro:IPR027238"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2J4"
                     /translation="MSGIKIEEVISTTKKERVAAHSHVKGLGLNPDGTTKHIADGFVG
                     QEKAREAAGIAVELIRSKKMAGRALLFAGPPGTGKTALALGIAKELGPKVPFCPMVGS
                     EVYSAEVKKTEVLMENFRRAIGLRIKENKEVYEGEVTELRAEETDNPLGGYGKSISHV
                     IITLKSQKGSKLLKLDAAIYESLEKEKVSVGDVIYIEASSGAVKRVGRSDAYIGDHDL
                     EADEYVPIPKGDVHKKKEVIQDVTLHDLDMANAKPSQGQDALSIVSSMMRHKKTEVTE
                     KLRQEINKVVNKYIDQGVAELVPGVLFIDEVHMLDIECFTYLNKALESTLAPVVIFAT
                     NRGSCRIRGTEIRAPHGMPTDLLDRLLIIRTMNYDVSEITSIVEIRAHVEGVKISEAA
                     LTKLGIIGESTSLRFVVQLLTPALIIAETNGREMLEEEDVDLVAELFKDGKASARQLQ
                     DHAEEYVYQ"
     gene            <1529283..>1530272
                     /locus_tag="LMJF_34_3510"
                     /db_xref="GeneID:5655128"
     mRNA            <1529283..>1530272
                     /locus_tag="LMJF_34_3510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686403.1"
                     /db_xref="GeneID:5655128"
     CDS             1529283..1530272
                     /locus_tag="LMJF_34_3510"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686455.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655128"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2J3"
                     /translation="MLEFLVTTQPSRRIVCRNEATYIYFWPYLFSREVPGALQLCRWA
                     ARRGAAVHGAVRLQPSETPNAAHRCYLTVTRPVAAGRTLISLPAALSLSVSSPESRKG
                     TFIGRYSALESFAQLLARELHNPRSPHRAYLEFLHDLHNSGTDEVSDALLAGLRYERA
                     AVLVDQLDAMYAGNSLQARGAANAPFLDKEQLTSASQRVEWVRLHQLQRRLEQGVPHF
                     AAKSTAWALSMALSRAMEDDAEGLSLYPLIDFCAHSFEPNAYICVGEDERIAATRPVR
                     WADSSGEPLLHVVTRRLLHAGEKVTLRWHWRPVKTTEDAEFWQMRFGYVPQSE"
     gene            <1531312..>1534176
                     /locus_tag="LMJF_34_3520"
                     /db_xref="GeneID:5655129"
     mRNA            <1531312..>1534176
                     /locus_tag="LMJF_34_3520"
                     /product="peroxisome biosynthesis protein-like protein"
                     /transcript_id="XM_001686404.2"
                     /db_xref="GeneID:5655129"
     CDS             1531312..1534176
                     /locus_tag="LMJF_34_3520"
                     /codon_start=1
                     /product="peroxisome biosynthesis protein-like protein"
                     /protein_id="XP_001686456.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655129"
                     /db_xref="GOA:Q4Q2J2"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR015342"
                     /db_xref="InterPro:IPR025653"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029067"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2J2"
                     /translation="MQQSSFEVAIDRSSHHSFVTASQHYLDTVLRPLYSGRLPLAVPL
                     RITGQSGHGIYVGCLTCRPHTRSKFVLVFPLAFCDDHGLKEGELVECVPLPNTPRATK
                     VLVAPLTVDDSEVVEQNALRVENLLLRQVQVVFPSMIISVSIFPGVPAKVVVTAIECG
                     DAEEKLRSGCATMHEGTHFVIATRVRRQQTDGAADGAATLPLWAFVRGRPARAAADSG
                     AERTDVAAVRVRRVTAEKYGWKNGMVLGVLDCATVATLNREEVTPGFLRAHLKQMTVV
                     VVNNADGEAAGAADEEDVCVVNSLTQATNLLLTPHGLDPSAPTARKAGDATRNDSAGV
                     ARPVPSSPALLPCSPVALDAVMQVHGRVAEELQRHLVAALHQSSVPRFANLHQNNVLL
                     CGGKGFGKSTVVRAVLDTLPDVHTVTLECGKTKSFSADIARALMECVLCKPAVLVLEN
                     FDSIAPAQQDSHVEAMTAMTRATLEATLTRFCYQFSVRPHGAVVVLATCSSRDAVHET
                     LRSAYCFRRVLTLEALNRASRTVLTGQVFPYAPREDVAAAAALMDNYTPFDVKQLTAR
                     MRAKRAAEPALSLRECAEACVTFFTPLAHTGISFLKGDKVSWESIGGLEEAKKTLYST
                     LVLPIKHPQLFARLPLKTRSGILLYGPSGCGKTFIVESLVKAENLHCVVINGPEVFGK
                     YIGQSEQKIRDVFERAQAAAPCVVFFDEFDSVAPQRGADDSGVTDRVVNQLLCYLDGV
                     EGRKNVFVVAASSRPDLIDAALLRPGRLDKAVVCPVPGEDDRVAILRSLLSKASAHFS
                     DEELRQVARRTVNWTPADLSAMVSSASTLVNMRFVERLTKQAAGVSGSIGGGGAAPDD
                     EDGFVIAGLGHGVTREKVGDTLKPLCLAARGGAEATVSNTAFLAAELMSIDDLWASVA
                     TTRPSLSEKDIQKHERIHALISKGKSAPPSNPPGSRLVTR"
     gene            complement(1534448..1534520)
                     /locus_tag="LMJF_34_TRNAASN_01"
                     /db_xref="GeneID:12981318"
     tRNA            complement(1534448..1534520)
                     /locus_tag="LMJF_34_TRNAASN_01"
                     /product="tRNA-Asn"
                     /db_xref="GeneID:12981318"
     gene            complement(1534579..1534662)
                     /locus_tag="LMJF_34_TRNATYR_01"
                     /db_xref="GeneID:12982055"
     tRNA            complement(1534579..1534662)
                     /locus_tag="LMJF_34_TRNATYR_01"
                     /product="tRNA-Tyr"
                     /db_xref="GeneID:12982055"
     gene            complement(1534727..1534798)
                     /locus_tag="LMJF_34_TRNATHR_01"
                     /db_xref="GeneID:12982061"
     tRNA            complement(1534727..1534798)
                     /locus_tag="LMJF_34_TRNATHR_01"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:12982061"
     gene            1534880..1534951
                     /locus_tag="LMJF_34_TRNAPRO_01"
                     /db_xref="GeneID:12982060"
     tRNA            1534880..1534951
                     /locus_tag="LMJF_34_TRNAPRO_01"
                     /product="tRNA-Pro"
                     /db_xref="GeneID:12982060"
     gene            1535015..1535087
                     /locus_tag="LMJF_34_TRNAASN_02"
                     /db_xref="GeneID:12982059"
     tRNA            1535015..1535087
                     /locus_tag="LMJF_34_TRNAASN_02"
                     /product="tRNA-Asn"
                     /db_xref="GeneID:12982059"
     gene            <1535691..>1541528
                     /locus_tag="LMJF_34_3530"
                     /db_xref="GeneID:5655135"
     mRNA            <1535691..>1541528
                     /locus_tag="LMJF_34_3530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686405.1"
                     /db_xref="GeneID:5655135"
     CDS             1535691..1541528
                     /locus_tag="LMJF_34_3530"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686457.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655135"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2J1"
                     /translation="MLAMSHESQLLGLLWCEATQPSCNAATLTRNIGVAFRYLETPWD
                     DKAKQIIGALITLNAGPMHTTIWAALFQQLRETDKPAIKVYILKQFANVCWTVPTNQA
                     ANAFRAFALEVRPLLEDLQVVVNATFQRSFVTTIKFFSSFAEKTLSNELFNAVYRSLK
                     EWKRPDSIRAAVTVIAAMANDNPSCPSPEQLLRRARYDLDCFSVAVLLDTLVSFEVAP
                     GRISDERRIVAFQDELSEIFDKILAAPQANEKVIPPCVSAYRRLKQVCDSWEPVAAEP
                     FALFIVDALAQAKISKLLVCPFLHFLQETPCIWSRSSRIVWQLTGSRDPFVRADAYAA
                     LATTIHVIGAPEHRLVLADLMERLRFSIAEHCSRTTVAILKFVKKLLLHARFPPSAEE
                     LYLSKLLHLCRRHGRGLYHDVPAQLELLNVFLCARVAPDALVVFALELFSVSHDRAVA
                     KKAFSVLRHFSTEVFLDSGVQTSGEYSDDANYFEAAMQMRCAEPFKDELLPFVRLHRT
                     KGLSACIYARLCTLAENETKNSISCIIVCDAVKEICTTNAAHIFDDIFFKHTTLCLLS
                     QLLVLQDRMPSDAYVSLLQACAACLQGNDLGIREDAHLLSMLVQHSWSAIVTCTTALF
                     STFRPAPVLPSCRFFRKDSLSQACRHLILMCRDIALSNDVAFYDSTLHEILTSNMSLF
                     ISCVSFLRCAPIFIAELVESVDCWLACCTILSTCVPKSVLRLLTVVLEAAETELPVAP
                     QRAGATHYSLLSVARMCNSMVKQAIEMDLLLCCPEICNFLLFFISKDADDEVFLFREL
                     IANNWTLVVDLFLFCERIVMCLHNDNDASALAAVLNLLLTLCDSVYFPQVTSVISRGS
                     LEELLQVLRKTPDFSQKCQCVFLASHILAAFDEKNSLEEKMSGCFSACSTDVDFFGRI
                     DRLVQLWNASDVQTQARLKTLLTSPSSIERLVCAAAVDVQYIPKAVEAALGASADREV
                     LDVLLLIVTEAESETLSPLLFAISDAVFGENDDLVKRIIRSYRWGWYGGQETMRMLSS
                     GAWRNLSTPLSEYLKLLFGFHQLDITERHVRCERYVGTLDSYESSLSFWQLLSGGASV
                     DILQHEMETGFSLLRLTEVLQLKGTSALRTVCLLCDQGVSIVTAFGLSNIRRLAIFFS
                     TGVGCELSSCDPLSLLRLLQVLVSTARGSLVESELSGWLQLSCWLLLDRVCLFSSTQE
                     TTEAASGKQPAQTFVAAELVTVFVQLSNLFLCSTAKTLDDVAVSVIRYAIRNATIFTM
                     GDVSERLFWMVVRHCIYEVWAAITAETVASVRDPEIIVFLCRAHVKVGLPLPVQRELH
                     ALFTPQLLSYGNADSELEEDSLRYILWLVGKFASSDVHSSVRGGASSLQHAPKWTDTA
                     DIGAPSSGRQALKHLPAAESNFSRKDARSLAAAVRRVTAQLAERVLANTTGATPSNVL
                     DALGVLCNLARPAPAESGPATPLLSNVVSLDHVYRIACDFTKAFPLLSADASLHPPGH
                     CLDHLLGQLPKERRAHSIPDALCLNSIAWLLSKLLQSWGRENAPDSALPAQLPCVLAL
                     YLPYLLRCDLPSYLCSLQGLRYLSVCGATPEVEAVYDVALPRLMEDLVDVRWGAGLAG
                     CWYEILVDCLSRVPGAVPDGGRQLSRRIWEGLWRGAGSVEHSCNQRFSERAQRSLQQV
                     IHGLAPRSAQWELCRLVVLDSGLQSRRVVLTPVAASAFSIESHTEAFFWLTRELQERT
                     WRSQLLQTQSAFVHYGAAVLDADSSRSLLFEFEKAVAPIRESPDERGEFAIGEEAACI
                     IAEGVRDSLFSATDAALAALNHFDFADIMQRRAVLHELAKMMVRSDANTPSWAEVYFD
                     VLYERTTWHDEGLWVACALATAAVGQTELCWSKTVLASLIPASSSAWKRELMRRIGQR
                     AKISGAQREARRFFADAAERLSALQGPPSPWKRELLAAVLSVFSS"
     gene            <1542245..>1542919
                     /locus_tag="LMJF_34_3540"
                     /db_xref="GeneID:5655136"
     mRNA            <1542245..>1542919
                     /locus_tag="LMJF_34_3540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686406.1"
                     /db_xref="GeneID:5655136"
     CDS             1542245..1542919
                     /locus_tag="LMJF_34_3540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686458.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655136"
                     /db_xref="InterPro:IPR007074"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2J0"
                     /translation="MSVTPKHSPCAETAADVQSRPAAPLPEADATSLGLIWTRAGIVA
                     LVAAFSFITISYCSHVYFDRDSAFHNALECLERVLKQHERSNWLLNGTLLGSTRLGRL
                     VLWDADLDIGVLVPSPSSFDAASAALDEECFGHRSIVKRGALNSDLRIWRKCTSRICA
                     EFYETTLVNGTTKTGEGQSKESDLFPLRSCTVSGVHAKCPNNAPFYLAQAYGQDWLTI
                     PLIKLF"
     gene            <1543883..>1545109
                     /locus_tag="LMJF_34_3550"
                     /db_xref="GeneID:5655137"
     mRNA            <1543883..>1545109
                     /locus_tag="LMJF_34_3550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686407.1"
                     /db_xref="GeneID:5655137"
     CDS             1543883..1545109
                     /locus_tag="LMJF_34_3550"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686459.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655137"
                     /db_xref="GOA:Q4Q2I9"
                     /db_xref="InterPro:IPR007320"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2I9"
                     /translation="MSGNDLLPLWIGTPQRGVTHDDTADPYTSKVGGQAVYFRLGAST
                     AEQQSAGALSKYFQCPQCKSTAQVSLLCQVYAPLEVYDRVLYILTCAACTRRPRAAAS
                     LQGSVPAPALTTGTSKKSGLAAAARSHTSFCFALRSQNFSREHFAELQKQLRAEAQRA
                     TEDEKEKAENDAPLFGGGDDDWGDDADDWGTEEGPVKEAKPSPAEPLDDAGDKNGALE
                     KTPNELPEFPLASRGMTVPLKGTLYTSGLPLDLYEEPPPKQTKELSIEEQLAAAKSMY
                     GSSAALDTSGFEEDDEAPEERCVREYMEHMERTPSQCVRWCLGGTPLRTSTTPIGVNG
                     SSLPPPCPACGAVRQFEMQLTAPVVFYLTKDIGEAKNTALHFSNVLVYTCSSNCYNTN
                     SNLPYLPEYVVVEDEL"
     gene            <1545716..>1546741
                     /locus_tag="LMJF_34_3560"
                     /db_xref="GeneID:5655138"
     mRNA            <1545716..>1546741
                     /locus_tag="LMJF_34_3560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686408.1"
                     /db_xref="GeneID:5655138"
     CDS             1545716..1546741
                     /locus_tag="LMJF_34_3560"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686460.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655138"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2I8"
                     /translation="MSSEDVILRNDVAGVRAFFSAAAKNVVNAVNENGYVPLYFACMK
                     SSVSPQVIEELVQLGAAVDGRGTSGETPLYISVYNHRLDVAKYLIARKADVNAVNGPH
                     RETALHVAARCGFADILSCLLSAGADLNMRNARQETPLYVAAQAGRHDTVYLLLEADA
                     NAALANEDGKTPLYIASEKEYKHVVVLLKATRADLKHAKSLADSEWRLRPEPMMSSGQ
                     MLDKAAADQQFAAAVRRRSSAGAPAPDTKPMDVVEIRVPEPQVRRHNPLTGESYGPCR
                     SLEEVGYDSPPTIPKELQNRPPARLSRVGGTSMVVGTGTEEGGREPIRIDSIGGDGVE
                     YYAPPNK"
     gene            <1548424..>1551249
                     /locus_tag="LMJF_34_3570"
                     /db_xref="GeneID:5655139"
     mRNA            <1548424..>1551249
                     /locus_tag="LMJF_34_3570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686409.1"
                     /db_xref="GeneID:5655139"
     CDS             1548424..1551249
                     /locus_tag="LMJF_34_3570"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686461.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655139"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2I7"
                     /translation="MPAFTLAQQCRFRHVLRCVCLIVLLGLSLGSSPTLVTAQDEPAR
                     DIIAPLPEGTQQAELELALPVSVAENVDPVGPSERPREAVVEVSVEVPLDDGAVAEHD
                     VLGIPQADEDAADAEEQRAIEETRMTEASREAAETRRDVQAEREDDRRLEEHERMAAE
                     AQSLSEEAEAQKAVEAQRSFEAAVEEESFSSAVRVSTEENGAQPSGSGAFHSANLEQE
                     AVAHHSEQLPPPVDSVEVELSSSSGAATLDTYLSTEEKVSKHMAEETKRAEAQIAAEA
                     QQADTVPHHEEMPKAAEVSTAEDAKQSEEKRVAQELQKAEQVRIAEEAALQAEEARKD
                     EKERLAEERRKAEEARLAQEAQRAEAQRTEEEVRRAETRRKMEEQRHADAAAASASKR
                     RKAAAEAQGRLNAERKQVLAKIDEERVRFRTAASDLITQQEVEKSSAVRRDKTVATEL
                     QKSMETKLEVLQHDLVTLGRVSATLRGRVSALLHSSTLTQVQEDVQALDEVVVKAGET
                     LDSIREAADSLADAARAAVGNQKDAPATTAEITLLAKQKLALETAHDAAIQHLLERLQ
                     ALDSELAEAAEQTEAEDKAVAGPAEAAEGAATPSLSLVAPAAAEAPQEVVSLPSEASR
                     PVRTSTPAPTPSAPGAESRVNSPKHAEESHSRYRRELIETPANRGGEESYSESSYEVR
                     HLEGGAPYKAKQHMEIAGTVVVIAIAATVQTLRWCRSACRDEEEDEETSEDVVPELQA
                     SEKSLASPQKSLPQSGGPLQQRPQASLPSMLPPRGANAAPDRGGTESPSCWESGNIVP
                     PSQRGTPSASSEQMHLPAEEGDILSTTPVLRHHPDAFPLGSPAPGRPGVIRRPPYGTS
                     PLDTARAPPPPGATSPFTPSRNEALGMFPTPMQRQPPLPGGQFGGPSPPPLSGNPPMA
                     GTPLQLHRRRNNGDDFELQNPFLSRWS"
     gene            <1552045..>1554657
                     /locus_tag="LMJF_34_3580"
                     /db_xref="GeneID:5655140"
     mRNA            <1552045..>1554657
                     /locus_tag="LMJF_34_3580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686410.1"
                     /db_xref="GeneID:5655140"
     CDS             1552045..1554657
                     /locus_tag="LMJF_34_3580"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686462.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655140"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2I6"
                     /translation="MPSEDESSWRLLFGIALSHGELLRAGRLSHDGWMMFLSSAQLIG
                     PATGVFPVLLDQLWLRQSLSEGARQADVNEHDPGAASVSSRAFSLSFGSSQMSLISRD
                     FHRSGNATTAPSASVPRLSSAAHEGESMGFSGFVDMMKVICVRIFQTQRFTRLREGHR
                     NFDEGDGESALLALRESAEDHVLLTESVKYTATTFLRPFISQCIIHASSQMRLHPARN
                     GWALHVNRLVAHIVGSLLHTAILPLFRKYAVAGRLSEAGYRAFIRDAFPGLDAVKETC
                     AVAIFYHGGFPDIRPLVKGLQPLAASVSPELATVVSEPTLGFTDFIEAMLMLTVVVYS
                     DEVRYPAHRPITAKVWSFFEEHVCGRALRGVAMCSDPYVTGRYATVPPGLVSVYPAVA
                     PRLQCPSLFVEVINFQGDNVAGGAVQPPAARASDKGAPSSLFLTEVTVAETESSLCLP
                     GDCGANADVALHAAAAFFATEWSFLERNRCVPLFGRSRASVSHAIMICGAAAEAAPTT
                     CPEILQVPLPDSLQQPTLYQCAVGVVAATAADGAFEEGAMCILFTPFRSLTVELAVSD
                     DDAATTGKDGESVAQTRPWGCADVIVTDTPLVQVVPPRLLAPLHTIFVSQTPAPSGDD
                     PAASAPPCISLSAVCELCRQLQWCATVDKQRHNLPSLCAQAWAKYGDFQRILHSTVSR
                     NGNTPSAGGALPSFTEQAAFLSFTDFIGCLATMLFLEQGGRLNDVPDVPRRLELALSS
                     LPPTFTSATGAASRVPDAGLRSPGIYNIPYNAFRDVPYLTALERKRKQSKEAQERRTA
                     LIASLREHHALQIPSPVTLPPLPEDRPCAMGLVSQYGTVNPTAVFHAVMRDGAEVIKS
                     HFLQQELAIPEMHE"
     gene            <1555504..>1557339
                     /locus_tag="LMJF_34_3590"
                     /db_xref="GeneID:5655141"
     mRNA            <1555504..>1557339
                     /locus_tag="LMJF_34_3590"
                     /product="putative phosphatidylinositol 4-kinase"
                     /transcript_id="XM_001686411.1"
                     /db_xref="GeneID:5655141"
     CDS             1555504..1557339
                     /locus_tag="LMJF_34_3590"
                     /EC_number="2.7.1.67"
                     /codon_start=1
                     /product="putative phosphatidylinositol 4-kinase"
                     /protein_id="XP_001686463.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655141"
                     /db_xref="GOA:Q4Q2I5"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR015433"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="InterPro:IPR027003"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2I5"
                     /translation="MGGIPNRRAEAQRRSLLQNLQLISFTNQSAEEQERCIRQLYDTD
                     ISTLEECLLQVTHVCITHPNSNAQELLHNFMLWLAGCSLNIAFRLAWTVDAVSAFYSS
                     TGIAGRLQHIHDELESYAINQGQPAIPSDSTSGGDGSRTSSDPEEVLRDVDASVVQRK
                     EVRLKLYNDERTFVTTLTNLSNTLRFFPDRNYRKDELRRGLRVLNQRLESMRLVHPLC
                     TSSGSVQWIVNISVDECTVFSSRERAPYLIRYEVIVDDTATMQDPTATRLRQPDGRFR
                     VHADSDEIFVPAPPPESEPRAASLVEASESGAVEDASPEALQCLQAVFGESKKVRMTR
                     VRKSSPWGAHPNWSMNAMIVKAGDDLRQEELALQLIHTFQCIWQEAGLTVRVKPYAAL
                     PTHRDCGLLEVIEDSASMDSIKKATRVSSIYNYYLKAYDGEDSVLYRKAQQNFVESMA
                     GYSIICYILQIKDRHNGNLMIQRDGSLVHIDFGFLFVTSPGGLNFESAPFKLSQELID
                     VMGGASSDAFNYFRILVYEALAAARERCEDILTRVSILTPNNAMPCFGADPGAAVRQL
                     RGRFRDDLLSEADYAVYAKELIVNSADNWRTRRYDQFQSLQNGIL"
     gene            <1558861..>1560027
                     /locus_tag="LMJF_34_3600"
                     /db_xref="GeneID:5655142"
     mRNA            <1558861..>1560027
                     /locus_tag="LMJF_34_3600"
                     /product="adenosine kinase-like protein"
                     /transcript_id="XM_001686412.1"
                     /db_xref="GeneID:5655142"
     CDS             1558861..1560027
                     /locus_tag="LMJF_34_3600"
                     /EC_number="2.7.1.20"
                     /codon_start=1
                     /product="adenosine kinase-like protein"
                     /protein_id="XP_001686464.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655142"
                     /db_xref="GOA:Q4Q2I4"
                     /db_xref="InterPro:IPR001805"
                     /db_xref="InterPro:IPR002173"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2I4"
                     /translation="MGLETLSKGTSPAPMSVVCFGHPLLDMMATVENEFLREHNVDPG
                     SVTLAAPEQLVLFSKLLDEFKGQVDYVPGGAAMNTARVLAWMLPDVHIAYVGALGKDR
                     FAEILKSALTKAGVEQLFEECEDKPTGTCAGLVVQKDRTLLANLGAAVTLSLTHIQTD
                     AVQSAIEKASLYYAEGFFLNTASSPNNLLYVAEHAQRHGKLFCFNLNAPYISIAFQSR
                     LHVLLPHVDILFGSDEDLLTYASVRWPHDFDLKTLGTVMHANSRRHEALVRCLARISM
                     LPRATPARPRLVVGTCGPHDTYVACGDHVRSYPVPPMAQEEMVDVNGAGDAFVAGFLA
                     QYMVSRDESTSVVVGHASAQNCIRHNGAVVSGVPPALTRRISGTTEPVMTANSA"
     gene            <1564089..>1564610
                     /locus_tag="LMJF_34_3610"
                     /db_xref="GeneID:5655143"
     mRNA            <1564089..>1564610
                     /locus_tag="LMJF_34_3610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686413.1"
                     /db_xref="GeneID:5655143"
     CDS             1564089..1564610
                     /locus_tag="LMJF_34_3610"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686465.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655143"
                     /db_xref="InterPro:IPR008011"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2I3"
                     /translation="MCAAKHTIREIRHVAESPYRAQVLSWYRRCLRTAFTAPWSSDED
                     ALYVLEETRRLFHQNRGIRDLERIERKLREVEMRYEMALHYNIPYPRPFNKMQGSMQE
                     SGVPYAAYLDSAYDHMVNPRIGVIAEGSANLGIMGGLEKSSQYFEDNTGEADVDGRAN
                     PYDTEAEPPSTVR"
     gene            <1565899..>1567611
                     /locus_tag="LMJF_34_3620"
                     /db_xref="GeneID:5655144"
     mRNA            <1565899..>1567611
                     /locus_tag="LMJF_34_3620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686414.1"
                     /db_xref="GeneID:5655144"
     CDS             1565899..1567611
                     /locus_tag="LMJF_34_3620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686466.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655144"
                     /db_xref="GOA:Q4Q2I2"
                     /db_xref="InterPro:IPR002641"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="InterPro:IPR021771"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2I2"
                     /translation="MDSALHAFRMHGASFYHWTSYVVYVIYSCLFFACEVIAGVLEIP
                     TDAPQYDALTHQANCTTTYEEWLPIASTLDDMDGFQKWRTDEASTYFSFEGVMRTIEE
                     LLELRSLESAEALLDNLQKHVHRSLYGISHRRLYLYKTGTKTVIHSYNSLVCFLLGRV
                     GEAARANQRMAVRTREVLSEMSRVYGSTALLLQGGVLASSAHFGVAKALYEAGLLPPV
                     VYGSGSGALVATLVCCSTDLASLFHSSSDGNSIAEANALLGASTADSRWKRFHRLLHT
                     GEVCDPVALADFLQRSIGDVTFAEAYARTGRVLNIPFVSASPAMPRRNAGVDVQLLNY
                     LTSPDVLVRSAVLYAICPVAAVHPASSSSYAPPGGAAPPTHTLLARTRLMSTVVAYEP
                     PVVHQSYACSSGDHVGYGVLDPVQRMRGLFCIRFCVVSDASVRGYLWHLLHQSAYGDG
                     LRQRTRLWDWARYTFVLCLLGLAHVFLRLLAWMGYDAIAAPSPTSMRTFFEDDAGENM
                     RMHPISSVWLYLRLCYSPTTANMQALGLEGERQVWPRLEQLRMSISVEQVLAATLKRL
                     PAYR"
     gene            <1568720..>1570267
                     /locus_tag="LMJF_34_3630"
                     /db_xref="GeneID:5655145"
     mRNA            <1568720..>1570267
                     /locus_tag="LMJF_34_3630"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686415.1"
                     /db_xref="GeneID:5655145"
     CDS             1568720..1570267
                     /locus_tag="LMJF_34_3630"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686467.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655145"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2I1"
                     /translation="MRLPRALAVAALCFALCMLTTSVGGHQVALISDIHYDPLYGTSR
                     ALKCTSSSSPVYGMQGCDSSLQLMASTLADVSAQSPSLLLYTGDWQRHKFANSSLAPA
                     AIFKDMSERFRNVTVDSSLGAVAFSGAVGNNDVVPDYYFSLGSTTSEEELAHRVAAMR
                     GAALLNDAEASVMRNCGYYTHIMDSVHVIVLHTLLWAHELQPSLPSNLSDPCNQFSFL
                     RSELAKVRAASKRAIIMGHIPPGLNTYNVLKRGFGSAAGDMFWKEQYEATYNSIIREY
                     KDLLVVQLFGHTHMFKLLTMPRNGVLGIVVPSISPIFGNHPSYLMANFSETWELEDAQ
                     SRYTIGDGVFHPGLSAKEVFSLNTGLYSVADVRAAITLLATDDTMWDRFLTVFCGGEK
                     SSHVFPHRKCDKQCRYIVVCSMLENNHTDIQHCVANYSLLPGPSQDTGTTVFMSAVIV
                     LCSLFVSGASVAMLLMIRSGQTTLSWSNMKSAIWWKSLVSKQESNTTTTTTSVGEDEL
                     RERRTVV"
     gene            <1572699..>1573187
                     /locus_tag="LMJF_34_3640"
                     /db_xref="GeneID:5655146"
     mRNA            <1572699..>1573187
                     /locus_tag="LMJF_34_3640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686416.1"
                     /db_xref="GeneID:5655146"
     CDS             1572699..1573187
                     /locus_tag="LMJF_34_3640"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686468.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655146"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2I0"
                     /translation="MPSMSKLVPATASEIAAIVSPASATTTTAAPVLVNLRLNIITAV
                     LILGVSLVLALVYTLWKLLPRIRSGELSFSKLEFDWRAELLNQMPKKEKVRRAAEKAR
                     REEEMASGCDRDKNEGHVQYAAMQPRVEVGEGDAAAARSQRSGQRHGEADESVAVTMP
                     RE"
     gene            <1576783..>1577100
                     /locus_tag="LMJF_34_3645"
                     /db_xref="GeneID:12981357"
     mRNA            <1576783..>1577100
                     /locus_tag="LMJF_34_3645"
                     /product="hypothetical protein (pseudogene)"
                     /transcript_id="XM_003722349.1"
                     /db_xref="GeneID:12981357"
     CDS             1576783..1577100
                     /locus_tag="LMJF_34_3645"
                     /codon_start=1
                     /product="hypothetical protein (pseudogene)"
                     /protein_id="XP_003722397.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3645"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3645"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981357"
                     /db_xref="UniProtKB/TrEMBL:E9AEH7"
                     /translation="MPSMRKLVPATASEIAAIVSPASATTTMTRSPAYVDGGVRITPV
                     MMVVGMSLVLALVYTLWKLLPRIRSGELSSSKLGFKGRAEPLSRKPKKVHSEDDCSSA
                     GMV"
     gene            <1581208..>1581687
                     /locus_tag="LMJF_34_3650"
                     /db_xref="GeneID:5655147"
     mRNA            <1581208..>1581687
                     /locus_tag="LMJF_34_3650"
                     /product="putative 60S ribosomal protein L21"
                     /transcript_id="XM_001686417.1"
                     /db_xref="GeneID:5655147"
     CDS             1581208..1581687
                     /locus_tag="LMJF_34_3650"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L21"
                     /protein_id="XP_001686469.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655147"
                     /db_xref="GOA:Q4Q2H9"
                     /db_xref="InterPro:IPR001147"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR018259"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2H9"
                     /translation="MVHSYGYKSGTRHLFAKKFRKHGAPSVSTILTNIKVGDYVDVVA
                     DSAVREGMPHKYYHGRTGIVWNVTPRGVGVIINKPVRTRTLRKRICVRFEHVRKSRCQ
                     EAFKAKEHQFQAYLAAKKAGKALPPLQKSSRLGGIVRPKTVEVLARRVADYEAMVPY"
     gene            <1583110..>1585023
                     /locus_tag="LMJF_34_3660"
                     /db_xref="GeneID:5655148"
     mRNA            <1583110..>1585023
                     /locus_tag="LMJF_34_3660"
                     /product="transmembrane/endomembrane-like protein"
                     /transcript_id="XM_001686418.1"
                     /db_xref="GeneID:5655148"
     CDS             1583110..1585023
                     /locus_tag="LMJF_34_3660"
                     /codon_start=1
                     /product="transmembrane/endomembrane-like protein"
                     /protein_id="XP_001686470.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655148"
                     /db_xref="GOA:Q4Q2H8"
                     /db_xref="InterPro:IPR004240"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2H8"
                     /translation="MRLGKQLPGSAQHMRAGRAPILVVAVVLLCATVFASAGITGHSI
                     GTIISPEANAYRSRRTLSPMDYYKLPVCQPSDEVMKARREHPFIGEILMGNRLVPTMF
                     EFRVGEDVKCANLCNASFTVKAVRRANYMINNDYYVRMFLDNKPLVSASPHEGSNAYL
                     LGYPLGAQNSVEKTQVKTNIIHNHLDFTIRVKNRAISQFTGEEVIGFKVVARSLAEVD
                     TCTATAFQHSNQPYVLPSYRDGKDAKVPFTYSVMWERSNEEYPIEHRIGEDAQRRGHR
                     IATLYGFLLTMLTGVVVAFVMLRTVRKDLAVYLDEELDEREIREDSGWKLVRGDVFRP
                     PQQAAALATAVGAGCQIVVTMLSSVFLCAIHVVDSTHRGTFLSTVIVLFLIGHVVSGF
                     VTTRLLKLFGIGTWKTAMCCMAVFPAALGGGVMLLNLIHWAKHSTAAIPFLTVVGIIL
                     SWLLISLPFGCFGIYWGFKMDTLAVTARVSSIPRLIPEDADSMTLYYVLAGSLVPFIA
                     CCVEMPFALNAFWREESMYLYGFLTFFSIALVVLSAEVGIVVTYFTLRGEDYRWWWRS
                     YSALATTGIHVFAYSIFFLKRSLQIRALSSIILFLGYMLGASIMFGMALGSIGFIGSF
                     WLVQKMYASIKAE"
     gene            <1588967..>1590799
                     /locus_tag="LMJF_34_3670"
                     /db_xref="GeneID:5655149"
     mRNA            <1588967..>1590799
                     /locus_tag="LMJF_34_3670"
                     /product="putative vacuolar ATP synthase catalytic subunit
                     A"
                     /transcript_id="XM_001686419.1"
                     /db_xref="GeneID:5655149"
     CDS             1588967..1590799
                     /locus_tag="LMJF_34_3670"
                     /EC_number="3.6.3.14"
                     /codon_start=1
                     /product="putative vacuolar ATP synthase catalytic subunit
                     A"
                     /protein_id="XP_001686471.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655149"
                     /db_xref="GOA:Q4Q2H7"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR000793"
                     /db_xref="InterPro:IPR004100"
                     /db_xref="InterPro:IPR005725"
                     /db_xref="InterPro:IPR020003"
                     /db_xref="InterPro:IPR022878"
                     /db_xref="InterPro:IPR024034"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2H7"
                     /translation="MARDQHAFESEQQMGSVKAVSGPVVIAENMSGSAMYELVQVGSF
                     RLVGEIIRLEGDTATIQVYEETDGLTVGDPVYCTGKPLSLELGPGIMSEIFDGIQRPL
                     DTIYQMVQNVFIPKGVQVRALNAQRQWDFTPSVKVGDIVTGGDVLGFVAENSLMNNHS
                     IMVPPNMQGRVVSVQPGGNYTLDDDVVDIEYNGKRKSLRLMQRWPVRTPRPVALKESG
                     NHPLLTGQRVLDALFPSVQGGTCSIPGAFGCGKTVISQALSKYSNSDCVIYVGCGERG
                     NEMAEVLMDFPTLTTVIDGREESIMKRTCLVANTSNMPVAAREASIYTGITLAEYYRD
                     MGKHIAMMADSTSRWAEALREISGRLAEMPADGGYPAYLSARLASFYERAGLVTCIGG
                     PKRQGSVTIVGAVSPPGGDFSDPVTSATLSIVQVFWGLEKRLAQRKHFPSVNWLISYS
                     KYLNALEPFFNTFDSDYMRLRAVVSEILQREEELQEIVQLVGKDSLSESDKIILEVAK
                     VIREEFLQQNAFTPYDKFCPLYKTCWMLRNIVTFYEEAQRVVAESAGDHKITWNYIRE
                     KIPTIYTGLTEMKFRDPIEGEEANTDYFKKQNEEIISSFNSLLQ"
     gene            <1592887..>1593402
                     /locus_tag="LMJF_34_3680"
                     /db_xref="GeneID:5655150"
     mRNA            <1592887..>1593402
                     /locus_tag="LMJF_34_3680"
                     /product="50S ribosomal protein L13-like protein"
                     /transcript_id="XM_001686420.1"
                     /db_xref="GeneID:5655150"
     CDS             1592887..1593402
                     /locus_tag="LMJF_34_3680"
                     /codon_start=1
                     /product="50S ribosomal protein L13-like protein"
                     /protein_id="XP_001686472.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655150"
                     /db_xref="GOA:Q4Q2H6"
                     /db_xref="InterPro:IPR005822"
                     /db_xref="InterPro:IPR023564"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2H6"
                     /translation="MSKQWLCREGERWWLLDARGQQLPHVAKIAAQYMTGQHRPDFTP
                     GMMTGDHVVITNIKDAVMTGDNWIRVPITWQTAYPGGKYRVRLSEMYERDPCMVMWWY
                     LKDEVNRHFVRKLKTRTAPLEKAWLYEDSVHPHAEKNPRPLVWTDTATMGWRYKDPTF
                     QRRWSPNQFMS"
     gene            <1594605..>1598537
                     /locus_tag="LMJF_34_3690"
                     /db_xref="GeneID:5655151"
     mRNA            <1594605..>1598537
                     /locus_tag="LMJF_34_3690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686421.1"
                     /db_xref="GeneID:5655151"
     CDS             1594605..1598537
                     /locus_tag="LMJF_34_3690"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686473.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655151"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2H5"
                     /translation="MSSSASLPAATSSSLSTSPPLLSSRESAQHIWRSLRRQRVPWQD
                     ALALLPWQLQAMTPAQRQFLSSQAARTPARVASLALAAWDMHEDAALVQQYRSLKRTT
                     YMVNYARLVSAALRERPSLPNGLLPVPYGVVEHGYVLGHRSPQDAKIALALSKHMTLL
                     GREALTREAAERLVLRHAALEGLAGHWQAALGIVQHSRAVRLSAREGMKRYIRSLLTR
                     QGGFPLTTAAPLAQSRDSSVSKHGDARVGPRNEKAAPAEFAVEAPARREDASADWVDA
                     LRAFLSKEPHTQTYPGARHVLESLPPEVMGNRTSLLLASTVLHCCARRMFAGTLTRRV
                     VSYVANANWFMALALTCAAQYYDVAVPLIPLATKGSSGGTTGVLDFPPELRAYVAAVK
                     HLQQEERPAAAETSSLTVKEAAALTYPEALAHALTATSPATWRTLLLSCPHTRSPTRL
                     RYFLLAACGEARDATLFERTSVSRCAEDRIECCTFQSRAASRLICAAAEPRNQQYFFK
                     VIPASCRAHHFERSPLTNAPRQELGPGPDTGQRAPAAAAATTDAAEVLSTSAAGAPAE
                     STLLAVSITPVRERLRTWRRRTATTPEECTQLLADVSLYLRATHRVEGAVISANQQPR
                     LTEDVFLKAVAALAASGVVQLASTERFHWPLAVLKTARLLRVQVDASLLVATARTIPS
                     MFVDRTGLALASILGAHTLLCDWKAGLQLCTRLLRKQQDGELEVDADTPRVGKPQTHR
                     FTAPPPTLLEAMAQVGYASPAAVAVRHWKTLQSFSVSTLAPLHSERSCALPLLLLELQ
                     QFHDERQLCEEVRHLCAGRRGGSLQKKLNGLSRCRMLLGAAFCLLDDEAALRRVLRAA
                     GKERARSADVDTHGLQRLLRVVPSTDAAQVLAAEAREGRCAHEHWLCEVMSRPDVAAD
                     AAGDLARLRPFSATLSALCFFKQAAAAHDAVGCLKGLVRLAERASDCPYLDVLLRSLL
                     RLLRLFLSHGGLLTASVVTREMAEGKGRAALPRPTVLALACKLFNRMQEMQRLSLPLK
                     PARRVLRRASDAHLSDAHAVAGDTDAARPGKSPVAPCAVWALLGVLHSTTSSVLQVPV
                     PASFTSSLLSRVVETNMAADWWTALLFFQSLRHPTMQERALLVRALRHCGGAATPILL
                     SNRRFLRDCPEQVVIWADEASGPSKWSQSISLLEHAQEVERRTTASAAEADQDGSDST
                     EPARAPASPLSPAVVAIIRGWNADERLRCSELLRRQGFIATGSSKNGTPLDDARVTKM
                     ADPRAQQQAEAILQLLKERPSFAEPFINAPPMLDADHPGVRAARRNGE"
     gene            <1599249..>1600625
                     /locus_tag="LMJF_34_3700"
                     /db_xref="GeneID:5655152"
     mRNA            <1599249..>1600625
                     /locus_tag="LMJF_34_3700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686422.1"
                     /db_xref="GeneID:5655152"
     CDS             1599249..1600625
                     /locus_tag="LMJF_34_3700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686474.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655152"
                     /db_xref="GOA:Q4Q2H4"
                     /db_xref="InterPro:IPR009286"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2H4"
                     /translation="MDASSIVFLGAGKCNVVVDLPMRFVPSSLSAASHPTGAATQRAA
                     LRIRNAAVKECPECYRALEPYAGRRRAVPLPADLYAAIASVVPAKYHALMHNTSEATL
                     VPNFTSDPAQLLQMDMAASDAAGRVADYTVEVKPKSAWQPPQVVGIVADGAARWIEET
                     KQHYCRYAQMLRYKEVRDVAEEAPASVASAAPHGSVRSAKMGCGPYCPSYLFRPALSS
                     REGLQRLMHNPQNNLKVVSYHASRKGTHTGDPKTLTVEELNGIADAIDASRVLAPLAH
                     LQLYGCAPASADASPEETQSRSVPVLDAHLLYHWSVAQNKEDVQWIVVDTDPDVLCSC
                     VSITDEDACKRPSRASPRYVAPTLDYAKCLDRFYVSTTAKDVSLMIAVSCRTSQPAAP
                     ASECAVMTDVSPEVDGGCFVRRGAAVYRIGVVDLDAKTHKSLAHYYMHDKDIVNAFVA
                     RGSNKGDE"
     gene            <1602022..>1602573
                     /locus_tag="LMJF_34_3710"
                     /db_xref="GeneID:5655153"
     mRNA            <1602022..>1602573
                     /locus_tag="LMJF_34_3710"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686423.1"
                     /db_xref="GeneID:5655153"
     CDS             1602022..1602573
                     /locus_tag="LMJF_34_3710"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686475.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655153"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2H3"
                     /translation="MAHGAAQCTLAAPGCVYLTPEQEEQLVDRLYTQSLLQKEATLAE
                     LDARYYPVTASQTISQETLQKSVQRQVDVEMERRQQRRKEMDAMAVAKAMGHASGSRA
                     AASKKTVTAEETDVSVRRLYDDALAQKKARKAESERLYAFHPEDLKSAKMSKAALQES
                     VNRMSKPKKTEFAVAEVNKIYGL"
     gene            <1603520..>1604428
                     /locus_tag="LMJF_34_3720"
                     /db_xref="GeneID:5655154"
     mRNA            <1603520..>1604428
                     /locus_tag="LMJF_34_3720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686424.1"
                     /db_xref="GeneID:5655154"
     CDS             1603520..1604428
                     /locus_tag="LMJF_34_3720"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686476.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655154"
                     /db_xref="InterPro:IPR007511"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2H2"
                     /translation="MSEGKRATSAAPEAKYNAYAEAADPDRYRVADALLFTCAEHGKA
                     CVLCVTAGKNGRSGRTAAVGATLFWLTCPNLNAIIARFEGHRCVQAVSAAMAQQPCLC
                     DWHVQSHDVYASRAKDLLSPAQWCFFESHFLSDEQPSLHKYGNAAVSHASDMKCLHAL
                     VAQTLAGVANPVGSVVVNYILLQHKLVCEAADTGNTEQQGVEEKRLLMKATLNSTRLF
                     SDFTTAFVRAASERPREDWHALHNVSFEVPLPEGNMWCKTAVQYMWQVDSQLAALCPD
                     LCARALTVHVALGGPSRRRHKKHRMN"
     gene            <1605190..>1606233
                     /locus_tag="LMJF_34_3730"
                     /db_xref="GeneID:5655155"
     mRNA            <1605190..>1606233
                     /locus_tag="LMJF_34_3730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686425.1"
                     /db_xref="GeneID:5655155"
     CDS             1605190..1606233
                     /locus_tag="LMJF_34_3730"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686477.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655155"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2H1"
                     /translation="MHLAGTPCAQQLGTFFSTSELSSSSHNERSSSAWPRGPPEQRYK
                     HAGAPVATYAHAPSRDVGFGGRAHVATHRGRDILTAKLQRIRAEGNTIVAERWFLRWG
                     LYAVRRAALRRVQHRARLVLWSRVGARCFAWWRLVAQRRLHREVLYRDAAARERALID
                     GLCRVAWERWRQWAQVYARQRARAAHLGLVNRQRHALLRFHAWTCHPRRCRQLRSVEK
                     IRFSAERSLARFTLIRWRLHALESYLAFPLQVRAAQQVATAAFRAWQRRALIGASMRL
                     IRHEALLHLAERCFDRWKRWLRRRLQAALLREANEARLLLRIFSQWAWHHELHALDYE
                     QYVAERHLPRLFS"
     gene            <1606977..>1608443
                     /locus_tag="LMJF_34_3740"
                     /db_xref="GeneID:5655156"
     mRNA            <1606977..>1608443
                     /locus_tag="LMJF_34_3740"
                     /product="serine palmitoyltransferase-like protein"
                     /transcript_id="XM_001686426.1"
                     /db_xref="GeneID:5655156"
     CDS             1606977..1608443
                     /locus_tag="LMJF_34_3740"
                     /EC_number="2.3.1.50"
                     /codon_start=1
                     /product="serine palmitoyltransferase-like protein"
                     /protein_id="XP_001686478.1"
                     /db_xref="GeneID:5655156"
                     /db_xref="GOA:Q6XFB3"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q6XFB3"
                     /translation="MSSLSETLSEPLMSRPFHRALELFVAAALAYFLLQRFHRRGRGK
                     PPNPMSRLSAEEQERRIAAFQSIPFRAECSVTSNVPVPEYHGLTEVVGREGSHITIVR
                     PGSSEAEECLDLATYDFHSFSTLPEVVEVARAAVNAYGVGSCGPRSFYGTIKPHLVVE
                     QDLAKFLKTDDAVVYSFAYATVATLISCFSGRGDYLVYDDGVSSSVMEGCMLSRSDIR
                     PYKHCSMTSLEERLQEVVAKDGYSKPHRRFVVTEGLFSDTGDICPLPQILGLCHKYRF
                     RLLLEDSYGFGVLGKSGRGTPEQFDIPTMDVDVYIGSLSTSMGAVGGFCAGASRMIDH
                     QRLTSTAYVFSASLPPYITASVSQSLAVLARDDTFVAKLRKHTKRMRRHLREAGFNAE
                     KIKLVDSIDDASPVILLAVERAYVEREGLEKVESRLQRVINALQKKKVAVVRNVFTTD
                     EPVNNVSGLRIVAKSLATEAEVTAALEAIETAVKAEFS"
     gene            <1611548..>1613047
                     /locus_tag="LMJF_34_3745"
                     /db_xref="GeneID:5655157"
     mRNA            <1611548..>1613047
                     /locus_tag="LMJF_34_3745"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686427.1"
                     /db_xref="GeneID:5655157"
     CDS             1611548..1613047
                     /locus_tag="LMJF_34_3745"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686479.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3745"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3745"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655157"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2G9"
                     /translation="MALPPVLHVGPHELKLFPICRSAEVAPGRHRCNDSLLTRYCFVG
                     ELQTDADGRSVADVAAGRGSNCRTATILWCYSPLFQFEHKRIRVEEGVIEAALTKEVT
                     ARQHADVNSPSLKSGGAEAVKHKDSYSTSSSKASSAAPSVTSATGLPAVYLRVGNSTT
                     FREYRLVTEGRHSTALGASTELRAPSDASIAGDGDGVVSVHEAHKPPTLRPLAPRRPT
                     LRPIDTRPDGNSLRSMARLAHKQNAALRRCGAPASASTQRHAAPVEKELKAPQRPSPF
                     STDARAAIATAPVPHPRNEGCDEPCEAVPPMRMSLSCGEDSPASPHAPNERNLPQWAS
                     PADHCETPEVCARKDVPHGSHPFSAAGGSSVSSAFLSSSLFLCVSSQSPTSALSTARS
                     AETDMCDLHSSTRVSGSSGCFFYDVHRHSREITCLVSAVCTPLTQSTSCLTPTPAPKP
                     SLTRSLALRTLGSSSDGMPCSTQAPHGSAAQGMQVEVERVIAATPPSAR"
     gene            <1615880..>1617433
                     /locus_tag="LMJF_34_3750"
                     /db_xref="GeneID:5655158"
     mRNA            <1615880..>1617433
                     /locus_tag="LMJF_34_3750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686428.1"
                     /db_xref="GeneID:5655158"
     CDS             1615880..1617433
                     /locus_tag="LMJF_34_3750"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686480.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655158"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2G8"
                     /translation="MLRPFQGRAAASTSTATRESTASRVATPQRRHQQMRNGELIDKG
                     SVSTEAEVGKPYWGTTESVAMTRSTTASNTVFSTRAATSTSRTVSGGAAETTSAVSTR
                     SSYLVHSSCPVGEETQELGSGSYSADEVDPLLQAAMQLGSPLYDPVKRQFVCWQLHAL
                     EKRPRAAYGDVEGVSCDFCGHTDWLEGVPERATSSPSASATVANADEGKMDTHAPSAA
                     ASFTAHARFFYNCSACQVDVCQACLEEVRSDERLHVPCFQCQRCGGYETRQNAPLHRC
                     AEVTRISDDEGSTGVQALLTSPRSNVDASQALPAAPATSSPKYRGVPVGRPVRLGLCR
                     RFQQAVEAVAAPDTEIAAHAGKIANSTPHRKRKRASPEAALVPKQRSGKTTNDTAEVF
                     RVSDVSDKSCRKVRRASASALPKPAPPKQEADDADGDASRALVEAALLPFARYEVHLT
                     PRTAEEVGEVGRIAREQHLVCSPLPSLAKTCVFYFTTRLAAETCVDRATAASLDAILK
                     QSVTPVCRT"
     gene            <1618339..>1619610
                     /locus_tag="LMJF_34_3760"
                     /db_xref="GeneID:5655159"
     mRNA            <1618339..>1619610
                     /locus_tag="LMJF_34_3760"
                     /product="putative actin-like protein"
                     /transcript_id="XM_001686429.1"
                     /db_xref="GeneID:5655159"
     CDS             1618339..1619610
                     /locus_tag="LMJF_34_3760"
                     /codon_start=1
                     /product="putative actin-like protein"
                     /protein_id="XP_001686481.1"
                     /db_xref="GeneID:5655159"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2G7"
                     /translation="MSVVEVGTFNVRAGYIGDATCTRCVPALRAAAAPEEVDLISLLY
                     AAGKSLDTAPLPSSSAFANEEAGGPADSLLSQGSGAPPNALLPLWSLRQVERHPKQHI
                     DSLRRLKRDVLENAEQDPLCLVLPEIWHERIDVMEALFQLILEAPGLTTALYCMRPSV
                     GWTFASGAASSIVLDVGHSHTTVTAVLDGYALRHSVDTIPVGGDAVTAQYSELLSKHR
                     PVVEAAAPVLSHSTVREIYWRDWVADVKHCLARVLPYQGGTGSVASAAGKGSALTAVK
                     EAAVRAAADLQAPDGARVHLDERKAALPFEVFFSAAGDEKRNVATLMAMCKRQMDPEW
                     QLHTVPHLLAGAGSLVPGFRDRVVEELKAQDSSYFRYERDGVLNMAQTADGAWVGASM
                     AASSSSFEPLWVTRGEWAEEGASVLYRKLFY"
     gene            <1620806..>1621666
                     /locus_tag="LMJF_34_3770"
                     /db_xref="GeneID:5655160"
     mRNA            <1620806..>1621666
                     /locus_tag="LMJF_34_3770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686430.1"
                     /db_xref="GeneID:5655160"
     CDS             1620806..1621666
                     /locus_tag="LMJF_34_3770"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686482.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655160"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2G6"
                     /translation="MERRSEWVASLRSTLPQFSKRSAAPLERGNAAAILGPAPRRTLD
                     KALSSHNTTSSLLLPSEWCEQATQRLITTLHGIVPPLQVQQTDYFLCSLIHPSYVQAS
                     TMRCESEALRRRVQQELRRTVCMPLELTMTGSKSLRLLRELTHYVEQGAAAAATSARA
                     RATLPAAPVAGRSEARDPSYGPSSWSSYPLDASWPELHSADSTAFVQAFQRAGLDSLV
                     LYDKSFFAASSTLTDNISGAGSAEVSLAAFTALCGSIELVSGWCSLLQFVDRVASEQR
                     GLERNTDGHE"
     gene            <1622490..>1624274
                     /locus_tag="LMJF_34_3780"
                     /db_xref="GeneID:5655161"
     mRNA            <1622490..>1624274
                     /locus_tag="LMJF_34_3780"
                     /product="phosphomannomutase-like protein"
                     /transcript_id="XM_001686431.1"
                     /db_xref="GeneID:5655161"
     CDS             1622490..1624274
                     /locus_tag="LMJF_34_3780"
                     /codon_start=1
                     /product="phosphomannomutase-like protein"
                     /protein_id="XP_001686483.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655161"
                     /db_xref="GOA:Q4Q2G5"
                     /db_xref="InterPro:IPR005843"
                     /db_xref="InterPro:IPR005844"
                     /db_xref="InterPro:IPR005845"
                     /db_xref="InterPro:IPR005846"
                     /db_xref="InterPro:IPR016055"
                     /db_xref="InterPro:IPR016066"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2G5"
                     /translation="MSSLDAKVEQWLAWDRDPATRQIIESLAAKKDTAELRRRLETRM
                     KFNTAGLRSTMGAGSAHMNRLTVLQTAQGLAAYVKQQFAPAELSRGVVIGYDGRHHSR
                     EFGEITATVMHQQGVKTYLYRHCVPTPFVPYGVKFFKALVGVMVTASHNPKEYNGLKV
                     YWSNGAQIVAPLDVSIAASIDANLTPLESSWAPFTAADHVDPYDVVFEDYFATLRSSY
                     APASDASAVRFTFTAMHGVGTRFTTHGLRHVLGLPASHLSVVAEQAEPNPDFPTVRFP
                     NPEEGQSAFALSFATAGAHGASVVLANDPDADRLAVAERLPNEEEGWHILTGNEIGAL
                     LGWWAMERARRQGIALERCLLISTVVSSCILKTMAAREGAQYSETLTGFKFMGNKALE
                     RKASEGLQTLFAYEEAIGFMWGERVMDKDGVTAAVVVADLACYLRKEKQCSLVEHLQS
                     LYRQYGYHFTHNSYMTIDDPSRTEALLQSIRTAASGDYPSQVAGRPVTRVVDLAAQVD
                     TATPSRRPSLGKTPMITLHVDGGMSITIRGSGTEPKIKWYAELVTKDAAGQQVLNAFV
                     AKAVRQLMQPHKFGLIMRPEDAETFSKL"
     gene            <1626110..>1630024
                     /locus_tag="LMJF_34_3790"
                     /db_xref="GeneID:5655162"
     mRNA            <1626110..>1630024
                     /locus_tag="LMJF_34_3790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686432.1"
                     /db_xref="GeneID:5655162"
     CDS             1626110..1630024
                     /locus_tag="LMJF_34_3790"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686484.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655162"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2G4"
                     /translation="MSSVSAAPQLSPKVIPGCSNTHSNSGLPTILSDLGTFAYQSACY
                     GPQQLLACSSAVTNAGEVIFVYDMNSMLLTQSLSGHKAAVTALLWRPPPASYLQTGLF
                     LWSGDARGALMYWDVVEGVALTSIQTPCHAAVQSLTLLTDEHLLVVTQEGAGYVFNSH
                     LVDNTPLPPGRLLLETKQSTLLGNISRPSLVACSRLNDQHCCAVVLGDRLRILTAIQL
                     DSGATAPVAKDLIYDSCDGAPTVVDVFFSDAQEEVLYFATRNTVGCYDWKLRLMLNES
                     LLWLPDEVEFRRIFRSCSSGAAARTAASRSQESTASSSGDAAAAQVPLMYSFGSDQRL
                     VAWHVTRHDRFTAVLTDVRGARINAKLCVNVVQSELDSSMFAVLFEDGSIVHWQYSPL
                     ARRWKLLDCWLAPVVRPVTFCPVGAHHCCVALESGHLALMDITHSMAVRRFNLVYSGG
                     TKIVLLCRYKWSDLVWIVSDRIQQYCHHHQVSLIDTRTGEVVRVLRKPSSAPEQTRMK
                     EITMDPTATYVLLTFWNGTFEVWTAADSRLVHIHSGLGVANVSWAPPLMRPCLSGVQG
                     TPQLLAVLFSEGTLSLWSAYKDRVVVSRDAIPLFHPSSVEGSVRSAVVADTLVMWDGH
                     GNGVVLRAQGTRLAVRRLRDAPPNSGAVMCLGGPSPPSRATEFVSFSSPLAWPSSGSF
                     SYHEDGNNAASSISTGDAGLSSPPTAGFSAARAVAVLFESGMFAVWDIATGERHALSS
                     AGMAADVRALSLYWAGGSLCVLGADGCLYVLDTYLTEMNSSVRYRALRRPMKNVAFLL
                     PAHRTYVQVALELGSPQSGVGDQAQRASHSLSDAPSVVMEAVPASVRPCRGPFGQLLT
                     EDIQTLQDELELYRTTMVPRDVLLRLSRCGSTAATAVPVAPLTWLRRAAVVADFLGQP
                     AKQRFMRLAADVLRHWQPSAVARRGARGCPSPASSPADAALAAELTEWPPVSPDSEPL
                     GEDSFSVPQTYACADAYSEALAPSHVVRRNRILLNEQRSAALLVNARNHRARDDSMTR
                     LALARDWLRLESRQNVIEVLLDAPPESTTYNELATLSMAVAASTAVQSSSVDSATSAL
                     FAASAKRAAAMLLAQGDVEAAVEKLVLAGEYRSACVTLQSKGRWRDAVLLVMAVPQVQ
                     RPLLAEVLQRWSALSVKRGYRLRSAALLLAVGGANPHETQPPPLAALSLLIESAHFTD
                     VAGVLALVLAQYHEAILGWSETAAAAWLSISPAPSSDTSPAQPVSAGAMMDTVLHALG
                     DYSGLLHTVGNMAAEEVVLRQAAALKVSMQQAAKDYSDEGGN"
     gene            <1630990..>1632057
                     /locus_tag="LMJF_34_3800"
                     /db_xref="GeneID:5655163"
     mRNA            <1630990..>1632057
                     /locus_tag="LMJF_34_3800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686433.1"
                     /db_xref="GeneID:5655163"
     CDS             1630990..1632057
                     /locus_tag="LMJF_34_3800"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686485.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655163"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2G3"
                     /translation="MRARRSCKFAEYLSTYAILEHIGIHPTTLIEKRDAAVGVGVYVR
                     DACDAGTALLAVPSKRFCTTSVLSRVGLKTSFCSPWRADSEVPSTAFAGPTCDVQGGI
                     LSFLTGSTQWPELAWRLALEQHRSVSPLWGWLQSLPSVEELADRRDVAERQCRVHHTM
                     LLPYYLKGRQRIREETVAAYSQLRAQNILPCFDRFAWAVDVVLSRGLLLPTAWPTAGG
                     VFTNSTTDGEHEEEDSDPLPHTSLECGVVPFLDLVNAPDDVGRVVNADIEIATSLETL
                     PKFLTDELAADATARGRGGDDLAEVKRLLETHYYLCLTLRKPLRASEEVILEWQVPVL
                     TTEVLTAAEDAIVSRFLKYMF"
     gene            <1632824..>1633417
                     /locus_tag="LMJF_34_3810"
                     /db_xref="GeneID:5655164"
     mRNA            <1632824..>1633417
                     /locus_tag="LMJF_34_3810"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686434.1"
                     /db_xref="GeneID:5655164"
     CDS             1632824..1633417
                     /locus_tag="LMJF_34_3810"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686486.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655164"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2G2"
                     /translation="MSFTYQRLKMRATTVAVDHMRSFCDGCNLVLSAVTHPFKRLVGR
                     VKAEAPWVNTLVACTLVTAVPLIFYPYVKKYVLTDERAAAEAERVRLCLQKGIDPYPY
                     MHHKEFVYGNSAPVLANETQIPQRIGWEFKALENYYKRKEKLRHEVGGNIDDTVQKLM
                     ALKKEQRSAYDRMRGKPGTEPRDLIFRGRNDADRLTS"
     gene            <1634388..>1634960
                     /locus_tag="LMJF_34_3815"
                     /db_xref="GeneID:5655165"
     mRNA            <1634388..>1634960
                     /locus_tag="LMJF_34_3815"
                     /product="putative ribosomal protein L14"
                     /transcript_id="XM_001686435.1"
                     /db_xref="GeneID:5655165"
     CDS             1634388..1634960
                     /locus_tag="LMJF_34_3815"
                     /codon_start=1
                     /product="putative ribosomal protein L14"
                     /protein_id="XP_001686487.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3815"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3815"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655165"
                     /db_xref="GOA:Q4Q2G1"
                     /db_xref="InterPro:IPR000218"
                     /db_xref="InterPro:IPR023571"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2G1"
                     /translation="MLRFFRARLAPTTTDAAAKLPAGNPVNKTWFRHNLIIRRKGSYR
                     SRWGNGTEGYGAGVPLSDQVKLHCVDNTNCKHVRLIAKATAERFAHCRVFPAVAHRVS
                     VQRFKGRGGGGEVSRHRVKPGNIYWVCLFTRRQTNTRMSGLQTNFDRNTCIIMNDQRV
                     PLGTRVMYCAGRHVNHKYHLKAVVLANFFV"
     gene            <1635832..>1636701
                     /locus_tag="LMJF_34_3820"
                     /db_xref="GeneID:5655166"
     mRNA            <1635832..>1636701
                     /locus_tag="LMJF_34_3820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686436.1"
                     /db_xref="GeneID:5655166"
     CDS             1635832..1636701
                     /locus_tag="LMJF_34_3820"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686488.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655166"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2G0"
                     /translation="MPAIVKQLPSSDDDNDQASLSPAKQYAQLGEESSPAGASRAELS
                     NAEAGAEAEGLAQPQKTDASGAERVVDVEECSRLKAAGNELFKDGNISEALTLYRKAL
                     WCAPLKPVRPHHPATGESSGLPTPPNGSAPAASSHTATQRDETEVEQQPEDKTDYTLT
                     AQVYCNAGFCLMKLDVKEEAAHMLSEAIRHDDSYLKAYIRRADCYYMMQKWSSAYGDY
                     ESYEKLGGVLDAQGCTRKAASKAKVDEEMQKMLGELKSLGNKILGNFGLSTDNFKFDK
                     DPNTGGYSMRFER"
     gene            <1637512..>1638213
                     /locus_tag="LMJF_34_3830"
                     /db_xref="GeneID:5655167"
     mRNA            <1637512..>1638213
                     /locus_tag="LMJF_34_3830"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686437.1"
                     /db_xref="GeneID:5655167"
     CDS             1637512..1638213
                     /locus_tag="LMJF_34_3830"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686489.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655167"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2F9"
                     /translation="MTVKPQVAQWQETVKQLAGLPHDVLRGMLRDVQAQLQEERRAFS
                     QERKEFEHVQLRLAKLTRDLESAQRQREQQRRHASKDAEAAARTSRLLRAARRRGQRY
                     EEAIARTLDDIHQLRHGNRDTAASPTSVPAISVGMDVLSIDSPGRRHVDVHTEVSVPP
                     TPARESSRAAAAVRAANEEQRRSVLLHELAHRVARVERENRMLRSSIDVLSRGDASSV
                     KLYCKLESLHPSRVV"
     gene            <1639074..>1639853
                     /locus_tag="LMJF_34_3840"
                     /db_xref="GeneID:5655168"
     mRNA            <1639074..>1639853
                     /locus_tag="LMJF_34_3840"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686438.1"
                     /db_xref="GeneID:5655168"
     CDS             1639074..1639853
                     /locus_tag="LMJF_34_3840"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686490.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655168"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2F8"
                     /translation="MSQLSASPREEPVGIPELFLQYLKAKDLKDQLAIVRAHPVLFTD
                     DVVAALKDARAQMNETFVEVKETCRVIDAVSGSLQYTGTSVQLQQTVAKELLDEDAIL
                     KKFATSLAGLLRARETAGPAAPSTISSLATASRVSSSLGAGKSHSPGAWFTQPSLVFS
                     VLTFLSAEEIFITAENVCRAWQTWLFLPDMSRFFWVGCVQREFPEQLQVLLQTAGDDL
                     YQSDWRSLAMLCVTEGEQAAEAEEAEEAGDGGAVRGVVPFL"
     gene            <1640831..>1641523
                     /locus_tag="LMJF_34_3850"
                     /db_xref="GeneID:5655169"
     mRNA            <1640831..>1641523
                     /locus_tag="LMJF_34_3850"
                     /product="putative aquaporin 9"
                     /transcript_id="XM_001686439.1"
                     /db_xref="GeneID:5655169"
     CDS             1640831..1641523
                     /locus_tag="LMJF_34_3850"
                     /codon_start=1
                     /product="putative aquaporin 9"
                     /protein_id="XP_001686491.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655169"
                     /db_xref="GOA:Q4Q2F7"
                     /db_xref="InterPro:IPR000425"
                     /db_xref="InterPro:IPR022357"
                     /db_xref="InterPro:IPR023271"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2F7"
                     /translation="MLSEFLSQLVAEFVGTFLLVLTIALASVGVGALAPIPIGFMLAA
                     MCFTFGYISGAHFNPAISFAVFINRKMTLRRTVMYIVVQLAGSFCASLYASAIIGLQI
                     PAPVAKGDLANTWQVLLCELVYTFALTSVVLHVCFSRQRSNDFYGFAIGMTLMAAGFS
                     VGGFTSGAFNPAVATGTQLVLCVYKNCDPLFYFWVYWIAPICGAFIASVIYQLLDTHE
                     SVPVVLGKEAVY"
     gene            <1642935..>1643276
                     /locus_tag="LMJF_34_3860"
                     /db_xref="GeneID:5655170"
     mRNA            <1642935..>1643276
                     /locus_tag="LMJF_34_3860"
                     /product="putative small nuclear ribonucleoprotein"
                     /transcript_id="XM_001686440.1"
                     /db_xref="GeneID:5655170"
     CDS             1642935..1643276
                     /locus_tag="LMJF_34_3860"
                     /codon_start=1
                     /product="putative small nuclear ribonucleoprotein"
                     /protein_id="XP_001686492.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655170"
                     /db_xref="GOA:Q4Q2F6"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR027141"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2F6"
                     /translation="MAESIPIKVLFDALHLKVSIEVATGEVYHGTVEELQNNMNVLLK
                     DATKTARGGKETKMDSVFVRGSNIVFFQLPDALQTSPALLRAGEVVSKAKDTRGDGKG
                     FGASRKRARNS"
     gene            <1643872..>1646217
                     /locus_tag="LMJF_34_3870"
                     /db_xref="GeneID:5655171"
     mRNA            <1643872..>1646217
                     /locus_tag="LMJF_34_3870"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686441.1"
                     /db_xref="GeneID:5655171"
     CDS             1643872..1646217
                     /locus_tag="LMJF_34_3870"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686493.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655171"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2F5"
                     /translation="MLLCLHHIPYCSLSLSRVALPQPTHPLFYYLCVPLIACMCRMGF
                     PKGNGWPHVLRLSGATALSLLCVTSNVVRARGLIRWFVPSLLLVSLFMHRATHGFSRS
                     SCVQSSALADVPAAATLAHARHVSETYPRFVSPSVKLPELRAPAPILRSGNANASAKV
                     SESSRVLEGTRCAIRKTPREVEFPAAEDRPCLPFPLEPLKSTSQPFTPSKLVSSDDPP
                     SLVLKKGVAELQKESHLCDTGTVESLLSRQQYVDVYFVASSLLTVGNGAAKVAAGGEK
                     RRLHLLSHRCLCSYALLRFKECCEDGTAALALYRHLQGDSSFSSLGMLDEVLHSRVVQ
                     ALLGALVMRELYSDAAVLLASVPPVLDTGGDTSSKDFGGIPSPLLVATRQDTLASLAS
                     FRQCVAARRWVEAVQIIDGSATAQSWAQATPLCAMVAFVRLEMDDPKAARALLLPYLA
                     SLPEPPSWEALSTAPVEHAQLWDNFTSHYVFSTTLLAKASFMSGSAYLNISAALLQRA
                     LRLSPSYAPARLFAEFVLSFEAQQQHVDAAVSASDYPKVLSVTAEMLRMPEVTRLVRA
                     ELYLVRTQAQWMRGQPLEVVHEASRCEQCDPQCALAFRLRADAFAMMSRETEAAADLA
                     VAKHLNARVGALFDELQVQRSRRNAAQVEAKAKRNSVPAFKSFPSASAPLRSSATESF
                     CGSTRRSGAQARMSTDTELSPSLRTHYDVLGVSSNASEAEIRRRYRRLTLQLHPDRLV
                     GAAESDRRAALEAFQLLGNAYSVLSDTQLRATYDAGLPGLH"
     gene            <1648041..>1661975
                     /locus_tag="LMJF_34_3880"
                     /db_xref="GeneID:5655172"
     mRNA            <1648041..>1661975
                     /locus_tag="LMJF_34_3880"
                     /product="putative dynein heavy chain"
                     /transcript_id="XM_001686442.1"
                     /db_xref="GeneID:5655172"
     CDS             1648041..1661975
                     /locus_tag="LMJF_34_3880"
                     /codon_start=1
                     /product="putative dynein heavy chain"
                     /protein_id="XP_001686494.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655172"
                     /db_xref="GOA:Q4Q2F4"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004273"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="InterPro:IPR013594"
                     /db_xref="InterPro:IPR013602"
                     /db_xref="InterPro:IPR024317"
                     /db_xref="InterPro:IPR024743"
                     /db_xref="InterPro:IPR026983"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2F4"
                     /translation="MATNAETDPRLSWVFEQIRRNLNGVTDDSLKDLFHDRKNVDTAL
                     STFGTVDSVLESSFVVVAREKELIDGHAKDPLQHAADAPPPQHHTGDGSGRGQRLRIS
                     SGAVYNANIACSALYAPDHSRCLFFVRVDHREITAEDAADWATNPQNPIHFAFELSGT
                     QVPSLNSFYVLLLEVFAPMLQDMGQAAGKRKALMALALNCGASAASVTQGGAAETGSG
                     ADAADGVTATGNNRQLYVDIHSWINRLGTQLEGFINQVGAERKLLIPQDLYALEYSDA
                     QLQAVLSNKDVLRQVDATVSQWQAEISYAMSVEPQKEGPLGEIEYWRERYSTISALYE
                     QLNSSQAKFILRIAKEAGCTSATMIDLTLQQFFRMHSESKDNVKFLGTLDRHFRTLHS
                     VDPKLGSLQPIIDTLFSMMTALRMVWIISRFYSTEERMVGLLEKIARLIAQKVSEHID
                     FRTVLTLPSEVAKVKVTEGQQCLIKWKAAYKSVQEEINSSEREQHWSFDERRLFDVTD
                     YMSDRCTDLLEVIETVEYYTTVLSAQLKTVLTDATDIERILKDVEKLKRPFGTLTFDP
                     FERRATHNWQVVFSGFLTAVTSLDHEVSLFINRIFDDDLRSAESAFELLVSFKRIRTR
                     PDHGGNSLDISALLLEKTDRILAQYFTEVENVRRIFQDQKEAPPLSKNQPPVAGAIHW
                     SMSLFHRLKKPIVRFQREGMLKSLVGQQVKAKYVEASRQMKNYSTARFLKWREEVRVP
                     APASLKWNILRADPDGTYKVNFNWSIFDMIRETKYLDRLGFEVPKALLHISLQDEAYH
                     GYVDALNAMLVSFNYELGALAGPERAILAAEVHELKQALEPGLLDINWTSLSIPDFVS
                     NCEKAITKFRNVSREVRKSADSLQTQVVNKIASTRLIPEYREFLQAGGELPELQTLVD
                     IIERRRVEQLERCMRAYRTAKPLLTKVEGQLLGTHTGRCANLVSYYSHWEQRIWRALA
                     TMVLKSLASFAKLVGYTTSSRASARPPPLFKVTVLLTSEPTYTPQQQEITTAFHKIQA
                     GIIETTKHFQRWMRGTCLEFTQGEIIPRPAEEEYMTLFTYYQDIYNLPQVYKLQALVN
                     RTIQTHLGALATNIKMLQRYRFVFLADKKISVEQQAKSQLQWIDYDAKFQLYFNMIRD
                     FDEESHVHDFGFMRCDEIPFYTELVGHVYQWVAMEGAQLSDTVRARMMQRYNTIKKIN
                     EDLMRPCDNIADLKFVLEVMHNARTSSLEVEQAVREIEYVYSSLQHYGVPLDAGMKLA
                     MSLQDMWSCTLARVHQTGIALEPRKVQFRELTVQEVSKFLDEGSKVLQEFRCTGPGRA
                     DIDLAAGNESKKQWRQRLSELQMKRDQLVKAENLFDLPLTTHTCLQQLNEELTKVETV
                     YDLYERWMSDLRRWNRSSWKDLLLSDLEATTEERAKQARVLGKQYGTVDPFPAVNQLI
                     LNFQNSLPLLAKLKSPALKARHWTELMRVTDKSFNYEQINLSELIAMELFRYIEEVDH
                     VVLAAAREQGIEQEIRAIKQYWAEKVFTPTPYAPRKGTARCDVLTDTSEIQEAVDDNT
                     LKVQSIANVKWAQPFAEEVKTWERRLSVISDVITVWVTVQQKWQYLESIFKGNDDIVQ
                     QLPKEASKFNDLDKKFVRIMKDTSASPNVSQCCNVTGRLEELRYLEEKLEECQKDLSN
                     YLESKRCLFPRFYFISDDELLSILATSSAKAVQDHMLKMFDNCAQLVFKSERDETICG
                     VESQEGERLDFGTPVKTDGRPVEEWLQAVLDESKQSLHDILKSGIFHYPKMQRLEWVR
                     QYHGMVALTGAKVFWTYEVEHAFVQVHKGKRGAVKQLSASLSRQLIDLVAEMDKDMDK
                     QYRKKINTLIIVDVHGRDIVDRFVRDSVTDAREFDWESQLRFYWEKAVDTCTIAQCTG
                     RFRYGFEYMGLNGRLVITPLTDRCFMTLTQALTFCLGGAPGGPAGTGKTESVKDLAKA
                     MAIQCVVFNCGEGLDYKAMGTIFSGLSQTGSWGCFDEFNRIELPVLSVVSEQLRFIQA
                     ALRAGAKEFLFGDSVIRLVPTIGTFITMNPGYAGRVELPDNLKALFRPVVMVVPDMEL
                     IAENMLFSEGFTTARELARKMVTLYSLAKGQLSKQHHYDWGLRALKAVLVMAGQLKRG
                     SSDLSEESVLMRALRDMNAPKFIAQDEPLFKGLMGDLFPGLDPTRVPQENLAKASTSV
                     LKERGFQINLKQIDKVVQLYETMQTRHTSMVVGPTGGGKSTVIDTLCKAQTELGLTTK
                     SYVINPKAQPTSALYGMMDPMTRNWTDGIFSNIFRSINKPAEGTERERRYVIFDGDVD
                     AKWVEDMNSVMDDNKLLTLPNGERIRLHPQCSLLFEVGDLQYASPATVSRVGMVFLDP
                     INLGWKPFMHAWKMRRPRDEQETLAELVDQFVQPLVNFVLDGADEEGTISPPPKLVMP
                     TNALSMVKQLTTMLCTVLPKDASLEPRALQSVFIFACVWSFGAFISSGPDRLRFDSFL
                     KRISGWNLQDVGDNFLTRFVGSGSLPEARTLYDYYFDLQDSRWKPWKVLVKPFERKPG
                     QPFSSLLVSTVDTERNMWLLNRIVLNRSPVLFVGESGTAKTVTIQSYLQHLKWSSVHS
                     SESGSEGSGDDVQLEAMLLEMNFSSRTTSLDAQRTLEDNIEKRTNTVLGPPARKRLIV
                     FVDDINMPKVDLYGTQQPIAFLKLLIESFHWYDRKDLLFKNVRDTQFVAAMAPPGGGR
                     NALDPRFVSLFTVFNILFPEEEAIQTIYQQILADAYKTLPVDADFATTITSMTLQLHV
                     SLVAALPATPAKFHYVFNLRDLSRIYEGLCRATPDKFPSTGALLRLWRNEVMRVFVDR
                     MGEEEDKAFVCGLIEKHVSEHFPRETATVMADPLLLGDFGDFEPASELEPLHIYEDFG
                     PSYARARQLVEAIMDEINTPVKKINLVMFDMALEHLLRITRVLSLPRGHCLLVGVGGS
                     GKQSLTKLAASICKMGVFEIVLSRNYGKDAFREDLKKLYHCVGVQRQRMIFLFMDGHV
                     KEEGFLEDINNLLASGMVPALFTEEEKEPLYASVAEDIEGAGLAPSKDNKWTTFIARC
                     RDNLHVVLSMSPSGDALRTRCRNFPSLINNTTIDWFQKWPAQALEAVGRKVLAEETLP
                     DELRTPIVEHMVQVHLTADRLSSKYQNELKRHNYVTPKNYLSFLANYAKLLVTRREDI
                     DDIVKKFTIGLEKLQHAEAEVNVLKEELAEKEVTLREKQEINAQMTREITEQQQKNQV
                     RKDESLKMEEELNIQNAEIEKESAEAQVVLEQAMPALEEAMEAVRHIDPKSITELRSF
                     AKPSVNVVAVVRMVCIVKGVPATWESGKIMMGQADFIRSLVDIDTLTPTLNQAKMNEI
                     NKVLKEFPVNSNDLKKVSMAASGLMIWVEAMKQYWNVAKEVFPKQELVRQLQKAKEMA
                     ERQLQACRDEIDRLTESLHRLEQQLEAGMAEARRLQEEKSVMERRLNAAHKLIDGFSS
                     ERVRWTEEKKLLGASRSRLVGDCLAGAAFLSYLGAFTYPYRQEALDSFWLPDLRARGI
                     PLTDGFDVRQLLTNDVAVSQWASDGLPSDALSVQNGILTSASTDYTGKGKRAGKIRFP
                     LCIDPQMQAVRWIKRQHQVNTRFETATFSDPDFLKKLEFAIQYGNPFLFENVDEFIDP
                     IIDSVLDPQFRYESGQRLIRIGDKDIPWDDNFKLYLCTKLPNPNYAAEVFGKTLVINY
                     GVTEDGLEAQLLNYVVASERSDLQRQSEELVQTMAESRAQLKELENTLIRELTLATGN
                     ILDNDDLIATLENTKSSATEVELKLHQAQETARTTEESRQQYRPAAKRGAVLYFVISQ
                     LSAINPMYEYSLSAFLYDVFGYSITKSDASFEIQDRLRNIIQTLTYNLYTYVCMGIFA
                     KDKVMLSFQMAVRLLGQEGRMVQSELEFFLRGCVLASKSFPANPARWLTERQWNDVCK
                     LSTTVDVFKHLTKDVADNAEEWQAWTALDRPEELDYNPLPCGYSNKISAFQLLCLLRC
                     FRSDRVYSAVTNFISTCELLGEQFVMPPILRYKEVLEKSSSMSPIVCIVSPGANPTDE
                     IVKLAAKEVRLDKMRSISLGQGQGEEAMRLVEVGATRGHWVLLQNCHLLTEWMKDMEK
                     MLEKMDSSQVHEQFRLWLTTEPSEQFPMGILQRSLKVVNEPPNGLKMNMKNTLSKVTE
                     DQLDVCPHWAFRPLVFTLAFFHAVAQERRKYGKIGWNVIYDFNETDFTVSMRLLDTYL
                     TKAYLNKDPLPWDTLRYLVGEAMYGGRVTDSMDRRIVQTYLAEYFGDYLFDTFQPFHF
                     FVEPGVADYCLPSGSTDPEKRVTLSQMVAQVDTFPNANAPDVFGLHPNAETGYLRHST
                     ETLWSSLIELMPRVSTVTVGGETREAKLTKFTEEILTQIPEPFDMKAVVLKETTRATA
                     NGHDAVQPTQVVLLQEIDRWNRLVNVMTTSLKELKKALSGMIGMSSELDELESALDNG
                     QLPQSWRRYAPATRKNLGRWIAHFQRRHQQYLSWNMHGEPKCVWLSGLMVPDSYLSAL
                     VQVTCRKYRWPLDRSTIMTTVTAFARPEEVTAAPEDGAYVSGLYLEGARWDPQRRALA
                     PQLKKQLITELPVMQIVPTESSRVKTVGTFKTPVYVNGDRRNAAGVGLVFMADLPSDV
                     HQSLWVLESVALLLDSDD"
     gene            <1663508..>1664422
                     /locus_tag="LMJF_34_3890"
                     /db_xref="GeneID:5655173"
     mRNA            <1663508..>1664422
                     /locus_tag="LMJF_34_3890"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686443.1"
                     /db_xref="GeneID:5655173"
     CDS             1663508..1664422
                     /locus_tag="LMJF_34_3890"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686495.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655173"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2F3"
                     /translation="MGHHADPNKYVAYRDATVLQRRIETFVLVFSVMIIALVMTFSSV
                     QHREAPCQDRAHEAEFDFMIRSDSTREAIVTALQTILKKRRCWLDFAPQNDDAPTMVQ
                     LNVLDTTTGLIAGRGFRLVRRSHGSNYQYELRAVFDKLCGTYPPISMEVMANVDYERV
                     TYYIKAASLMNSTVKYLQHSSLLTKEKNRVTTVTQLQSVFPGFHQLGPSTARLSTLQS
                     AKYTVEGVSQVYFNGSPLDIRVHVQHWQSDKGTPDFWRVVLSTQNIMAERDLVSLQSS
                     IREGLMRLDLLCNTTSARCDDELDLYLW"
     gene            <1667535..>1669040
                     /locus_tag="LMJF_34_3900"
                     /db_xref="GeneID:5655174"
     mRNA            <1667535..>1669040
                     /locus_tag="LMJF_34_3900"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686444.1"
                     /db_xref="GeneID:5655174"
     CDS             1667535..1669040
                     /locus_tag="LMJF_34_3900"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686496.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655174"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2F2"
                     /translation="MSLRMQSFAMSFSRRPHCHSTALQRYLALPQTPLDLPALSKLPA
                     QLVENGVVHQIVREMAIRTSRCYQSFSDPIIQKKMRKPNVDRLWWVKSYVLREFNYCV
                     ALHRGLEQCPQQGIFDSSTDISFERHEYGSSPSLFPCLCNTDDDSFIYEPAQTYSSGD
                     SVGSRAPRDAEEGTVSASASSSTSTLATSTFRPLGFLSNPAMTRDEVEAAFSTWDRGK
                     ATMPLILALKALRPRQSLLDVMVNEAAIRSDELNGWFIRFCRHRVAWRVLHEHLLYLT
                     HPANTQQVISSDTDVVEVLQRAGIAVVEIFSGLVDNGSVLSLEIHLEEDKCILTRAPC
                     GMLVSSSTSRLSCPADLPETRPTPISSRGIYSVEGHLTYIFREVLKNACAATLKLRPD
                     INVLIRYASDDTWVVVEFVDQAGGIHPQHFKNIWKFGWTTSEHYESHLGGFGVGLPTS
                     KVYMGMWGGSIDIYSTLGVETTVRVRFPKAPVEVLVPESTTAAAGISTTWK"
     gene            <1669903..>1670196
                     /locus_tag="LMJF_34_3910"
                     /db_xref="GeneID:5655175"
     mRNA            <1669903..>1670196
                     /locus_tag="LMJF_34_3910"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686445.1"
                     /db_xref="GeneID:5655175"
     CDS             1669903..1670196
                     /locus_tag="LMJF_34_3910"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686497.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655175"
                     /db_xref="InterPro:IPR018793"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2F1"
                     /translation="MEKEHKSICWRPKNALIECVVMTKCFQAKESVEDCIGANDCFLE
                     RRNWTLCKMNAINPRYRLRGNPYDLATEDQKKIEARNERIRQRELEEEGIFTK"
     gene            <1671749..>1673140
                     /locus_tag="LMJF_34_3920"
                     /db_xref="GeneID:5655176"
     mRNA            <1671749..>1673140
                     /locus_tag="LMJF_34_3920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686446.1"
                     /db_xref="GeneID:5655176"
     CDS             1671749..1673140
                     /locus_tag="LMJF_34_3920"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686498.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655176"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2F0"
                     /translation="MSTSYSVTTYMTTTYVNCEDVSGSDSEYSEYDLVNEQMQDFLLD
                     SEDTSDGDADVEDILGFGAVFMGGLMPTRSMDAHQACAWRRTTKPNRRRIAKKSESCS
                     SLSNAARLTASSSTTMLSDLDTVVREAVVTGGAAQRRGTRKQRRAMASGERRWLVPPL
                     SAVSVESTDGGNDGRRQLPWFTVVFDLDETLVGARYGPIHLRPHVGELLRSLHRLPVE
                     IIVWTAGTAHYVNPILHAIGQACGRRQWFHHIISRHKRWYRDTNVSVKDLRQLGRPLD
                     RLVMVENNPISALPQPSLCVLLEDYLQPNAADESLLVLKGLLERLALQYERAARTSSA
                     TGTCEQASEEECPAQRHTRSPRNTLRDATATRTTALPSLELLVRDDAALQLVEFRMED
                     ILKEDGVPMLQQAEMRELVGGADTLRCLCLCYTPPLLPSSTAVAPQGTAALMSCVSMA
                     MRSYGSVNPLRPL"
     gene            <1674168..>1675814
                     /locus_tag="LMJF_34_3930"
                     /db_xref="GeneID:5655177"
     mRNA            <1674168..>1675814
                     /locus_tag="LMJF_34_3930"
                     /product="putative expression site-associated protein 5
                     (ESAG5)"
                     /transcript_id="XM_001686447.1"
                     /db_xref="GeneID:5655177"
     CDS             1674168..1675814
                     /locus_tag="LMJF_34_3930"
                     /codon_start=1
                     /product="putative expression site-associated protein 5
                     (ESAG5)"
                     /protein_id="XP_001686499.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655177"
                     /db_xref="GOA:Q4Q2E9"
                     /db_xref="InterPro:IPR017943"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2E9"
                     /translation="MSAAFAAMKSYGKRSGRVAWARKRSLCLLWLGFLYVSWFYFREL
                     QSTYRDALSDIHTTVDKGVIGCHSANVSVAVTSTFMNTFIKAAVIPMIQNESNTVIVP
                     TQEVNHVWVDDMVLQHFKLRSLTVSTGVPDAQSMMIRATGLGLQVNKSRFIFQYMGVR
                     CSGTFWASLKEITVDAVMRLTLLPEERWNVTFPHLALDWGQVDVHHNLDSEACRLAQR
                     VVELFIGELDIFVVSKVKRMLDEKMPLKAADGLNDAFARFGIRAITPPVMTANAMAVT
                     LDLNPLDWGCASTPTASSVPELVSRDFAVRTTATSVNNVLYNAVQAQRLQVEKHLSAM
                     WNTSLLADLFPELYRACPGCRLYTLAQATREPVINVLHDGEVSVDVQDLLVGVYVQPN
                     STEHSSALSSLITEKQLRPRAGFSAGYRFLRRRKRISSQYHRKAFPVLAIGCSAASGV
                     RNISASTGHSISYELLPVRDVAVKVMASNIGDVSTKDLEKLITKVWNDFAAPLVNSAS
                     PLKLPFFVQEALLKVGSDVIEGGVNFSLHEEFLRAVFSTL"
     gene            <1680082..>1687968
                     /gene="TOR3"
                     /locus_tag="LMJF_34_3940"
                     /db_xref="GeneID:5655178"
     mRNA            <1680082..>1687968
                     /gene="TOR3"
                     /locus_tag="LMJF_34_3940"
                     /product="phosphatidylinositol 3-kinase-like protein"
                     /transcript_id="XM_001686448.1"
                     /db_xref="GeneID:5655178"
     CDS             1680082..1687968
                     /gene="TOR3"
                     /locus_tag="LMJF_34_3940"
                     /EC_number="2.7.1.137"
                     /codon_start=1
                     /product="phosphatidylinositol 3-kinase-like protein"
                     /protein_id="XP_001686500.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655178"
                     /db_xref="GOA:Q4Q2E8"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR001478"
                     /db_xref="InterPro:IPR003151"
                     /db_xref="InterPro:IPR003152"
                     /db_xref="InterPro:IPR009076"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR014009"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="InterPro:IPR024585"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2E8"
                     /translation="MAESLAPNDVGGISVTKLFSSDSTAALGQQLSSIFSNLNSTPND
                     RQQRAGECLSALTDTLFLHENELGANESLHERIIVLIDGTFCTSVDKGCSSFRVVFDV
                     KWKDQHEKRNRCFVLLLSRAFKCTTPEDCLKVIQCIGEVLEDNIRTTTDLLADHVEPL
                     LRDLFAADVHRRTVACEVLAKIVSTTTFIIKRNPTLLELLTSSCAPLVTLKDAMETRN
                     LWHRTALIRLTSALVENCYEVTPAVAKDVADLVFRYMRAAADESQLVGVLSALIHVAV
                     TPAFVSAPWDLPQLVCFLCDTDWSVYAVATRVAAVAAINKVAVFICQEEKACYEALRT
                     RSLEFISSDDAVEVVTEGLELLKEMEVLERELHLGGAVVNALCACIQRLPHVPIIYEL
                     LELIRERYSDLEVKSIYSLLEGYLDTKQELLNFGKVNALLRFAGPRIRLDDPRVAQLR
                     INVGANQPVPVILHSLPLLTTLQRTEQLHEVLEILSHDDRGVRRVAVSTALELCEIIM
                     ERNKFRNATQEGSAQRMQWLDEEVRNAVERVLDVAVADRDPGIRLWALQHLTVPFFPY
                     LCLCDNLDAIFMARNDNDKATRDQALTLLCQLLPYHPTVVQPQLQRAQEYMLHDVATM
                     DASVSFAVCKAGLLKMCVDHDALLIEGSTVEAIVLRRLEAQPFISRSLSIALLQLIRS
                     ILERTASQHHSDFHSFLRPLLLIVNGGDSCTRRREALETLTAFISHITKTDISGLSEV
                     YRAAARIIRRETEEEESVTIAAMKVLSSIGAVTPVKMRHVFRMVESDEMEEEEVVVTP
                     ALAHCKPRLRISTDMPERYPSVVLYYLVRSLQLALDPKQQVDTLVAVRTMLHDVEGKV
                     ELNLLTQLLPQLQTWLRDPERAFLYETVLGLMNDLAILLCQFKGTVAPSVGYELLRSV
                     QAFCLRPQASQKPFSAYVVQLLDSLAKGIPAQEMRDNRWAIEFIHQRLSQNKNDLDLV
                     HRVVKSLESFIAVMHEKELQMILPHVLQCIEPAKASPGGKLSKSKDINDACFDFLNFV
                     MAKQLTLVKHCCAQIVHTIMWYIELSDSNEEMDVGLNTLATLVDTVKMPAKRFIMPIE
                     RVAVRNGFPPQYFVNLVQSAAGGAKTHMTTSSGTGLNPDRPITLVSHLPRLSQAEFEH
                     EMRSTPRSENVLIDVLDVRHHHGQTMIDFRFHPGTDTAACCNLFSRKATDNKSAMRRN
                     LGILRVEQTEERSRPVGAEVIKALANLPVAKTKKREQSWVLWLHNATVTLLRNSPYAV
                     LRDTCAVADRNTELAKDLFPFAVAAVCGHLETPLRAQLMDIFDRALAAAPADVKQGLF
                     CFAEFMESERDDDRVKLVKAMRESVVSVDRESTSQKFGINYDQDPERGVIVTKLAPNG
                     VGARAGVPIGAQLLAINDIPVRAVSDIRGLIEGLTHIELLLSYEVEEKTKSKPKPLMN
                     LEVLASVAFSGEMHIKAIYFNEVLFESLSSKICKIADRKDSQMRRVMTIAEDLIQYYR
                     HLNMTMTANGLLKTLTRKFSDEIFAPEQFGFEEIASLEQLNWWSEALRRYEARMDSFG
                     TRCLEVASLVGVLRCEQALGHSSRVQELAEQYWEQLPADAQREVAPFRAKAAFCLGAW
                     DTFDALALDKRMQSCFGVVERCAALFRAECHDELLRYTDKVRESMLESFADSLNENYN
                     RAYEGMTRLQHLRHFEELVSFTTACEERQALLKRVWHRRLVQMSSRPDDLMTVLSINS
                     LVLEPEDDLHSYVYVIRCLCKSQWFSHAEHLLQRLLRENASLEVLCECDPELIHTYIK
                     YVYLAKDKHGAYVELKNILSAVEVDPEDPRAEMWGQCWLLLGEWTMYLFPECGEEAIK
                     ELMCATELGPNSAAAFHSLGILHCDLARDPSTQGEVQNNHLICCINSLFKSIQLCNDV
                     PGSLVMQDVLRILSVWFANSGIREINEAVHHGVQVVADHVWLNVVPQLIARIGIEARY
                     ARAILTDLLIRVGSQYSHALIYPLTVAEKSPDAVRRHMAERVIMGMRDIPENDRIVKE
                     ASLVSNEMVRIAILWTEKWHAAIQQAAYKPNNTAAIFSMLQPLYAELDRASTPNELSF
                     RCNFGQTLRRAKVALEEAKTDEAWGFLRQVYAQLRRGVLERRLYMSDVSPTLDGIQDS
                     IVAVPGTFEHDKPLITIRKFHSRVYVMPSKQKPRRIGLDASDGKKYRFLLKGHEDMRQ
                     DERVMQFIRLIDTIFQSDNAASAIGLSIPQYAVIPLTDNVGVVGWVENTETIYKMLET
                     YRQAHEVSVYEEVNLIMKKGGLDTIEDYHRLPKQQRKALLNYAMENTPKNELRHIFWD
                     HNDTCEQWLSYRQTYGQTLAAMSMVGYVLGLGDRHLNNLMLQGNGTVVHIDFGDCFEV
                     AMHRALYAEAVPFRLTRLLVCALGITGVDGLYRMTCELAMKNLHRHSENLLSILEAFI
                     YDPIINWRLNTVNDVTEKSGSKSAQQESNNGGTAALAGETAAAACLGIDNAAQAEAKP
                     VAMQLSKSVSKPVPHSALPGESQMFENGEETRNQQGDLALARVQAKLTGQDFGVINSS
                     FSMMRSSRRLEAGGSQPQGSSWGSNSLAGFTDSPKDSFAAPLLTTYLSLRVLNGGAES
                     LDVPHQVDRLIQEATSLDNLSDAFLTGWAPFW"
     gene            <1692289..>1693101
                     /locus_tag="LMJF_34_3950"
                     /db_xref="GeneID:5655179"
     mRNA            <1692289..>1693101
                     /locus_tag="LMJF_34_3950"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686449.1"
                     /db_xref="GeneID:5655179"
     CDS             1692289..1693101
                     /locus_tag="LMJF_34_3950"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686501.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655179"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2E7"
                     /translation="MSAAQVGRSDGVWEVPSPDTSRDSQPPRLAHGAGGLATRCTSTH
                     PKSELQPHLDTIHRELEELKHRRERLEAQRKELLEGRHEQAEGQRTGCVSGSVSTHAR
                     VARSQSTSGLTFAHPRSEMESLTACSGLHAAHERHSKSVYRDSLVLANMKPIPSEKER
                     RCLLKTTPHLAVKNALRTAAQHDSTLLMGSFLLEDNPHTCTFGRERRFRPLLGHQGKY
                     FLSADVAVNQFMNRSHANSTASLSALGSSSQTPGPGAYTPRYSKLSRPPRSS"
     gene            1695686..1696561
                     /locus_tag="LMJF_34_3952"
                     /pseudo
                     /db_xref="GeneID:12981358"
     CDS             1695686..1696561
                     /locus_tag="LMJF_34_3952"
                     /pseudo
                     /codon_start=1
                     /product="hypothetical protein"
                     /db_xref="GeneID:12981358"
     gene            <1699112..>1699396
                     /locus_tag="LMJF_34_3955"
                     /db_xref="GeneID:5655180"
     mRNA            <1699112..>1699396
                     /locus_tag="LMJF_34_3955"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686450.1"
                     /db_xref="GeneID:5655180"
     CDS             1699112..1699396
                     /locus_tag="LMJF_34_3955"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686502.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3955"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3955"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655180"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2E6"
                     /translation="MLNIPDYRQQPLVRMIYAWPAFLGVILFTLLTLVGMMRCVLRGL
                     DGGSARYIGPNITTSVRQDIFYVVAAPLIFQGLCVSIYTTWVSWKFFRHN"
     gene            <1702828..>1706937
                     /locus_tag="LMJF_34_3960"
                     /db_xref="GeneID:5655181"
     mRNA            <1702828..>1706937
                     /locus_tag="LMJF_34_3960"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686451.1"
                     /db_xref="GeneID:5655181"
     CDS             1702828..1706937
                     /locus_tag="LMJF_34_3960"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686503.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655181"
                     /db_xref="GOA:Q4Q2E5"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2E5"
                     /translation="MASLRDESARLADEEAYASLLEICTELIIAEGTNDPPLKQPLGV
                     LHELLHCQHLGGDATVLSVRAVRILLEKFISVMSSKLRVKLVECVRSAFERVSRLIHG
                     STTSDADSGFVHTKRWELQEELLQCMSAAAQSDTAVQAALPPLQEQLNFCKSVMDVSL
                     DMCLQALRMCCVLLRSAQLSAQPHLVAMIRDLFQSRLTALESMEMNQDWLRLLRHLTE
                     VAVTLKAYAARTPETTEENANAGKRKNRKRKRTMASNQSRAARVSAAGVDGGHGDDTD
                     EALVLLRLCQRVCATPRLDRAFRSTVFSCVNAVLSDAACIAGVSADTCVGVAMDLARE
                     LTRNVRTTLTIVNPFVNREVVAGTSSAAATIPLAGGDEEGDDDEEQGEDLLSSTEGAK
                     WHLPEPEWPLLVLIANIFAAKTVPTPEHMWWSVGDDEYARRFSKEDRLRLTNAFFAAE
                     DVLDLKKRGSRVQLSTMREFLWPFDLGCRVLFQPVPCTYAVAEVEPAAPSLQCPPWRA
                     GELAFALRKCDVSAFLEHLGAVSHNGGDIAAYGQSVLLQVLLVVGPHAKDATRAALLS
                     FLADAATPLIEQVSEVLVRHDRAWASTLLDAGVTEMILRRGTSVTPERSPVVQMLRRE
                     AASLPSTPPLLPRCGLTTVGPTELRRVLQHGTRSDVEALLEVLTFTEACVWDTVACRE
                     TVHALAGAAAQGRDSTAQANGAAPAGWAWQLEHLLTSLVVKRLQDMALQLQQRRTLQQ
                     IVEESEVVEVIVCDNGRSSQFTCPRQHPLHHHHSCNWKCNECSASGLQDAWSCRECDY
                     DLCATCARTRCNRVNGALTATTQDLLTALRASADTSTGASAPLTRAVLFSEERGLVSA
                     ATPLACLHRQTVHLGEIYTACPCGLVSPGPARAVEAAAAPDASLLGTLLSLFGRTCGQ
                     DVGVQRRLLKAYESAGPFVFLGGARAVPAELRCLTTQLAPHLPLSVKNLITRYVAIDC
                     RRFAFQTLHDQAATVMSANTGVAPESPKPHKTQVPRSDKPGLLRVLHDSFCGLLSPLM
                     KVDFTFEGEEGFGSGPSQEVYTELSAYFRAESKFWFVTEDDGGADPVMLAFPTTKALF
                     LKEFFALGAACARAFIDEYRMDIDLLPQAWPLLMLPSLGLPVCQTAGTRISPCAATLA
                     MLTSLLEVLDPSLHRSFAQLRCISEVELEAAGLEMDDGTLLRTHADLEQHLQHTVVTR
                     FEVALENLRQFQWGLLSVVEVEALWCLSNEERSMLICGSDAKGDGPLFTEEELRAQTT
                     AGSGYSSSSVHVDMLLSIVGGDFTRAQQHDFLEFLTGSPRMPFNGLAGLGRPITVAMK
                     DMESKNEQTLPSCNTCFLYLKLPPYTTRAIMRERLLLAVTEGRRNYSLS"
     gene            <1707929..>1710367
                     /locus_tag="LMJF_34_3970"
                     /db_xref="GeneID:5655182"
     mRNA            <1707929..>1710367
                     /locus_tag="LMJF_34_3970"
                     /product="putative adaptor gamma-1 chain"
                     /transcript_id="XM_001686452.1"
                     /db_xref="GeneID:5655182"
     CDS             1707929..1710367
                     /locus_tag="LMJF_34_3970"
                     /codon_start=1
                     /product="putative adaptor gamma-1 chain"
                     /protein_id="XP_001686504.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655182"
                     /db_xref="GOA:Q4Q2E4"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR008152"
                     /db_xref="InterPro:IPR008153"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013041"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017107"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2E4"
                     /translation="MSSMDSMRLQATIRLIRQCKTSEEERSNVKIISAQLRKGFADAK
                     PYIRVRYMLMLLYIRMLGYPTEFAHMEVLKLLSQPDFSGIRVGYLALQLLFSESDEVL
                     TLVENRMIAHLSVAGSRRAISYEQLCLIGISLNAVANIASEDMCRDLLDSILHLLKNS
                     PQQLRSKAALAVLRVVRKAPDQAGYILEYCTDLFDGNTESLMCILTLVIECLQTDSGA
                     KMVGAFRKQATSAVRALKALVLSSRITEEDVSGITDPFLQVKLLHFMRIIGAGSDVTS
                     EALNDVLAQVITNTDATRNVGCAVLYECVRTINAIESDEGLRTLAVNTISRFLSSVKD
                     NNLRFVGLQTLLMYSRKDFDAVVQHQAIVLECLRDTDLSIRRRALDLTVTLITVNNVR
                     LLVPDLIAYMSLCSEEMKGDVARHICSVIETHYPSDIWRVDYSIRFLKVAKQFAPLDF
                     ARHLLVVLSSQTKDVQTRAVEALWEEASYPFDARHQSRKAFLMVALWCIGEYVELLLG
                     AVKGLTGADVATCLSSLTTNTNFTLVKQYGLTALMKVATKCPDAKPQAMATFASNMTS
                     MDCELQQRACEYTTLLVDFPQEAVFSFSQMPPINPEADAVKPVEVVSLTQEQLHQETT
                     NTLDDLFNFDGANKPAPPSTDTSTLMGGSSSQLDSLFFPDSAFPTVSQCAPAVSGSTV
                     MADASVKSASASPTGGGDVTGVPVCSCADFDVLLSGRMEGSIIFADLVVQSKLSDAVE
                     QLSFSVAVLRMCTVEVAPLPSTIAPYGVAAQRLKVDNTQNTANPRMLALRVRISYTVR
                     GEPREQMFQVSQVL"
     gene            <1711560..>1712006
                     /locus_tag="LMJF_34_3980"
                     /db_xref="GeneID:5655183"
     mRNA            <1711560..>1712006
                     /locus_tag="LMJF_34_3980"
                     /product="nucleolar protein family a member-like protein"
                     /transcript_id="XM_001686453.1"
                     /db_xref="GeneID:5655183"
     CDS             1711560..1712006
                     /locus_tag="LMJF_34_3980"
                     /codon_start=1
                     /product="nucleolar protein family a member-like protein"
                     /protein_id="XP_001686505.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655183"
                     /db_xref="GOA:Q4Q2E3"
                     /db_xref="InterPro:IPR004037"
                     /db_xref="InterPro:IPR004038"
                     /db_xref="InterPro:IPR018492"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2E3"
                     /translation="MPQDEQTKVTEEYDYDRELYRCPISWPITSDKPKMTKKVYSLIK
                     KTVTANKKRGIVKGIKDVTKAIRKGQKGILVLGADASPYDVVSHFPVMAEEAKIPYVW
                     VPSRQDLGTATQCKRATSVVLLKVNEELKPSYDKIVLAIEDLNSEE"
     gene            <1713403..>1714839
                     /locus_tag="LMJF_34_3990"
                     /db_xref="GeneID:5655184"
     mRNA            <1713403..>1714839
                     /locus_tag="LMJF_34_3990"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686454.1"
                     /db_xref="GeneID:5655184"
     CDS             1713403..1714839
                     /locus_tag="LMJF_34_3990"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686506.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.3990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.3990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655184"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2E2"
                     /translation="MNFALTMSAAPHRLWYIDGDVVKVRVSLTCVPGEVPDTRMEMAP
                     LQRVPRHNYFSVDPTEPGSRETDVRVRPLEVELIGLVELDTSVMKLIDWPAAVSEKEI
                     AVSLRSGRSRSAVIYTLYRTGKKTLQEDMHLKRYECAALEFVFRLPEGCPPTFKGRGT
                     DYRHDIIISATWYPVRSSASAKAAKPHICKVKVPLVVFNSVATVAQLPLLSLFPLPPN
                     SALVAEDFHFQASPLAAVPTPWAAAPLMDVMRPQQAQLRTSLTVRHDAKATMQSSLAA
                     QRQPLSLMIPCGGVNVLQVHLHSSCVPLGEYLQGSFTVLQTRQWPCDSAADPGAQRKR
                     DMEAPVPVSVTATLELLECVTPEYALATSDPSVMDAKGHGMENFVCTHRRVIDHAEFC
                     VLDTPCVPFEFSLPVGLVPASTITDITSFLWQLRVVVMAVPRKTLARTAAPGVDQLGP
                     LLAPVAGVFPLLVMPPSVPFKVRQGAAW"
     gene            <1715353..>1716873
                     /locus_tag="LMJF_34_4000"
                     /db_xref="GeneID:5655185"
     mRNA            <1715353..>1716873
                     /locus_tag="LMJF_34_4000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686455.1"
                     /db_xref="GeneID:5655185"
     CDS             1715353..1716873
                     /locus_tag="LMJF_34_4000"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686507.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.4000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.4000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655185"
                     /db_xref="InterPro:IPR012462"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2E1"
                     /translation="MEDVITRIADTASYPLHVLQRNKKTIGIVGADALAALPMAGGSC
                     THRLVISATELKPFLIDSPAAEVLFKWCARVSCSLSRTLKRHCLVVKNVLRGVAISAL
                     LEEDHSDASTVETVWADVERSAELWKTPFTGGSTETLHVYMMSVPEVADDISKTLHDM
                     PGASAAAPECSLATTRVLLGDSASEMVAAIRQLFNQFLGTEAESLTGTEVCWPASMLF
                     PVNVHTRDDARRRAEHAALRLPYQGLLRHEDAIQAWSTWDDLRRQHEANDASIFRTGA
                     AWERHLATSPHRDLAPGSAPSLPGAETLLVSGAYDYYHYRVDGFRDDGWGCAYRSLQT
                     VLSWFQHAGLVRSAIPSIRRIQEMLYQVDPDKASKRDFVGSREWIGSFEIMLVLQQYL
                     PGLECIIKRLERGQDLDTNASVQSLLMEHFRSPLAAPVMIGGSSYAHTILGVHVNVHT
                     MEAQYLILDPHYSAYPTQIKTAIKKGYVGWKEASKFFETGSWYNLCIPRVDLFDPR"
     gene            <1717530..>1717844
                     /locus_tag="LMJF_34_4010"
                     /db_xref="GeneID:5655186"
     mRNA            <1717530..>1717844
                     /locus_tag="LMJF_34_4010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686456.1"
                     /db_xref="GeneID:5655186"
     CDS             1717530..1717844
                     /locus_tag="LMJF_34_4010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686508.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.4010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.4010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655186"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2E0"
                     /translation="MMLRRVAAKTTMAAAAPLLSSTRAYNMFVFKDPVRRPQLSPEER
                     AKVKINYAEWPEEFRDYDPEDPYKNSPEVIEGLSSWNLFLWGVECAFIYQFYEVVFPK
                     SI"
     gene            <1719422..>1720120
                     /locus_tag="LMJF_34_4020"
                     /db_xref="GeneID:5655187"
     mRNA            <1719422..>1720120
                     /locus_tag="LMJF_34_4020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686457.1"
                     /db_xref="GeneID:5655187"
     CDS             1719422..1720120
                     /locus_tag="LMJF_34_4020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686509.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.4020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.4020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655187"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2D9"
                     /translation="MAATAPAETMPLNTAGKSTVGTTSAPAADAAAQPQPPPLQDSLT
                     RRLFASWQQGVVASIGAVMGIGFLLFFLYTPVKEDTVHHTAVVASEALADARLKGQAV
                     QLSKDVVLEVLRNPKSLDATVDVVVELLAREETKIAVSSLLQSLFEDHYTQEVTKKFV
                     LRVVQDPWIQDQLQMITEEQVRKLLNNAAVKTELSKFLLKSAVDSLEKPQLHYEVAKA
                     MRHSVASLVNFWWI"
     gene            <1720997..>1721989
                     /locus_tag="LMJF_34_4030"
                     /db_xref="GeneID:5655188"
     mRNA            <1720997..>1721989
                     /locus_tag="LMJF_34_4030"
                     /product="putative geranylgeranyltransferase"
                     /transcript_id="XM_001686458.1"
                     /db_xref="GeneID:5655188"
     CDS             1720997..1721989
                     /locus_tag="LMJF_34_4030"
                     /EC_number="2.5.1.59"
                     /codon_start=1
                     /product="putative geranylgeranyltransferase"
                     /protein_id="XP_001686510.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.4030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.4030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655188"
                     /db_xref="GOA:Q4Q2D8"
                     /db_xref="InterPro:IPR001330"
                     /db_xref="InterPro:IPR008930"
                     /db_xref="InterPro:IPR026873"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2D8"
                     /translation="MEESAAPCGPIAADLHHKFVHELDDNTQWKAQHLKMNGVYWGLS
                     SLVLLHRMDYKPGDVVDFVLSCYNGDGGFGGNADMDSHLLHTMSAVQLLCMFDAVARI
                     DVERTARWIASMQLPDGSFQGDEWGEVDTRFSYIALSCLRLLGRCECVDVEAAVQYVL
                     RCQNWDGGFGVSPGAESHAGQIFCCVGALCIANALDRIDRDRVAAWLAMRQLPSGGLN
                     GRPEKKADVCYSWWVVSSLSALGRTSWIDKEALFQYILSCQDTQDGGFSDKPGNQPDV
                     YHTFFGLCGLSLLGYEGYKLNPINPVYALSYDILDRLNIAPEHGSQVGRRVPRS"
     gene            <1722911..>1723930
                     /locus_tag="LMJF_34_4040"
                     /db_xref="GeneID:5655189"
     mRNA            <1722911..>1723930
                     /locus_tag="LMJF_34_4040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686459.1"
                     /db_xref="GeneID:5655189"
     CDS             1722911..1723930
                     /locus_tag="LMJF_34_4040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686511.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.4040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.4040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655189"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2D7"
                     /translation="MESSVVDSFAAATVSLTAPQRRDLMRHWLRSLAAAVKYLPRQEA
                     SLGVSGGVDADRFSTRSSRRARHDTHEGETWSGASPYFSLPTSDLLCLCMRECAMADP
                     TTGPDVLRELLLCAVKLELGELEVLKHIVHVLTSADVCRHRTSSEQVELLNIVSLAVK
                     RCKLPLPPLDRVLCVLVGVTLSARENLVVLSSIHRLQHMHAADTVAAVSRRAATQAGE
                     YNIKDVVYGLEVAALLPGCHDVFVAGVLLRAGELAPRMSPKEVGAVCKYVALLNPSRR
                     QNTLSYSCGREVRALLPLLVERTERLLGHFRLHEARHVLRCFREHKVRHSLIFSRLTP
                     MAGDG"
     gene            <1724770..>1726767
                     /locus_tag="LMJF_34_4050"
                     /db_xref="GeneID:5655190"
     mRNA            <1724770..>1726767
                     /locus_tag="LMJF_34_4050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686460.1"
                     /db_xref="GeneID:5655190"
     CDS             1724770..1726767
                     /locus_tag="LMJF_34_4050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686512.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.4050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.4050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655190"
                     /db_xref="InterPro:IPR003018"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2D6"
                     /translation="MDSIASLPAASDCADPLLARLQDSYTRQKRQLTAQKRKQVDVEL
                     QAAAAHCSDSPATLELFSDRTASLFDELERLLGVRHEQWNTPSRELALLQHIRVQGNR
                     ELRECMSFIEEGYTSGFEKLLRESRLEGRKAELPKATASCSPATSKSNSVQQPKAASV
                     GSSVTPEDAPSHLSVREALSESISLMAESLAVLLQCEVVRVYLYDTNAHLKCVAQFPY
                     RARHADPMHSSYLALMAVREVHHIVCQEHLVINGWLSKSQSASDGSGSATAAHNVGSS
                     TAASGLEDIRTCLLLPIFSPEGAGKPYGLVHAVNKQYPTALGVATDDTTEVAHVGFTA
                     DDEMLASSVARVLGTILRRYPVELFFASATGEKLRRSAFPGDAEVLSLTAHLPPVLQD
                     DVQDAAEVGQLALSHLTPILAHRVPMDAIYEARTAAGEGRRRKLAVIGPREGAVSSVE
                     FNLRCMKELWESSRDDNATLHKQCRTLQEQVHAMRLLLRNVLDGVAVARAMQLSTEVA
                     QFLHNLEMYGRTERTERMAEYVSEKMLAIPDTTARGPGAADTNATQYHMRGSDLQTLQ
                     NHHACLNTVTPASLHFDGPSGVRSYTSDPAQKREQVRFIDELCRLARDEKPSLPLARG
                     GDGRRQALPSTFPTVTPAKAVRGTKHAVKQDLYPFGRPFKL"
     gene            <1728410..>1731130
                     /locus_tag="LMJF_34_4060"
                     /db_xref="GeneID:5655191"
     mRNA            <1728410..>1731130
                     /locus_tag="LMJF_34_4060"
                     /product="putative ubiquitin hydrolase"
                     /transcript_id="XM_001686461.1"
                     /db_xref="GeneID:5655191"
     CDS             1728410..1731130
                     /locus_tag="LMJF_34_4060"
                     /EC_number="3.1.2.15"
                     /codon_start=1
                     /product="putative ubiquitin hydrolase"
                     /protein_id="XP_001686513.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.4060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.4060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655191"
                     /db_xref="GOA:Q4Q2D5"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2D5"
                     /translation="MRSGYVGIYNQGSTCYLNSVIQALYHLPAFRTQIYNLPNVEKDS
                     VALALRDVFAQLEVRNRNTTTTELTKAFGWSAQEAAVQHDVHELMQQLFDSLETTLKE
                     TSKKNMIRDMFGGLMIYRSRAIDGAEYLSDRLEDFYDVELVVQNKANIEESLREFSSG
                     ERIEGVCVEVVPGADATPHTIERSQHFLDCPKVLLVHPNRVAFDMETYELVTLRNVWS
                     FDFDLSLASYVVDDASLRLDKESQEKWKRLSHRTHLGANYRLRSILTHAGDATIGHYY
                     VYVNFDGEWVRFNDEVVESATEEDVRKSAFGGQSIQSRYRLFDNERASLLIYVNDDVK
                     DELLNETPPPSAIVEVGRCIEEERTRKEETHKVSYYLCDKSVVDVLDGVNGASDKLQR
                     HMSVRLSPGQDEMAAIVTAAAKELHVAPEQIRIFCRDRHGLSPWCAVESMCNSYDSYY
                     YPPIFIDIAPPLAEEDAASATTAAAAAEPFLAFLRNIESPHDRDVPVAIVRSIPELQA
                     RVPCDAVVYESRGGPQYLNAITATNQLVCGANLLYTHQRSSNDAVRGYLQHRQLVCTK
                     VYLYDDYTAELTELFEIHIVESTPYTTLQVGLYKMMTESKRGLPIPPSHNHLAFFKGN
                     DRCNYAFAMPMATSLTIQWNTYNHTLRDVWGSAQHEHKIVMTILPMPLEKIDLTVLVT
                     FNGGYNNLPHVYVPLEGGSVTFRELLELMVQQLGSRLRAGAAAGYEQQLAGQARLLRL
                     LRVRRGELIEVVEDLDTPIDLETREDIVLDKLCPALPGYELVNVLFCRRRSGEYYFGL
                     PTNICINSSLDEQGDVLLRRIVKKLGYPDQEEAMKKWILCVMNVKSRKTRTASKKEVL
                     ADLVKEVGGAPFVFVVDRPQCLLLDGIEEEEHRPESIVIKSASKTDLSTT"
     gene            <1732645..>1734714
                     /locus_tag="LMJF_34_4070"
                     /db_xref="GeneID:5655192"
     mRNA            <1732645..>1734714
                     /locus_tag="LMJF_34_4070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686462.1"
                     /db_xref="GeneID:5655192"
     CDS             1732645..1734714
                     /locus_tag="LMJF_34_4070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686514.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.4070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.4070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655192"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2D4"
                     /translation="MPPKAKAAEPKPKSKKALALQAAIDQSTKEAQKTYKQHEQLRTK
                     ADQVEKSQREYLLLDETVARERIKEEKKRYRAAVADLRMEEQLAFATYIKHDHWEHIS
                     EASRLPNVHSEADINDFLSSWKKRQETNDRYEPDTVVIASHAPNSTEDAKLLFIRGEQ
                     RLPPQKRRALMREELLQCYDAYELAEKIKDDRDTYTSIGSTAASQKPMPWASVLQEVY
                     LQLRATFDFVSTQTLLFYDQMIDSADGETVMRTVSAANPVIKFGLWVKTKDVTRSFTS
                     LAFPEIEVRLDPKQNSQPKLPKMLGLSKENIAVRAVQLAFDPYSCYVSRRSQYYALDC
                     TIKIDLLTFAERPRSSGEWLLRMETPESHRLHVEEYPPRTAEARIEDPALRISFEVPQ
                     SIVIRQPSLFIGRWNEDTHEWEPCSGATLGASFGPTARVAENPRRATFIASELAQFAV
                     LHETVFDVIYESWSLKPFDGSRILVTLEGRHRGDATDREFRFLLEDAKCRLLSPEDDE
                     LAPLRTSCWSPAVLLRKLKQSGFNFLVRDEEACFLENVIPKTRQLEEKAYADMAQLSQ
                     CFTIASSRHNKNGEDADMALFRVSKRWLRPGEEDESFDIPTTADLWHSIRYRTDDCAL
                     ACFTELDETTNMNILDGAETHYNLYSLLTPVEGEETLRGQLLNTNYLLRRCVLEFLQL
                     VRPLTWG"
     gene            <1736091..>1736864
                     /locus_tag="LMJF_34_4080"
                     /db_xref="GeneID:5655193"
     mRNA            <1736091..>1736864
                     /locus_tag="LMJF_34_4080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686463.1"
                     /db_xref="GeneID:5655193"
     CDS             1736091..1736864
                     /locus_tag="LMJF_34_4080"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686515.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.4080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.4080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655193"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2D3"
                     /translation="MLRRSGVRLVYERFAGHISGDKGHMTLQQACTIFGYQLDEEWTK
                     KDIKKRFQKLALQFHPDKGGTDEQFLALKEAQHLLLTHRHDRSADWAAKGAKGEGGHG
                     GINFRRMNYDNLTNTIHRQTADNPECRSFGLQDFAVFLVFITAAGMYYVYKIYTTHMH
                     VLRSRWSYSEDAIRGDYTGKAPSEGLWHPWMADVETRDRMDDIAILQGSVKRALIDEK
                     RKEAPPVYTPWQLGGPFARHTAPTRAPEVLEDARASAST"
     gene            <1738404..>1739711
                     /locus_tag="LMJF_34_4090"
                     /db_xref="GeneID:5655194"
     mRNA            <1738404..>1739711
                     /locus_tag="LMJF_34_4090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686464.1"
                     /db_xref="GeneID:5655194"
     CDS             1738404..1739711
                     /locus_tag="LMJF_34_4090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686516.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.4090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.4090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655194"
                     /db_xref="GOA:Q4Q2D2"
                     /db_xref="InterPro:IPR000237"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2D2"
                     /translation="MRAQIVDLTCKLGESNKQRALLEASFGRTATLPALYVAQSQDFM
                     CAHAIDAACLLVDAVLPSQSGGGPGQCKGTAEASPAWSPTLQSTTTESLQRIVKDQSD
                     RLKEAHHALKRLTNELQQRTAALHQQDATLADLKRRLVELEACNTSLKQQLMNVPNTE
                     EWKHAQEELDQQLARTRLEYESRESQLVLQHSTEVQALKALHEREVQEMQREQRDAVA
                     QAVQNALASSSPTLVRGGAHPPGIRDGAADGPHPCKTDDDAYLDLLNDYQAMEMQCAA
                     ATQERDAVAAEQQMLLRELQELLQTAGGPLSASAANGISTTAATTADGSQPTAGRDSF
                     THTADLKEAVRRIHEQRLTFVKLQEELMHSRREVTQLRRFKAGLPEDGLSAQQLQYVR
                     SVVVQLLCSLNDIRVARHLLPVLSMLLKFTDDDLQAITKAMLQ"
     gene            <1741269..>1742195
                     /locus_tag="LMJF_34_4100"
                     /db_xref="GeneID:5655195"
     mRNA            <1741269..>1742195
                     /locus_tag="LMJF_34_4100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686465.1"
                     /db_xref="GeneID:5655195"
     CDS             1741269..1742195
                     /locus_tag="LMJF_34_4100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686517.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.4100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.4100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655195"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2D1"
                     /translation="MTSWKDQIAAVLFFRDPEEALTAQKMRNAEAMAKATEVRLQYHQ
                     DEREVKEKMLQLENRVKAQRERYARQVAPMLKEFDDIAISQHYYQEVGNSVSAQETFV
                     DHMAQRETQQFGYISKKLISVSLNFEALRQQMRSGQPFARELKAALDDAESEDLNVMS
                     EPLRAFADRGVPEPTLVRAAAFDLARSIEETGKAPLQQPVLGWLDLLKFRTAFSPSTV
                     DQNEVRARRAAAQFTRYIEQKQYASALALAEEVDTWTRNEHDAAVEYFNNSYRSFRQA
                     TLPVITSEIFLAYAAASLNASRVACVEHMLKE"
     gene            <1742776..>1750572
                     /locus_tag="LMJF_34_4110"
                     /db_xref="GeneID:5655196"
     mRNA            <1742776..>1750572
                     /locus_tag="LMJF_34_4110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686466.1"
                     /db_xref="GeneID:5655196"
     CDS             1742776..1750572
                     /locus_tag="LMJF_34_4110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686518.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.4110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.4110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655196"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2D0"
                     /translation="MACNTSHVKQLLSTARMYRRPDMLHDIVCEVRDAEMTSNRFSAE
                     LHVLCAEVAVELKQWSAAAELLKGLGAAQETRLLAVRRAFCEVLVSLHHVDENTSLSE
                     DEKVQEYVVGTASALQALAEAVEVWPDSLDAVLTGIRTLWLIVSPLLSAGHEAEVCDA
                     VAFLATLHQQLHIGGGYTLVQWLVRAALCFRAAERHNDALARFSAALEVAALMGNQRL
                     FVQVLRLAAAVIFVKEKANVSAKTRADLLPSYRNRPVHFAILLTYLVLGGCLEMEACK
                     EDLHSAYHTISDVADVAQQSPETVASAPRGRKKQAAVKLPPAIRLVDTFAVTESDVID
                     EVKSDLLLCISLHGTLSPEQVEELKQKRGSSNHRVRSFAAFALVVRESHRHGLRGLGK
                     CADASSISAAHRAELRTLASELVDVLKNTNTIHDESERQHTLRTGASLLWNLVLPFLQ
                     NSTMGDVQPALAAVADVSQAFMPALRKLFFQVATQQCHTAFEEDNRSLLHQLLPILQR
                     ECQRGGFDGAVPACLFRLQWLQHQMAIREEPESSLTSQQDRCLFAIEECRSIANPLKR
                     IPVIKTAFRHLPSIMQESDAQATVAEASEPQKAAPGRGALSTCRSTVQLYRELLELCM
                     QDLSASLYAVAMAVAEALRGLPCPLLGAGDADIEEARAAASLHAATILARQLEEAEPH
                     GAQKDVRSVSVADPRTAATEESENRLAALLIEAAQRGAEVESRRSGSGGWIAANACVA
                     FLNWKKLSYERGEYRAHLVELLDLQKLYTALYEHDQVQDVELLSDLTTSSVLGLVAEY
                     LEASNPPAGTGTSPLAKQMGRDGFAAHVRRLRTCANCEPSNAQLRRAHAMCLEALQII
                     PGVKQKWFLAMLSSALARLVGDKPRYSPHPQEQLFILLGVLAGPSAMSEKVALLINEA
                     RPLLRKDPCVRLCAWVAAVAMQLGQEEVALECCEVADRLYASNRLGWGSLFEMPSPFS
                     PGGGASTGPSKTTDSGSHKKASMELALAQLDGQPTFPKPDAEDWEAYAELLSIKAQVG
                     VQHLHGLVSVARNRAVQLLLTNCVNAAIAAAQGPAASKVEHITNAYTLYYTFLRTTRI
                     SLGTATFVLPSLRMLLSKALLAQLPKRSWSDSFTEVVYRLSCVLVHVSLSSEQEDDAR
                     QLVTLLRHLRELLPLRYQKSLKDREVTEVCYRTPSVDDFLQRSKNMEAELQARGWMIV
                     ALASKDTTGEAEAFALALAASQGGPLATAQCLFESAYAATLRRGDSTPLAQVVRHLQE
                     ALRTLEGLPATAPLLQSPEETDRWHATLADASLTATFLRSRAQRHCLHNGDVAGEAAE
                     AAGGERQAAPLKAPVKAHFTKVTGVTFQHAFLGLRIVSLLFRTTPTHDVVEVGASSVK
                     AAKYPTTPASHRDCAKVMLDYVSCLWHLSAKWLCEDAADEDTVVLKLPTDNSLYYNYA
                     EPSAAAQRLRRCVPDEEFKLNTEGLWQCLLDLGDYLARTGDEPHAFMVYSWVRFSAAL
                     AFGDARGDSRCGLVQRLCNLKMCAAAASSGLSDGPYVAALTRLAEARSLVEEAVKRDV
                     EANCVSPSWEAAMVVGECEVLIQLGETEQAATLAEDVLCRGLECASWNTAATRARALR
                     ARARHEAICLRYGDALRTLQQAFQLIGAATPSPTPTVISVRLWAELCSDRLAVLMDSQ
                     STAEAVEWAGTVRQQLHQWRAAASASAMQVDTTHSACLRADVEAALELWISRLVTTVT
                     PQLPVADALSYPAACSSITQRRANTEELLRELLLVAEPPTTLHSCLYTTHAKWHVRDR
                     VTPQWLAQHSANVDDVRTRLLVLLEEIRVLDELLLRLQNARASCKVGVGSPAQAEVDA
                     ATATSMFFWQGALIYWTAIDRLEASELASCLLVAFRRLSMEDLQLPTSSAPAHCEREV
                     LRFIRGAASSSCAATVDRAPHAVEQAVMVGARWQRGVARETDELQQALQHYRVTDARA
                     QSLTDVSVVPALLQKAAVHCRQWPHTRLAAAIVAAVAQVEVLQRVENQLEQRDDLVGE
                     ELHAQRHALLTAAWTRAQLIPARIEKPGSRMRKGMPAGKQRKVSEPSTSAPVRQLTEE
                     EEALLQRISLGVQMAVHHGHLDVAADLSEALSHLAVLLERPHIAAAAAEQTQANQLVG
                     LLWRSCVHEMTDGAEGRLWRQMLAVQPLFTNCTSYTQLADQVVTATPMERGLRSCSLL
                     CVEPEEEVSAVPLTAPGKGGHATEVSPYAIDSAVLSVAMGNCRTGFCIVTLRHPDGAV
                     EGRRRHVPQQTWATLAATLQRTETQKQEQLGSAEDVRIDGAEERVTAEDLSSMLKELN
                     AVALELFGEFQPSFQQYCEKTPLYLCLAPELQPFPWEQTCVLRCCSVVLRELGAAAVV
                     SRTGELQRCGKRALQHPPKPAEPNSTKGSSAGPLVCLIDLFGDYRESVPAICGTDHCK
                     SKVSPQCLLTCSSARVPPDAAYLTWMLRNTAPGVLIVSMCGSLTDALPWSHFTSLNFT
                     QLHSVVLADGAFNASSQKREEQFRLLASATRIGKADSPSSHPRWMTQTLFLLRGAKFV
                     AANALPCSPCVTDALARRCLSSASSGKALVEQLRGKSRDTKTPFVTLYGVVGSVPSKA
                     KA"
     gene            <1751527..>1752351
                     /locus_tag="LMJF_34_4120"
                     /db_xref="GeneID:5655197"
     mRNA            <1751527..>1752351
                     /locus_tag="LMJF_34_4120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686467.1"
                     /db_xref="GeneID:5655197"
     CDS             1751527..1752351
                     /locus_tag="LMJF_34_4120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686519.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.4120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.4120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655197"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2C9"
                     /translation="MDTRPPSKVIAVHDYLGSCASVQQLLNESVADLPLSRLTPTEPL
                     EVYCADLRGHNFSEAAPMTSASAYLLACAADIIKMQEDILCSEAGLLGLGFGSLVASC
                     AALHAPDAFSSLTLVVSDIAQLQRCLPSSYPVGELLRRAPAKATGLAELNSYLLDRVP
                     DPAERAALLAAVEVRRGLARFRFSNELLQYTEPFVLSAPAGSTFAKPTVVYICGKDGA
                     ISPEEEARVRARFPAVQFVKLDTQGEPLTSPKLRLVPLFLQSCGMLGEIKEANMEQ"
     gene            <1753359..>1755806
                     /locus_tag="LMJF_34_4130"
                     /db_xref="GeneID:5655198"
     mRNA            <1753359..>1755806
                     /locus_tag="LMJF_34_4130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686468.1"
                     /db_xref="GeneID:5655198"
     CDS             1753359..1755806
                     /locus_tag="LMJF_34_4130"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686520.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.4130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.4130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655198"
                     /db_xref="GOA:Q4Q2C8"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR011678"
                     /db_xref="InterPro:IPR026895"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2C8"
                     /translation="MLRAVALVCVAAVLLTCLPAAAIHEDEQGLRDWIMHLVGNVQDS
                     AAQVATNPELLYVASDDGAVAAIAVGAYGGVNLTWRQISSATPLCVAAGPQAVLTVNN
                     AGVATLMSPTTGSIEVTYALQTVTTTLQAAACSVVGGKAVVVTYDGTTLKRFEFLTAS
                     EEQSIPVAAYASAPGEVSKMYVADSVLLVNHGGDSADVLHLGDLSKKRSVAGIATSIA
                     ADGHFTTRDAATVRSFPTNDAASEMVCSDCGITVVRNAHTGESTGVVRVETQVETLRI
                     TFPNSVVTIPNLCSSITAYPLLAFEKDDGDMIVLIKTSAHNLLLVSAAEGLVWRRFEA
                     LANVAAAAIVEPMEALDHFHFNKNMLLVSRVGTLYSIPILGMGAQVNYIKDFSQELVA
                     AMKAPSMAKVQVRRLAVRDDGRIAVVYAESGTTSGHILIDLAERKVTNVTTCENAVLS
                     TPELEVAADLSVTGSLLHGVFYTYVSHAESGTIEGYSVSAAAGARPTWVVQMPSAIVA
                     HAAGSEPRRTDVVNALRVYPNISGKEMAEEVRRTYPMRNVIAVAHYEPSEEELPSLVV
                     TAIDVVTGSVLAMTRHANVEGDVKMVIVEHAIVYYYLDAKKMRYCFGVWELFEDENSP
                     VVSKTAGATIPQIIASFFVNTKREFSSRATRPPIVVVSTLGSFGGPLADMGVTTSYNA
                     IARKSLVLAYATGRVAVVELRHLLAGNQMPLPGVKGRQMSHLVFPSFMFASHKYRVAF
                     PRKITTEPTLLESSCHVLVSGLDLFYVRSSSGKPFDLLNSDFNKPLLITLVCGFAALS
                     VMARYFVNRKALNSAWQ"
     gene            <1757054..>1758451
                     /locus_tag="LMJF_34_4140"
                     /db_xref="GeneID:5655199"
     mRNA            <1757054..>1758451
                     /locus_tag="LMJF_34_4140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686469.1"
                     /db_xref="GeneID:5655199"
     CDS             1757054..1758451
                     /locus_tag="LMJF_34_4140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686521.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.4140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.4140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655199"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2C7"
                     /translation="MASRGAAACATRSRAPEVHRVVSDKVALQEEAKSVRERRLALEE
                     VMRHERAQRLQAAASRTTETANTSHSSGSAAPSKEQQKGVAVDSSRAPQTLKEYRREL
                     DKDSRYKELLRLHYYTNRHLNPAGVHFYTVKSRVKEYQRHAPSPPPSARAHRLLSPTR
                     KAHRETELAQPSTRPLETISVVEGTSEQWTKSALLRMQANQHLLRRIEEHEKKEAARI
                     GRPIVRGTAAPAGRLSAPPQPYKAPVATGAIASCPAPVAEAAVSACDAPRSLAVDKSY
                     TAAAPTWRWSPLRQPSPRMTYLITSPLRLRGRAASPTAAQSDSLLKTSLIHGSSVPLH
                     APCKVTFPPTSARYDGRATCSWKPLEYSGTAHLEGRRSWSTYKPIVEQLPSAPSASPG
                     TWAELTQSRSHPRQSLTARSPPPRDYGAREMGEDAPSVPTVGPPITKPKPTLLDGFRM
                     PGTVLKREDLFQGFI"
     gene            <1759443..>1761419
                     /locus_tag="LMJF_34_4150"
                     /db_xref="GeneID:5655200"
     mRNA            <1759443..>1761419
                     /locus_tag="LMJF_34_4150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686470.1"
                     /db_xref="GeneID:5655200"
     CDS             1759443..1761419
                     /locus_tag="LMJF_34_4150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686522.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.4150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.4150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655200"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2C6"
                     /translation="MEALSRGFCAAALVQSLAPKEVEGWHRQWPQPTLQVVDIQRYPR
                     VPTVSCGPSRFYMAVSDSESLAWLVVPPCTALEDSVAAFEIEVGCCVTLLSHALVTAA
                     NGLNVVVPLQVKYSNNTLRLLGQPSCAEALFPLSAQSLLQRHDADDGTPCAAAALQRP
                     LHAIALRDFTDAPQRALGNWCVTARVVWKGREYPLNSHASCLGGSSDPRRSVSAGSPR
                     FVFRCLLADEHGDAVVAAFYGGEALVERVRLHGCYRLAQGMVKWGTGESGAPSELQFV
                     EKSIEEELASGATQQMFPFHASALVGEVAQQLRDVVAVIETAQVGGYVSVVGTVVAVQ
                     GNTQVTTKRGRVWRSVVTLANGADDSAATGRCSGPFAEVTLWGEVAETVEPVLGERWV
                     FHPCAVHLFQQRKTLSSLASTMAVKLVPHPCSAKHAPRATASPGWESGGGVADAVPNA
                     ASAGKPVGSPQVVKKDMQLVLDLQEASPTLPVLARVQGVLRPFLDWMCTECSRTQQSV
                     VTAGSIATGKPTACAHCSTAQLCPTLRLRVWLSDGFCTGLAAFHGCAAESLLEASPAE
                     VARYVERQSTFVDEMFDRLVGLPVLVWLLPCGGADALDAAQFIVANCKRIHYVSGAHT
                     LLSAIDTFASLDEGVSCGRADVSAQTLPATGDTA"
     gene            <1762564..>1775289
                     /locus_tag="LMJF_34_4160"
                     /db_xref="GeneID:5655201"
     mRNA            <1762564..>1775289
                     /locus_tag="LMJF_34_4160"
                     /product="putative dynein heavy chain"
                     /transcript_id="XM_001686471.1"
                     /db_xref="GeneID:5655201"
     CDS             1762564..1775289
                     /locus_tag="LMJF_34_4160"
                     /codon_start=1
                     /product="putative dynein heavy chain"
                     /protein_id="XP_001686523.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.4160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.4160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655201"
                     /db_xref="GOA:Q4Q2C5"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004273"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="InterPro:IPR013594"
                     /db_xref="InterPro:IPR013602"
                     /db_xref="InterPro:IPR024317"
                     /db_xref="InterPro:IPR024743"
                     /db_xref="InterPro:IPR026815"
                     /db_xref="InterPro:IPR026983"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2C5"
                     /translation="MSLSQATKDCVTAVRKAVKKHISGDVVSEQKIGAVLQLQLRVTA
                     ASEAEVAQILLSAMVKAACGAQRGSAKLPNGEVIVDGTAPLTLHSFAEAVRVSTFRFQ
                     DLPANNPALRLVAEATYTRHLQHSSELAVQFIHNFPPCLLGEALSRFDVSVGGYVVLS
                     LSVDNDRIIQLRLFTTAIDAVMACMCSTSFTGEVLPRKWASRDTLQPPQLLEMLEEVQ
                     MAISEYWNDSAQDDHARSVAVFLMRSVGTDICEYFSTKAAAAGGLFRGEKKVLEEAHV
                     CCDDWLNACARLTTIDWGAVWRDRYEDAVLVRIRDRLRTALALRGIVEEIRELLGAND
                     FRALKTDALWDVFDDVDVMDPSSGAQSEWSGALAAYYRRLEPIEQRCAGVLRDLFATR
                     AGLAPQAILDEFSGYCHLMKRPIISRELVTERDALLAKLNDRLDAIRLEYTRRAESTE
                     DELVLEEEDRRCQTGRFFPGVVNNIIWLRQLRGRVEESIAMCGSILVDLPTASAFVAS
                     ANQLLGELHDYEQECYRNWVADVEDKSDALTLDADAPLMEIDATGRVDVNYSERLVQL
                     LKEVRVLGALGLHIPRTIARLAQQGAQFLPMGVALKQVANTYNSMAADIIPCTRAMLL
                     EPAVSFEKVITASGEKKLTWRSKKEAARFIERLQSAAQSLTEFNRRLHKTHHEIEGVV
                     VELLDISLLRSRDRWLSKARQIREKIENSGFQNTESWRQFWDMQLYKAMEAQYQVGLE
                     SLHEAVEEIKADIVYNAESGQAALRPPLEVLRLQYYQRISDFITFPRRFQGCGKESVF
                     REMPSRNAHGVYVVLQSAGQLFKRVMHELKRFSPYLVIGRCGLEGNPSLEEIVGKSLT
                     EVQHWEQSVRLLKQKSKDINGEDLFIRCGCITLCTAAIKGAVEDHLVRLTDALKVTLK
                     QSAEQHLNSINDYLAKAAKCLDSKMTKLGEIGQANLLYGELMEQRPAMEVEFYHFYNK
                     NVLLQNMTGTAGLDFTKTKDRWTTFMKRLDSHEKEVEEQLNRIQESVSSSVKEWERDS
                     VRFTTRWHELKPKDLTAHKPLAFVMKKKKELQALKERGEECKKQCEYFHLDEPDLQPI
                     QDTEADIEDYLKMWSMLGDFQQQVQELCKEAWISFRAKVYRFEDFVKLWQGQLKEIPA
                     NSVTVHIRTILDNWSLCVPLLKYVRGEGFTSAHWTELFQLLKLRSVTQDTVQFGQILD
                     RYEVILKNEGPIKKLHSRAQGEARIREALDDVRAWGTDARFALTPHPDRAGVVLITDW
                     KDTMSTLSDNRALLLSMKESPYFGLFSNDATKWEERLSTLDEYLRHMNQIQRKWVYLE
                     PIFRRGALPHEKQRFHRIDSAYLTVMKAVENDNRLMALAEHTEFKATLHDVSEQLERC
                     QKALNEYLESKRDGFPRFYFISDDDLLEILAQSKNPSVIQSHLKKLFMGIHSVQFDAQ
                     RENILHIQSLEGEVVTLLKPVRVTEEVEAWLSQLDAGVKATLKAHVAQCVAKADIGTY
                     ASQVLCTAEMITFTRKVETAIRDPIGSAGALQKLKSQLQTRLRELTAYAGGNSDVLVG
                     IKLKVLIMDLIHNIEVVQLLIANDIDKESHWLWKKQLRFYLDSTQQCVLRMVDAEFRY
                     SYEYQGNAPKLVHTPLTDCCYLTLTQGMRLGYGGNPYGPAGTGKTESVKALGNAMGRQ
                     VLVFNCDEGIDFKSMGRIFTGLVKCGAWGCFDEFNRLKVDQLSAVSQMIQVIQEALKN
                     GDKECQLLGKSIDVDPNAGIFVTLNPAGKGYGGRSKLPDNLKQLFRSISMSAPDNELI
                     TETILYSEGFENATQLATKIVETFTLCSQLLSHQQHYDWGLRAMKAVLRLGGTLVHDF
                     LMERVAGKVQLSAEQILQKESEILIKSLRVNTLSKLTFDDAVIFNTLLSDIFPGVPVL
                     EIDYQKLRPAIEESIKELRLQVVETQIQKILQLYEALQQRMGVVLVGPSGSGKSTLMK
                     VLRRALQQLGTKVPLYVVNPKALPREQLLGHMDPDTREWFDGVLTDAARKVVKEEASA
                     RSWIVCDGDIDPAWVESLNSVLDDNKLLTMPNGVRVQFGDNVNFLFETHSLEFASPAT
                     VSRMGIIYLSEEDVDPKMTVASWLAEQPKESQQQLQQWIDAYFYKAIDLLLSSGDLVV
                     GTTRTGLVMSGLVQLRNCTTKKQFVLALLYGLGSYLPDETRCAYAKDILLLAEERAPD
                     AKNPLDFRYDEERQDYVSLEFVPAAVLAIDDLYRHPMVSTVECQRALEVMRAWTKPTS
                     PGVYRPFILVGPEGCGKTMLLNNLFLSTTSTRVASINCSAQTEAIHVIQKLRQACSIF
                     NSNQGKVLRPKEAERLILLLKDLNLPKPDRYGTVQLHSFLQQLILYNGFYDAELEWVT
                     VERVQIVGSIGPPGSMGRHPVAPRFLAITSVLSISYPSKETLQQVYSEFIKVMLQSER
                     LKLNMPNKGAADLARCVTTIYETVAARCTVDAASHYVFNPRDITLWVLNLLNYDTPNI
                     ADVLAYEARRIFVDRLVTLEERTRLAKVIRDNVTLLVGHRDALSEKESIYYVSWLDAT
                     RAGKKRLAGTTLEEVKTSAEAFALNYSRENAGLNVQLIPEVCAWIARVDRVLSQERGN
                     LMLVARAGVCASQIVRLVAYSNRTEVVTLAITREYGVKQFTAELKSVMTKAGVEGQSV
                     VLLLEDFNFFHPYFLETVNSLLSSGEVVGLFTQEEQDALLNPLKDEAAGEGMSAYNFF
                     VDRIARYLHIVVVMDPTNRNYELQCRANPALFTRCNVYWLGTWDSSSLKVIPRIMIAD
                     VYKALDQREDKKEFSLTTELVHLHRSFGEKFAPQHFKVLCETFDHVFQEKSRQVADGL
                     ARLKSGVTKLDEAQENVDKIATDVTEKKQLLEVKQQEADDALKEIQKRMEEAGNQKRS
                     IHKIQKELDKEQSGIRERKVVIEGRLSGIQPVLDAALSAVSSIRSDHLSELRSMAKPP
                     AAVQCVMQGVVLLIEAGKGAEAATWPAIRKVLAGDIKGQILDFDIDNVGAAARGQVEK
                     FIASNAEYFKRETIARASKAAAPMAEWLKAVVEYSKVLDTVAPMRDELKEYEANLQKG
                     QEEMTKYEGKLRKVEKKVEELKAKFGEKTVEAERLKDKLEQAEQLLENAKELLSKLGD
                     EHTRWTAQMKTIKQDSYFLPKRCLLAAGVITYLGEDPEDTRRATLAEWKERVKLPDFN
                     FFTFLRDESVQLHFKAEGLPGDELSMDNAVMIHEQVNTPLIKDPSGQAVGWLQANLKK
                     QKAVVDVCSISEDRLVSALELALRFGKKFIVSDVDGVEPFLYPILRKEFHNEGTKRVI
                     QIGDRRTVDYADGFQLYLVTRSTDLHVPPDIISYLTPISFTITQSGLEGQFLGITIQH
                     EQPQLEKEKLDMLEKEEGLKMQLAELEERLLKNLANSEGSLLEDTTLIESLNQIKSQA
                     SDITTALEQSKVVQEDLDRKRNVYRPFATTASSVFFLTKSLQELSHMYQFSFQLFLDL
                     FLRALKRHKDLRTDPETKIAALQETFIQITVSAIAQSLFKEHRVVYGIHLCRNIHHAA
                     CAAAEWDFFIDKAIVLEEKRKEVRVPTFVLPDSVQTFRTFAALFPDLVSKARFQEADV
                     WLQWMRAATPESDYPGFLKSLTHFQRLLLMKTLRGDRLIAAMNAVACTLLKVDSIGEN
                     GTLVSAVEQSDANRPVLVITSAGADPSQELQAIAHETMGRTRFHQLAMGSGQTDEAMR
                     LLRESAVKGDWLFLKNLHLVIPWVSQLQKELMVLKPDASFRLFLTSEAHDEFPSILLG
                     QSLKITFEPPPGIKQNLLRTYSSWDAAFVNEKDEKQRQLLFAAAALQAIVQERRSYVP
                     QGWTKDYEVTAADLKASVDIVLHQSARGDADWYAIRGILNDAIYGGKMETAFDKRIMA
                     TYVDKMFRVNCMAGTKQQEPLFHHTRIPSGDYDEFMKVIKKLPDSDIPVLFSLPPNAD
                     RVVQLSRVRALTGDLQRISESYSEAALDREAWAARLTPVLDTWAALTARHADILVPLP
                     LAPPSPSSRSTAAAARTPLERFLEAEHLTALRLVTQVNVAVSDLCKVIDGGALLTENR
                     RTEAAAMILGDVPANWEGHFPSAARISTWMQALVSKAVTIGEWQKMMANGTFTSATLD
                     LSKFMRAKTFLNALRQETAHAIQQPLVSLVLVATTSTPPAGAPLVTALEGLMLQGAVL
                     DDADLLESISTADEPAFFPIKKVFAAWMESPPILKASVRVPVYANTTKEDYVCDFVLP
                     CADEVAAQNFVLSGVSIVLEQ"
     gene            <1776288..>1776932
                     /locus_tag="LMJF_34_4170"
                     /db_xref="GeneID:5655202"
     mRNA            <1776288..>1776932
                     /locus_tag="LMJF_34_4170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686472.1"
                     /db_xref="GeneID:5655202"
     CDS             1776288..1776932
                     /locus_tag="LMJF_34_4170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686524.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.4170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.4170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655202"
                     /db_xref="GOA:Q4Q2C4"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2C4"
                     /translation="MARRAFPRPTLPAAVLCSLLPTLHSPPTPLSLLVKYKHTHTHTH
                     THTHIPHTAAISLDGNAPSRVMYGDKGPPKGYSVPRFDTNASKRCQTCSSTVHWTFEC
                     PLKNSATLSAKKSAATTVKLSPSQMLRYGIKQKSANFVSEPTEREVFDAELRELRSVL
                     TAEVRQELKAKKSAAHKSGNDCKKHEAPLPSAAPKKEPPSDSVTMKTERTEEEE"
     gene            <1777723..>1779468
                     /locus_tag="LMJF_34_4180"
                     /db_xref="GeneID:5655203"
     mRNA            <1777723..>1779468
                     /locus_tag="LMJF_34_4180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686473.1"
                     /db_xref="GeneID:5655203"
     CDS             1777723..1779468
                     /locus_tag="LMJF_34_4180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686525.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.4180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.4180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655203"
                     /db_xref="InterPro:IPR009581"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2C3"
                     /translation="MMLWRDVRRHGRPLSLGLLILQILTVAHWWMVTMYLPRSSTSSL
                     PLIPGYTNAALPSVSRESWWAKLRKQTTPPFSHPPPPPLHNEEPTLPPERVAAISTSA
                     PSVPPRPPVPSTALPTDAGESTKGVPALPPERISERGISTTSASPTLSSDDTIAAFYA
                     QLAVFEANLQVKDVKGNPDQPTKGFVDIDADDGAGVPLPYDPYYIEDSARWTACDPRN
                     ASFSVERDRLCQEYLRNHNNMRSIKAMSSKLLQGRTIKMQITYAHNGLRTIVKLSQRK
                     FIYEAVSEYWAYSFDRALEFNRVPTSVFVPIPLDYLRVAVAYSPLFSQWFHRFVVLYN
                     YTNRNFVQCAYYTRQVSECSMATLQLWMKDVHPALDTFLAIPYEIDNSFIRKYYIPGH
                     ELFAGTKRARLRAVGELLDRSVFDFLIGNTDRGTNNHNNFAYGGCSAETECQLEKSEN
                     RIKGLAKYAYIDHGSSLYSHKEPVENPFFGNADRVSICRFRRSTFEHLAKYASTEGAH
                     YPLIEHVERSVPAAAYEVSHESVIRKVQVRLDKIVHIINRCRVKYTDNEVFSMPEYDS
                     VRIPEEDATLGDEWD"
     gene            <1780715..>1781644
                     /locus_tag="LMJF_34_4190"
                     /db_xref="GeneID:5655204"
     mRNA            <1780715..>1781644
                     /locus_tag="LMJF_34_4190"
                     /product="putative protein serine/threonine phosphatasee"
                     /transcript_id="XM_001686474.1"
                     /db_xref="GeneID:5655204"
     CDS             1780715..1781644
                     /locus_tag="LMJF_34_4190"
                     /EC_number="3.1.3.16"
                     /codon_start=1
                     /product="putative protein serine/threonine phosphatasee"
                     /protein_id="XP_001686526.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.4190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.4190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655204"
                     /db_xref="GOA:Q4Q2C2"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2C2"
                     /translation="MNLDAWEEKVRLVQPLEMKEMQLLLRTAVNLLIEESNVQGVHLP
                     VTICGDIHGQFLDLLRLFEVAGEIRRETGSMNYIFLGDLVDRGRNSVEVLTFLLILKL
                     KYPHKITLIRGNHETRQVTTMYGFYDECAEKFGTVEIWKLCTEVFDCMPIAALIEGKS
                     LCIHGGLSPEIRSVDQIRLLNRRQEIPNEGPFSDLVWSDPENVDGWVVSQRGAGFLFG
                     ASVTQEFIHRNRLNLIARAHQLVHEGFKYHFDEEYLCTVWSAPNYCYRCGNLASVLRI
                     YEDHSCEFVVFKEVEAQITLSDEPRTKEPAYFL"
     gene            <1782506..>1783171
                     /locus_tag="LMJF_34_4200"
                     /db_xref="GeneID:5655205"
     mRNA            <1782506..>1783171
                     /locus_tag="LMJF_34_4200"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686475.1"
                     /db_xref="GeneID:5655205"
     CDS             1782506..1783171
                     /locus_tag="LMJF_34_4200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686527.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.4200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.4200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655205"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2C1"
                     /translation="MPFSLGELQNVFLDALTGCPPDAPQQTRDTAVTVAGASIFAGSW
                     QPLESTRVPVRAYLRGTGEFDTEDSCRRAVMRVVDATLNDVLNDDAVNAFIGAKACES
                     ADIVGACEHILRKYLLWMLDGYLHYDGTPQCPFYDALKSTVCAFSVEWGQTFGPMFAE
                     AQSPDEFFSLLVTRGAQHHATAVATNPDDAKVRMATAMSIQVFLMAKTYSPSTPFPSR
                     VAL"
     gene            <1783728..>1785194
                     /locus_tag="LMJF_34_4210"
                     /db_xref="GeneID:5655206"
     mRNA            <1783728..>1785194
                     /locus_tag="LMJF_34_4210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686476.1"
                     /db_xref="GeneID:5655206"
     CDS             1783728..1785194
                     /locus_tag="LMJF_34_4210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686528.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.4210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.4210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655206"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2C0"
                     /translation="MESKVIALLTSRPLLTAAEAALELGVTHGALQPIFASVATSNEG
                     VYTLLTVSVEEAADGSATAVVMRKADRLEEDASAYALLSLTYPSNVSASSLPVQLHPC
                     RESSLRAYPLVARGDMEPRAAATAPPVAAAAPAATEPTRTEDCKPAAACLSAATPVAP
                     TTSPRAQGEPPRSTRAPVTVTAPRKEAAARAPSPKASIFDKMKEAAATKRPRTEKAPS
                     KPLRQPAKPKKVAQTENTTSLAKLARASRRKNGGTSAATGAATAPSSVRFLDDDEDAT
                     THFSHSEGSSSSSHSEAIAKEEPPVFDVVEVPASNDEVVMCDDAPPLAFRPAAPRPSP
                     PTPTPTKKGPETKKANVAAAAAESGAAQCKLSTFFNAAVVAFQKAYVREMQTEMKVEN
                     GEFVCCDVPRYKHTSTGEVINEDEYHQRTAALVQSNSRDAAASTPNRKSAGASVESPP
                     CQTAAQKTGSRGTGQKSVTQEKTAAAPAKTLHSFFKTS"
     gene            <1786388..>1786999
                     /locus_tag="LMJF_34_4220"
                     /db_xref="GeneID:5655207"
     mRNA            <1786388..>1786999
                     /locus_tag="LMJF_34_4220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686477.1"
                     /db_xref="GeneID:5655207"
     CDS             1786388..1786999
                     /locus_tag="LMJF_34_4220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686529.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.4220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.4220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655207"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2B9"
                     /translation="MSKQVLQSLPLAKGKDIHSRMAKLALYKECLALAYLVRNKLVRE
                     HTLREVREKWLEHRGDGGHTLQLQLASCLDRIAYGRMCHSKARQRLLPNASESYDWGV
                     VNPMENHEKWIRRREERQCPDAFNHSRGKRDFVPMSNWGYGNMDPDAIAKHKELTDRQ
                     HFIGPHWRDRPKPMVLEDLSFEEELYVHFQGKPKMRKTPKKHL"
     gene            <1787565..>1788107
                     /locus_tag="LMJF_34_4230"
                     /db_xref="GeneID:5655208"
     mRNA            <1787565..>1788107
                     /locus_tag="LMJF_34_4230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686478.1"
                     /db_xref="GeneID:5655208"
     CDS             1787565..1788107
                     /locus_tag="LMJF_34_4230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686530.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.4230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.4230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655208"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2B8"
                     /translation="MVGSWECCATSIATTHRDSRPLSLCHCPFYPNSPIYISAIRSRD
                     TGRPTGAAPSLAFIRPHRKLFGACRAFHQLSDTHRLTAMSQLSIVKDQLLSKGINHFV
                     VLSSSGQVVEYSGDFENKEKQVLAYAILQQCSALLAKGELMKRVTMKFDDVLYVATTV
                     QDSATVYGVVAKRPTNGATM"
     gene            <1788871..>1790103
                     /locus_tag="LMJF_34_4240"
                     /db_xref="GeneID:5655209"
     mRNA            <1788871..>1790103
                     /locus_tag="LMJF_34_4240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686479.1"
                     /db_xref="GeneID:5655209"
     CDS             1788871..1790103
                     /locus_tag="LMJF_34_4240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686531.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.4240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.4240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655209"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2B7"
                     /translation="MSTTAYALVAEEKQYPLQVGKNVVGRSSVPVEGVSFINLESPLA
                     AISRMQAFVDIGANGDAWISDCNSTNGTFLSISPGPGIRLEANRYYQLSPGCRIVFGD
                     VVCTFETLSEAPPTPEHPAHLLTSHSRPTRKTESLGVVDALADSTATTTPARHPSKQL
                     NAHRSNVPYLDESGSLLREPAASRETVATTKKTPRRERREPTAPSPPLKRAKVESAAP
                     SSFLKVKTAATAKATTPARALAARPHVCLTGMDSDERVAVTKRVRELKGRVVDDITKA
                     NLLVVATPPVRTPKFIAAVARGIPVVSVDYICNRRAELDDARHHIVGLKTDQHTYTAA
                     ELKKVIYRKDASPLLQGVSFNIAALSSKTKSVAAEIISSSGGEVVSTKKGGGTALTDA
                     QLDKLYDSILRGKVPDVL"
     gene            <1790743..>1792521
                     /locus_tag="LMJF_34_4250"
                     /db_xref="GeneID:5655210"
     mRNA            <1790743..>1792521
                     /locus_tag="LMJF_34_4250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686480.1"
                     /db_xref="GeneID:5655210"
     CDS             1790743..1792521
                     /locus_tag="LMJF_34_4250"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686532.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.4250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.4250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655210"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2B6"
                     /translation="MASKRLRSNVDVVGGINELLNLSVRSPSHGEERLDTQSFSGQPN
                     WSLQVTETDDMHSTPLKRLRTSESPAGVSSRSPSSASPSSLRTTSDSIGGDELDLLRR
                     KDEEVADMALFLAKAVGETSSRHSLAELVGLLVRSGVSRVALALKRVGGQTTFMGNLH
                     EATSFTDNERRIAIVLFSSLMAHVDAEALLQKCVVTFLVKSLTSANTQEASPALDHRI
                     ASHWSARGKQKGAVPQPSSGSSRGVAGGLEGQVARLCGDAAGSSGSYEDKSCASLALR
                     SLLTIMFVYNSSPHMAASRHLSVPLLFANAGGLQHLGKLLSDRDTQEHALALLEVLTA
                     TEELSLQNDGLLALVPALVAQLRTSAVEVPVLKVLTNITNILPHALSATGTAAAFAQF
                     ALETLLRPRAVSTPDEIEIFVLCCAINVVKYESKETESPEGELAEALVASQDTLMSLA
                     GAMVESYRCSSTEQLVRSGYYALLLGALSLVPVAKEEGSTTLRVLVMTAVARVSDGHS
                     IGLTAGHQPMRIVVAIIQEFLFFQSSAGTLTKEVLQDMKALVDRILRSNHIDVASDGD
                     RRATTADSITAVSTDEDDDLVLGQLL"
     gene            <1792826..>1797472
                     /locus_tag="LMJF_34_4260"
                     /db_xref="GeneID:5655211"
     mRNA            <1792826..>1797472
                     /locus_tag="LMJF_34_4260"
                     /product="putative Unc104-like kinesin"
                     /transcript_id="XM_001686481.1"
                     /db_xref="GeneID:5655211"
     CDS             1792826..1797472
                     /locus_tag="LMJF_34_4260"
                     /codon_start=1
                     /product="putative Unc104-like kinesin"
                     /protein_id="XP_001686533.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.4260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.4260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655211"
                     /db_xref="GOA:Q4Q2B5"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR010482"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2B5"
                     /translation="MIASLPIPLSVLSPDCPLTRPARRAPKQHAHAHTHTHTHTHTNV
                     RARFILAGLHAERLSAMSVKVAVRSRPMSDHELKANAEVIVRMNGNEVELRGSVDGYG
                     GKFLYDSALWSTGQVVNGSSNTEASQAYVYDAIGAELLEHIMTGYNGCIFAYGQTGSG
                     KTYCMMGRDKDDPGLIPRIAQSLFEQSVALREQNIEVCVEVSYYEIYNEKVRCLLRPT
                     QGGYDDTRLRVREHPKYGPFIEGLAKFVVSTPYEFLNLMRDGNKVRTTASTAMNATSS
                     RSHAVFAITLTQKQQKGNLITQKTSRLNLVDLAGSERASKTLATGKLLTEGATINKSL
                     TCLGKVISALAEAEESGKRRHVPYRDSTLTWILKDNLGGNSKTVMLATISPSSLQYDE
                     TLSTLRYAERVKKIVNKAVVNETNNNEVIAALQKEIWTLKSQLANASMNERERLQEEL
                     EASEAVKKELTSSLGEKLAYTKRLMEEREEYMHQLELKLSAQAEEIEKLRRANEEKER
                     RIDELLQRIHGLAASGSPPDSEKVERIQELVAALEQEQRMAKTHMKEKQQQQQQATCA
                     ALDSSEDDAESHSLAVANPSRRLNTTASNTTATLAAVPGAEWSAPAVADMATELPVAV
                     RAAIQKSHSGFVVYSDPNADDVDHDLVLQSGYESADEDLILDEEVELAAPADSDLDDI
                     LTEDSALELPPTSVLARDGDADELLADPDIVLDESVSEAPATPAPAAESSREAAPVYD
                     AFSAPASTPSSKLATNASTAGVALASLTADSTLSVKPRAALSGGSLVASQALAESPTP
                     PPVSGKEAPALSNMRGSIISGAHVVPKDFFAKSSERPEIYAPNDRTAQLVIKSHALPN
                     NRYLHEPFRAINLTEASPTGPKTPCVCEIDMFRGRFRNLDTAGVKSFDLFSVNLFRVE
                     KDPRHSRRLTLYFLDAPHRYALEFGSTARRQQFFELAMLMRRNSVLWCPSLCVDGEND
                     VVITVKGTTLQRPGNRDISVTGEVKMTVARMPYEVIDMWYGCFSLEGKPLPRSVAVFS
                     GFFPKDQREIYVIGVIDVPASLLGNDELAGYFLAYIGASTYVVLANTALSSDTHHTSN
                     AMLVLCKRSFIVRVANIQLLEALSLRKEGVHHGDFTATGCSLRINESSLCVILVNAKP
                     GVYTMQSRAACIRSLLSSFPFAKTSVDISMRFDYFIVSGAFNFGGDFTSEDALIREIL
                     ADNLMSNMREMEPSPTLSSAPSPLRIFYAVRPSVSRMDMSVYSTSRALRFANVFFSAD
                     IFCQRSFLSLFAKGLPRVRLLLSRLTIKGGRLPPIRCAELQVSLDVLEGSPATFRLSP
                     QDGDYVILDSTETALYPCVSNTEYLRLQTLTFSLLDRIGSAEAHKHVVVASGVFPLKS
                     VALAEPVLLHIPLYYEGCAVGKLTAVLLQVYYERNNAELCALGLRDARYATIFSCYEN
                     EMRRASGQWTPASIVRDGVFHFSAEDPTESQEREACSLPDPHAWRWTTEWQHDHREDD
                     QQGWVYADGVGADLQLSATASTSIRRRRWVRVMQASGPIAYHSYLAEKLKMAAV"
     gene            <1798608..>1799318
                     /locus_tag="LMJF_34_4270"
                     /db_xref="GeneID:5655212"
     mRNA            <1798608..>1799318
                     /locus_tag="LMJF_34_4270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686482.1"
                     /db_xref="GeneID:5655212"
     CDS             1798608..1799318
                     /locus_tag="LMJF_34_4270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686534.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.4270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.4270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655212"
                     /db_xref="InterPro:IPR005176"
                     /db_xref="InterPro:IPR014764"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2B4"
                     /translation="MKNANRLRASVSFARERVVSTAAASSAKGPVMQLVSKGARSDME
                     LVFDRLHALDKSAQSDTISGKGLAQFLSEVGVEESSFECMVLLWKLGATQKGCITRSE
                     WLLSVYAHGIESIVQMRQNVSAWVEDVRESGGSFLLMYNYLYDYIRGEEDRRMTLTTA
                     LGAWDVFFGKNDLYAKWKAWAVDHVKGGVSRDLWRQLGIFLTMDTTAAQRSGDHISAL
                     PWPSAIADFLDQDGVPAS"
     gene            <1800878..>1802095
                     /locus_tag="LMJF_34_4280"
                     /db_xref="GeneID:5655213"
     mRNA            <1800878..>1802095
                     /locus_tag="LMJF_34_4280"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686483.1"
                     /db_xref="GeneID:5655213"
     CDS             1800878..1802095
                     /locus_tag="LMJF_34_4280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686535.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.4280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.4280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655213"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2B3"
                     /translation="MDSLELMCNFVGSSAAEIEKAVEDKSFLNLCNRPLPNGQYPIHV
                     LASRNNAESVELLLQVGVDANQASKEPGNRLGFTAVHYAAIANCVRALEVLKRYNADL
                     DRPAADQWTPLHAATFRGRSAAVRALVKLGVNIDCATSEGHTPLVFAVNLGRIEDARY
                     LLQNKAMVQLNDAHHDNLLHYALHYRLAQAVNGDYKLPDSQLDIAVLLVLNGVRPDEQ
                     NDEGDTPTRYVAATLPSLPKALDLLFANADKLHCLPTELNYRTLVSATTSFLIDEIGM
                     AAVQAQALVDIMAALEKERKASRPMRTVAADCVTDAAASLSLPAGHPAVPAEVLDRRG
                     GKPNSKQCPFLARSGKLQANGHAAANEGKCPRCPVAFLTMRCGKGTLLLVGAAFLLGY
                     FCGHKARCMRPRV"
     gene            <1803367..>1804029
                     /locus_tag="LMJF_34_4290"
                     /db_xref="GeneID:5655214"
     mRNA            <1803367..>1804029
                     /locus_tag="LMJF_34_4290"
                     /product="putative nucleolar protein family a"
                     /transcript_id="XM_001686484.1"
                     /db_xref="GeneID:5655214"
     CDS             1803367..1804029
                     /locus_tag="LMJF_34_4290"
                     /codon_start=1
                     /product="putative nucleolar protein family a"
                     /protein_id="XP_001686536.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.4290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.4290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655214"
                     /db_xref="GOA:Q4Q2B2"
                     /db_xref="InterPro:IPR007504"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR021154"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2B2"
                     /translation="MPRGFGGRGGGDRGSGSRGFGGPRGGRGGGGFGGGRGGGRGGGR
                     GGHMSEPDPPENVEEVGTFMNAAEGELVYKVTAHGVVPRFNAFVYTEHKAKIGKIEEI
                     LGNTTDVMFSVKPSPGVQAASLSEGDKVYISPTQFTPLRLFTEPPKPRGRGGRGGGRG
                     GDRGGRGGVRGGDRGGRGGFGGRGSFGGMGGGRGSFGSGGRGSFGGRGGGRGFDGRGR
                     GH"
     gene            <1805052..>1805852
                     /locus_tag="LMJF_34_4300"
                     /db_xref="GeneID:5655215"
     mRNA            <1805052..>1805852
                     /locus_tag="LMJF_34_4300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686485.1"
                     /db_xref="GeneID:5655215"
     CDS             1805052..1805852
                     /locus_tag="LMJF_34_4300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686537.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.4300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.4300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655215"
                     /db_xref="GOA:Q4Q2B1"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2B1"
                     /translation="MNADTAPLSWEWGGKRGRRTICGFNVAGDCLGGLVLLIGIPALV
                     VAHLAAVVLTPLFTASHDGNTLLLEVLLELFLCMGAVALLFLLLVADPGFVEVPTPLS
                     CRCSHCGTEVDDFDHHCGAVGACIGKGNMCYFILFLLFAALLCVLGAVQNVAFVAATV
                     RAHIRDAGTSWTSIAALIRNIFTTLCWPRILCLLALSVAAVNGGVVCTFLCLRYTYLA
                     YKGLSSVRRRRQFDVSGSLSKVFASTFRPAFSHNFILPRYHALADVSD"
     gene            <1807328..>1810918
                     /locus_tag="LMJF_34_4310"
                     /db_xref="GeneID:5655216"
     mRNA            <1807328..>1810918
                     /locus_tag="LMJF_34_4310"
                     /product="putative coatomer alpha subunit"
                     /transcript_id="XM_001686486.1"
                     /db_xref="GeneID:5655216"
     CDS             1807328..1810918
                     /locus_tag="LMJF_34_4310"
                     /codon_start=1
                     /product="putative coatomer alpha subunit"
                     /protein_id="XP_001686538.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.4310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.4310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655216"
                     /db_xref="GOA:Q4Q2B0"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR006692"
                     /db_xref="InterPro:IPR010714"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR016391"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2B0"
                     /translation="MLTKFEARSSRVKAVALHNSTTWVLCGLHNGAVQIWDYRMSTCV
                     DTYTEHVGAVRGADFHVNQPLFVTGGDDYTVKVWNYKLRRCLFTMTGHMDYVRTTFFH
                     HEQPWIVSCSDDFTIRIWNWQSRKSIACLPGHNHYVMCAQFHPFSDLVVSGSLDKTIR
                     VWDISALRHRKEEVGITHDLLGTTDVVVRYELEGHEKGINWVAFHACGDLLLSAADDR
                     TVRLWTMSGTSCYVSRTFTGHTSNVCCAVFYRNDYLISCAEDRTVRVVHMSSGVTVQT
                     FRREVERYWIMASDSTRNLIAIGHDAGLQVFKLTRERPAFAIHSATQLYYTCQNKLHM
                     YNFETEEVTSCTVTYQFNPPTALSCCPTTGGVMLSYANGGPQIEWIPKPLATRTCNVE
                     ATLKGIDGVFFGGHKLAYVDVSGKMCIQNVAKASGKPQQTDVSCSRIFPGPVGCVLCQ
                     SNDKILLYQVAQQGAVAEATVSGVRYAVWDKDFSKVALIAKNTVTIMTKRLKIIASVA
                     ESSARIKSAAFDETRDVMYFTTSNHLKYCYLRSGETSTISTLKNVVYLVRAVGDSIYV
                     LTRDGRVLRKELDNVELNFKLNLQQQSYRDLIRIVQQGKLKGQALVGYLHKHGHSEIA
                     LHFVSDSLTRFNLAIECGAIDIAKATATELNQPAIWRRLADTATSFGDIQLAQFASAK
                     AGNYYASGLLALLTGNIASVANLVNATRDDNFKLHYSMYMDDARQRVDILCKVNQLPL
                     AYVTAKSNGLEEMAAQVLQRMEPEVAARVQAQRFHPAPQKPAVEPATENWPMLQVEES
                     VFARLLKEPGQLDIIAQPELDEDVAAGAGWDDDEDDNTLLASAGAGAGDAGALTTKDE
                     MDGGWDDDLDIDVSAALPGAGGATSAGSGYVVPREHPTIMQTWVDAYTLPAFHVAAGS
                     FASALRLLQRQIGLADPTPLKPYMLQLWAAVNVCRPAPNGLRAVFAMSTPPPDSETEA
                     RHAPALPDFMPVLAEKLRVGYQLFVEGKFSEALDVFRSILHLSVVTVVKDDQQKAMLR
                     EIMAIAPEYTRALALQLQLRTLNAFSAESLQLALYFTHFRLHRAHLTLALSQAMSKAY
                     KQKNIKTAAEVARRLLEQDPPQNKAQQAAAIIAEADRNPTNAIEIEYDERNPFTICSA
                     TYKPMYKGVVSPVRCSYCFSPANPSCKGTLCPVCKLAKIGVDSAGLVNRI"
     gene            <1812088..>1812426
                     /locus_tag="LMJF_34_4320"
                     /db_xref="GeneID:5655217"
     mRNA            <1812088..>1812426
                     /locus_tag="LMJF_34_4320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686487.1"
                     /db_xref="GeneID:5655217"
     CDS             1812088..1812426
                     /locus_tag="LMJF_34_4320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686539.1"
                     /db_xref="GeneID:5655217"
                     /db_xref="InterPro:IPR019329"
                     /db_xref="UniProtKB/TrEMBL:Q4Q291"
                     /translation="MTRWNQRMAKMAFRRSKFRRLAWGDGDPYPYTPRATFRYQWDDW
                     PMWEKMWHLAVGVLGVEFAVWAYYSKLNSRMDWAREEALRRMRLRREAQELMILEGET
                     FPSDIQPDRH"
     gene            <1813011..>1813700
                     /gene="QDPR-1"
                     /locus_tag="LMJF_34_4330"
                     /db_xref="GeneID:5655218"
     mRNA            <1813011..>1813700
                     /gene="QDPR-1"
                     /locus_tag="LMJF_34_4330"
                     /product="quinonoid dihydropteridine reductase"
                     /transcript_id="XM_001686488.1"
                     /db_xref="GeneID:5655218"
     CDS             1813011..1813700
                     /gene="QDPR-1"
                     /locus_tag="LMJF_34_4330"
                     /EC_number="1.5.1.34"
                     /codon_start=1
                     /product="quinonoid dihydropteridine reductase"
                     /protein_id="XP_001686540.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.4330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.4330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655218"
                     /db_xref="GOA:Q4Q2A8"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:Q4Q2A8"
                     /translation="MKNVLLIGARGALGRAVANAFANGKWSIISVDQAAAVQQGDECC
                     AVNPASSIEELQQAYKSAVTGLKVDAVINVAGGWAGGSVADTSTAASTELMLRQSLFS
                     SVAAAHVFSTQGEKNGLLLLTGAAAAVSPTPGMIGYGTAKSAVHFLCQSIAEDPSVLP
                     TDASVLAILPTILDTPGNRSAMPHADRSTWTSLEDVAQQIVEWSNGSRRPASGSLVKI
                     VTENSKTRFIV"
     gene            <1814240..>1814902
                     /locus_tag="LMJF_34_4340"
                     /db_xref="GeneID:5655219"
     mRNA            <1814240..>1814902
                     /locus_tag="LMJF_34_4340"
                     /product="20s proteasome beta 7 subunit, (putative)"
                     /transcript_id="XM_001686489.1"
                     /db_xref="GeneID:5655219"
     CDS             1814240..1814902
                     /locus_tag="LMJF_34_4340"
                     /codon_start=1
                     /product="20s proteasome beta 7 subunit, (putative)"
                     /protein_id="XP_001686541.1"
                     /db_xref="GeneID:5655219"
                     /db_xref="GOA:Q4Q289"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q4Q289"
                     /translation="MASGASVIAIKYNGGVLMAADTLLSYGSLAKWPNIPRIKLLGSH
                     SAVCATGSYADFQMMAKQVEDNIERQRMYYNVDELNPSEVFSYLHRSIYQKRCDFEPC
                     LCQMVFIGVRDSETFLAAVDDVGTRWEDDCVATGYGAYIALPLLRQALEKNPGGLSRA
                     QAVQILTDCLRVLFYRECRTINKFQMADAAGDGVRISEPFDVETNWEYEGFCFEKTAI
                     IR"
     gene            <1815629..>1815967
                     /locus_tag="LMJF_34_4350"
                     /db_xref="GeneID:5655220"
     mRNA            <1815629..>1815967
                     /locus_tag="LMJF_34_4350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686490.1"
                     /db_xref="GeneID:5655220"
     CDS             1815629..1815967
                     /locus_tag="LMJF_34_4350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686542.1"
                     /db_xref="GeneID:5655220"
                     /db_xref="InterPro:IPR019329"
                     /db_xref="UniProtKB/TrEMBL:Q4Q291"
                     /translation="MTRWNQRMAKMAFRRSKFRRLAWGDGDPYPYTPRATFRYQWDDW
                     PMWEKMWHLAVGVLGVEFAVWAYYSKLNSRMDWAREEALRRMRLRREAQELMILEGET
                     FPSDIQPDRH"
     gene            <1816552..>1817241
                     /gene="QDPR-2"
                     /locus_tag="LMJF_34_4360"
                     /db_xref="GeneID:5655221"
     mRNA            <1816552..>1817241
                     /gene="QDPR-2"
                     /locus_tag="LMJF_34_4360"
                     /product="quinonoid dihydropteridine reductase"
                     /transcript_id="XM_001686491.1"
                     /db_xref="GeneID:5655221"
     CDS             1816552..1817241
                     /gene="QDPR-2"
                     /locus_tag="LMJF_34_4360"
                     /EC_number="1.5.1.34"
                     /codon_start=1
                     /product="quinonoid dihydropteridine reductase"
                     /protein_id="XP_001686543.1"
                     /db_xref="GeneID:5655221"
                     /db_xref="GOA:Q4Q290"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:Q4Q290"
                     /translation="MKNVLLIGARGALGRAVANAFANGKWSIISVDQAAAVQQGDECC
                     AVNPASSIEELQQAYKSAVTGLKVDAVINVAGGWAGGSVADASTAASTELMLRQSLFS
                     SVAAAHVFSTQGEKNGLLLLTGAAAAVSPTPGMIGYGTAKSAVHFLCQSIAEDPSVLP
                     TDASVLAILPTILDTPGNRSAMPHADRSTWTSLEDVAQQIVEWSNGSRRPASGSLVKI
                     VTENSKTRFIV"
     gene            <1817781..>1818443
                     /locus_tag="LMJF_34_4370"
                     /db_xref="GeneID:5655222"
     mRNA            <1817781..>1818443
                     /locus_tag="LMJF_34_4370"
                     /product="20s proteasome beta 7 subunit, (putative)"
                     /transcript_id="XM_001686492.1"
                     /db_xref="GeneID:5655222"
     CDS             1817781..1818443
                     /locus_tag="LMJF_34_4370"
                     /codon_start=1
                     /product="20s proteasome beta 7 subunit, (putative)"
                     /protein_id="XP_001686544.1"
                     /db_xref="GeneID:5655222"
                     /db_xref="GOA:Q4Q289"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q4Q289"
                     /translation="MASGASVIAIKYNGGVLMAADTLLSYGSLAKWPNIPRIKLLGSH
                     SAVCATGSYADFQMMAKQVEDNIERQRMYYNVDELNPSEVFSYLHRSIYQKRCDFEPC
                     LCQMVFIGVRDSETFLAAVDDVGTRWEDDCVATGYGAYIALPLLRQALEKNPGGLSRA
                     QAVQILTDCLRVLFYRECRTINKFQMADAAGDGVRISEPFDVETNWEYEGFCFEKTAI
                     IR"
     gene            <1819170..>1819508
                     /locus_tag="LMJF_34_4380"
                     /db_xref="GeneID:5655223"
     mRNA            <1819170..>1819508
                     /locus_tag="LMJF_34_4380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686493.1"
                     /db_xref="GeneID:5655223"
     CDS             1819170..1819508
                     /locus_tag="LMJF_34_4380"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686545.1"
                     /db_xref="GeneID:5655223"
                     /db_xref="InterPro:IPR019329"
                     /db_xref="UniProtKB/TrEMBL:Q4Q291"
                     /translation="MTRWNQRMAKMAFRRSKFRRLAWGDGDPYPYTPRATFRYQWDDW
                     PMWEKMWHLAVGVLGVEFAVWAYYSKLNSRMDWAREEALRRMRLRREAQELMILEGET
                     FPSDIQPDRH"
     gene            <1820093..>1820782
                     /gene="QDPR-3"
                     /locus_tag="LMJF_34_4390"
                     /db_xref="GeneID:5655224"
     mRNA            <1820093..>1820782
                     /gene="QDPR-3"
                     /locus_tag="LMJF_34_4390"
                     /product="quinonoid dihydropteridine reductase"
                     /transcript_id="XM_001686494.1"
                     /db_xref="GeneID:5655224"
     CDS             1820093..1820782
                     /gene="QDPR-3"
                     /locus_tag="LMJF_34_4390"
                     /EC_number="1.5.1.34"
                     /codon_start=1
                     /product="quinonoid dihydropteridine reductase"
                     /protein_id="XP_001686546.1"
                     /db_xref="GeneID:5655224"
                     /db_xref="GOA:Q4Q290"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:Q4Q290"
                     /translation="MKNVLLIGARGALGRAVANAFANGKWSIISVDQAAAVQQGDECC
                     AVNPASSIEELQQAYKSAVTGLKVDAVINVAGGWAGGSVADASTAASTELMLRQSLFS
                     SVAAAHVFSTQGEKNGLLLLTGAAAAVSPTPGMIGYGTAKSAVHFLCQSIAEDPSVLP
                     TDASVLAILPTILDTPGNRSAMPHADRSTWTSLEDVAQQIVEWSNGSRRPASGSLVKI
                     VTENSKTRFIV"
     gene            <1821322..>1821984
                     /locus_tag="LMJF_34_4400"
                     /db_xref="GeneID:5655225"
     mRNA            <1821322..>1821984
                     /locus_tag="LMJF_34_4400"
                     /product="20s proteasome beta 7 subunit, (putative)"
                     /transcript_id="XM_001686495.1"
                     /db_xref="GeneID:5655225"
     CDS             1821322..1821984
                     /locus_tag="LMJF_34_4400"
                     /codon_start=1
                     /product="20s proteasome beta 7 subunit, (putative)"
                     /protein_id="XP_001686547.1"
                     /db_xref="GeneID:5655225"
                     /db_xref="GOA:Q4Q289"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q4Q289"
                     /translation="MASGASVIAIKYNGGVLMAADTLLSYGSLAKWPNIPRIKLLGSH
                     SAVCATGSYADFQMMAKQVEDNIERQRMYYNVDELNPSEVFSYLHRSIYQKRCDFEPC
                     LCQMVFIGVRDSETFLAAVDDVGTRWEDDCVATGYGAYIALPLLRQALEKNPGGLSRA
                     QAVQILTDCLRVLFYRECRTINKFQMADAAGDGVRISEPFDVETNWEYEGFCFEKTAI
                     IR"
     gene            <1822711..>1823049
                     /locus_tag="LMJF_34_4410"
                     /db_xref="GeneID:5655226"
     mRNA            <1822711..>1823049
                     /locus_tag="LMJF_34_4410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686496.1"
                     /db_xref="GeneID:5655226"
     CDS             1822711..1823049
                     /locus_tag="LMJF_34_4410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686548.1"
                     /db_xref="GeneID:5655226"
                     /db_xref="InterPro:IPR019329"
                     /db_xref="UniProtKB/TrEMBL:Q4Q291"
                     /translation="MTRWNQRMAKMAFRRSKFRRLAWGDGDPYPYTPRATFRYQWDDW
                     PMWEKMWHLAVGVLGVEFAVWAYYSKLNSRMDWAREEALRRMRLRREAQELMILEGET
                     FPSDIQPDRH"
     gene            <1823634..>1824323
                     /gene="QDPR-4"
                     /locus_tag="LMJF_34_4420"
                     /db_xref="GeneID:5655227"
     mRNA            <1823634..>1824323
                     /gene="QDPR-4"
                     /locus_tag="LMJF_34_4420"
                     /product="quinonoid dihydropteridine reductase"
                     /transcript_id="XM_001686497.1"
                     /db_xref="GeneID:5655227"
     CDS             1823634..1824323
                     /gene="QDPR-4"
                     /locus_tag="LMJF_34_4420"
                     /EC_number="1.5.1.34"
                     /codon_start=1
                     /product="quinonoid dihydropteridine reductase"
                     /protein_id="XP_001686549.1"
                     /db_xref="GeneID:5655227"
                     /db_xref="GOA:Q4Q290"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:Q4Q290"
                     /translation="MKNVLLIGARGALGRAVANAFANGKWSIISVDQAAAVQQGDECC
                     AVNPASSIEELQQAYKSAVTGLKVDAVINVAGGWAGGSVADASTAASTELMLRQSLFS
                     SVAAAHVFSTQGEKNGLLLLTGAAAAVSPTPGMIGYGTAKSAVHFLCQSIAEDPSVLP
                     TDASVLAILPTILDTPGNRSAMPHADRSTWTSLEDVAQQIVEWSNGSRRPASGSLVKI
                     VTENSKTRFIV"
     gene            <1824863..>1825525
                     /locus_tag="LMJF_34_4430"
                     /db_xref="GeneID:5655228"
     mRNA            <1824863..>1825525
                     /locus_tag="LMJF_34_4430"
                     /product="20s proteasome beta 7 subunit, (putative)"
                     /transcript_id="XM_001686498.1"
                     /db_xref="GeneID:5655228"
     CDS             1824863..1825525
                     /locus_tag="LMJF_34_4430"
                     /codon_start=1
                     /product="20s proteasome beta 7 subunit, (putative)"
                     /protein_id="XP_001686550.1"
                     /db_xref="GeneID:5655228"
                     /db_xref="GOA:Q4Q289"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q4Q289"
                     /translation="MASGASVIAIKYNGGVLMAADTLLSYGSLAKWPNIPRIKLLGSH
                     SAVCATGSYADFQMMAKQVEDNIERQRMYYNVDELNPSEVFSYLHRSIYQKRCDFEPC
                     LCQMVFIGVRDSETFLAAVDDVGTRWEDDCVATGYGAYIALPLLRQALEKNPGGLSRA
                     QAVQILTDCLRVLFYRECRTINKFQMADAAGDGVRISEPFDVETNWEYEGFCFEKTAI
                     IR"
     gene            <1826252..>1826590
                     /locus_tag="LMJF_34_4440"
                     /db_xref="GeneID:5655229"
     mRNA            <1826252..>1826590
                     /locus_tag="LMJF_34_4440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686499.1"
                     /db_xref="GeneID:5655229"
     CDS             1826252..1826590
                     /locus_tag="LMJF_34_4440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686551.1"
                     /db_xref="GeneID:5655229"
                     /db_xref="InterPro:IPR019329"
                     /db_xref="UniProtKB/TrEMBL:Q4Q291"
                     /translation="MTRWNQRMAKMAFRRSKFRRLAWGDGDPYPYTPRATFRYQWDDW
                     PMWEKMWHLAVGVLGVEFAVWAYYSKLNSRMDWAREEALRRMRLRREAQELMILEGET
                     FPSDIQPDRH"
     gene            <1827175..>1827864
                     /gene="QDPR-5"
                     /locus_tag="LMJF_34_4450"
                     /db_xref="GeneID:5655230"
     mRNA            <1827175..>1827864
                     /gene="QDPR-5"
                     /locus_tag="LMJF_34_4450"
                     /product="quinonoid dihydropteridine reductase"
                     /transcript_id="XM_001686500.1"
                     /db_xref="GeneID:5655230"
     CDS             1827175..1827864
                     /gene="QDPR-5"
                     /locus_tag="LMJF_34_4450"
                     /EC_number="1.5.1.34"
                     /codon_start=1
                     /product="quinonoid dihydropteridine reductase"
                     /protein_id="XP_001686552.1"
                     /db_xref="GeneID:5655230"
                     /db_xref="GOA:Q4Q290"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:Q4Q290"
                     /translation="MKNVLLIGARGALGRAVANAFANGKWSIISVDQAAAVQQGDECC
                     AVNPASSIEELQQAYKSAVTGLKVDAVINVAGGWAGGSVADASTAASTELMLRQSLFS
                     SVAAAHVFSTQGEKNGLLLLTGAAAAVSPTPGMIGYGTAKSAVHFLCQSIAEDPSVLP
                     TDASVLAILPTILDTPGNRSAMPHADRSTWTSLEDVAQQIVEWSNGSRRPASGSLVKI
                     VTENSKTRFIV"
     gene            <1828404..>1829066
                     /locus_tag="LMJF_34_4460"
                     /db_xref="GeneID:5655231"
     mRNA            <1828404..>1829066
                     /locus_tag="LMJF_34_4460"
                     /product="20s proteasome beta 7 subunit, (putative)"
                     /transcript_id="XM_001686501.1"
                     /db_xref="GeneID:5655231"
     CDS             1828404..1829066
                     /locus_tag="LMJF_34_4460"
                     /codon_start=1
                     /product="20s proteasome beta 7 subunit, (putative)"
                     /protein_id="XP_001686553.1"
                     /db_xref="GeneID:5655231"
                     /db_xref="GOA:Q4Q289"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q4Q289"
                     /translation="MASGASVIAIKYNGGVLMAADTLLSYGSLAKWPNIPRIKLLGSH
                     SAVCATGSYADFQMMAKQVEDNIERQRMYYNVDELNPSEVFSYLHRSIYQKRCDFEPC
                     LCQMVFIGVRDSETFLAAVDDVGTRWEDDCVATGYGAYIALPLLRQALEKNPGGLSRA
                     QAVQILTDCLRVLFYRECRTINKFQMADAAGDGVRISEPFDVETNWEYEGFCFEKTAI
                     IR"
     gene            <1829793..>1830131
                     /locus_tag="LMJF_34_4470"
                     /db_xref="GeneID:5655232"
     mRNA            <1829793..>1830131
                     /locus_tag="LMJF_34_4470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686502.1"
                     /db_xref="GeneID:5655232"
     CDS             1829793..1830131
                     /locus_tag="LMJF_34_4470"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686554.1"
                     /db_xref="GeneID:5655232"
                     /db_xref="InterPro:IPR019329"
                     /db_xref="UniProtKB/TrEMBL:Q4Q291"
                     /translation="MTRWNQRMAKMAFRRSKFRRLAWGDGDPYPYTPRATFRYQWDDW
                     PMWEKMWHLAVGVLGVEFAVWAYYSKLNSRMDWAREEALRRMRLRREAQELMILEGET
                     FPSDIQPDRH"
     gene            <1830716..>1831405
                     /gene="QDPR-6"
                     /locus_tag="LMJF_34_4480"
                     /db_xref="GeneID:5655233"
     mRNA            <1830716..>1831405
                     /gene="QDPR-6"
                     /locus_tag="LMJF_34_4480"
                     /product="quinonoid dihydropteridine reductase"
                     /transcript_id="XM_001686503.1"
                     /db_xref="GeneID:5655233"
     CDS             1830716..1831405
                     /gene="QDPR-6"
                     /locus_tag="LMJF_34_4480"
                     /EC_number="1.5.1.34"
                     /codon_start=1
                     /product="quinonoid dihydropteridine reductase"
                     /protein_id="XP_001686555.1"
                     /db_xref="GeneID:5655233"
                     /db_xref="GOA:Q4Q290"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:Q4Q290"
                     /translation="MKNVLLIGARGALGRAVANAFANGKWSIISVDQAAAVQQGDECC
                     AVNPASSIEELQQAYKSAVTGLKVDAVINVAGGWAGGSVADASTAASTELMLRQSLFS
                     SVAAAHVFSTQGEKNGLLLLTGAAAAVSPTPGMIGYGTAKSAVHFLCQSIAEDPSVLP
                     TDASVLAILPTILDTPGNRSAMPHADRSTWTSLEDVAQQIVEWSNGSRRPASGSLVKI
                     VTENSKTRFIV"
     gene            <1831945..>1832607
                     /locus_tag="LMJF_34_4490"
                     /db_xref="GeneID:5655234"
     mRNA            <1831945..>1832607
                     /locus_tag="LMJF_34_4490"
                     /product="20s proteasome beta 7 subunit, (putative)"
                     /transcript_id="XM_001686504.1"
                     /db_xref="GeneID:5655234"
     CDS             1831945..1832607
                     /locus_tag="LMJF_34_4490"
                     /codon_start=1
                     /product="20s proteasome beta 7 subunit, (putative)"
                     /protein_id="XP_001686556.1"
                     /db_xref="GeneID:5655234"
                     /db_xref="GOA:Q4Q289"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q4Q289"
                     /translation="MASGASVIAIKYNGGVLMAADTLLSYGSLAKWPNIPRIKLLGSH
                     SAVCATGSYADFQMMAKQVEDNIERQRMYYNVDELNPSEVFSYLHRSIYQKRCDFEPC
                     LCQMVFIGVRDSETFLAAVDDVGTRWEDDCVATGYGAYIALPLLRQALEKNPGGLSRA
                     QAVQILTDCLRVLFYRECRTINKFQMADAAGDGVRISEPFDVETNWEYEGFCFEKTAI
                     IR"
     gene            <1833334..>1833672
                     /locus_tag="LMJF_34_4500"
                     /db_xref="GeneID:5655235"
     mRNA            <1833334..>1833672
                     /locus_tag="LMJF_34_4500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686505.1"
                     /db_xref="GeneID:5655235"
     CDS             1833334..1833672
                     /locus_tag="LMJF_34_4500"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686557.1"
                     /db_xref="GeneID:5655235"
                     /db_xref="InterPro:IPR019329"
                     /db_xref="UniProtKB/TrEMBL:Q4Q291"
                     /translation="MTRWNQRMAKMAFRRSKFRRLAWGDGDPYPYTPRATFRYQWDDW
                     PMWEKMWHLAVGVLGVEFAVWAYYSKLNSRMDWAREEALRRMRLRREAQELMILEGET
                     FPSDIQPDRH"
     gene            <1834256..>1834945
                     /gene="QDPR-7"
                     /locus_tag="LMJF_34_4510"
                     /db_xref="GeneID:5655236"
     mRNA            <1834256..>1834945
                     /gene="QDPR-7"
                     /locus_tag="LMJF_34_4510"
                     /product="quinonoid dihydropteridine reductase"
                     /transcript_id="XM_001686506.1"
                     /db_xref="GeneID:5655236"
     CDS             1834256..1834945
                     /gene="QDPR-7"
                     /locus_tag="LMJF_34_4510"
                     /EC_number="1.5.1.34"
                     /codon_start=1
                     /product="quinonoid dihydropteridine reductase"
                     /protein_id="XP_001686558.1"
                     /db_xref="GeneID:5655236"
                     /db_xref="GOA:Q4Q290"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:Q4Q290"
                     /translation="MKNVLLIGARGALGRAVANAFANGKWSIISVDQAAAVQQGDECC
                     AVNPASSIEELQQAYKSAVTGLKVDAVINVAGGWAGGSVADASTAASTELMLRQSLFS
                     SVAAAHVFSTQGEKNGLLLLTGAAAAVSPTPGMIGYGTAKSAVHFLCQSIAEDPSVLP
                     TDASVLAILPTILDTPGNRSAMPHADRSTWTSLEDVAQQIVEWSNGSRRPASGSLVKI
                     VTENSKTRFIV"
     gene            <1835485..>1836147
                     /locus_tag="LMJF_34_4520"
                     /db_xref="GeneID:5655237"
     mRNA            <1835485..>1836147
                     /locus_tag="LMJF_34_4520"
                     /product="putative proteasome beta 7 subunit"
                     /transcript_id="XM_001686507.1"
                     /db_xref="GeneID:5655237"
     CDS             1835485..1836147
                     /locus_tag="LMJF_34_4520"
                     /codon_start=1
                     /product="putative proteasome beta 7 subunit"
                     /protein_id="XP_001686559.1"
                     /db_xref="GeneID:5655237"
                     /db_xref="GOA:Q4Q289"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q4Q289"
                     /translation="MASGASVIAIKYNGGVLMAADTLLSYGSLAKWPNIPRIKLLGSH
                     SAVCATGSYADFQMMAKQVEDNIERQRMYYNVDELNPSEVFSYLHRSIYQKRCDFEPC
                     LCQMVFIGVRDSETFLAAVDDVGTRWEDDCVATGYGAYIALPLLRQALEKNPGGLSRA
                     QAVQILTDCLRVLFYRECRTINKFQMADAAGDGVRISEPFDVETNWEYEGFCFEKTAI
                     IR"
     gene            <1837650..>1844966
                     /gene="TOR2"
                     /locus_tag="LMJF_34_4530"
                     /db_xref="GeneID:5655238"
     mRNA            <1837650..>1844966
                     /gene="TOR2"
                     /locus_tag="LMJF_34_4530"
                     /product="putative target of rapamycin (TOR) kinase 2"
                     /transcript_id="XM_001686508.1"
                     /db_xref="GeneID:5655238"
     CDS             1837650..1844966
                     /gene="TOR2"
                     /locus_tag="LMJF_34_4530"
                     /EC_number="2.7.1.137"
                     /codon_start=1
                     /product="putative target of rapamycin (TOR) kinase 2"
                     /protein_id="XP_001686560.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.4530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.4530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655238"
                     /db_xref="GOA:Q4Q288"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR003151"
                     /db_xref="InterPro:IPR003152"
                     /db_xref="InterPro:IPR009076"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR014009"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="InterPro:IPR024585"
                     /db_xref="UniProtKB/TrEMBL:Q4Q288"
                     /translation="MSSVDSEKLAASIRTLAGSRDERIAFVTEGVKQAKELQGKSVQE
                     YEMVVSSLLMCLESFEVVHGTSLDVLCELTVLDILLNLDLSVIQLSQCNSYLRLCLMA
                     VNEIPVAVAAAKTFAQTLSYSMTTDFVRTQIGETLEWISLSDAKSQPRRICGILVLTE
                     VALRIPMVILPRLSEVFDRIWDCLVVHDEEVRSRALCLFTLCAKLLVNRPAAIRAETC
                     DSLMSHLKGNLASKSKDKRIAGLLAFEPIVINSIGTSNIRYEDLSTLLVPYIVGGGAN
                     VNAETRELLFRCLVVLCRFSAPQFVAHQLKDSVRFALDSINRNIQRNTAFEMLSEIIP
                     IVGKAEFAPFVDDTCEVIKTIFEKSPSPCWKALQCFSIICKECRPSKMETYVESCIEN
                     VFVWGLSAELIECMRAIIESSSAQYRAKLEESLLDMISVTLCGLPFRQQIDAPRVSES
                     STDVSASEYEISVALNALKQFGFSNSELMGDFLRVSVLPFIDSNSVAVRNAAVYTIVK
                     LLIPPGEKGDLSIARRMCVNTVITRMLVVGLSDPNPVVRQTILSAFTEDFYPYLSEQQ
                     YLFRFYSALGDESINCRVAATEQLCQMIRYDPSHILPALREEMVVLLHFITSTFNMNT
                     VQNGFRLLAAIATRAPQLVVNFTEGICEALVPYFSTLSSRSSILLSFLHCCTAVAAAL
                     RKFGSTPFSSKREIALVCELLETLPADRSYHIIRLSCLRFLSATLAPLMEGASPYVLY
                     PRLFQQLCTLLHRTEESVDIRLEALRCIGVIGALDSHVFQSFNLNEKEKACEMSAVVV
                     DRVTHVKCCRIVLGAVAALLDPESKRSAGAREGLLRTGVQTMLNIFEHIPCSKSEIGL
                     VIGPLARVIRQLPGGRLFATVLFEFCNIIRYAGAVVLNDLNEIYRVFDNVWELQVNYR
                     FLAVRMLSFVANFEASDNRHYGQQHSRILPQLFDTLNRADLRADLKYAVLEYIVRHVD
                     TLQPCTEAAVDNLLGALQNPANPLDFVNHCVVTLKEICLKLYVDELVGAIVRCLLACL
                     SVDLARKTRGRDSIALCNNIMGVFCVLIEELQGDFLKHSTYIIQALKNYRITNTEFGV
                     MNNRVATGLRCARSPMSIQQQNAEVAALLKTCESVVMKSMSRMGEVWSYANLNDDNAN
                     AGIAEERTMPINEQRLISPMKVVPLTKEEWVKWSDQFAITLLQESPFQVFRCTAVPIG
                     INAAPLVEKSTQFVQDTLQIAFRSMWNYASSALQTAITDFFRQSFRQAMMSTTVPAEV
                     VTMLLGIVEYMDHVGEALFISYNDLSECAWNRGMLAKALFWREAAYRDDPVGTVESLI
                     SLYSELHMVDSSVGILNMTSEEQRRSLLQTSLVKLARYTEALQLTQQELELEAAPSEA
                     SSSESLSKARGYKNGSRGWSRMLHYTSNSDLTPSSLKAEESCRDRRVEVNARLMLCLS
                     ELGEYDKVLEQWGSMLHNCKDRVTDTDEMHVLFFVSQYAADASIRLQSWDTLEHVLDW
                     LPPDMVLYHVSKAALEVVRGNYDAALVSVTNGRKVLLEDLTSLLHESYARAYEGLVVA
                     QQLTEMEEVIIAKQTQKALSSAAHIPHLCHIWEQRIRMMHATVPTWKQVLGIRGLLIS
                     PHEDVKTRIQFTKLCRQEKAGQLEKFTLAELLGFANPTLEQLTSRNVNPRVVMQYISY
                     LSDTNALGPGSAFGTESDLIKKMIDVHTKAQNSAVLARAYTRLGSKVDLIESVQCFKT
                     AIMYDPQWFLAWRKWAEANAQLLQTDKGEETCRNAIEGFIRSIQLGTSDSTLIQDVLK
                     LLTLWSSHCDSDHNLKELRERVFDVPSRVWHLVVPQLVARLDTGSDDSCRLVADVLTN
                     VGYDYPHTLVYPLNLCTMSDSERRKRYSNEVLGKLQERYPVIVLQGRLMIDELIRVSA
                     LIYEQWYDKLEAAATAFFGRRSTDEMIRTLLPIHETLTRVPETVVESEFLSKYSKRLT
                     EARDWLRSYSSTRYTGDIQSAWKLYHSVYCNIDKQIKSSDTLQLQFCSPKLFEARNLS
                     IGIPDARPVREESVAKVNRFQKDIIVIASKQRPKRIGIITAEGKLQKFLLKGREDLRL
                     DERVMQLFSLVNILMQSDSRASKNLGFQIQRYSVTPLKDNVGIIGWVDGCDTLHEVVK
                     HFRERKSIPVELEMRMLDQIITFDNSKAYDYLTIMSKVEVLEFLSDHTSGQDIRKAMW
                     STSPNCEVWYDRRRMYTTSLANMSIVGYILGLGDRHPNNIMLQRASGLVVHIDFGDCF
                     EVAMTRDKFPEKVPFRLTRMLRSALDVSGVDGAFRACSETAMCVLREGSHSVLALLEA
                     FIQDPLISWRLINRHGQEPESSNDHKTIEEQVNIANMRNATSAAEAESMCDSFGQRDS
                     GPFSVAKHLCGEEVDVVHQGVFIVKRLSSKLKGQDFISAGTELLDPRTQVGQLIEEAT
                     DVTNVAQSWSGWYPFW"
     gene            <1845929..>1846255
                     /locus_tag="LMJF_34_4540"
                     /db_xref="GeneID:5655239"
     mRNA            <1845929..>1846255
                     /locus_tag="LMJF_34_4540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686509.1"
                     /db_xref="GeneID:5655239"
     CDS             1845929..1846255
                     /locus_tag="LMJF_34_4540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686561.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.4540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.4540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655239"
                     /db_xref="UniProtKB/TrEMBL:Q4Q287"
                     /translation="MAALGSDVQATSVELVSVIEKMKERKTLLEEQISAEEAEYEGVL
                     AEVRAMQERLAVLKESLAKKQAVRADLERTISETYSAFKSILDASKKLLSTAKEESLA
                     LKAQIE"
     gene            <1846830..>1847912
                     /locus_tag="LMJF_34_4550"
                     /db_xref="GeneID:5655240"
     mRNA            <1846830..>1847912
                     /locus_tag="LMJF_34_4550"
                     /product="cell differentiation protein-like protein"
                     /transcript_id="XM_001686510.1"
                     /db_xref="GeneID:5655240"
     CDS             1846830..1847912
                     /locus_tag="LMJF_34_4550"
                     /codon_start=1
                     /product="cell differentiation protein-like protein"
                     /protein_id="XP_001686562.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.4550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.4550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655240"
                     /db_xref="InterPro:IPR007216"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q286"
                     /translation="MDAPAAYPPWEEESNDLAKFGYRQQRFPQAGYSRFPVAQPQPRP
                     PQQPQPQPQPPQAALPQQVARLEPSQYPDVVREMLMHIQNLYHQDTRERAILTLSKKR
                     EKFTLLGPTLWYSVGVMAIFLQEIVSMYPLLNTPSSAPVKPIINRVSSVLTLLQVIAQ
                     HDASRRPFMESNICLFLYPFLRATPAERSEVLRLTSLGVIGALVKADDPAIISYLLNT
                     EIFPICLKIMEQAIEISKIISTFIIQKLLMSDQGLVYACQNPSRFTAVADVLHRMVAE
                     KGPQNEHVCGPRLLKHIIRCYLRLSENERAREALPKILPEELRNNTFQEYLDEDINMR
                     KWLLQLLVNIGDEGARRISETAKHAQ"
     gene            <1849006..>1850178
                     /locus_tag="LMJF_34_4560"
                     /db_xref="GeneID:5655241"
     mRNA            <1849006..>1850178
                     /locus_tag="LMJF_34_4560"
                     /product="RNA-binding protein-like protein"
                     /transcript_id="XM_001686511.1"
                     /db_xref="GeneID:5655241"
     CDS             1849006..1850178
                     /locus_tag="LMJF_34_4560"
                     /codon_start=1
                     /product="RNA-binding protein-like protein"
                     /protein_id="XP_001686563.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.4560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.4560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655241"
                     /db_xref="GOA:Q4Q285"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4Q285"
                     /translation="MQSKGVETGSYKPSLRVDIGSADNAKEEPANVTEGSPHKVITPH
                     VSTNIFVAGIPSTWDDDALRERYKEFGEIVSTKVVKNRHFGFVMFRKAESAHAAINAT
                     HLTQPTPNCGTVLHVSIAMHDEGLDDHPNDRLFIRGLPQWATKEHLRQMFAPYGVITE
                     CAVLMNPLGQCKGSGFVQFSSQQEATAAIKARDSISMDNWPNQLEVKYSESAEVRQMR
                     QERNRNRQRHWLPSPQYRGGNTPSSLPSPYPGFSPPLSLIPSPQAFPVMNAMPFSMVY
                     SPTPATTGAPTQIVYPQPIYQTIPPFYSASAVPIPAPIPLPQKGDLHFSGPPLTEELL
                     RLMLQSYGEVEAVKKLDNDTGIAVRLRDVTKHALVVQQLNGSLFPTGQLLAVGIYA"
     gene            <1851730..>1852089
                     /locus_tag="LMJF_34_4570"
                     /db_xref="GeneID:5655242"
     mRNA            <1851730..>1852089
                     /locus_tag="LMJF_34_4570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686512.1"
                     /db_xref="GeneID:5655242"
     CDS             1851730..1852089
                     /locus_tag="LMJF_34_4570"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686564.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.4570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.4570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655242"
                     /db_xref="UniProtKB/TrEMBL:Q4Q284"
                     /translation="MGSNFLGYSDEDHGLASVWGRLIFLSCITTGIFYVIFGLFACRR
                     LIVKDIRWLLMAFLYFSMGVCHAFFTLTLLCFAIACVLHTFEKPMQNGEMIMYSGIMT
                     IVTMYFACGRKTILYSL"
     gene            <1853136..>1854113
                     /locus_tag="LMJF_34_4580"
                     /db_xref="GeneID:5655243"
     mRNA            <1853136..>1854113
                     /locus_tag="LMJF_34_4580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686513.1"
                     /db_xref="GeneID:5655243"
     CDS             1853136..1854113
                     /locus_tag="LMJF_34_4580"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686565.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.4580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.4580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655243"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4Q283"
                     /translation="MSLDIATYQLLDADHHIHFCSQSPDTKFLACALGNGIVCLVNAI
                     TFNAVARGAPGKDFLDVPATCIRWAPEHCNNAWQLVSSSCAGGVMLWHWDRTEFSLRR
                     GAAACEQHNEVMVVDVSPSGKQVLTAGSDRIVRLYDSELTPLAQLTEGVNADGTSRPA
                     HTNRIFSLRFLTEVAAVSAGWESPIQLWDLRACRSNRQVVGVQGVSDCLEPVPSTSIV
                     LVASPKSTNTLQIFDTVTGRVLEENSNKVCSQLNLRERVLVCRLQAETGNAWCLTVSP
                     PSVIVVCVSSGRIVARAALAHTPINMTMKDASVVVGCKNGVLLQVSLSM"
     gene            <1855775..>1856851
                     /locus_tag="LMJF_34_4590"
                     /db_xref="GeneID:5655244"
     mRNA            <1855775..>1856851
                     /locus_tag="LMJF_34_4590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686514.1"
                     /db_xref="GeneID:5655244"
     CDS             1855775..1856851
                     /locus_tag="LMJF_34_4590"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686566.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.4590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.4590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655244"
                     /db_xref="GOA:Q4Q282"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="UniProtKB/TrEMBL:Q4Q282"
                     /translation="MSIGTDYLSAMLNYNGCLQERILRRLLIIENETDSLLALRCALV
                     PLQTPTRKRKRHTEPVAAQGTSFNVDVDTTRHRWSTELCEALNDEAAKANCIASLCPP
                     AKERWCAVAAALRRAGHPSFTPYELFTKYKEMHSDSRPFALSEARFVCQYVQEHGGDW
                     QGLCQALRQRLGHVRSPFQVAQQYRQRLRCAFVENRLTSSQLLTLLADLPASPQDRDF
                     AALSVEAQRFTSHKTLQVSPLYLKRELEPLDFAARVPTCHHLYWKLVNLLCNFTLSHP
                     NRLHAFQHRMPFCYQQRSLADLARSLQCEAAELQERVVHALLRLSRPPEALNYEECSK
                     KLFGTVCGAQLIYQISEKLHEKDI"
     gene            <1857568..>1858407
                     /locus_tag="LMJF_34_4600"
                     /db_xref="GeneID:5655245"
     mRNA            <1857568..>1858407
                     /locus_tag="LMJF_34_4600"
                     /product="putative
                     1,2-Dihydroxy-3-keto-5-methylthiopentene dioxygenase"
                     /transcript_id="XM_001686515.1"
                     /db_xref="GeneID:5655245"
     CDS             1857568..1858407
                     /locus_tag="LMJF_34_4600"
                     /EC_number="1.13.11.54"
                     /codon_start=1
                     /product="putative
                     1,2-Dihydroxy-3-keto-5-methylthiopentene dioxygenase"
                     /protein_id="XP_001686567.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.4600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.4600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655245"
                     /db_xref="GOA:Q4Q281"
                     /db_xref="InterPro:IPR004313"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="UniProtKB/TrEMBL:Q4Q281"
                     /translation="MEGISEEQRQREEAEIRERDRKRQQEKEDYERRLAEAKAEEERK
                     RREEEQLRLEEEKRKKRQEEEWKRLGSDAIQDLPPVPPPVAEEGALDMWYLDDETSQP
                     PLSTASLKPGRKVGAPVITMKALRELGVVLFRVSMSDFSVVRQIIKEREYKHTDEVKI
                     SQTAKDDSFLERWYQEHYTEDEQFRVVMDGSFFLDIRSKQDEWIRVHVKAGDLVVLPA
                     GIYHRATLDEDDYVALYRGFQDAPRFVPVKRSDSRADSNRVRLAYLMSLKKGDVATQN
                     GFL"
     gene            <1859196..>1860863
                     /locus_tag="LMJF_34_4610"
                     /db_xref="GeneID:5655246"
     mRNA            <1859196..>1860863
                     /locus_tag="LMJF_34_4610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686516.1"
                     /db_xref="GeneID:5655246"
     CDS             1859196..1860863
                     /locus_tag="LMJF_34_4610"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686568.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.4610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.4610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655246"
                     /db_xref="UniProtKB/TrEMBL:Q4Q280"
                     /translation="MYTRDVSDRISGISAADLAQRLVEVSARNTARDGALSPSVCQRP
                     LPHCVSALLWDAKCAGAAPPRTALLRGDVVDMTSSVSDATLSCVALSDDVRFRFARSR
                     HRRLTGILSSTAAPLPPRMCRVDVTHFYWMDECAPGLTYDDQSVLSTVLQKRIVQWAV
                     SAFARNPLLRNISLQALEAVFPALLAFSPREREELLKHAAELLGQGTLIWYGQAMIKQ
                     FHESAASLALSLLTSSEERCSAALLFALATAQEVMGARRDDAAQALRFLLEVYGVRGV
                     ALSPALTTAALLVSRATVPLCTRRCLGAGSRQHHLLQPYLFPLSCAHVETLPWIPHNT
                     HTSSPEHLRELVRRAREAAAAVLATAAPCTATTAQKRHAHEDDVNAFFSANHALEIHR
                     DTLVTHASGDVPSSLPALKAADSGAAARSRLLEAAPKWWEQEAKASNSDTAREETELK
                     LHVKAAAAELREPHGSDHALLAVIHRTRKRQRNREQPTAQTVEAALEGAAIRLKRRAF
                     LQLVDIFALNAHTEDRDGKARQYLEQHHVAEAQIRDFTTLLSSTRKT"
     gene            <1862057..>1864462
                     /locus_tag="LMJF_34_4620"
                     /db_xref="GeneID:5655247"
     mRNA            <1862057..>1864462
                     /locus_tag="LMJF_34_4620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686517.1"
                     /db_xref="GeneID:5655247"
     CDS             1862057..1864462
                     /locus_tag="LMJF_34_4620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686569.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.34.4620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.34.4620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655247"
                     /db_xref="GOA:Q4Q279"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR000845"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="UniProtKB/TrEMBL:Q4Q279"
                     /translation="MSTSPSDACAIQQLMTKPTDTAVHYCAETCNLDYDTNDSETGNL
                     DEVLLCAEPLKEAQNLLPNAKSHPNSPKASMQTFLQIVPHFFTLTLEEISSLDVMVRE
                     YSEMDAIIEEGAYLEHIYVLASGTVEVMNSKKGLKRAFGHRRIGSMVAPSVFGIDDAI
                     LENAVEFTYHASSNTTLLLIPRKQFMDLFARSPIFANNVSSQILRTLPSFSVFQEFCR
                     AVFGISSSSASDAQGRRSGYSLSLPILIRLFRSSGNILHQHANRKEVDYEALRYCTRR
                     LPVNITVTYVIILTQGIPDYLSDEFLADAANSQPGATPCIAAVDTGKRRRCAWTFGGG
                     GQTLVLMRDGFTDTIDFVSNLCIFCIEAKKLRARLQHLVSPSAAEVLRNALSPVENNL
                     SAHARMEEVLASLPFSDDELQGLESVWGDETLQQIYNIMVHREEYVVHVESVSSKVFS
                     ENPYANWALTILRHIKSRLCVSELEPLPEDIIIDVLFSPNRTLKNLFCCMSAVIKALI
                     DNISEESGIGKGERAVNWKNVNDRYYYLLTGLLERNAMIRDAYRSRLQSNGFTLMEDG
                     HASALIVDLIDVSNISPDETDPGLRACAARASKKSREGKRHFIINVDKTFGAQIEAIL
                     RSLLLTFGSRIQSVNLTGKAAGLTGNRGDVVLPHKLIFSKQTFGEDSTDEIRLCNSKS
                     FSREDITPFLDKSCSAQVHHGTCITLPGFMLQSQPVLKFYKTVHGCTAVDMQSSYIAR
                     QLEECRRNGVLRQTIPCRYLFYCDDMPLGNENGSVLKPQKREIISTIYATARALLRKI
                     LES"
CONTIG      join(FR796430.1:1..1866748)
//
DBGET integrated database retrieval system