GenomeNet

Database: RefSeq
Entry: NC_007287
LinkDB: NC_007287
Original site: NC_007287 
LOCUS       NC_007287            2682151 bp    DNA     linear   CON 18-JUN-2017
DEFINITION  Leishmania major strain Friedlin complete genome, chromosome 36.
ACCESSION   NC_007287 CT005272
VERSION     NC_007287.2
DBLINK      BioProject: PRJNA15564
            BioSample: SAMEA3138173
            Assembly: GCF_000002725.2
KEYWORDS    RefSeq; complete genome.
SOURCE      Leishmania major strain Friedlin
  ORGANISM  Leishmania major strain Friedlin
            Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae;
            Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Rogers,M.B., Hilley,J.D., Dickens,N.J., Wilkes,J., Bates,P.A.,
            Depledge,D.P., Harris,D., Her,Y., Herzyk,P., Imamura,H., Otto,T.D.,
            Sanders,M., Seeger,K., Dujardin,J.C., Berriman,M., Smith,D.F.,
            Hertz-Fowler,C. and Mottram,J.C.
  TITLE     Chromosome and gene copy number variation allow major structural
            change between species and strains of Leishmania
  JOURNAL   Genome Res. 21 (12), 2129-2142 (2011)
   PUBMED   22038252
REFERENCE   2
  AUTHORS   Ivens,A.C., Peacock,C.S., Worthey,E.A., Murphy,L., Aggarwal,G.,
            Berriman,M., Sisk,E., Rajandream,M.A., Adlem,E., Aert,R.,
            Anupama,A., Apostolou,Z., Attipoe,P., Bason,N., Bauser,C., Beck,A.,
            Beverley,S.M., Bianchettin,G., Borzym,K., Bothe,G., Bruschi,C.V.,
            Collins,M., Cadag,E., Ciarloni,L., Clayton,C., Coulson,R.M.,
            Cronin,A., Cruz,A.K., Davies,R.M., De Gaudenzi,J., Dobson,D.E.,
            Duesterhoeft,A., Fazelina,G., Fosker,N., Frasch,A.C., Fraser,A.,
            Fuchs,M., Gabel,C., Goble,A., Goffeau,A., Harris,D.,
            Hertz-Fowler,C., Hilbert,H., Horn,D., Huang,Y., Klages,S.,
            Knights,A., Kube,M., Larke,N., Litvin,L., Lord,A., Louie,T.,
            Marra,M., Masuy,D., Matthews,K., Michaeli,S., Mottram,J.C.,
            Muller-Auer,S., Munden,H., Nelson,S., Norbertczak,H., Oliver,K.,
            O'neil,S., Pentony,M., Pohl,T.M., Price,C., Purnelle,B.,
            Quail,M.A., Rabbinowitsch,E., Reinhardt,R., Rieger,M., Rinta,J.,
            Robben,J., Robertson,L., Ruiz,J.C., Rutter,S., Saunders,D.,
            Schafer,M., Schein,J., Schwartz,D.C., Seeger,K., Seyler,A.,
            Sharp,S., Shin,H., Sivam,D., Squares,R., Squares,S., Tosato,V.,
            Vogt,C., Volckaert,G., Wambutt,R., Warren,T., Wedler,H.,
            Woodward,J., Zhou,S., Zimmermann,W., Smith,D.F., Blackwell,J.M.,
            Stuart,K.D., Barrell,B. and Myler,P.J.
  TITLE     The genome of the kinetoplastid parasite, Leishmania major
  JOURNAL   Science 309 (5733), 436-442 (2005)
   PUBMED   16020728
REFERENCE   3  (bases 1 to 2682151)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 2682151)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire, CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR796432.
            On Jun 1, 2012 this sequence version replaced NC_007287.1.
            Data release policy www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2682151
                     /organism="Leishmania major strain Friedlin"
                     /mol_type="genomic DNA"
                     /strain="Friedlin"
                     /db_xref="taxon:347515"
                     /chromosome="36"
     gene            complement(<4809..>7349)
                     /gene="SCG4"
                     /locus_tag="LMJF_36_0010"
                     /db_xref="GeneID:5656020"
     mRNA            complement(<4809..>7349)
                     /gene="SCG4"
                     /locus_tag="LMJF_36_0010"
                     /product="phosphoglycan beta 1,3 galactosyltransferase 4"
                     /transcript_id="XM_001686518.1"
                     /db_xref="GeneID:5656020"
     CDS             complement(4809..7349)
                     /gene="SCG4"
                     /locus_tag="LMJF_36_0010"
                     /codon_start=1
                     /product="phosphoglycan beta 1,3 galactosyltransferase 4"
                     /protein_id="XP_001686570.1"
                     /db_xref="GeneID:5656020"
                     /db_xref="GOA:Q7YXV1"
                     /db_xref="InterPro:IPR002659"
                     /db_xref="UniProtKB/TrEMBL:Q7YXV1"
                     /translation="MQPSVCLCHFAGHLHTLGTPSATPALRGKYTIMREENNVPAEWA
                     PRDTHRLDPLQLLPPSQRHCGQSSAAESGEGCHSRSRGKPEVHSTRASSGGKRSTGTL
                     PRSDDCLNAVARTPLFNSCGHPRRSAAQCLRLCTRQRRLAALAVLLALIVMVHWVISQ
                     FTTNVGLQQKSSIELLNEANREYESSSPFSVLVQHERAVERLTTAQRGLAASGAGSLA
                     RLDRDQLPSWTLRVIDEDCTMCFDNVTYASAVAADAGRSTNKTGHHKQKGLSVFATTS
                     APLGLMGPMLFAMASVTDDVDVAAELPRWQWVTWSYAQQRRFVHASQSRSTGERPRHL
                     IVLGIPSTDQPMRYPLRDAQRATWLTYREVARTENNFTGALLQLYVFAAAEHDSEDST
                     HSAVDMVQLAPTVSEYAAATEQHLAVEAGDVNNAPPYLQRRVVLRDGWRDIPRSDDAV
                     WRSPCAGVRTTVVTAASLVAGTSSLAALSAQLSLPVTPAFTAAAQYVCHVSAALWQEA
                     LHHRNSLWLDFLTDRKPTTKKKMGMSISWGIPTEVGMSQKTVLWLNYAYTAFPDVPYI
                     MKGDDDMYLKVPQYLSDLRHVRGGWQKPRNLTVTIPHRGVIPPTLAIDDAEECLYRVW
                     WTYSKKIAYGNGVGYILDRRLIQAALNPFDGFNALLMKLLTNPYDYRLEKEYLSLNMQ
                     YEDMHIGKQIRDHHDAVERFCPKKRVCYMADRRFRAHQILRPKPVKLTWISVMAHFGM
                     PAIPYYVHYFHKNEFKVAEEAKRLIAQGIDAKTIEENATQRMHEWVASQVPSTLVGLG
                     ASFHLDWVRGDPHTAYTVAEEDEVAVYDVRYKLRRRNDVACVLESGKR"
     gene            complement(<9129..>9431)
                     /locus_tag="LMJF_36_0020"
                     /db_xref="GeneID:5655254"
     mRNA            complement(<9129..>9431)
                     /locus_tag="LMJF_36_0020"
                     /product="histone H4"
                     /transcript_id="XM_001686519.1"
                     /db_xref="GeneID:5655254"
     CDS             complement(9129..9431)
                     /locus_tag="LMJF_36_0020"
                     /codon_start=1
                     /product="histone H4"
                     /protein_id="XP_001686571.1"
                     /db_xref="GeneID:5655254"
                     /db_xref="GOA:Q4Q277"
                     /db_xref="InterPro:IPR001951"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:Q4Q277"
                     /translation="MAKGKRSTDAKGSQRRQKKVLRDNIRGITRGCVRRMARRGGVKR
                     ISSEVYEEVRRVLKAYVEDIVRCSTAYTEYARKKTVTACDVVTALRKQGHILYGYA"
     gene            complement(<11415..>11873)
                     /locus_tag="LMJF_36_0030"
                     /db_xref="GeneID:5655255"
     mRNA            complement(<11415..>11873)
                     /locus_tag="LMJF_36_0030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686520.1"
                     /db_xref="GeneID:5655255"
     CDS             complement(11415..11873)
                     /locus_tag="LMJF_36_0030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686572.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655255"
                     /db_xref="UniProtKB/TrEMBL:Q4Q276"
                     /translation="MGCTASKTKTPAANVASKGADEFYALATTERHPVAEKLLEEWVL
                     FVDAQARRNAGDSSAARAYETRLKEVWADTTNRPVTHRSVDYVGKMFLEYIKEDLSHR
                     GWGGNFDYKVAGVVTQGFLKANANIDTALSDTPEEVTWEIKIHYDSLGVS"
     gene            complement(<14019..>15317)
                     /locus_tag="LMJF_36_0040"
                     /db_xref="GeneID:5655256"
     mRNA            complement(<14019..>15317)
                     /locus_tag="LMJF_36_0040"
                     /product="N-acetylglucosamine-6-phosphate deacetylase-like
                     protein"
                     /transcript_id="XM_001686521.1"
                     /db_xref="GeneID:5655256"
     CDS             complement(14019..15317)
                     /locus_tag="LMJF_36_0040"
                     /codon_start=1
                     /product="N-acetylglucosamine-6-phosphate deacetylase-like
                     protein"
                     /protein_id="XP_001686573.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655256"
                     /db_xref="GOA:Q4Q275"
                     /db_xref="InterPro:IPR011059"
                     /db_xref="UniProtKB/TrEMBL:Q4Q275"
                     /translation="MGNATIIKGNIVTTSKVLYGGCVIVVNDLIVSVCGNETVARKYL
                     VELESTHPGVGAATWYEAAFVLPGFVDIHNHGLGGASDVIGHWSNPEYSLKELARCGT
                     LTTLASVIFSDSHKKLVTECIDAIEKRVGTYTEDNCILGGIHAEGPVIHDRGGLPECK
                     SEMSLGDFKRLVDSMPSLRVMTISPHIDARCNYEKVRYLLEKKVRVALGHDRAASKSE
                     IMGALKLAASEEEKMHVTHLCNVSTFNHRASSLVNAAMCPRFPNAPLYKGARPPTLEI
                     IADLIHVDSVTLQSVLASRSVDDIAIITDCISAHIPGKHVVYNGRDSVVQAGGACYLC
                     DSFGRASSTLAGGTSMLADLFHILITLFCKDVVEACLHTATVPARIANLPDVGAITEG
                     KKANLLLFDAELHTIEKRMIHGHWTSHKPYAILHPSVVHL"
     gene            complement(<17464..>19125)
                     /gene="PUF1"
                     /locus_tag="LMJF_36_0050"
                     /db_xref="GeneID:5655257"
     mRNA            complement(<17464..>19125)
                     /gene="PUF1"
                     /locus_tag="LMJF_36_0050"
                     /product="putative PUF1"
                     /transcript_id="XM_001686522.1"
                     /db_xref="GeneID:5655257"
     CDS             complement(17464..19125)
                     /gene="PUF1"
                     /locus_tag="LMJF_36_0050"
                     /codon_start=1
                     /product="putative PUF1"
                     /protein_id="XP_001686574.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655257"
                     /db_xref="GOA:Q4Q274"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q274"
                     /translation="MSSEEKLTALYARRQEILKDLSEVDTSIKFLESEIQTKATEAAK
                     RTIDENKSGNADLDRVNEVIASCVRDATGLRDALKLVEACRYVQEFGKEDDAARQKIP
                     FRNVFAQECIRHALDLSNDANGSELMQHLVPLLRSGTRPVTMGDIFYDPTTNEHDLSE
                     VLLLIRELSSDIVTVACNTNGARVSQRIIDVLCTHEEFDVYTSVLEPSIVDVAKDING
                     NHSLSKLITSARFCQLGDSDKSASGAAAIYERIFQKIADNCIDICKNRQGCCIIQKCL
                     QHAPQPYHTTIINTVLNNSLKLVQDPFGNYVVQFILDKQQDINGAKKEDADDDAMSTA
                     PNYTNQIIRQMLHHVAELSCNKFSSNVIEKCLKTSSPDVRQLLVDELTAPHVLPKLLT
                     DSFANYVIQTAISTASDDGQLTQLRDAIIPLQSLLKNSPYGVKIESKLSRRHREAARR
                     LLKKKEAATTVTQAPPAQQEPLLPPYMPPQGMSAIPMMAPDASMGQQVSFTNLNTDMA
                     SFLQPQRMIGMPFVLQGQQMISIPNAPPPSFTTGMINGSGLPEYR"
     gene            complement(<20911..>22602)
                     /locus_tag="LMJF_36_0060"
                     /db_xref="GeneID:5655258"
     mRNA            complement(<20911..>22602)
                     /locus_tag="LMJF_36_0060"
                     /product="putative L-ribulokinase"
                     /transcript_id="XM_001686523.1"
                     /db_xref="GeneID:5655258"
     CDS             complement(20911..22602)
                     /locus_tag="LMJF_36_0060"
                     /EC_number="2.7.1.16"
                     /codon_start=1
                     /product="putative L-ribulokinase"
                     /protein_id="XP_001686575.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655258"
                     /db_xref="GOA:Q4Q273"
                     /db_xref="InterPro:IPR005929"
                     /db_xref="InterPro:IPR018484"
                     /db_xref="InterPro:IPR018485"
                     /db_xref="UniProtKB/TrEMBL:Q4Q273"
                     /translation="MIPKQMAEPLVIGLDYGSDCARAVLVRVRDGAELQSAVFSYPRW
                     AKGEYCDPKRMQYRQHPCDYMEAAEDVITTVLKAAGPAARDNVVGLAFDTTGSTPCMV
                     DETCTPLALRPSFANNPNAMFILWKDHTSVKEAAAINALAHRSTPDYTSFCGGTYSSE
                     WFWSKALHVIRSDEKVSQAAYGIVECSEWLPALFTGVTSYQKLIRSRCACGHKAMWHE
                     SWGGFPPRSFFAQLHPRLGLLRSRMSDVTETIDKPVGTLSEEWARRLGLSTRVVVAGG
                     AIDAHLGALGAGIKPYTLVRVMGTSTCDMMVIDSSILGHRRVKGICGQVDGSIVPHMI
                     GLEAGQSAYGDVFAWFSELLQYSSARIVAGTTLLDENAKAELTCEIKRKMLITLAEDA
                     SRIRPGESSVHALDWFNGRRTPDANQNLQSVIGGLTLGSDAASVYRALVEATAYGSRA
                     IVERFRREGVRIDNVIAVGGIAKKSSLVVQVLSDVLDMPITVCKSEQVCALGSAIAAA
                     TAAACYKSIPEAQKKMASGSSAAYKPCPEAARVYDELYKRYIKLAANTEQMYSHM"
     gene            complement(<23448..>24416)
                     /locus_tag="LMJF_36_0065"
                     /db_xref="GeneID:5655249"
     mRNA            complement(<23448..>24416)
                     /locus_tag="LMJF_36_0065"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686524.1"
                     /db_xref="GeneID:5655249"
     CDS             complement(23448..24416)
                     /locus_tag="LMJF_36_0065"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686576.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0065"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0065"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655249"
                     /db_xref="GOA:Q4Q272"
                     /db_xref="InterPro:IPR003034"
                     /db_xref="UniProtKB/TrEMBL:Q4Q272"
                     /translation="MDPVKRRLVYVADENEALLSELSGTPPTRQSRHTRLLVPLSPPT
                     SSQPSPHLVSPPPRPVDATAEAAPVATADKALLVSYDGFLLTDGSGRFSTPRDAAQAA
                     NIRDALKTCRSFLNGFLNVARPESESAESCSSGASSSTYMEEEDSDLEDTSSDDSPAP
                     RPRAAKAARASRPHSHTHSPSQMTVTKLKELLRNRGLSIAGNKACLVKRAQKLRAHES
                     ERASETAPLPLGASRRALQGSLRHETKLNSGVSVSSPPLSPRPSQRRSPNCHTSDDKN
                     NSIWGALVHAGSRLFRGGARASWGFHTRPAEDADDAPLSTRRRISA"
     gene            complement(<25377..>26144)
                     /locus_tag="LMJF_36_0070"
                     /db_xref="GeneID:5655250"
     mRNA            complement(<25377..>26144)
                     /locus_tag="LMJF_36_0070"
                     /product="stress-inducible protein STI1 homolog"
                     /transcript_id="XM_001686525.1"
                     /db_xref="GeneID:5655250"
     CDS             complement(25377..26144)
                     /locus_tag="LMJF_36_0070"
                     /codon_start=1
                     /product="stress-inducible protein STI1 homolog"
                     /protein_id="XP_001686577.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655250"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q4Q271"
                     /translation="MEDYKAKGNDAFKAKRYQEAIDWYTKAIELDPNGEASGALYSNR
                     AGSWQNLNNFEKAAADSEQCIRLRPDWLKGYFRLGVAMESMVKYDEAQKAFQKALQLS
                     PGNEEVMDKLHAINTKVRERNEKTKSQQCKTPEEAKQLGNSFFKDGKYDQAAEFYTRA
                     IELQTEPVKEKAVYYTNRAACHQQTHMYSLMVDDCNAAIEIDPANVKAYLRRGIAYEG
                     MEKWKLALEDYTKAQSISPGVAGASQGILRCQRVLRS"
     gene            complement(<28924..>29814)
                     /locus_tag="LMJF_36_0080"
                     /db_xref="GeneID:5655251"
     mRNA            complement(<28924..>29814)
                     /locus_tag="LMJF_36_0080"
                     /product="putative leucine carboxyl methyltransferase"
                     /transcript_id="XM_001686526.1"
                     /db_xref="GeneID:5655251"
     CDS             complement(28924..29814)
                     /locus_tag="LMJF_36_0080"
                     /codon_start=1
                     /product="putative leucine carboxyl methyltransferase"
                     /protein_id="XP_001686578.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655251"
                     /db_xref="GOA:Q4Q270"
                     /db_xref="InterPro:IPR007213"
                     /db_xref="InterPro:IPR016651"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4Q270"
                     /translation="MALIQTAHDACSRKVHCVRKGYLNDPFVSFFEKDHTIVNSPLMN
                     RGTWLRTTAFENCVRGFATAAGQPIQVINFGAGMDTLYFRLKHSDPQFPVQKFMELDL
                     ADLVAEKERIIKRHSEMHSLVGSQYVLVSCDLYDAKGVAKALKEHLHGGTPTIMIAEM
                     VFVYIEGSVTTNLLRTVMSDVIEPGTKTMLVTYDAIQPFDRFGKVMVENLQHFGADFK
                     GIGDFPTPEAHAGRCSELGFKAVKSVTMKNLYLGVPRQIQIRLNKLEMIDDWEEWNLM
                     HEHYCFVVASTEDAPLPKLF"
     gene            complement(<30598..>33765)
                     /locus_tag="LMJF_36_0090"
                     /db_xref="GeneID:5655252"
     mRNA            complement(<30598..>33765)
                     /locus_tag="LMJF_36_0090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686527.1"
                     /db_xref="GeneID:5655252"
     CDS             complement(30598..33765)
                     /locus_tag="LMJF_36_0090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686579.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655252"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q269"
                     /translation="MVHVAMSSHIEQAATCLRCGNHNGAAAALRELEVGEGVRTLQTA
                     MQCLMNENGESDDVYVRFVAFKVLAYALTRCRHGRRQQSDTVITFLLGYAYQMAAEVE
                     TPAWTPVVSELATATAVALKLGCVGDNLDACVEEVTAVCSGLVDLAQTCTPSPKAYLH
                     RIICQSAVEEFGLFSGPSRYRGLPMRVHRRCRKLFAEEGRLPTLIQALLRGLLLSAGE
                     SSMSVDKGLTVLVSCLAWPSHQFFEEDSSTEESCGVFYVAHEEWDRLLVGDVGLESGA
                     CVTVHGVLREWYESGAVNGVPANRQKVIEIIQLLCSFKGSEWTEGQTLRFLVSSLSLC
                     LDVFAHLSRWATKDDFHLFPLLANAILRLVSNYVEFFFHPQAHTLVSRLTALTDFLIR
                     RDTSSNTDTDVMSCVDEMLSVWFHLTSYIERSSFSGNGFETIAQRHLISQGCQSIFST
                     YLDTKVNTDAAELELDCFADTFTNSHLHLVAQVGRLCASDTCELLIRYLRSLRSTLAS
                     TLGAGGTAPTPLFEALWTLLKIVGLFIADPLEGEQSYIPRCFLEMGSQGSALLLHVVK
                     ELDALLPLLQNPAAASPAVLAAFLDVFTQYITTYVEAEESCTLYADAFSGGADMVAQS
                     LLAVVGALRLTPFEEESTSAACRLLDCLADKSSRVRSFCHRQDAFQALTRAVQDIHQF
                     RFYGHTRGRLIAFVISCCSDADSVQAQLHEFALSPSSEDDVNLVLELLSSLAGLFESL
                     HSQQVIRCVFPALLTTGQRLIGVSASKFYEREIVIESVQCVRSMFVTCSPLLEDSDTR
                     MLLDLVVAELRYAVTALQSSSAWTSADGEGDKAEFIIATARLLSSLAQWKALDCFLSD
                     DDTRAVSIATVEAAGALLRHMDERSLSLPSLEDGIFTCMELCAESFTADFVFASCSDA
                     FLSAMLYALNSERANIQRAGISVTASVAAFLEAATPPASHASACCDLLRVVLRSLTSG
                     KVFNNLRQISRVLLLLVRGVPYDSVVATVEAAVREVANCDAFVAAIFPALQSAAGSAN
                     ATESGFEELLQDALSSLHGTTIMGA"
     gene            complement(<34482..>36341)
                     /locus_tag="LMJF_36_0100"
                     /db_xref="GeneID:5655253"
     mRNA            complement(<34482..>36341)
                     /locus_tag="LMJF_36_0100"
                     /product="putative DNA damage repair protein"
                     /transcript_id="XM_001686528.1"
                     /db_xref="GeneID:5655253"
     CDS             complement(34482..36341)
                     /locus_tag="LMJF_36_0100"
                     /codon_start=1
                     /product="putative DNA damage repair protein"
                     /protein_id="XP_001686580.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655253"
                     /db_xref="GOA:Q4Q268"
                     /db_xref="InterPro:IPR001126"
                     /db_xref="InterPro:IPR017961"
                     /db_xref="InterPro:IPR017963"
                     /db_xref="UniProtKB/TrEMBL:Q4Q268"
                     /translation="MTAMSRSVRDQVNSLQHFQQHSRLYFIGQWRTKMEDVFREWFVA
                     HPEWNHGTLEQQRTFVHIDMDAFFCSVQLAKPEYAHLKTKPVGIAAGKYNSDISSCNY
                     VARSYGIHAGMYVNSAKERCPELVTLGYDLEACERVAKTLYQIIFDLFPTGVKMSMEV
                     YSIDEVMLAADTTDYALLQPFCETVRRELFSATGCTASCGIGPNIMLARVATDRGKPN
                     GICVVHAKDVAQTMTSLPLKYIHGAGASTMEKICRALREQGILDERTDAGGVTCGSVQ
                     KLKREALQRILGKRQGETFYHLVRGEDGRVVTRTGDPEDQRHLGKRIPNAVGCSMNYA
                     VRPEGVDDVWKIVRQLLEDVCTKLRRTDAVAQGLRVTLLERHPLHPKETQKYMGRGKC
                     VEVHLPIKLPHAMAADEVEAMELEIRKAVAPLLVASRAISDAERAAQLGLSPNEMDLV
                     IWTVAIASLRDIVVEDLRGMTVQATGLRQKQQAPFTRQRLSGQQMTLATGFFNAKRPR
                     TQDVVTVVEPTPAQPPSDTVRGPPADSCLDAATLYLLYAQPWPHRDDATAAQWRCGCE
                     SACRQLDYPAVKAYLRCALAKLSEWPEPQEAAGTFQQLLSFANTRLPAPLDFL"
     gene            complement(<37511..>40327)
                     /locus_tag="LMJF_36_0110"
                     /db_xref="GeneID:5655259"
     mRNA            complement(<37511..>40327)
                     /locus_tag="LMJF_36_0110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686529.1"
                     /db_xref="GeneID:5655259"
     CDS             complement(37511..40327)
                     /locus_tag="LMJF_36_0110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686581.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655259"
                     /db_xref="UniProtKB/TrEMBL:Q4Q267"
                     /translation="MPSRLMLPLPSLPLFSSSLYARHMCICVRVRVHGSGGEEELLSA
                     TTETHTPSLHYTRLAVSRVALPLLTLSVSLFFASAGRSCKGEDCPMSAYQVARPTDGA
                     LRTALKAVLTTSPPPTLVPHPPSKNVAWRPRRIVEELKALRCVEALSSFEAELRGLVG
                     LQEIRCRTKLVNHAYRDECALREVEHLLAAEAAQRRDVTEKFFDIVRAPFEVLHLHLR
                     EELTRRSLRCEERSIWRALQLRASGSRLGLAEADNRATLGALEECSREELKNRRLIEL
                     GDNLQREIVVQRRLAGHLRCVDHSKGAQRARQRLEWQEEMGRATLERLYSLHLILLLQ
                     DVKVDFSEAVKRDVVLLSEASRATTQQVRVADCEERVLACLEQERRLRLTLEEQEHTG
                     SKAVTQAFLLGWRGVYRQITKDSDVTSVFGKIELLVRRDIADQRRSELSSLLLACQAQ
                     TRVLKRHQAERRALCQQYIDGARFISGEENREANQLFCDHHVWQCQQAALHRATVLAV
                     EEVASSRAIRGAEAQARLACKLEYLAEKLQLQCEEGRQRVAEEEERCLGALRERYVHI
                     FFIQGAVRLFDSERAERMLIEVEESAAAVDTLLPLRQALTHSLVSDAYRPLSGLEDEF
                     RARVTVEETRERCGLVRQHVLLSEAAHRIGLFELEHNFWIRPITAQVSAMEADARRRL
                     CSSAEAEMLLVRRCVLEDWEWEKRKSIHKCEMLVRESLALTNRLPALPSLSRLTDATD
                     MWGALEADWGDAASDVATWSANWLLHDPPSLTCYSTLRCEDVLVEAYLERDLIHFMEH
                     REWLQVLQHKTTTNSSAESSAVDQTYWKLHSLSMRLEPQQRAAFINVWHSNQSFDVSF
                     PLTQQPDEAIVGERTISFYAPDAGTTAALMQRDTDAGMVFFLILDDEGTVLACATMVV
                     EVAPKCSAHLCIPLDSNRGFVRLV"
     gene            complement(<40903..>41874)
                     /locus_tag="LMJF_36_0120"
                     /db_xref="GeneID:5655260"
     mRNA            complement(<40903..>41874)
                     /locus_tag="LMJF_36_0120"
                     /product="putative mRNA capping methyltransferase"
                     /transcript_id="XM_001686530.1"
                     /db_xref="GeneID:5655260"
     CDS             complement(40903..41874)
                     /locus_tag="LMJF_36_0120"
                     /codon_start=1
                     /product="putative mRNA capping methyltransferase"
                     /protein_id="XP_001686582.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655260"
                     /db_xref="GOA:Q4Q266"
                     /db_xref="InterPro:IPR004971"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4Q266"
                     /translation="MSQNQAAAAYDDVTRKRKDDWSSQQVAFRHFNNFVKKALIQFSL
                     DCVLANRAASPSEGAAVLDLASGRGGDIGKWFFMQSPPQSNLRAPSAALHTSVYDCYD
                     VSRECINEAERRCKEMIAAMKRPPQCGASFTVADCFTESFLRGTLPCSPHFGRYSVVS
                     IQFAFHYACKSLDLIRDVFSAVSDALAPGGVVLITTVDIAMLSKRAAEGTLGNELYSI
                     FFPHPPEYAAASNGNALLVTGTEYHFRLDGFVDCTEYVVPHDAVVRIASEARLRLCER
                     MSKPFSEFVPEYSANWKANKGNKLSQAELELVTLYRALCFVKEKVSL"
     gene            complement(<42761..>43864)
                     /locus_tag="LMJF_36_0130"
                     /db_xref="GeneID:5655261"
     mRNA            complement(<42761..>43864)
                     /locus_tag="LMJF_36_0130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686531.1"
                     /db_xref="GeneID:5655261"
     CDS             complement(42761..43864)
                     /locus_tag="LMJF_36_0130"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686583.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655261"
                     /db_xref="InterPro:IPR018997"
                     /db_xref="UniProtKB/TrEMBL:Q4Q265"
                     /translation="MSSEGKETEPPQAGEPSAAVKLPSENSSSSEDTDSDTYTISQVL
                     FDSLTGRGFSENAIKKSIVAGCIDEGTCTQWIQMHEGHPELDTALEDGVEVIIKAKRV
                     LTEAEREAKVRELQERVRRNKEEEKLELQRKERERVEVGRKMLRMKSEMEELRRKMNA
                     EEARRENAAELEARRRIKIQIAADRLERRGHTRDEALALAEKEYEEAAAKARAEAAAK
                     LETLQRTQAPVQTATSSSDGAWNLSAITAPSSAQSTLVSLFAGEAPTCAQPLVDNIHK
                     RAPAEQTGECVRTLRLILGNIVSDPFDTKKRTLRISTKAFRDSILPVDEAVRLLRWCG
                     FALSTDAANNQTLCLSTVVVRRLHQVLGLLGSE"
     gene            complement(<44682..>46634)
                     /locus_tag="LMJF_36_0140"
                     /db_xref="GeneID:5655262"
     mRNA            complement(<44682..>46634)
                     /locus_tag="LMJF_36_0140"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686532.1"
                     /db_xref="GeneID:5655262"
     CDS             complement(44682..46634)
                     /locus_tag="LMJF_36_0140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686584.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655262"
                     /db_xref="GOA:Q4Q264"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q264"
                     /translation="MLKQLKETVVSAISSSPLNAYELDTSGTTLCGRSDLFEKCDAVV
                     RANGKKVSIFTLCIKRVLQRCTASEALALIKVVKESVALLTHMRHPGILSIEGPLVED
                     KKKIWFVAERVSMVLAPETVQGLPLQVKLLGLCHCAEAIRFLHEKAELLLFNFALSSI
                     YVTEDNQWKVGDLCFAVPRAQLSAPSPPPFPFHSVAAPLLDYLPTEYVEFCTEKAADA
                     VNRDLFSVGAAPLVYPDSDTYGFLVVTVEVLQGKRLFNCGGNPQEQQRQLSAAEGHIS
                     RYFPAGALRLPRPPISTVVITGPFATPDMKTLTGLFFFGILDSDTRFRLLKALYDGLT
                     KGDFCEAVILSDIVPLMVQESKADAMLRFVLPILLLCANTLSAGSFDRALREYFVSLL
                     TAIIRAPSLQPAAVYAEQVLQKREGIHKHFASVKDTATLIVPLILKLMSSEGNERLLK
                     GSLEWFRDVLTQTPTIKLGLPKDIAARLLNVASSNADFFALAFQCLEKILTFSATETN
                     MEVEVNLTRNIANTSISFTSVQLDYMLGLLRGIQEKMTPEHRAVKSIPLLCPLLLHAN
                     GTVRQFAVASIVRYAQLLGSSSAPATVPPPPPPPPSSGGSFSPSAANSGAPAAPDGSW
                     TQPALFPSATPPPARASDDVFASLFP"
     gene            complement(<48882..>50339)
                     /locus_tag="LMJF_36_0150"
                     /db_xref="GeneID:5655263"
     mRNA            complement(<48882..>50339)
                     /locus_tag="LMJF_36_0150"
                     /product="fructose-6-phosphate2-kinase/fructose-2,6-bisph
                     os phatase-likeprotein"
                     /transcript_id="XM_001686533.1"
                     /db_xref="GeneID:5655263"
     CDS             complement(48882..50339)
                     /locus_tag="LMJF_36_0150"
                     /EC_number="2.7.1.105"
                     /codon_start=1
                     /product="fructose-6-phosphate2-kinase/fructose-2,6-bisph
                     os phatase-likeprotein"
                     /protein_id="XP_001686585.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655263"
                     /db_xref="GOA:Q4Q263"
                     /db_xref="InterPro:IPR003094"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:Q4Q263"
                     /translation="MVLVHLRASNVYDVGGMNEANTIDFKHMVGVEYHTQREVVRSPP
                     SLTDTKVNHVAMVSMGLYRFSNATSPVVIFVSSEERCSMPARFFCTRFVHYFRWIGES
                     VQLFVASKSFQDHRPTPYATQRDTWLQENRRCVSAALDYFDSNPKLGFVATPVAVIFT
                     DCDCADARAALVSLLPPERSFLIRHVRFAEEWESHKHNSYRFIDVSLQRQALRASRSS
                     GSVVCSSLTSFLNSMLPTLYQLYSAEPLEGAPGETLKSFPPIFFTRHGQSEYNVEDRL
                     GGDPDLTETGRIDAEDIAHFFERQVKTNVNLFDHRTTVWEEDGDFEVWCSQLRRTQRT
                     AQPTADILSHGVLKPFKSLNEIHAGICEDMTNEEVKSLYPFIQRFRHTDKVGFRYPDG
                     ESYVDLVRRLTPLLNDLNNCTKCVVVVAHQAVLRTMLSFFGGRPVEEAVHVPCPQRTI
                     WACTMNRLGEPQLAEIALSPRQSQDKRPDVHWQGW"
     gene            complement(<50883..>51740)
                     /locus_tag="LMJF_36_0160"
                     /db_xref="GeneID:5655264"
     mRNA            complement(<50883..>51740)
                     /locus_tag="LMJF_36_0160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686534.1"
                     /db_xref="GeneID:5655264"
     CDS             complement(50883..51740)
                     /locus_tag="LMJF_36_0160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686586.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655264"
                     /db_xref="UniProtKB/TrEMBL:Q4Q262"
                     /translation="MQQLQVSACVLLLALLCVTTVRSSGNLQLGTWDVSTLVPGRGAV
                     PPNYELTVQPGKWTVKERDTGRVGRLFDYAAARIGLVYAGVPSDEHALCRMPPSLILK
                     LAAVRTDDGVRLECQTVWFSPSMLRSFENDGLLHRRFDPAEPLYSADSGRCLATPWRV
                     RELYVAKLGDGLLLLTGVLVGGASGTQESCSVHLEVRYRPIASGKESSSSSSLFSIAM
                     LLMVVAVRLLPRYILTRKGQLDKTSYRGRNPTSLTPTQRLHLLRQQKEVIEKMKAEDS
                     ANAAKRTAV"
     gene            complement(<53654..>54310)
                     /locus_tag="LMJF_36_0170"
                     /db_xref="GeneID:5655265"
     mRNA            complement(<53654..>54310)
                     /locus_tag="LMJF_36_0170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686535.1"
                     /db_xref="GeneID:5655265"
     CDS             complement(53654..54310)
                     /locus_tag="LMJF_36_0170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686587.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655265"
                     /db_xref="UniProtKB/TrEMBL:Q4Q261"
                     /translation="MSCSSPALARVSFFCSWSLFIAPSPGAEIAARLAGRGGVEIFLR
                     AALSAFAYPNRAEAHERVEMDGTSHFTRIKDTPETLNPITGRSIYYGMRPWRCDDRFQ
                     DWLKSFTCFDSVSVQYNLLKLFVQCARSEEGQEPIDNYHRLGRAEVMYYVERYRSGMM
                     RTGVLETYPYDQNELRRIAEEDGLKMRVWRHQRELEMEAKEGKIDEVMHMNVMRRGKP
                     "
     gene            complement(<54717..>57254)
                     /gene="EF2-1"
                     /locus_tag="LMJF_36_0180"
                     /db_xref="GeneID:5655266"
     mRNA            complement(<54717..>57254)
                     /gene="EF2-1"
                     /locus_tag="LMJF_36_0180"
                     /product="elongation factor 2"
                     /transcript_id="XM_001686536.1"
                     /db_xref="GeneID:5655266"
     CDS             complement(54717..57254)
                     /gene="EF2-1"
                     /locus_tag="LMJF_36_0180"
                     /codon_start=1
                     /product="elongation factor 2"
                     /protein_id="XP_001686588.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0180"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655266"
                     /db_xref="GOA:Q4Q259"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR005517"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q259"
                     /translation="MVNFTVDQVRELMDYPDQIRNMSVIAHVDHGKSTLSDSLVGAAG
                     IIKMEEAGDKRIMDTRADEIARGITIKSTAISMHYHVPKEMIGDLDDDKRDFLINLID
                     SPGHVDFSSEVTAALRVTDGALVVVDCVEGVCVQTETVLRQALTERIRPVVFINKVDR
                     AILELQLDPEEAYQGFVKTLQNVNVVVATYNDPSMGDVQVSPEKGTVAIGSGLQAWAF
                     SLTRFANMYAAKFGVDELKMRERLWGDNFFDAKNKKWIKQETNADGERVRRAFCQFCL
                     DPIYQIFDAVMNEKKDKVDKMLKSLHVTLTAEEREQVPKKLLKTVMMKFLPAAETLLQ
                     MIVAHLPSPKKAQAYRAEMLYSGEASPEDKYFMGIKNCDPAAPLMLYISKMVPTADRG
                     RFFAFGRIFSGKVRSGQKVRIMGNNYVYGKKQDLYEDKPVQRSVLMMGRYQEAVEDMP
                     CGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVVRVAVEAKNPSDLPKLVE
                     GLKRLAKSDPLVVCSIEESGEHIVAGAGELHLEICLKDLQEDFMNGAPLKISEPVVSF
                     RETVTDVSSQQCLSKSANKHNRLFCRGAPLTEELALAMEEGTAGPEADPKVRARFLAD
                     NYEWDVQEARKIWCYGPDNRGPNVVVDVTKGVQNMAEMKDSFVAAWQWATREGVLCDE
                     NMRGVRVNVEDVTMHADAIHRGGGQIIPTARRVFYACCLTASPRLMEPMFVVDIQTVE
                     HAMGGIYGVLTRRRGVIIGEENRPGTPIYNVRAYLPVAESFGFTADLRAGTGGQAFPQ
                     CVFDHWQEYPGDPLEPKSLANTTTLGIRTRKGLKPDIPGLDQFMDKL"
     gene            complement(<58232..>60769)
                     /gene="EF2-2"
                     /locus_tag="LMJF_36_0190"
                     /db_xref="GeneID:5655267"
     mRNA            complement(<58232..>60769)
                     /gene="EF2-2"
                     /locus_tag="LMJF_36_0190"
                     /product="elongation factor 2"
                     /transcript_id="XM_001686537.1"
                     /db_xref="GeneID:5655267"
     CDS             complement(58232..60769)
                     /gene="EF2-2"
                     /locus_tag="LMJF_36_0190"
                     /codon_start=1
                     /product="elongation factor 2"
                     /protein_id="XP_001686589.1"
                     /db_xref="GeneID:5655267"
                     /db_xref="GOA:Q4Q259"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR005517"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q259"
                     /translation="MVNFTVDQVRELMDYPDQIRNMSVIAHVDHGKSTLSDSLVGAAG
                     IIKMEEAGDKRIMDTRADEIARGITIKSTAISMHYHVPKEMIGDLDDDKRDFLINLID
                     SPGHVDFSSEVTAALRVTDGALVVVDCVEGVCVQTETVLRQALTERIRPVVFINKVDR
                     AILELQLDPEEAYQGFVKTLQNVNVVVATYNDPSMGDVQVSPEKGTVAIGSGLQAWAF
                     SLTRFANMYAAKFGVDELKMRERLWGDNFFDAKNKKWIKQETNADGERVRRAFCQFCL
                     DPIYQIFDAVMNEKKDKVDKMLKSLHVTLTAEEREQVPKKLLKTVMMKFLPAAETLLQ
                     MIVAHLPSPKKAQAYRAEMLYSGEASPEDKYFMGIKNCDPAAPLMLYISKMVPTADRG
                     RFFAFGRIFSGKVRSGQKVRIMGNNYVYGKKQDLYEDKPVQRSVLMMGRYQEAVEDMP
                     CGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVVRVAVEAKNPSDLPKLVE
                     GLKRLAKSDPLVVCSIEESGEHIVAGAGELHLEICLKDLQEDFMNGAPLKISEPVVSF
                     RETVTDVSSQQCLSKSANKHNRLFCRGAPLTEELALAMEEGTAGPEADPKVRARFLAD
                     NYEWDVQEARKIWCYGPDNRGPNVVVDVTKGVQNMAEMKDSFVAAWQWATREGVLCDE
                     NMRGVRVNVEDVTMHADAIHRGGGQIIPTARRVFYACCLTASPRLMEPMFVVDIQTVE
                     HAMGGIYGVLTRRRGVIIGEENRPGTPIYNVRAYLPVAESFGFTADLRAGTGGQAFPQ
                     CVFDHWQEYPGDPLEPKSLANTTTLGIRTRKGLKPDIPGLDQFMDKL"
     gene            complement(<61341..>62018)
                     /locus_tag="LMJF_36_0200"
                     /db_xref="GeneID:5655268"
     mRNA            complement(<61341..>62018)
                     /locus_tag="LMJF_36_0200"
                     /product="putative serine peptidase clan SF, family S26B"
                     /transcript_id="XM_001686538.1"
                     /db_xref="GeneID:5655268"
     CDS             complement(61341..62018)
                     /locus_tag="LMJF_36_0200"
                     /codon_start=1
                     /product="putative serine peptidase clan SF, family S26B"
                     /protein_id="XP_001686590.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655268"
                     /db_xref="GOA:Q4Q258"
                     /db_xref="InterPro:IPR000223"
                     /db_xref="InterPro:IPR015927"
                     /db_xref="InterPro:IPR019756"
                     /db_xref="InterPro:IPR019759"
                     /db_xref="InterPro:IPR026730"
                     /db_xref="InterPro:IPR028360"
                     /db_xref="UniProtKB/TrEMBL:Q4Q258"
                     /translation="MPWRQWWSAIRCSQYGDVPFVLLGVFIGWNSDVSCAVKGVSMVP
                     TLHPGEYIVFVPYTMLQVRRWFNAPLVNLSDVVVVKVSDDLSVCKRVVKCTSSRTQAE
                     EWGKEHYVEVMPALYSPPAAQHTNGDDEDSTEIDSVANSERAYFDYVARNTVRSKDWD
                     SCIDRIPNPSQWVWLEGDNKSESFDSRRCGPVPIECIRGLVLASIWPSPHTLQRPPPP
                     PRASQLH"
     gene            complement(<64829..>66250)
                     /locus_tag="LMJF_36_0210"
                     /db_xref="GeneID:5655269"
     mRNA            complement(<64829..>66250)
                     /locus_tag="LMJF_36_0210"
                     /product="putative SET domain protein"
                     /transcript_id="XM_001686539.1"
                     /db_xref="GeneID:5655269"
     CDS             complement(64829..66250)
                     /locus_tag="LMJF_36_0210"
                     /codon_start=1
                     /product="putative SET domain protein"
                     /protein_id="XP_001686591.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655269"
                     /db_xref="GOA:Q4Q257"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR003616"
                     /db_xref="UniProtKB/TrEMBL:Q4Q257"
                     /translation="MSISQRVAVVHDAATTPEQLAAFQRECPNSCDFFPVKDAAQLQC
                     VVQHIHAASPSVYGAVANLYTDRSGDANGGVTSALATLFFQHASLSYTGCRAATLSYP
                     FDVLLMMLFYAGVPLPPFALVDSVEAARRAAHRLKAPVQIRNTCGLLGLCRNCCTVQD
                     AMEETLISAFHEHGKIVAWEVNASKAHAVRVLVAGGSVKGAAAAIPVESCAAAPLWAA
                     DAEEAAQRFGAAVSRYVLYDCGVASLTLNTLKENPGKWCFEDLVLNPALPHLVLQEAA
                     PNLLSGAPTAAELVASLLEEARKLHPTPTFELKLHEDTRKGYHLCATKALRKGDVVFE
                     DECRSFAVVTRPHVERHWDGPLKKTFTEYAWPLDSEGHVYAIWEEDPQRWRPINHSCD
                     PNCIFAAPHSLNVIAARDIAAGEDLSMDYATFCDGTMKPFECLCGAACCRGVISADAC
                     SLAKYGGHSWLRRVPSAVKPLLP"
     gene            complement(<67853..>68641)
                     /gene="DPMS"
                     /locus_tag="LMJF_36_0220"
                     /db_xref="GeneID:5655270"
     mRNA            complement(<67853..>68641)
                     /gene="DPMS"
                     /locus_tag="LMJF_36_0220"
                     /product="dolicholphosphate-mannose synthase"
                     /transcript_id="XM_001686540.1"
                     /db_xref="GeneID:5655270"
     CDS             complement(67853..68641)
                     /gene="DPMS"
                     /locus_tag="LMJF_36_0220"
                     /EC_number="2.4.1.83"
                     /codon_start=1
                     /product="dolicholphosphate-mannose synthase"
                     /protein_id="XP_001686592.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655270"
                     /db_xref="GOA:Q4Q256"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q4Q256"
                     /translation="MQYSIIVPAYKECGNLEPLIRRVFAAVTEQGFPTQNVEMLIVDD
                     NSRDGSKEVVDRLHEEGFNVHMDVRTTERGLSSAVIHGLRHTSGAYKLVMDADLQHPP
                     ECVPALFKALGRDGVEFVCGTRYGVGIEVDKNWPAHRRLISWGARLLARPLTTLSDPM
                     SGFFAIRDGVFKRHAGEVNSIGYKIALELFVKCRVQCFEEVGFNFATRTYGESKLTGK
                     VILHYLEHLYALYLFKLGRLFYVFVVVAVLFAIYLLAFLYHSLF"
     gene            complement(<70055..>70384)
                     /locus_tag="LMJF_36_0230"
                     /db_xref="GeneID:5655271"
     mRNA            complement(<70055..>70384)
                     /locus_tag="LMJF_36_0230"
                     /product="putative peptidyl-prolyl cis-trans isomerase"
                     /transcript_id="XM_001686541.1"
                     /db_xref="GeneID:5655271"
     CDS             complement(70055..70384)
                     /locus_tag="LMJF_36_0230"
                     /EC_number="5.2.1.8"
                     /codon_start=1
                     /product="putative peptidyl-prolyl cis-trans isomerase"
                     /protein_id="XP_001686593.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655271"
                     /db_xref="GOA:Q4Q255"
                     /db_xref="InterPro:IPR001179"
                     /db_xref="InterPro:IPR023566"
                     /db_xref="UniProtKB/TrEMBL:Q4Q255"
                     /translation="MGVIRTVMKAGSGATPKPGQTITVHCTGYLADGKKKFWSTHDDK
                     NPFTFNVGVGQVIRGWDEGMMQMQLGETAELLMTADYAYGDRGFPAWNIPSNAALLFE
                     IELLKIQ"
     gene            complement(<71351..>72025)
                     /locus_tag="LMJF_36_0240"
                     /db_xref="GeneID:5655272"
     mRNA            complement(<71351..>72025)
                     /locus_tag="LMJF_36_0240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686542.1"
                     /db_xref="GeneID:5655272"
     CDS             complement(71351..72025)
                     /locus_tag="LMJF_36_0240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686594.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655272"
                     /db_xref="InterPro:IPR021622"
                     /db_xref="UniProtKB/TrEMBL:Q4Q254"
                     /translation="MLFDGDDDNLPEVPTIRSNTLMPLTTSDAQAQRLQQLEAEYRAS
                     RAETAAFRPRAAHRCSSSRPVSPPEPVKAASHVWEERDEAAFYELHSLVPHLSPQFAC
                     SYSDAVLLIAAIQSGGAASGNRHTLADKCQSLEADRRQLEQRLEKFRVQCEELKREVA
                     EVKQKLRVVQEESRNSVNALAQRREEMRKQLLLEETRAEKLMVRNKKLEQENDSLKGR
                     VREQFR"
     gene            complement(<73427..>75328)
                     /locus_tag="LMJF_36_0250"
                     /db_xref="GeneID:5655273"
     mRNA            complement(<73427..>75328)
                     /locus_tag="LMJF_36_0250"
                     /product="EIF3-interacting protein-like protein"
                     /transcript_id="XM_001686543.1"
                     /db_xref="GeneID:5655273"
     CDS             complement(73427..75328)
                     /locus_tag="LMJF_36_0250"
                     /codon_start=1
                     /product="EIF3-interacting protein-like protein"
                     /protein_id="XP_001686595.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655273"
                     /db_xref="GOA:Q4Q253"
                     /db_xref="InterPro:IPR019382"
                     /db_xref="UniProtKB/TrEMBL:Q4Q253"
                     /translation="MGLYQHHRCPPPQLLPPQKHGCAVIHSYPPYTPSFPVYQVCLCV
                     HLLLVIVSDCAIFIFLLASESSLSRPLSSPKTRTTQRTLTHVFAKMATNPDIETDIPR
                     DVYQFFRGLNRAVERRDAAAMHDLYESQFDALTKNYYMAGHGQFRSWPALRLEQVSSC
                     FRGNHMAELVYSFLFYKHLFMDNRSVRAPDAEGAWKTYSELLPMLKSYELPNWMLWDI
                     FDEFLYQMTVVYQKVFVTEGIWAVPEVSRLLNEVIDNSRLLELVKQPDFLEDIHRGPN
                     TGALSGFYAIVTKSKLNVLLGDYYSALTDLEPLDVYNKGRAVLTRVSPCAVSVFYHIG
                     FSYLMIHRFEDASNAFRRCVTVKLNGRRFSERVQQDAAYMYVCARVLGGMPINNLTSY
                     LDSRKVAAFEDDRESLRTGDEERFRDVFDRCSPKFLTVPPSDGSPVKGSEGRELQARM
                     FRRAVQQQQDIIKLRGYFKVYQNTKMNLLETLLEVDDGYAPLFALKMRSRQLVHDGVT
                     ADLLQGVFTSSSEFDCIVQDDNVEVVPSMTFGGIEQKLLNKIKNTQRDIEVAKRKFNQ
                     TRNRDEGGNKRKDQRDQKRRPNQQQLHGGVGNNAGSANRSSNNVNRHPRQKMAAQPMT
                     SNLFNRNDN"
     gene            complement(<78299..>79762)
                     /locus_tag="LMJF_36_0260"
                     /db_xref="GeneID:5655274"
     mRNA            complement(<78299..>79762)
                     /locus_tag="LMJF_36_0260"
                     /product="putative xylulokinase"
                     /transcript_id="XM_001686544.1"
                     /db_xref="GeneID:5655274"
     CDS             complement(78299..79762)
                     /locus_tag="LMJF_36_0260"
                     /EC_number="2.7.1.17"
                     /codon_start=1
                     /product="putative xylulokinase"
                     /protein_id="XP_001686596.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655274"
                     /db_xref="GOA:Q4Q252"
                     /db_xref="InterPro:IPR006000"
                     /db_xref="InterPro:IPR018483"
                     /db_xref="InterPro:IPR018484"
                     /db_xref="InterPro:IPR018485"
                     /db_xref="UniProtKB/TrEMBL:Q4Q252"
                     /translation="MYAGIDIGTSGIKIALMRSDGQIADSASAPLTVSSPHPLWNEQD
                     PDSWWMAINSAMNVLKKRQDMSSVRAIGLSGQMHGATLLDKNHKVLRPCILWCDGRCY
                     RECEELEKAVPKSREITGNLMMPGFTAGKLLWVKKHEPEIFAKVNKVLLPKDYVRFLM
                     TGDFASEMSDSSGSMWMDTGKRDWNDDILRATGLSRANMPKLYEGSEITGKLSADVAK
                     RWNMNCVPVVGGGGDNEAGAVGAGLFKPGQAMLSLGTSGVYFVVSDGFHYNTKEAVHS
                     FCHALPERWHLMSVILSCAVCLEWAAKLTRCRSVDEFVGEAMTAKNFDERPLYFLPHL
                     AGERTPHNNPNAKGVFFGLTSHHSRPELARAVLEGVSFAMSQGMDAVHRCGVEPSNIA
                     LIGGGSRSRFWRQMLADVSGYPMDYCIGSEVGPALGACRLAQIAVEKRPLEELLPCLP
                     LKETHMPDMKKHEQYKKRRVIYDELYKQLKPIMNAKL"
     gene            complement(<80648..>83101)
                     /locus_tag="LMJF_36_0270"
                     /db_xref="GeneID:5655275"
     mRNA            complement(<80648..>83101)
                     /locus_tag="LMJF_36_0270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686545.1"
                     /db_xref="GeneID:5655275"
     CDS             complement(80648..83101)
                     /locus_tag="LMJF_36_0270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686597.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655275"
                     /db_xref="UniProtKB/TrEMBL:Q4Q251"
                     /translation="MVHARQCDTMADIYAVAQNLIEELRTNLAELRRSPDVQARLQRT
                     AARKIGAERARCHSHYPGFQSTAEKPRLCFLPLTTAPTTHVAFSHDFCRSEEAAIEPD
                     GNGALTTVTATPCTRSCSRSTVTKATPSSGTSLLSGNTTGVALTTRPQILASQSVKAV
                     KGQNSPAREPAGHVKHVAAAGEPRAGDGTTAANAASSEAHTDSATTAWCMPFSGVSRP
                     LVDLRRLTPLARQLYTDMQRRAAAMPAASPSAEWRRRTAGPQDAEVRRAVRDYLYRMN
                     IISVMEAEDTSVTAPHVFRDAVLNGTALCQLVATLREGGEPSLSDPVLCRCPRTLNEV
                     RVNYAVALGALRSTPSTAQELMPRAAWTMTPEEVYLRASPTALLSLFVHLISTYLPAP
                     EELPVWKQHMCWQPPADAADYAPVPPTELAAMEAGCCRFLHTWGVLPDGSVYQLPGDE
                     CLLPIATAAPYMAKWSRFVVRSVAPSSISVPSVWPFLCNGVLLVLLARRSGVEAAAKE
                     AASSPALQPFFANPRTAACCVANITSALHSFQTASTKKLPLSLISEESVAAVIRGDRV
                     HILHLLLHVRAAVEGTPQPPGVRSALLSKDAVAEAGCTPAKVSGRAPDGEGVAASSTS
                     SWPSASLAQTPSTVAKAALRRSAPPSPAHRSLSPRRVPAIASSSSGILRREAVPADEP
                     QGRRGLCRWLRQQLGTEYRYTAADESFVFDAATFSWRHPCLLFSDGVVLAYLIRRLER
                     RRCSFLDCVHPTSKKSAKLFNVRRCLEFLRFNAGVVFDVLLLDEALTEGRVEGVVSVL
                     QGMRRHYCLTNVRRSHHDA"
     gene            complement(<84141..>84899)
                     /locus_tag="LMJF_36_0280"
                     /db_xref="GeneID:5655276"
     mRNA            complement(<84141..>84899)
                     /locus_tag="LMJF_36_0280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686546.1"
                     /db_xref="GeneID:5655276"
     CDS             complement(84141..84899)
                     /locus_tag="LMJF_36_0280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686598.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655276"
                     /db_xref="UniProtKB/TrEMBL:Q4Q250"
                     /translation="MALPFSGFVGTASLSLSLFRRCCLLLSQQLQERAHAHTHTHTQS
                     LTFCHRTMASSATSSSSPDDKIVNLLAIALQKMDDFKGKSADARRYASQVVAAVRANN
                     NTEEEFRDQIICIVANVKNLSGELGAGSQERKAGISAAELATMDANAMRSQLQKRTMA
                     ATFRKRAREQTNVDKTSLHCTKCGLVRRDRLNINELALDSEESGSHFDYNFDNSCACS
                     HSSDDERSSSGDEEDDETAMSKGSCATASDKHSD"
     gene            complement(<85213..>86163)
                     /locus_tag="LMJF_36_0290"
                     /db_xref="GeneID:5655277"
     mRNA            complement(<85213..>86163)
                     /locus_tag="LMJF_36_0290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686547.1"
                     /db_xref="GeneID:5655277"
     CDS             complement(85213..86163)
                     /locus_tag="LMJF_36_0290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686599.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655277"
                     /db_xref="UniProtKB/TrEMBL:Q4Q249"
                     /translation="MRRREAESAARFYMAGMLVVLLGLLLSCGYSFGLFHSPDEVEQL
                     NAAIRAVEGRRVALLLDSVVSNGTRFDGKGHMHPLYALTCVQEEETEEARRMIRNVAR
                     RFRTEPIDIGYAHHPLTAAYRHRRYAVAQALIEEWRRPVPDASDEEAVMDEVYASSLT
                     VSELQRVDPSVHVYCRDVDAVRCRALDPERIRDASNSHLEAAYRRRFGQTQELPAVTP
                     YRDTDMPSKIVAPASTLRAAFWDDPFRPVVPDLLPPRTAMVMNPGYFDNVLDQLSYTL
                     LGHMEGSSTAVAFGLFAMCTICLFLGTWCAGVSYWLLHCT"
     gene            complement(<86913..>87911)
                     /locus_tag="LMJF_36_0300"
                     /db_xref="GeneID:5655278"
     mRNA            complement(<86913..>87911)
                     /locus_tag="LMJF_36_0300"
                     /product="conserved NUDIX hydrolase protein"
                     /transcript_id="XM_001686548.1"
                     /db_xref="GeneID:5655278"
     CDS             complement(86913..87911)
                     /locus_tag="LMJF_36_0300"
                     /codon_start=1
                     /product="conserved NUDIX hydrolase protein"
                     /protein_id="XP_001686600.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655278"
                     /db_xref="GOA:Q4Q248"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="InterPro:IPR020084"
                     /db_xref="UniProtKB/TrEMBL:Q4Q248"
                     /translation="MCCHTSPLRFSYPNTVLRSNRRRRHMIRTTAAAARLPQSTQGWV
                     PLMRRALEFPIDSVTFPSHFYLHTVTNGTASTVGFSPQKEPVGLTALRQCAVLVLLSP
                     AATGNGFQDMCITLTKRTATMGSHKSEMSFPGGHVDDDETLRNAAQRETLEEVGLPPS
                     EYEIIGSLTPITTNALSARVTPFVAVATSPAQPYRASPVEVDSIHYLHMSMLLLSAST
                     GHARVIKYRSFTSDRPCFFPCFFASPAQTVVSSAVCRSPKATGVADDCGFDPMLPEDF
                     PGELVWGLTSFVTCELVARVAKAIMDGPEANSAAAVNALLTPSNVVARDPLAGSLQ"
     gene            complement(<88908..>89600)
                     /locus_tag="LMJF_36_0310"
                     /db_xref="GeneID:5655279"
     mRNA            complement(<88908..>89600)
                     /locus_tag="LMJF_36_0310"
                     /product="putative dolicholphosphate-mannose synthase"
                     /transcript_id="XM_001686549.1"
                     /db_xref="GeneID:5655279"
     CDS             complement(88908..89600)
                     /locus_tag="LMJF_36_0310"
                     /EC_number="2.4.1.83"
                     /codon_start=1
                     /product="putative dolicholphosphate-mannose synthase"
                     /protein_id="XP_001686601.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655279"
                     /db_xref="GOA:Q4Q247"
                     /db_xref="InterPro:IPR008570"
                     /db_xref="InterPro:IPR014041"
                     /db_xref="UniProtKB/TrEMBL:Q4Q247"
                     /translation="MSSEHWVFFGLPPFFTEQHSSATLDRQCTLWSNLLLDHAIYHAQ
                     RTAGGDTNALLRFYTTQSDIFYNPAINKRLSPEGAHTMLQSLVARHPNHVVIVSDGGP
                     RDFSVLVCTTEDGFKGMEETLLRYILDHGEVQTTAMLSKKGTVMTFDELASGAALGYG
                     QTRSAYLARFSSAAVPVADVGRLSEEQAIRMYLHALNRRPVSAMRPFKVTLFNLDGTA
                     TQPYQGVKFGGE"
     gene            complement(<90862..>91482)
                     /locus_tag="LMJF_36_0320"
                     /db_xref="GeneID:5655280"
     mRNA            complement(<90862..>91482)
                     /locus_tag="LMJF_36_0320"
                     /product="putative proteasome beta 2 subunit"
                     /transcript_id="XM_001686550.1"
                     /db_xref="GeneID:5655280"
     CDS             complement(90862..91482)
                     /locus_tag="LMJF_36_0320"
                     /EC_number="3.4.25.1"
                     /codon_start=1
                     /product="putative proteasome beta 2 subunit"
                     /protein_id="XP_001686602.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655280"
                     /db_xref="GOA:Q4Q246"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q4Q246"
                     /translation="MAETAIAFRCQDYVMVAAAGLNAFYYIKITDAEDKITQLDTHQL
                     VACTGENGPRVNFTEYVKRNLMLNRMRQHGRHSSCDSTANFMRNCLASAIRSREGAYQ
                     VSCLFAGYDMPVSEDDNGAVGPQLFYLDYLGTLQAVPYGCHGYGACFVTALLDCLWRP
                     DLTQQEGLELMQKCCDEVKRRVVISNSHFFVKAVTKNGVEVITAVH"
     gene            complement(92031..93312)
                     /locus_tag="LMJF_36_0325"
                     /pseudo
                     /db_xref="GeneID:12982068"
     misc_feature    complement(92031..93312)
                     /locus_tag="LMJF_36_0325"
                     /pseudo
                     /db_xref="GeneID:12982068"
     gene            complement(<94379..>95803)
                     /gene="RNHii"
                     /locus_tag="LMJF_36_0330"
                     /db_xref="GeneID:5655281"
     mRNA            complement(<94379..>95803)
                     /gene="RNHii"
                     /locus_tag="LMJF_36_0330"
                     /product="putative ribonuclease HII"
                     /transcript_id="XM_001686551.1"
                     /db_xref="GeneID:5655281"
     CDS             complement(94379..95803)
                     /gene="RNHii"
                     /locus_tag="LMJF_36_0330"
                     /EC_number="3.1.26.4"
                     /codon_start=1
                     /product="putative ribonuclease HII"
                     /protein_id="XP_001686603.1"
                     /db_xref="GeneID:5655281"
                     /db_xref="GOA:Q8WSZ0"
                     /db_xref="InterPro:IPR001352"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR024567"
                     /db_xref="UniProtKB/TrEMBL:Q8WSZ0"
                     /translation="MLHAWRFVPLARSTSALGSGLLRPSRVLRQKRLAYSPFRPPPTW
                     NALQKVEVGHRQTDTGEPTLDGTLDLVGYQLSRDGLLPQTNILGRTLPVPDTSGISAA
                     TRRKLERERDVAVAHMKRHGVRLRRSIKETAVTIGCDEAGRGPLAGPVVGAAVSRIPV
                     SSFNNEFDQLYEAPEQFQIFDSKSVSERQRDLVFAMITGHVDFFDIASCKKFVVHHCA
                     GDEATSLTLSSKKLDSHVKLSKLPFKKLLSMQTPYLITYHGYNSAGNYVYFWSIGIAN
                     HTYIDEYNIYNASMNTMHRSAQSIWHMLSDARFSHEAAPRPRSSSIAQYLFSRFCTAA
                     NHDNEKRYQVPHHLELLKGATEYFDFEPIQPPLVLIDGHAVPGPSYDYFTSVRIGGDV
                     QPIIEGDKRSLSIAAASCLAKVTRDELMNYIDALYPGYGFRDNKGYPVEQHMKYVAKN
                     GLCPIHRKTYRPCRTVLEKGLQRK"
     gene            complement(<97083..>97274)
                     /locus_tag="LMJF_36_0340"
                     /db_xref="GeneID:5655282"
     mRNA            complement(<97083..>97274)
                     /locus_tag="LMJF_36_0340"
                     /product="putative nuclear protein family a (nop10p)"
                     /transcript_id="XM_001686552.1"
                     /db_xref="GeneID:5655282"
     CDS             complement(97083..97274)
                     /locus_tag="LMJF_36_0340"
                     /codon_start=1
                     /product="putative nuclear protein family a (nop10p)"
                     /protein_id="XP_001686604.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655282"
                     /db_xref="GOA:Q4Q244"
                     /db_xref="InterPro:IPR007264"
                     /db_xref="UniProtKB/TrEMBL:Q4Q244"
                     /translation="MHLRVYMVDGKRVYTLKKVDPEGKPTLSAHPARFSPDDKLSRHR
                     VTIKRRFKVLPSERRLQPL"
     gene            complement(<99323..>100834)
                     /locus_tag="LMJF_36_0350"
                     /db_xref="GeneID:5655283"
     mRNA            complement(<99323..>100834)
                     /locus_tag="LMJF_36_0350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686553.1"
                     /db_xref="GeneID:5655283"
     CDS             complement(99323..100834)
                     /locus_tag="LMJF_36_0350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686605.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655283"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="UniProtKB/TrEMBL:Q4Q243"
                     /translation="MQKPRTVSATPLPQVAAVPRPRMSGAAAAAPHDRSYHVAVTASS
                     RQRRVSLNAPRHVPKYIFTEPASVPWSRSLRGAHDICATVSHSRQRKLSKTSEGSVLQ
                     ARPRTFSAADSEKVLATRGVPFAADKLGTGKDEALLQLNDGFDGGLSTSTLTTCSPKG
                     SRHRPSQPGRMLKLQLDATAIEDELKLSANSKSANTVSSKTPRPDKFAAYHTLRLLFV
                     PIWKRYRFHKQMVWATAIVAKHVLLKVHWRRQRRSERATDTFLHVLRIPRTKLRCAAH
                     LLEGQVVRIQRAFRRHRARVQAVVELNYRKVRRDVEEAYWEAVVTQHEAELAVQQRPF
                     SPVPKAVREVFGARAEARARFGSIQRRTSLLSSAGNSSYDTAVPSNELDVYNFHMIGR
                     LPGSLLRFEMTSAVFAQLRRSAARAHLMDDFSETRARRAGMGGFMEHGDIAPTNTAFV
                     RSRGKCRAQLPCFLPESVYAAILNNTCYLTSLMRDDRKLRAHLRQREHHLESY"
     gene            complement(<102102..>102881)
                     /locus_tag="LMJF_36_0360"
                     /db_xref="GeneID:5655284"
     mRNA            complement(<102102..>102881)
                     /locus_tag="LMJF_36_0360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686554.1"
                     /db_xref="GeneID:5655284"
     CDS             complement(102102..102881)
                     /locus_tag="LMJF_36_0360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686606.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655284"
                     /db_xref="GOA:Q4Q242"
                     /db_xref="InterPro:IPR002809"
                     /db_xref="InterPro:IPR008568"
                     /db_xref="UniProtKB/TrEMBL:Q4Q242"
                     /translation="MTAEQNILLDPSIRDWVLLPLIVIVLFMGVLRHYVTILMNSPSK
                     PNMARICNVNIQNYGRILLSSGAALSPEPFKHRAERMLNGMLKKEVDPVNPMEMMNDP
                     NVMMGLLKNQFMMMVPNIGMMMLVSYFFSGFVVAKFPFPLSHRFREMMQRGLEIDVLN
                     CNYVTSLSLYFLIMSGNQGLLQLLLGEDVESENHSAMMMQQMPQASAQPVDFAKVFKQ
                     ISDELAFAKDHHRWGYENAPDVLLKKWRSQKRAKGTAAKRR"
     gene            complement(<103919..>105286)
                     /locus_tag="LMJF_36_0370"
                     /db_xref="GeneID:5655285"
     mRNA            complement(<103919..>105286)
                     /locus_tag="LMJF_36_0370"
                     /product="phosphatidylinositol-4-phosphate 5-kinase-like
                     protein"
                     /transcript_id="XM_001686555.1"
                     /db_xref="GeneID:5655285"
     CDS             complement(103919..105286)
                     /locus_tag="LMJF_36_0370"
                     /codon_start=1
                     /product="phosphatidylinositol-4-phosphate 5-kinase-like
                     protein"
                     /protein_id="XP_001686607.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655285"
                     /db_xref="GOA:Q4Q241"
                     /db_xref="InterPro:IPR002498"
                     /db_xref="InterPro:IPR023610"
                     /db_xref="InterPro:IPR027483"
                     /db_xref="InterPro:IPR027484"
                     /db_xref="UniProtKB/TrEMBL:Q4Q241"
                     /translation="MGQVGGTATSGRGLTALQVAAALRVTAAARLKQAEAAVSSSQAM
                     HSAHCSIAEQSKAIKPEDCSAVQRLTVPSTDHKGKHVEVRVTEYAPDVFSFLRQLKGV
                     TDPQFADEWSLPENRLKMEMGEGRSQALFLKSKTMLLMCKTISVEEVHALLHVLRAYT
                     LHITAHPSSLLMRFYMLLKVSVRSEEGYILCFNDVFGTASVLHEKWDIKGRVPKNGKH
                     LHYPHLIGSGYEPDPHATKPPPKRHVLANPAIDASQQHPGRESAVVVRGTKDAQGLPT
                     LHDKDLTRLFWVPRTARKRLVEELLRDYDFLKNAGMMDYSLLIGVAYQDDKTRPSDKH
                     CGIESTNVTSSSAVAPASTSAEARPASLAQDSHPSGTRTMLTTVPEFANGVRSFDGQE
                     MYYIGVIDVLTTYTLKKKSANFFKSLLWKQKTLSTIPPDRYAQRIASFTELIFPDVKE
                     EANGG"
     gene            complement(<105857..>106411)
                     /locus_tag="LMJF_36_0380"
                     /db_xref="GeneID:5655286"
     mRNA            complement(<105857..>106411)
                     /locus_tag="LMJF_36_0380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686556.1"
                     /db_xref="GeneID:5655286"
     CDS             complement(105857..106411)
                     /locus_tag="LMJF_36_0380"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686608.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655286"
                     /db_xref="UniProtKB/TrEMBL:Q4Q240"
                     /translation="MEVVAPSALPSRDLFFFCSALCTLHIAPIVAMADCDGDLSNVHP
                     ELLKLCADPEDWREQRRRAMKAKIFGTGAQAGASPAAETYLPTDRTFGPSPSSAQQPS
                     ASSYSGQQGSVSQQAAESYILQQILSHKRRREEANTEKASALASTPQPHPQPLLTQPQ
                     QNPPASQAQELSLKEKLMRKYRKG"
     gene            complement(<109983..>111974)
                     /locus_tag="LMJF_36_0390"
                     /db_xref="GeneID:5655287"
     mRNA            complement(<109983..>111974)
                     /locus_tag="LMJF_36_0390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686557.1"
                     /db_xref="GeneID:5655287"
     CDS             complement(109983..111974)
                     /locus_tag="LMJF_36_0390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686609.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655287"
                     /db_xref="UniProtKB/TrEMBL:Q4Q239"
                     /translation="MSSKRTEGTAADEERRRTSAASSGSSSVSSTDSDEASSSVSDSS
                     SSGSGSSSDSESSDSERPSSTPQRQSAAAAERATSTQQLQQQRHVQLNPELRFERPDK
                     EYIPLPPLRDMQDMVKVLFLLSTDKKRYPDGRHRTLDYFRVAVEMFVTEVRQEYKRQY
                     QQAQRNGRAMQRFTWKNSGELAICFACCCDNVKLLYDSLQPGPLKPLWDAFVGQLPPM
                     LIVQSRVPETMLSSQTYHTKYMDWVKGGTRYGGEQSTANVRFPSVADRRVKVETYLRS
                     GAGYKIEAVQVGSTPAAPAAVPAAVAPRPSLAAAAAPMQALETRAPFAGRLPGTGSAK
                     VPVAPGVGGPRPPVKVPMKHVGGGVAHGSVTTAAAPPLASTSVKQMPPEMKHLFWLSV
                     LAHVKGGEASRAFPDDRLEALPGLLRLCEMTEHTEEMCILMDVLAASSSGVQTVFERL
                     GGLLSFRRFASHFIQSEEAEPLMQLVEQLARWRVAAWGSTSQQAWQTDMNQRRTRDLM
                     WLRTLPLIPEAKRAAWGALLLVMEQRYIFKAPRPDDTTAVDNPLKRRRSEVELGDLHA
                     VLSDNVDMQRWVVPRVNVFSAVRLPVELRVPPLCTKLEENTVRFLNAKREYAEKMQVT
                     WRERLEKILSAQPRAPGPAVPVPLWYDPYALLRVASPQP"
     gene            complement(<114379..>115719)
                     /locus_tag="LMJF_36_0400"
                     /db_xref="GeneID:5655288"
     mRNA            complement(<114379..>115719)
                     /locus_tag="LMJF_36_0400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686558.1"
                     /db_xref="GeneID:5655288"
     CDS             complement(114379..115719)
                     /locus_tag="LMJF_36_0400"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686610.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655288"
                     /db_xref="InterPro:IPR001478"
                     /db_xref="UniProtKB/TrEMBL:Q4Q238"
                     /translation="MTTVLNRRFDVLCHSGTCPSYLIDVLSLLVAHANDTELFKTELR
                     KGDGGEFGAAATGAGSAHATSSTGPASRTDRAVGEARERQAADRRTQLMYKQVEDPEV
                     LDDALRASHETVLIAAERSLQTYTEDLKHINDIAMATSAKQLRAMRVETQQQMEAFRD
                     RVCGSVVAQTKEELEVMRSELAASVRADVSDMVRQLHQVSFSTQQQLQQLTSSYTDFV
                     AQAHDALTLAPLADAYEAVKTVEYMQEQLKCIEAAATTRSDVETLEERLKDLESIVTT
                     LGSVAKTPDVGAAAAAREGFSVNVPPPLSLSQQKPVLSNRSASHRSQTPKCTSPLPLH
                     LHVSRSASAKGRPSSPPPASPGPPAQRTLAERLGVAVEAAEDGVVLAEVLPGSAAAAH
                     RLGVGHIISHVGRTAVKTPAAFEEALRGIEGQAVKITAYDPFNGRVRVLTAQPL"
     gene            complement(<117283..>117879)
                     /locus_tag="LMJF_36_0410"
                     /db_xref="GeneID:5655289"
     mRNA            complement(<117283..>117879)
                     /locus_tag="LMJF_36_0410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686559.1"
                     /db_xref="GeneID:5655289"
     CDS             complement(117283..117879)
                     /locus_tag="LMJF_36_0410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686611.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655289"
                     /db_xref="UniProtKB/TrEMBL:Q4Q237"
                     /translation="MYSDGERKTVSELQREAEATRKEIIEEAQRLERIKKATAKTQFS
                     IDQLFRFFAREVETEGEKKMLIDLLSSNPPDLHIECVPVLPVVIAIANGRMTNARRIY
                     ATDNAFLDDSAFIFLVHTLRFLPQACKIDFLDISGTRVTERGMCFVLEMMIERNTPFT
                     LVAKRLSIPSPEAEAMRARYASLMSALRDKKCCRFIQE"
     gene            complement(<119037..>120521)
                     /gene="AAT28"
                     /locus_tag="LMJF_36_0420"
                     /db_xref="GeneID:5655290"
     mRNA            complement(<119037..>120521)
                     /gene="AAT28"
                     /locus_tag="LMJF_36_0420"
                     /product="amino acid permease-like protein"
                     /transcript_id="XM_001686560.1"
                     /db_xref="GeneID:5655290"
     CDS             complement(119037..120521)
                     /gene="AAT28"
                     /locus_tag="LMJF_36_0420"
                     /codon_start=1
                     /product="amino acid permease-like protein"
                     /protein_id="XP_001686612.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655290"
                     /db_xref="GOA:Q4Q236"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:Q4Q236"
                     /translation="MRAHQHTTACAGMVGGNDSNLSELSPMLLHGTWLRMSHSHAALD
                     TESNCSIGRNLRRVNSVPVLTRRDRHLMTVSPMLFDRYYMAEGGGLISSAFNLASATC
                     GAGVLALPYAMQHCGTVTGTLTLIFVCNLTIYSVFLLAKVSALTRLMTYEELAIDLVG
                     PITEKVTATIIVVFCWGVAVMYIVMMGDFIVPLFEALGLSHKVHRRTAMVLFWALVMF
                     PLSMARKVQTLRYASIVGTVSTLLLAGALVDRFAQDRREHSNRTGLDPGRHTPPRAPL
                     ARWDSEMSGALTTFVFSYCCQPVAPRIYEELKDRSVKRMCVCTVSSMTAATLVYILTG
                     VFGAMSFGDSVKPNVLVNFSNHLDSHTAQLAYFGIVVSLTMAFPMTIFPTRDSIVMGM
                     GYHAEENPAPVWLSRTVAGLLALLALLIGSALPNIRVLFDVLGGVCGGSLSFVLPALF
                     ALRSGYWTTAEVGWRHMALTWLTLVFGVVMCGLGTYNSVKSNFF"
     gene            complement(<122627..>123499)
                     /locus_tag="LMJF_36_0430"
                     /db_xref="GeneID:5655291"
     mRNA            complement(<122627..>123499)
                     /locus_tag="LMJF_36_0430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686561.1"
                     /db_xref="GeneID:5655291"
     CDS             complement(122627..123499)
                     /locus_tag="LMJF_36_0430"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686613.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655291"
                     /db_xref="UniProtKB/TrEMBL:Q4Q235"
                     /translation="MVVMLPALYARECVACSGAFRSCSRSGHRVPCLSCAAPAREFLL
                     CRVSTTVSVSPPSFTCTLFRFRHPSPRTCRTCFRVTVFSSALACSLFACVGCRLPSSP
                     SRYTLWRILMYRQSIAGLALAAALAEIQPALTPRQEEEIWRVFDAAMQAAVADAPLMS
                     HISVQTPPPSSVGGGGYAAVTSTASELYVPADAEDGSGIDAEERAFGKPAAASQDGET
                     PFEDSHIAFPVYRLVDDEWTLLLKDPTVVVRNELGVSEKIQLDYLRVRLKDIGAQSGA
                     TQPKQVRAVRERRA"
     gene            complement(<125300..>126748)
                     /locus_tag="LMJF_36_0440"
                     /db_xref="GeneID:5655292"
     mRNA            complement(<125300..>126748)
                     /locus_tag="LMJF_36_0440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686562.1"
                     /db_xref="GeneID:5655292"
     CDS             complement(125300..126748)
                     /locus_tag="LMJF_36_0440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686614.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655292"
                     /db_xref="UniProtKB/TrEMBL:Q4Q234"
                     /translation="MRRRLACWPTAALAVARAITTNSFVSSIEQVQQQLQTAQDRRVE
                     LLRYGRQLYEVEMLDDLKTAYTPAVASKICYVASQLRIDATKGQPYTAVLEATMTAEG
                     EQAMEVASLARIVHSCLVLRSGHLHEVLFTFIPFLREKAGTMDAVTTAVLINAYGRSG
                     VHHPGLYKALCDNGATVLKDPRVPLAHIANVAYAVSRVKFLHPALMLTLRDHALRKVA
                     EASPIISLTVLDAFTELRQIDDDLFNAYEQRLLGQLNELQAPLMASLVSCVVRAGRGK
                     AEVMESLGARTVAIADTFDAASIAKVTNAYYEADVASEDVLGALAERACKVAADFRAD
                     EIATVLNALSAFDLFDAELFPLLASRLVALHRQGGYVDVADAAVILSSFAAVQERNDE
                     LIYVCTQLFAAYPGVAMDPAVRVNALWACASLNVHNEAQTKMLEEVRATPSLVMWESK
                     TDTLPKAKATLEERTRFLAKVYGITISSSGAR"
     gene            complement(<128968..>131427)
                     /locus_tag="LMJF_36_0450"
                     /db_xref="GeneID:5655293"
     mRNA            complement(<128968..>131427)
                     /locus_tag="LMJF_36_0450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686563.1"
                     /db_xref="GeneID:5655293"
     CDS             complement(128968..131427)
                     /locus_tag="LMJF_36_0450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686615.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655293"
                     /db_xref="UniProtKB/TrEMBL:Q4Q233"
                     /translation="MPCMCLTRYGTGASEATTLQRGRVSPVRVSLKDVIRHISHTRTH
                     AHTLRLHSRTEAGGKHEKGDNIASPPIPLHFIGVRITQAHSLTALFSLPLVSVFGSLP
                     CTCTVNSCISRTFPCDIPPPLPPPFSPLHPSLSLSLLSAVRTCVCLLRTDTRRTHPNT
                     LTQDVHTQVHIYTHIYASIGKPFCTSKRLLVFALSLVCVCVCVCVCALVRERDGFSVS
                     GFLFSIYFLCAPRNGVHPSYRFRFLCFPASLLPPSPTPLPKEYTWFVLCLVLSLWSRD
                     DDNESAAAPSKAQAQLMIPGGAGSGLEPAHPRGGLAHPYMDSVPTSSVPGMFSSYTGR
                     STFSAGIGEGGIAGGRGGARAASAESSPSEGEAFTKEDRMLLRLLYHQQQAIQVQLNT
                     MTEWMQQVNYRIASLERLSRHTRPVTAVGATSSLTASAAPLPSRSTSAAEGYGTLAGQ
                     IQGAPLYSSSPALSARDAPRPQTGSAPASVYSGQGLHQRATSSAPPLSSVQESSRACT
                     PPSEQTRHQTGGAGGGSAVPSTTRSFESAMAQPWDPHNTSLQSASGAGVHSRTSSHTS
                     ALGRRANPLLSSSTTMNKLPTSTSRPNWGDPKQLSRLDASVPSGTAQTSLSSGLTSLD
                     TQQPPPSQQQQQSRQPPVVSPPTAAAVPYASSPLYTSADAVVPPYRRMPPEPTTRRPH
                     SRAAAAVTASPSTVSCAPPVFSGTVDASLAASGREGTLPPAKSSSMATSSNHGDARGR
                     AATETTAVEGSREVRATYSAAAVSPENPRAATDPAGGAGRAARPHDGGTRLPSASNDD
                     SLSDGYGSYESRMYMKNLGLL"
     gene            complement(<132378..>134231)
                     /locus_tag="LMJF_36_0460"
                     /db_xref="GeneID:5655294"
     mRNA            complement(<132378..>134231)
                     /locus_tag="LMJF_36_0460"
                     /product="putative vacuolar protein sorting-associated
                     protein 45"
                     /transcript_id="XM_001686564.1"
                     /db_xref="GeneID:5655294"
     CDS             complement(132378..134231)
                     /locus_tag="LMJF_36_0460"
                     /codon_start=1
                     /product="putative vacuolar protein sorting-associated
                     protein 45"
                     /protein_id="XP_001686616.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655294"
                     /db_xref="GOA:Q4Q232"
                     /db_xref="InterPro:IPR001619"
                     /db_xref="InterPro:IPR027482"
                     /db_xref="UniProtKB/TrEMBL:Q4Q232"
                     /translation="MSSVSSSKVNRGRRNCLEQAWNYLNTAFSATAGLKVLLCDDATR
                     EILSVAYSQHQLLQHNVVLVDMLANQERYPMKHFSCVIVCRPSAASLAAVYQELAEGN
                     FASYDIYFTYMLDSTLVHSLANADVLNLVSRVGELYINSIPVTEWVCLMQLKPSLLSK
                     GPSPFMNPITYSQWDPKSLERMSEGIISMLLSTNRRAVIRYREGSKVSEKLAVEVAAR
                     MRSVHATFPDLKATESVLVILDRRDDPVTPLLMPWTYEAMIHELIGFQHGNEVVIDDP
                     DAKPEDRVHVVTPQTDGFFGQHRYDDWGQVCVAVSEMVKAYKEMNNFDRNTVSLDEIK
                     SFMNRFPAARKQSVQVTRHCAITSELVAEINGRNLTRLSVLEQDIISNNNVTEHSRLV
                     LEVVQDPKTDVDDALRIVMLYHLHYERVAGSIIMQLKQELMQRQCPREKVQLIDRLIE
                     YAGQDQRCHEIFRSSTGHMLKTVAKAVGQFGKDVQNVLTQHVPLVKKIINRVYNGTLS
                     VEKYPVQGVPGCPIPAGQAPFVHAKDIIVVYIGGYTFSEAMLLAQINEGNVDNNQETL
                     MNFGKQVSRKLGTDGVTGPSTEPYTAKIEAHVSLITTSMLNSKDFIHSLPS"
     gene            complement(<135198..>136565)
                     /locus_tag="LMJF_36_0470"
                     /db_xref="GeneID:5655295"
     mRNA            complement(<135198..>136565)
                     /locus_tag="LMJF_36_0470"
                     /product="dihydrouridine synthase domain protein-like
                     protein"
                     /transcript_id="XM_001686565.1"
                     /db_xref="GeneID:5655295"
     CDS             complement(135198..136565)
                     /locus_tag="LMJF_36_0470"
                     /codon_start=1
                     /product="dihydrouridine synthase domain protein-like
                     protein"
                     /protein_id="XP_001686617.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655295"
                     /db_xref="GOA:Q4Q231"
                     /db_xref="InterPro:IPR001269"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018517"
                     /db_xref="UniProtKB/TrEMBL:Q4Q231"
                     /translation="MEFRRRRVPLTLASAMKVEESMFYQTTILAPMVRVCSPGFRALC
                     GAHGADVVFTEEVVAAKLATCQREVVRYPTVDTPMAEYVSYDPFKHTYKRTVVLSTPV
                     LPDTTYGGQKADRISAPRTVLQLGVADPARGAAAALVCSNDIDGIDINMGCPKKFSVH
                     NGFGAALMKRPEVGGAIVRAVHGAVNSDSNVEARGGKRVAVSLKTRLQDTAEATVGML
                     RAILAASQHTPANPVLHAITIHARTPDQRPEQAPLYDRAAEVVRACRADAAFEGICWV
                     LNGSVLSRQDGEAKCARYGFDAAMIARAALEDARCFHRKGSELPASSAAHDGEAQSTE
                     DAEEYAMAIMKELFFYSVRYRTLFNNFKYHLTRAFPVVRALKPFMEEVQLELRSYADC
                     YEFFHLTVEEKALADSCAHTVELLAEKPASTRKRAAVTAAASEEDGEQAHKLARVETT
                     TKASI"
     gene            complement(<138176..>138853)
                     /locus_tag="LMJF_36_0480"
                     /db_xref="GeneID:5655296"
     mRNA            complement(<138176..>138853)
                     /locus_tag="LMJF_36_0480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686566.1"
                     /db_xref="GeneID:5655296"
     CDS             complement(138176..138853)
                     /locus_tag="LMJF_36_0480"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686618.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655296"
                     /db_xref="GOA:Q4Q230"
                     /db_xref="InterPro:IPR002124"
                     /db_xref="UniProtKB/TrEMBL:Q4Q230"
                     /translation="MLRKTNLFLFAASRALMSGGSSHGPTPYQDKSYPVQPHNLNELQ
                     QPPDSWRKSPIMSKLMDQSLPVYDDVVTGVGRLYWQEPARVWHLFEADDTLMLEEHDR
                     EEWNDRPYVAVNHLYEPPIGSEERPIRVEGTGNPGDQQIVLCFGNCAPHVPQSNYYMM
                     MKGYSKTKCPMCQQWFYVHNRPWLVMHPDWTDEPAADEGPAYTFAEIEAEFDRDFHEF
                     GVYLNAE"
     gene            complement(<140714..>141760)
                     /locus_tag="LMJF_36_0490"
                     /db_xref="GeneID:5655297"
     mRNA            complement(<140714..>141760)
                     /locus_tag="LMJF_36_0490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686567.1"
                     /db_xref="GeneID:5655297"
     CDS             complement(140714..141760)
                     /locus_tag="LMJF_36_0490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686619.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655297"
                     /db_xref="InterPro:IPR026319"
                     /db_xref="UniProtKB/TrEMBL:Q4Q229"
                     /translation="MPRPQFITCQLCGKGFGSASINIHIPQCYEKAIKRWQLNPQGPR
                     PVMPPLHGKPAAKASNGGPSGIAFAGQPCGAGMSAVRSLQMQSMPPESVEPESTNLHP
                     CSKCGRTFNFDRIAYHESVCKGDQKRRVFDSSKQRCAGSEGDDAYAGGAFGAPSGVRR
                     GRTKKLGTANTTSRYTPAPATQTNWRQQHEEFIAAIRSAKRADAEAQNMWGTGPAAPS
                     FSTSRGPARGGLFGATPSGYGDGAGMSARVSASTRRIPPLMAKQNETLKQGIATGGRA
                     ARAKEGGGIPAPRTGRPLGRPTPPSGRDSFGGRGDRFSSRGGGGGMGGGGGGGRILND
                     NTTSVGMLQAMGRA"
     gene            complement(<143095..>144627)
                     /locus_tag="LMJF_36_0500"
                     /db_xref="GeneID:5655298"
     mRNA            complement(<143095..>144627)
                     /locus_tag="LMJF_36_0500"
                     /product="putative DNAJ domain protein"
                     /transcript_id="XM_001686568.1"
                     /db_xref="GeneID:5655298"
     CDS             complement(143095..144627)
                     /locus_tag="LMJF_36_0500"
                     /codon_start=1
                     /product="putative DNAJ domain protein"
                     /protein_id="XP_001686620.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655298"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q4Q228"
                     /translation="MTQDEAPAASSSGKGNWEALKEQGNQAFKSNAFEEAIQHYSAAI
                     EAHPDEPVLYSNRSAAYLKRGQYQEAAHDAEKAVAMDRAFVKAYSRLHSALCNLGLFD
                     RASEALRAGLTAVSTSPKATPQDVKHLRELLNSAEQASKVVPRGRQLIETGCFAEASR
                     ALAGPYRDFPGSSTLAFLYAEAHVPSSPDEASRVLSPFAYTHGSDPYYLYLRALVLYY
                     RGQEGFSSAQNILRETLQMDPDNTKARILLKRIRAVESHKDAGNAAFKNKNAKVAVDE
                     YTRAVECDQTNARMNATLRSNRAAAKMNLNDYKGALLDCDYAISNGATSAKIYARRSR
                     IQEQLENFDEAVRDMQQAAEEDNQFVAELRQLKARAKRAKRKDYYKILGLPQHESNQD
                     AIKRAYKKACLQWHPDKWAHASEEEKSHAETQFKEVGEAFGVLSDPKKKRMYDSGQMD
                     NDVEGANMPSGFGGGASQEDIVTVMNMMFGGGGFQAGGFPGAFGGAGNGRRRPRGGPG
                     FF"
     gene            complement(<147982..>150249)
                     /locus_tag="LMJF_36_0510"
                     /db_xref="GeneID:5655299"
     mRNA            complement(<147982..>150249)
                     /locus_tag="LMJF_36_0510"
                     /product="putative mitochondrial carrier protein"
                     /transcript_id="XM_001686569.1"
                     /db_xref="GeneID:5655299"
     CDS             complement(147982..150249)
                     /locus_tag="LMJF_36_0510"
                     /codon_start=1
                     /product="putative mitochondrial carrier protein"
                     /protein_id="XP_001686621.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655299"
                     /db_xref="GOA:Q4Q227"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR002167"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q4Q227"
                     /translation="MLSTTSSSFSTSATETTGNLFASPSNASSSRVMSDTADDLSASS
                     SREEILVIPVHTIVEKVTPLCGLSVPELHALVLRYDTDGVGGLTEPQWSLFCHEHRHA
                     FSSLGEELLDFDRSGEYSVLVVKHGYEGTSNTNAPRSFTKEVIRFIESFAAGGIAGAV
                     SKTVIAPGDRVKIIFQVEPTRHFSLREAVYLGVETVQKFGITGLWIGNGATMLRVVPY
                     AAITYASFDFYHSKLRFMFSRSNPDGSPDEARAVTLRFISGSLAGATSTTCTYPLDLM
                     RARFAARSSSGKRRFPSYSAAFKEATSRQGILSLYGGLFPTLVGIVPYAGCSFACFET
                     LKHYIVKVSNLKSDKDIPTYQRLVAGGFAGLLAQSATYPLDIVRRRMQVTPRRYSSVI
                     DALRTVYREEGIRQGLYKGLAMNWIKGPIATATSFTVNDLVKRRTRNYYETTVVYSSR
                     HNIVTLPEAFLCGGVAAATAKFLSLPFDRLKILYQVDMTEKTSAKKGAQLLYQVVKQS
                     PNMWTSGHVTMLRVVPYGALTYCFFDMFQLLAERLMYSHVATPYTNFAAGAAAASLGT
                     TIVYPLDLLRTRVAVNAVPSFQSYFWLLRAMARRHGIGSLWKGCYLSMMGVGVLGGIG
                     FALYDYLKERFGCHTFLQYMAAGATSGLAGSVITYPLNVMKRNRQAERVVYAQLGTSS
                     VQSLLKSPKTVAFLYRKMPFSFTVSSLTFGISFAVNDWCRDVIAATRNDMLREMLFLP
                     SFAVSKSMLSRGDTP"
     gene            complement(<150996..>152330)
                     /locus_tag="LMJF_36_0520"
                     /db_xref="GeneID:5655300"
     mRNA            complement(<150996..>152330)
                     /locus_tag="LMJF_36_0520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686570.1"
                     /db_xref="GeneID:5655300"
     CDS             complement(150996..152330)
                     /locus_tag="LMJF_36_0520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686622.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655300"
                     /db_xref="UniProtKB/TrEMBL:Q4Q226"
                     /translation="MENIKEEICLVANIIDRLLEANGSLRADVLEPLIQRLRVAAGEL
                     SRIDQQSKSDPVLSSFSRNADGIEGTGGGSRHGSSKLQLSKSLTPLTATRKQIRGCRT
                     VSATCKKIGDPKVFVSSEISQSVCCSLYNLLEGTTRLLRGSHGHIFVKRGVDMFSIAN
                     VSRKLAFPPPQVYHRCLGSADAEVLGSSIALNRNVDEVGRKSAVLIFPVHKLLPEGGP
                     GEPIATIHVERREHAFFPFSESDEYTLYFASLFCGELMSRIPQINFLETFYDPSTQLI
                     VAPFEPYCPVVLPPIERGVVSMLGETGKQPSENPEYAARAVSWLTRKISARAPEILIR
                     RESRPTHNTKPFAPGVTHMPSLLEIKAYVENLQSCWKKNMLENVDLLELDRGAQQDLK
                     VARSELTATRRELAATADKLRLYELDAWDYKREYGAMKSELDAYMDSLERLH"
     gene            complement(<153258..>154154)
                     /locus_tag="LMJF_36_0530"
                     /db_xref="GeneID:5655301"
     mRNA            complement(<153258..>154154)
                     /locus_tag="LMJF_36_0530"
                     /product="protein phosphatase 2C-like protein"
                     /transcript_id="XM_001686571.1"
                     /db_xref="GeneID:5655301"
     CDS             complement(153258..154154)
                     /locus_tag="LMJF_36_0530"
                     /codon_start=1
                     /product="protein phosphatase 2C-like protein"
                     /protein_id="XP_001686623.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655301"
                     /db_xref="GOA:Q4Q225"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:Q4Q225"
                     /translation="MGDMLAKPETQKFSTVFETSHLRVGCCSMQGWRKSMEDAHVAQL
                     NLNGNRDQAFFGVFDGHQSDEASRYCRAHMLDELLKNIAIYKDDVAKAFEVSFQEIDK
                     QICKKFVSSGTTANCVYLADQQIVCANAGDSRAVLYRGGKVVPLSVDHKPSVPAEEAR
                     IVAAGCHVENGRVNMTLAVSRALGDVDFKSCAAKGWVDQAVTACPDITVTPSRSDDEF
                     IVIGCDGIWDVLSNEECCDLVKTLIQNSDIDKNGHSVAVDISLVCEQVLDRCLAQSNS
                     VKAGTDNMTIIVVEFKPPFFKC"
     gene            complement(<154765..>155190)
                     /locus_tag="LMJF_36_0535"
                     /db_xref="GeneID:5655302"
     mRNA            complement(<154765..>155190)
                     /locus_tag="LMJF_36_0535"
                     /product="putative small nuclear ribonucleaoprotein"
                     /transcript_id="XM_001686572.1"
                     /db_xref="GeneID:5655302"
     CDS             complement(154765..155190)
                     /locus_tag="LMJF_36_0535"
                     /codon_start=1
                     /product="putative small nuclear ribonucleaoprotein"
                     /protein_id="XP_001686624.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0535"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0535"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655302"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR027141"
                     /db_xref="UniProtKB/TrEMBL:Q4Q224"
                     /translation="MADTSNATKDIPSSLVFEAMHSRVTIETVEGDVYKGTLAAFDIS
                     RGNIELVEVRHQAKDSTFGFYERVTVRGSKIRIVLLPPEMKAAPSLQWRRESVQEELK
                     KSLKHVPVLRPIVPSSRPLRTKKAQPKNDKSKQLRRKLR"
     gene            <156279..>156911
                     /locus_tag="LMJF_36_0537"
                     /db_xref="GeneID:5655303"
     mRNA            <156279..>156911
                     /locus_tag="LMJF_36_0537"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686573.1"
                     /db_xref="GeneID:5655303"
     CDS             156279..156911
                     /locus_tag="LMJF_36_0537"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686625.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0537"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0537"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655303"
                     /db_xref="UniProtKB/TrEMBL:Q4Q223"
                     /translation="MSLFDISPSSSESSSQSDNSSKVDDRIQLTYAETVVSLATAVGL
                     VIIVLLDLLYRSTSRHAMLLRVQRETRFDGAYILGKPEGNRARIILENGLKTHEFRIR
                     HPPQYSRVIPAVVSDSRDAKQDCVEMLSKVRSILSTSHGRCAELMSMRCCLACVTGAL
                     PGEQSERFLRIYERVMFCSHRVNGDEKLVTSDDIRYMHAFYYNNVLKVLQ"
     gene            <157618..>158571
                     /locus_tag="LMJF_36_0540"
                     /db_xref="GeneID:5655304"
     mRNA            <157618..>158571
                     /locus_tag="LMJF_36_0540"
                     /product="putative ubiquitin-like protein"
                     /transcript_id="XM_001686574.1"
                     /db_xref="GeneID:5655304"
     CDS             157618..158571
                     /locus_tag="LMJF_36_0540"
                     /codon_start=1
                     /product="putative ubiquitin-like protein"
                     /protein_id="XP_001686626.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655304"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR015496"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="InterPro:IPR019954"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4Q222"
                     /translation="MAVTIKLANGSQHTVEVPDFSITVAEFKKQIAEALEIPASEQRI
                     IMRGKVLKDDGVLSAIGMEDGNVIHVVRSKKNVAVPSSTNASSTLAASDPTSSPNVQP
                     STTTPAQPVPAPAAANPYAALMSNFGAPQTQQPAPGAPGFPAAGNPFAGMGMRMGMGG
                     GMGGAVNPTPQQAMELMQNPMMQQMMQQALNNPQFMQYIIQNSPQLAGLPQDQQQAII
                     EMMQNPYMMQQAMAMMGGLGGAGGVPPATSQAASTPAVGAGFNPAMFAPLAPQGNPRE
                     VYREQLQLLRDMGFPNEEANIAALQQAQGNVQFALERLLGA"
     gene            <159355..>160290
                     /gene="CRK3"
                     /locus_tag="LMJF_36_0550"
                     /db_xref="GeneID:5655305"
     mRNA            <159355..>160290
                     /gene="CRK3"
                     /locus_tag="LMJF_36_0550"
                     /product="cell division related protein kinase 2"
                     /transcript_id="XM_001686575.1"
                     /db_xref="GeneID:5655305"
     CDS             159355..160290
                     /gene="CRK3"
                     /locus_tag="LMJF_36_0550"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="cell division related protein kinase 2"
                     /protein_id="XP_001686627.1"
                     /db_xref="GeneID:5655305"
                     /db_xref="GOA:O96526"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:O96526"
                     /translation="MSSFGRVTARSGDAGTRDSLDRYNRLDVLGEGTYGVVYRAVDKI
                     TGQYVALKKVRLDRTEEGIPQTALREVSILQEFDHPNIVNLLDVICSDGKLYLVFEYV
                     EADLKKAIEKQEGGYSGMDLKRLIYQLLDGLYFCHRHRIIHRDLKPANILLTSGNVLK
                     LADFGLARAFQVPMHTYTHEVVTLWYRAPEILLGEKHYTPAVDMWSVGCIFAELTRRK
                     VLFRGDSEIGQLFEIFQVLGTPTDTEGSWPGVSRLPDYRDVFPKWTAKRLGQVLPELH
                     PDAIDLLSKMLKYDPRERISAKEALQHPWFSDLRW"
     gene            <160849..>161766
                     /locus_tag="LMJF_36_0560"
                     /db_xref="GeneID:5655306"
     mRNA            <160849..>161766
                     /locus_tag="LMJF_36_0560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686576.1"
                     /db_xref="GeneID:5655306"
     CDS             160849..161766
                     /locus_tag="LMJF_36_0560"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686628.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655306"
                     /db_xref="UniProtKB/TrEMBL:Q4Q220"
                     /translation="MQSGAALLEPPLSMHCKYTLRILPFSLPPVVSPQLCRNSWFCTH
                     ILAAALAFSVAISSNMAATSYDRDAAVKVADENYSLRKRLARMEWEEKQRRAAEYESR
                     FEGAVDTSANDRMRSRNSALQDEIAGLESQLKELQMINVTDLQHEYTRLDNRRAYLLN
                     EIAGLRRILANQSKEVKRATRSVNSQHELRRQNNEQHAASIEDIQMFRKKRESLAEET
                     QHLIAKERQLMSELETLPAPGEDEEFVASRLREDNEKKDHIIAQLEATLKEQMKAGAQ
                     LPEANSAVDIQHLREEYVRLNDQLKRIKQ"
     gene            <162644..>164884
                     /gene="MEFG"
                     /locus_tag="LMJF_36_0570"
                     /db_xref="GeneID:5655307"
     mRNA            <162644..>164884
                     /gene="MEFG"
                     /locus_tag="LMJF_36_0570"
                     /product="putative Mitochondrial elongation factor G"
                     /transcript_id="XM_001686577.1"
                     /db_xref="GeneID:5655307"
     CDS             162644..164884
                     /gene="MEFG"
                     /locus_tag="LMJF_36_0570"
                     /codon_start=1
                     /product="putative Mitochondrial elongation factor G"
                     /protein_id="XP_001686629.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655307"
                     /db_xref="GOA:Q4Q219"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR004540"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR005517"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q219"
                     /translation="MRRSGLAYMLRSSVPLLATPAFLANVKHMRNIGISAHIDSGKTT
                     LSERILFYSGRIGKIHEVKGGTEVGATMDSMELEKERGITIRSAATQCRWKNSTINII
                     DTPGHVDFTIEVERALRVLDGAILLMCAVGGVQSQTLTVDRQMKRYGVPRICFINKLD
                     RDNANPQRAVKQAQERLGINAVFIQLNMGTAQDFEGVVDLIEEKAVYFDGPFGEAIRY
                     EPVPSYIKEDVVAARKELVSRLAECDEEMEFIFLNDQEPTVEQIHSAIRRATIANKFV
                     PVMVGSAYRNKGVQLLLDAVERYLPSPVERHNSGYQVRRVKDEDGNVSNVKEGEVALM
                     TDDEKPLVALIFKIEETKKSGLSNYVRVYQGKMRKEHLMNIRTGKNFLPPKLVRMHAD
                     SAEVVDEVRAGDICAIQGEVDASSGDTLMKSGPQSGSQLFSCEDMYVPPRVISASLKT
                     KDDKEQSRVRERMLAFMREDPTFVYYRNSETNEDIVEGMGELHLDIYVERLKREYGLH
                     VELGKPTVNYREIITERQEFDFVFKRQSGGAGQWAHLKGYAEPLPIDMSVEKGVKNKA
                     TTRCSNGDIRESLQKTVVKHLERKIFVKGELMHAPVWGVHFHLNGGAMHEVDSNDQAF
                     KNATQELWETLLPKLKPTLVEPFMDVEMTVPAANMTDVATEFSKREGVVTETAVDGPD
                     AVIRGETALDTMFGFISDLRRLTKGQGDFSMQFKEYRPMQQYKAQMRMDERNNDLGRK
                     PFKLSD"
     gene            <166720..>167460
                     /locus_tag="LMJF_36_0580"
                     /db_xref="GeneID:5655308"
     mRNA            <166720..>167460
                     /locus_tag="LMJF_36_0580"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686578.1"
                     /db_xref="GeneID:5655308"
     CDS             166720..167460
                     /locus_tag="LMJF_36_0580"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686630.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655308"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4Q218"
                     /translation="MRRGRLQEWHRTAAAVAGQAHRGSHRMPHHDYLTDFGTHHVATA
                     GELSRCVASVSDKSWIECFTNTVSETPLSSLTTSCSAVHANHPSTHFDLQAPLFLSEG
                     SLARASVIDLGGRSSRSFLHGMSSCSATPSCSKARRFQSYSLHPCNCGHAHRAKLVLF
                     AVQADILLSCPTKDRHMTAYHISLGAEVDQLVGHDDLILGGAVNPDDTLVATTSRDCT
                     AIVWGLPSCKQRRSLTHPQLVHACRFSS"
     gene            <170445..>171104
                     /locus_tag="LMJF_36_0590"
                     /db_xref="GeneID:5655309"
     mRNA            <170445..>171104
                     /locus_tag="LMJF_36_0590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686579.1"
                     /db_xref="GeneID:5655309"
     CDS             170445..171104
                     /locus_tag="LMJF_36_0590"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686631.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655309"
                     /db_xref="GOA:Q4Q217"
                     /db_xref="InterPro:IPR001040"
                     /db_xref="InterPro:IPR023398"
                     /db_xref="UniProtKB/TrEMBL:Q4Q217"
                     /translation="MKSATMSATHALRDKWFVSFLPLLTADMVNTDYKGNWQLAAQER
                     TQKLDWITSVEELWSTMNSLPKVHQLGMGSTLIFARNNKEPPSYEAYPNGSRIMINLL
                     KPPTTDAGLELVLAVVMGETAAEKASDGKPVCDVLRIAARPSREHSEQIRVEVWLSDS
                     TRSHAVAEFLAEAMRAKGLAANSYNIAEASFDAAAPGKDKKVLAASTMPSPSSPPMVK
                     D"
     gene            <173326..>173784
                     /locus_tag="LMJF_36_0600"
                     /db_xref="GeneID:5655310"
     mRNA            <173326..>173784
                     /locus_tag="LMJF_36_0600"
                     /product="putative ubiquitin/ribosomal protein S27a"
                     /transcript_id="XM_001686580.1"
                     /db_xref="GeneID:5655310"
     CDS             173326..173784
                     /locus_tag="LMJF_36_0600"
                     /codon_start=1
                     /product="putative ubiquitin/ribosomal protein S27a"
                     /protein_id="XP_001686632.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655310"
                     /db_xref="GOA:Q4Q216"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR002906"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4Q216"
                     /translation="MQIFVKTAAGRSVAVRVSAEDTVGFLKAQANVTQGNLFFAGMCL
                     AEEEPLAAYGLSKESTVDVVIPVEGGKGKKKKKRIFTKPKKPTHRHKLEKMRALKYFK
                     VTENDDGSYKVERTRQDCPHPQCGAGVYMAQHKDRQYCGKCHLTYKAESK"
     gene            <174967..>175752
                     /locus_tag="LMJF_36_0610"
                     /db_xref="GeneID:5655311"
     mRNA            <174967..>175752
                     /locus_tag="LMJF_36_0610"
                     /product="DNAJ protein-like protein"
                     /transcript_id="XM_001686581.1"
                     /db_xref="GeneID:5655311"
     CDS             174967..175752
                     /locus_tag="LMJF_36_0610"
                     /codon_start=1
                     /product="DNAJ protein-like protein"
                     /protein_id="XP_001686633.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655311"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:Q4Q215"
                     /translation="MTTFKQNSTSGNTSVLDDLFSSSINVSAPASTAGASAQPMYFSS
                     SASATQNATPSAAAANHSSVLTDLFSAPDVASSEKDDKYGSVGETHAMIYVDGNSGSA
                     EHGVTNLFDLSKPVKKDKYNSAESLLEAFERQGKKSGSGGGRPDERKTLADLTRNKDD
                     NKVRARLLPLMNYYDVLGVAPTASEEEIKRSYKKKALQLHPDRAGRDQMQEEAELFKV
                     ITKANEVLSDAEQRRMYDASLASGAGQPAMAPSAADWWCHMQN"
     gene            <177841..>178404
                     /locus_tag="LMJF_36_0620"
                     /db_xref="GeneID:5655312"
     mRNA            <177841..>178404
                     /locus_tag="LMJF_36_0620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686582.1"
                     /db_xref="GeneID:5655312"
     CDS             177841..178404
                     /locus_tag="LMJF_36_0620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686634.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655312"
                     /db_xref="GOA:Q4Q214"
                     /db_xref="InterPro:IPR006721"
                     /db_xref="UniProtKB/TrEMBL:Q4Q214"
                     /translation="MVFSARRALAQLLFGGAMALMHLLAMGAGAHMHASLSVSRLASP
                     LQCTFPSPLCLIRFCLPPPTLPRPQHTEAIASRRTCRSTHSYRTIFRHRFSWFHLRRL
                     FVLPYRGSHSPTMFRRSLMALNWRDQGISYVKYLNVTTEALHMATKDKVRAKYSRFSA
                     PNYVAVKNDGTGVMEEVKKVPAFTKDY"
     gene            <180098..>180664
                     /locus_tag="LMJF_36_0630"
                     /db_xref="GeneID:5655313"
     mRNA            <180098..>180664
                     /locus_tag="LMJF_36_0630"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686583.1"
                     /db_xref="GeneID:5655313"
     CDS             180098..180664
                     /locus_tag="LMJF_36_0630"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686635.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655313"
                     /db_xref="InterPro:IPR021994"
                     /db_xref="UniProtKB/TrEMBL:Q4Q213"
                     /translation="MPWYLSTFRVGFCAIYAYFGYVQVRWLLETEDRYRRSSTWKPAV
                     GTIFDHKVVMTRGGSSYVQYKFNVDGVEYIGDRFRSGGIHKEEMVSNPTLLGAGTQLV
                     VYYNPADPSESAIKLQADRGAESVFVIGSLLSFLIAFRAVRCETILPNMFYRFLGVNR
                     RVGGISGLRQARSHAKQRMKYGKHSGSL"
     gene            <181551..>182456
                     /locus_tag="LMJF_36_0640"
                     /db_xref="GeneID:5655314"
     mRNA            <181551..>182456
                     /locus_tag="LMJF_36_0640"
                     /product="putative ribonuclease H"
                     /transcript_id="XM_001686584.1"
                     /db_xref="GeneID:5655314"
     CDS             181551..182456
                     /locus_tag="LMJF_36_0640"
                     /EC_number="3.1.26.4"
                     /codon_start=1
                     /product="putative ribonuclease H"
                     /protein_id="XP_001686636.1"
                     /db_xref="GeneID:5655314"
                     /db_xref="GOA:Q8ISS8"
                     /db_xref="InterPro:IPR001352"
                     /db_xref="InterPro:IPR004649"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR023160"
                     /db_xref="InterPro:IPR024567"
                     /db_xref="UniProtKB/TrEMBL:Q8ISS8"
                     /translation="MTDTPSALSARLSTRLSGTKRPRESLIEFRVKDIMESLGVSEDY
                     LVLGIDEAGRGPVIGPMVYTGAVISLGEHDDLVRLCHVADSKMLNERRRLASLQQLRQ
                     LKTFRSFTVCVSPEEISKTMTGRSGRNSNTLSHETAIQIISEATLASAGKLCAAYVDT
                     VGPPETYQARLAGRFPHLRVTVAKKADSIFPIVSAASIVAKTVRDTAIEALGENIGSG
                     YPSDPRTMEWLRSHVHRFFSFPHAYDFARHSWGPLVQLANDPAVRVPVVCEQDLEGAR
                     QQGRGGDSRQQKLSFAKPSPKRHMV"
     gene            <183872..>185356
                     /gene="TTA2"
                     /locus_tag="LMJF_36_0650"
                     /db_xref="GeneID:5655315"
     mRNA            <183872..>185356
                     /gene="TTA2"
                     /locus_tag="LMJF_36_0650"
                     /product="putative GPI transamidase component Tta2"
                     /transcript_id="XM_001686585.1"
                     /db_xref="GeneID:5655315"
     CDS             183872..185356
                     /gene="TTA2"
                     /locus_tag="LMJF_36_0650"
                     /codon_start=1
                     /product="putative GPI transamidase component Tta2"
                     /protein_id="XP_001686637.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655315"
                     /db_xref="GOA:Q4Q211"
                     /db_xref="InterPro:IPR009600"
                     /db_xref="UniProtKB/TrEMBL:Q4Q211"
                     /translation="MPTATAAKAAARPPVRTSVERLLLHPFVVFLVTFSVRAALFTSR
                     YSVEPYISSPVIPHPSLEDIVGKAAAGAWHDAAQSAYVSGGRSQAERIVTPPPVHFSM
                     SISMTEASTWREVVYWRESGFAEVEPYYLQELALWYVRFIPAVLAKPPVTGLVLSAMD
                     GLTAALISRWSSATAALLYAFFVLNPIMVLTTTSQSLTSFELLLLTVTVDLCARRAKS
                     ALAYAGALVGAFTLGSHFIAVPVVLLAPLGTQSYRIAFAVAAALAACVGAYAVLYLYT
                     TEVSHRFASLYAPPDNGVLWYVRQLVLPSFARCLEVFMLQLAPMLLIPATVAFPASYL
                     RQPLSSTAHPHLFTDGRVFLLLMAEGLSVLFRNQLTLPYCFLIILHFYSSLNPTASKT
                     VTLEDQRVVTYSPYTRVRLLVPIFIQLTSIPLEASFYAGWVLRETANANWKFFSDVAF
                     MIGATAFFVMWYTEVVEDAVLCENDGGADAVTCSASPFRATKRD"
     gene            <186844..>186975
                     /locus_tag="LMJF_36_0655"
                     /db_xref="GeneID:12983070"
     mRNA            <186844..>186975
                     /locus_tag="LMJF_36_0655"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722885.1"
                     /db_xref="GeneID:12983070"
     CDS             186844..186975
                     /locus_tag="LMJF_36_0655"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722933.1"
                     /db_xref="GeneID:12983070"
                     /db_xref="UniProtKB/TrEMBL:E9AG13"
                     /translation="MLYLCKFPVSRPYRHPQDLSVRCLTWPSSLSQAYAHTHRHPTR"
     gene            <190205..>190813
                     /locus_tag="LMJF_36_0660"
                     /db_xref="GeneID:5655316"
     mRNA            <190205..>190813
                     /locus_tag="LMJF_36_0660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686586.1"
                     /db_xref="GeneID:5655316"
     CDS             190205..190813
                     /locus_tag="LMJF_36_0660"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686638.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655316"
                     /db_xref="UniProtKB/TrEMBL:Q4Q210"
                     /translation="MPGLGKFAFHVSFHLSRYFFAAVVAALLLLSLSGGSLAGTRTRD
                     GSTSGGAKNGTTRTVTTTTTPPTTAAPVSLQEACHTEMKLYCSDHPISPLRCLVEQYD
                     RTTKSNSEEPRRRTSVLYSDVCGSWLAAREACLGFVHQRGRELCGSFVGDVRECLRQI
                     PPLVLPHACVTSAYYESVRLVGKLRQHQNEDARLRLLREKLP"
     gene            <195591..>196982
                     /locus_tag="LMJF_36_0670"
                     /db_xref="GeneID:5655317"
     mRNA            <195591..>196982
                     /locus_tag="LMJF_36_0670"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686587.1"
                     /db_xref="GeneID:5655317"
     CDS             195591..196982
                     /locus_tag="LMJF_36_0670"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686639.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655317"
                     /db_xref="GOA:Q4Q209"
                     /db_xref="InterPro:IPR000620"
                     /db_xref="UniProtKB/TrEMBL:Q4Q209"
                     /translation="MADALPSALFIALAILFLFWGTVQTLSLKWADTIEASDGFTGPT
                     SGQGGSHAVHFRLLYSFAHPFTQAFFMFCAETSCLVLLVCTLVWKKYVAPRLRDSRRG
                     AAAAPTGELVAGEDYALPCSPSLWLLPSGADFLASIVQNVGLTLTYASVYQMLCGSTV
                     VWIALISYFWLGHRFTKVELWGMGCVVLGIFLVGLSNLLERGLNFESTSHGRHKSPVL
                     GNLLVLMAQILHAYQGVCEERLIRLYKVPSLQMVGTEGIYGIGMSLSLLAFLQLVPMA
                     TWGHNLASVEEFSASGGPGVLHANITWVQQLQPALKVPYDDVVLAFAQIRESWECKVF
                     ILVYLLSGFFYNACHMSVIKYVSAMATVMIGSLRNVTVWLVCLLIPSIFEEHFNVVQL
                     TGFVFLVLGNVLFHRIWIARFDAVLPAQVINACPVLFHDARKDREDMVKVEKRSRDTS
                     LEPQAREMRPKEG"
     gene            <199117..>202221
                     /locus_tag="LMJF_36_0680"
                     /db_xref="GeneID:5655318"
     mRNA            <199117..>202221
                     /locus_tag="LMJF_36_0680"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686588.1"
                     /db_xref="GeneID:5655318"
     CDS             199117..202221
                     /locus_tag="LMJF_36_0680"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686640.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655318"
                     /db_xref="UniProtKB/TrEMBL:Q4Q208"
                     /translation="MLDCLSLWPFFCLDGDAYVKRCSCRLKRSYRLPGDAYACAVIFD
                     HKKGNQKALLPETATALPPLPPPNRSKAVPSVQAADWHFQFQFAKMFADLLAAPSYHA
                     GDRSSDAGVAPVSPSFSPRCISASSSAGSRSGCHLRQLSAGGDDGSYPRVSPLVGTAH
                     PSAHTDGRARRPGFSECLSPLSIPEGCASSTTAMVSPSSGHPEGRSLSLGGSSEAPPR
                     RSSGGTLGNSLEGYIPMSGSSSFSSHHGDSARSPPSSTRTLSLYHHGQKALGVAFSTP
                     SRGATALLPEGAASPALDSAESSADDANFVVMRSGTREGGQQSPQSIASSKSSSPSAM
                     PCAPPLAQPKAGAVVVEKYAPMLPAPPSPLRFSVFYTEEEHRVLLETRETEERRCLYQ
                     AHKAVLSVYRMWAAAGADADYGDGDRPLLTSSRMGDGASTRLLEDYRGPKTPNTLKAK
                     AADTRAQPFPLATATAANAVAAERVRCFLKSSIDSARGRCCLGAGQEGGAAIGVLPHR
                     STTPRITYAGSDAETRRGSPGHVPHPQASHSSSPAASRMLDYSSVQMPETASSLMHDT
                     SEPPSSVHQARLLSPWRATHTDHHDAAARRAEGKADVHLEFRSSRDDSRGRSQRRPRT
                     SLVPHLVSTSPAAVRLSSASLSLGASSVALGRRSLLESRLRAETAAPREDLSRSAVLP
                     PARAAAAARAPSPSLRPVLSAGVRCLSSLSAAQTEGPGASQATWSPVWNASVNLVPAS
                     TAICQMSPSAEDDKTCDHVPGGAVRYASNEAFRRRQRAPLPGTSSGGLLSSLPHGIDT
                     DRRTWLAVDRLQDHHRERLSSYVHYKRFFDAVYGEQSGSPLVSREPDGRHSSAGRTSP
                     VPPCAVRTCSSMSFDVGDGNRHASTWPWRSSLSSSLYPRVRSPELVACRDLRHFSPSG
                     STAARRAPAPPSKEPTTFCARLTGGAASLTVPADGTLFAARLTRLSTLEKLCRAELQR
                     RCMEDQSLLLHHFIVEGTATLQRVGRTTALLHRHRQRAAGGTTKAYRMPSAWTFIPNE
                     VDGL"
     gene            <203107..>203913
                     /locus_tag="LMJF_36_0690"
                     /db_xref="GeneID:5655319"
     mRNA            <203107..>203913
                     /locus_tag="LMJF_36_0690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686589.1"
                     /db_xref="GeneID:5655319"
     CDS             203107..203913
                     /locus_tag="LMJF_36_0690"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686641.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655319"
                     /db_xref="UniProtKB/TrEMBL:Q4Q207"
                     /translation="MRRCCRLFAGSGNSTTASSSGAMISLREATRLAKIAGCFDSANG
                     SSSSLLRRCTDSACAQGRNVTSSSSSWEEIKRRQHQVFNERHLTAENTIAVTVSCVNM
                     AHLSVYVHSVQCGYPASHAPGPSGEGVPGKRTITTATLTNQSCAVLLLWVSMGSPELL
                     AVRCALSPGAVETCWRAAPAAASSDTTKAGSTIQTAAPSSTLSEKDKLRRIKSWAEEL
                     VLHRWVVVSGQLRMEDVYDGDLHKVVAVPVLEVARDHFKGSVLALPPGFL"
     gene            <204695..>205384
                     /locus_tag="LMJF_36_0700"
                     /db_xref="GeneID:5655320"
     mRNA            <204695..>205384
                     /locus_tag="LMJF_36_0700"
                     /product="putative MP18 RNA editing complex protein"
                     /transcript_id="XM_001686590.1"
                     /db_xref="GeneID:5655320"
     CDS             204695..205384
                     /locus_tag="LMJF_36_0700"
                     /codon_start=1
                     /product="putative MP18 RNA editing complex protein"
                     /protein_id="XP_001686642.1"
                     /db_xref="GeneID:5655320"
                     /db_xref="GOA:Q6T456"
                     /db_xref="InterPro:IPR000424"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR017084"
                     /db_xref="UniProtKB/TrEMBL:Q6T456"
                     /translation="MFRRLSPAAATRSMATMTHPLTSATQSQSVTSTRAAVSRVAMRG
                     CSSSSGTSSGDVSSTKGAAFSVSRSGQRAPSINCVTLVGVVHDIQTGYVFEDAVTQFT
                     LTTTSLDAANQAQECVVEKDHHTVRCYGDVFSREVRAKLSEGNVVCVNGRLRLNPQME
                     PSCNKYYYFPYIQVQPPHGQVSVVYGDRRSPPSPVNAATGELNNGNGDPTNSAAPAED
                     GDPSATTQKTP"
     gene            <207740..>208519
                     /locus_tag="LMJF_36_0710"
                     /db_xref="GeneID:5655321"
     mRNA            <207740..>208519
                     /locus_tag="LMJF_36_0710"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686591.1"
                     /db_xref="GeneID:5655321"
     CDS             207740..208519
                     /locus_tag="LMJF_36_0710"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686643.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655321"
                     /db_xref="InterPro:IPR003603"
                     /db_xref="UniProtKB/TrEMBL:Q4Q205"
                     /translation="MGTDKVMSEKLVLEKTKVKSLSDVQRLDMWGEGLTDISLVAKLP
                     RLEVLALAANNVSSLKALQGCELLQELYLRKNKVANLREVTALRVLPTLSVLWLRDNP
                     CAQHPYYREFVLHCCPGLRQLDGVEVTADERKAAAKRLTTKTLDEILGRSACADAASS
                     PRPKKSSGAGSSPAKATDVTPSSTPGGVSDSTATIEERNASSRSVLFTTVAAQRAMLL
                     SIVSLLSELTVESLELLQREVQERVEKQKEKLTKYVQENSQ"
     gene            <211089..>212384
                     /locus_tag="LMJF_36_0720"
                     /db_xref="GeneID:5655322"
     mRNA            <211089..>212384
                     /locus_tag="LMJF_36_0720"
                     /product="putative mitogen-activated protein kinase"
                     /transcript_id="XM_001686592.1"
                     /db_xref="GeneID:5655322"
     CDS             211089..212384
                     /locus_tag="LMJF_36_0720"
                     /codon_start=1
                     /product="putative mitogen-activated protein kinase"
                     /protein_id="XP_001686644.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655322"
                     /db_xref="GOA:Q4Q204"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR003527"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q204"
                     /translation="MSAEIESHILKKYEIQAQLGQGAYGIVWRALERKHNRVVALKKI
                     YDAFQNSTDAQRTFREIMFLHRLHHPNIIKLLHVHRAFNDRDIYLVFEYMETDLHVVI
                     RANILEEIHKQFIIYQLLKTMKYLHSAEILHRDMKPSNLLVNSDCTMKVADFGLARSI
                     LSLEGEQASRPVLTDYIATRWYRPPEILLGSTRYTKGVDMWSVGCILAELMLGKPIFP
                     GRSTTNQLELICSVTGMPSAADVAATNSQFAHAMLRDIHCAHRRTFAELLPSASADAL
                     DLIERFMRFNPNRRISAAEALEHPYVAAFHRPDEEAVAPEPITVSLPDSQRLPLAKYR
                     DAIYEQIAALRRSSTSADQRQRAERQTAGSTASRKTSVSSTAARAAPQRSAVKPTSTS
                     AVSEASSSKAYARPAFRSATSAASGLESRPVAREAAVRK"
     gene            <221343..>223007
                     /locus_tag="LMJF_36_0730"
                     /db_xref="GeneID:5655323"
     mRNA            <221343..>223007
                     /locus_tag="LMJF_36_0730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686593.1"
                     /db_xref="GeneID:5655323"
     CDS             221343..223007
                     /locus_tag="LMJF_36_0730"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686645.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655323"
                     /db_xref="GOA:Q4Q203"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:Q4Q203"
                     /translation="MGVLLFPPGHGFRLFVHFSRLSFFVCIFLRLCCSLLPSLALQTM
                     PSGNTQHRNWSSSNSGEVGSRQSPASTSEGRRSPNGRRSYQERITTVRFIQPSTGETM
                     CTKLNRVQRTKTKPENDAELCESFLKGHCDSGNGCQYVHVPKQYLWRLLSPHVDPKTL
                     FYYPGFNVRCYTPDMNVYYDIPSEFIYQTKGSDRYVELFNDNGDNFKDKCRLCPNLQS
                     HGICDNNEQCDDIHCAVADLDQFPHIATHRATKEAVARYEHMPPELIVRVYQPNTPGD
                     GMDFNGDDVLRTAGATQYEDAYKQTGGIPALKMQHCAHFQTKKLCRMGDGCRFLHVVS
                     VALASPSPDEEASMRSSPAPATITASATSAPNAATPTPTAAKMHTATTMTATVTAGRQ
                     LREEDVAMNAAAEMAAIAMAAGEPRYIGSHLDNTVPQVSRNGRPHTYGTQAVVPQQLQ
                     PHQQLQPYQSQQQPSSIYPYGPVSMGAVKERVSPVQYRSSGRLSPIKVVVTPGQMEGA
                     PAQRLSPVSLPSGGSSGTPTQQPHSRTSPLRRNNPYSLSPSSTSLN"
     gene            <239818..>241449
                     /locus_tag="LMJF_36_0740"
                     /db_xref="GeneID:5655324"
     mRNA            <239818..>241449
                     /locus_tag="LMJF_36_0740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686594.1"
                     /db_xref="GeneID:5655324"
     CDS             239818..241449
                     /locus_tag="LMJF_36_0740"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686646.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655324"
                     /db_xref="GOA:Q4Q202"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:Q4Q202"
                     /translation="MFPMDIANTGNQQMLYRNNQPPQQRQQHQMPQHHLQQQHHQMPQ
                     QQMFPSQYGYQQQQPYLAYPSTAGPNAGKGAMDFIPSQQYMPQQQMFQYGYTQQHQSP
                     LNQQFFHSVMAPQTQPPPPPMRYNQQGNSNSTNQYMGGHAGGHPRYHGGRGRGGMHSG
                     YGGQFHRQVHNSYFYNQQHHYSSNNAVPEKTPTVHLIHPETKKIISIKLNRIYSTMAD
                     IRPQLHQQSHSNGASASNVPSVTEDSKSEKASKNERPKEKSDSSPAPKFDPKTTKLVL
                     CTSFLSPKGCMHGSGCDKVHIAGLEYTWPQVEAKEVKKEGKKAYSAGFFVHCYDPTLT
                     RYYKVPSGSVYVTKGSADYVNMFNDHGDNFKMKFKLCAPMLEGAECEKGEECEDIHCS
                     VADLEAVRENSANATHINNIEAMADVPRLPADMTVRVFNQNSFDTWRDYPGGNLLITE
                     GAKAYQKQYEQEMNSVPTRKRMQHCAHFRLKDMCRLGESCRFLHVLPTEQELKERKDA
                     EVAEAAAQAAAKATEGVAGEGIMKSDTKDAGATIE"
     gene            <259145..>263017
                     /locus_tag="LMJF_36_0750"
                     /db_xref="GeneID:5655325"
     mRNA            <259145..>263017
                     /locus_tag="LMJF_36_0750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686595.1"
                     /db_xref="GeneID:5655325"
     CDS             259145..263017
                     /locus_tag="LMJF_36_0750"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686647.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655325"
                     /db_xref="GOA:Q4Q201"
                     /db_xref="InterPro:IPR015360"
                     /db_xref="UniProtKB/TrEMBL:Q4Q201"
                     /translation="MSALTPSVTPVTLRSVSGKSLLLTPPVTLATVLTVATAPPFSFA
                     PESVKILLHGRVVRLLQYQKQHGSDVLKLPLDASAYTPLRTTAKWAHSVALASSSSPG
                     AELKAEPRSVIVYGVPQHIQATASAPRTSAQEPAALPTPFAETHGKSLPMSTSLRAGQ
                     QECSDSTCTTVAATPTTPKASRHASLMRLPMSSPTARVAPIKGPLPYPHSPDGLHELG
                     KICAEFDSDDDEDFITLLQGAPPSIYNHPTVLYMSNKVKGDLVILQAAMEQIARVSPV
                     FFDWIVENPQRFLSALNRGGERSLQQVKDQLRMLAMRAMADQMSGETPSRHVMMLEVN
                     TRDGSPDVYQVEVQVGDFSDASTPSDSLTPNSLADNNSAEEEKGDGEDNVSTDEGLEE
                     NDTAASSVDASAEDGGVAGGTEEAEEEDERHRGAILLSSPPGPLEEPRSSHPPSDTVP
                     SPGRAVTGAMLSQRGSVATAEERASAEERELPLTPSTPADAVAAGVARRSFPPLPSTS
                     SAAARSASLDVAASPASPAVSPHEDSNAEDVQLSGLRKELQHVDSLTQQWAHQATNDA
                     AHRAHTAITKLRRDLFTMLNDLITTSSTPASLLRSFGNVRRLALLACDFFSTAEEFYV
                     QLDEQGVRSSVFGETPQDSVAAFAVVAALSRLLVRDVDAAVERQLQQGAAGLSRVGAL
                     RSLRRIHSIWESPALRWTTTEGPEKLLMALLQLCRQQRAVVLWYSSHYVLKEVGKTIQ
                     TIAYLLGGRGEAQRTVSLQRLKVSSKAHKQDEVADCITALSDALTETGTLSDAMRCQW
                     FTLMHSRYQRLVLPIEKDLPAPHMTSDPLYVCDTRHVLPPTGSSARPDTLRGTMVSAA
                     RWWAGYCDDRHTCCADKWCLALTERLWNVVTAMENAAAAATAENVALVLTGDGTEESA
                     ANSPSLEAAARDWLGDIAWIPVDSVVASSVATASTSLSRSVARHSAVLFEQVWPPAEA
                     KDGIAAADPSSSVAGVHGMLPLFSGDVHMVDVAAVAAGHRPVLQVAGGAALPTYLATV
                     ARSFVLPASAREQIFVRHLFGMFAKHPRIPVAAAVRDAALANARCQDSPWLVSEYVLY
                     DYGGALSTFTDAAEKADTVAAVGAAVTTKPAPSTAAAALPPPMTDPSAECVSDNFVRM
                     PSVPLSKRLSTPRPLPPTQRRPVRATVCSQLARAQAAAGAMAKRQYARSHAVDELYEM
                     MLGSLLEHRPTGEAEVLDHLVHYVESSQDAMRGRVYERQAEAAAAAAAKKVAPSTKPS
                     HSAVGGGSSCTQPQPPSGKPNSFARRRQ"
     gene            <267135..>269702
                     /locus_tag="LMJF_36_0760"
                     /db_xref="GeneID:5655326"
     mRNA            <267135..>269702
                     /locus_tag="LMJF_36_0760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686596.1"
                     /db_xref="GeneID:5655326"
     CDS             267135..269702
                     /locus_tag="LMJF_36_0760"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686648.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655326"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q4Q200"
                     /translation="MTRSSTLNRPVLLTKDASRSHPGAAYDTSSGARAAAAAAARASP
                     LPSPSVSSSDLCDTKGVSSSENRTCPAAATVQSVYLSRPSPPAPPPRPAGHRRSRRNS
                     LTSVKTNSSASFLPHEQNFSPDEEATATLRFFSTMPDLSAAKEEAEEEPWCSSPDEDL
                     TMGTSSSVLGGTGNIPFAAQSGGSEAAATPACGARKGGSDGGGAGAHSHDATSFAGPP
                     PSPHTSKGSVHAGGTAGVVARLKERGNAFLLREEFELAIATYTEAIRLDPAHEALWGN
                     RACAFLLSFRYLPAVADCLYVLHIYPGHTKACWRAAKAYAAAYRLAEAKKYYQLAQQA
                     CERDSMWRGSASASRRTASLSLMRSDRGGDETPDGLFARGAAGSSSAEAAGAFCRRDS
                     RLLKSERERQVLATEEAALGMVETYWQHLRHERWADALAAMDKVLTLPSYTGPTAVSW
                     QALRIEALLHLHPKKALSEAEALYRTYPDSLELYPVLAKTIFYDVHDAAATKRCLGLL
                     DEAAEKRCAQNHLLKVHVRYCATQLRERLPADAGKASAVHMEAWVKLHYLREDSRTAE
                     LRHTIEKFARHRDAGNAAYEAGDWDAAASAYTRCLETDRLNHALLAAVYCNRTAVYMQ
                     AGRWRDALGDADSAVALSPQYATAHARRGRVKLYLLSQEYRGQRAVLASCSAAPWTAA
                     IRERLQGYADAAVIDLTRAVELSPTTEHKTQLQQALAQRRAIKASLKPTCETPKSSMP
                     FSAASASEGERHRGQSAHSPHPQADARRAESAAICELTDQLKLLGLSILAPLAPGEFG
                     RLPEPKVIAKAYREAALRWHPDKWVTATPHEKQRAEQQFKSICVAYQALRERSGVVF"
     gene            <271472..>272785
                     /locus_tag="LMJF_36_0770"
                     /db_xref="GeneID:5655327"
     mRNA            <271472..>272785
                     /locus_tag="LMJF_36_0770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686597.1"
                     /db_xref="GeneID:5655327"
     CDS             271472..272785
                     /locus_tag="LMJF_36_0770"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686649.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655327"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1Z9"
                     /translation="MATDLDSFSTYIDHLILLLAARFHAPLEVSVEELLPSSMNLSAE
                     AQCPWELVACSVQQALRTPQTAQERLLMRHLDVHHFSASVCRERARYMQWKLQECRRR
                     RGDKQQLVQSPAVPSAARANTSSTVAASATAAGQPCDVACTSLHNDVCSLYKLVLQSL
                     PSTLGGTESDDDEEDAQAPTTSVQSLASASEPSSFERVHEVFMRTPAEQERDELVARA
                     RDEFLSQVQALQSVYYEKYHRWMDVPASVLDPPPASSKQPASTDGAAAALESAAPQRG
                     SESERAALLEALGAAAAPPPRHRKQANHASSSGAADWTEKPHTLASMLHQVQLRRPLR
                     PSAVSDDVLESLYRARAETEEAPKNLCVASGLRSCPPAASTSATPSFAGGCADTITAE
                     AVAVAPSSSQPSSSVAAVRKDTVPPASRRGRWQIVEYDDDDDGEG"
     gene            <274803..>278018
                     /locus_tag="LMJF_36_0780"
                     /db_xref="GeneID:5655328"
     mRNA            <274803..>278018
                     /locus_tag="LMJF_36_0780"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686598.1"
                     /db_xref="GeneID:5655328"
     CDS             274803..278018
                     /locus_tag="LMJF_36_0780"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686650.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655328"
                     /db_xref="GOA:Q4Q1Z8"
                     /db_xref="InterPro:IPR001300"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1Z8"
                     /translation="MSTLSLAPPSLSTPVIGDADSGDGDGAQRRMQKQRVLQRREEEV
                     ARLEATLARERVANANSLNTLRASLQRERLLRTTAEKGRQAAQAEGRHLRTALRALLA
                     QPPSNSNTEPLSSTVPVSLYEEARRLLLRCEKTFAELKALQLRSTDAAGLEVLRRYDI
                     PVLDEIPPAWPPVTPQRSGKEEDDHARCRARAGGGPNSTSAAREKAASGTTPLPMEDT
                     VTGLEISELTALSPDTPCSPSSATRQVRAATAACEATGTWRGKGRVPPVHTSSNGTAN
                     PDVGEETLSADGRRRPRPAVPSFPLPSSETSAAKVVQPWMGPMHEFAGSTPFLDATPL
                     QELSAEHHTRLSELGREDTIRDTDHLLRSLAEEIATLATSQGLRTASEVAALCRRRGL
                     HYVDAAFPPVSETLGFDSSGGCRGYDVDRRTSFVVEWRPRDAVVPRGRKAELLTSAGI
                     DPDSLRCGRLGDAGVVAALAALAESAGAVMSVLASTTSEDEDNGIYVVWLCVHGWWTR
                     VTVDAYLPCVIEENRPIDLYGCSSTTTYDLWAPVCEKALAKVLCGYHPLCSLTAETAM
                     GNFTGGPVECWDWWHRRSSTALEEMEAALNTSARGAGVVLLSTFSTAVLRDTSSRSVA
                     VAGAYAAYQRLGLRPGTSYRVLAVADNAEGEPMVLLRNWTRRREQRESGQACCRFDGD
                     SAFRGGDRRNLSPRRDSNDGTAAAKGWLAKPPSQSSAASSQCDSCVWLNYTKEVLPYF
                     DGCHVCFDCRRYHDLRVPIAFTGSRPAIPTQLVRVRVQEGFARPLYGVTRCPTRLWIG
                     LHQPFSRVDTSDAAPACFPWGLKMTLVGQEEAPVPFGGGGGCARPARRSYILSESFLG
                     EPKELPAVWMYLELEPVADSAPHPATDLQDEDAAATTTSTEFFVVPHMEWIVRKDRAH
                     TSQDDDGLGSLGCDVPSVQHRRSVGQEGQHRRLHKGAAPHSDQSGCASDAERAVWHQC
                     SNHHPTSLAELSLGNATTAIVAVLAERRESVLVDVVDAPEELRAAVYHDVLDRIDFSD
                     CSVAGGSGHRHTSHLSQASAATALGEVRCQLNGRCMLTFSW"
     gene            <281035..>282720
                     /locus_tag="LMJF_36_0790"
                     /db_xref="GeneID:5655329"
     mRNA            <281035..>282720
                     /locus_tag="LMJF_36_0790"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686599.1"
                     /db_xref="GeneID:5655329"
     CDS             281035..282720
                     /locus_tag="LMJF_36_0790"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686651.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655329"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1Z7"
                     /translation="MERDKPPPALRFARQWTLPSSSAGDAGFATLDYPSRHTESPSPF
                     SRSHVPLTPSPDRAGRRQPLEGSLAPGSPSPLPPLELSALTSGGAARHADASLERTSL
                     PVPAASSASNVAARCVQPMMSASDADGKSFWRRQAQRLEATCTALEEELRTVYRVFGK
                     EADGIPRVLEASSHTSLLAVGSVDPTYETVARERDMARLELAREREKNFLLRHRLREM
                     DAEVHGLQIRHARVVGQQRVGDASKRALPSFDSVSNVGVRSAKHRRASTRCCSSSRSS
                     AQSTRDVRRSPTYSHSRSITRPYTSSSAKREESPRPTPAPVSTCSAHYSDDSKVARSS
                     TASTSSSACRESGRRAANMSVADPAAFRKPHGLSTHSPVKPSRQATDAYEAEARDLLT
                     WLLSARPSSSSPSRRQLFLWQKGGAGSRGPESVRHSNLESPPRRVFHNGFFSAAVAIS
                     EGEGDGGRWARGTAHGAAKARPAIRDSRLLTPIPPQQERGAAHDEKARGHPTGAVRSF
                     CAMPLWMRATQSAADPSRDALSGKGAPTGHAGDGEWIAWQPHVIAPRQQSGEA"
     gene            <283379..>285259
                     /locus_tag="LMJF_36_0800"
                     /db_xref="GeneID:5655330"
     mRNA            <283379..>285259
                     /locus_tag="LMJF_36_0800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686600.1"
                     /db_xref="GeneID:5655330"
     CDS             283379..285259
                     /locus_tag="LMJF_36_0800"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686652.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655330"
                     /db_xref="GOA:Q4Q1Z6"
                     /db_xref="InterPro:IPR004598"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1Z6"
                     /translation="MHTLLFLSALGDPTTASEVGAEGVRRRVVFSEAHPPLLLTTIGT
                     SGHTALSKEHAEALAVISGNMSSSSSALDVPLVEVICSYPTREGLCAECPALLLLVYE
                     HVVAELQAGRRAVDVFRGTSRQDHLSELLAVRSLSELFERLYPLSQSCILDESTASSQ
                     FWRQARVTLEAAWAAPHDAKGRALLTQVRGQPRFHFCGPRDVETPGEGYPLHPVSLER
                     ALATSKRFLRTAMTCALDGSTDALAGRQPELRAVLQLAHLVPLTPSTGAPPRKEVTPE
                     GLSFCMVSLQQRWWILVNAALERVLLLTRAAVNGNGNTSGSSGVTKPLLWQLLAVLSV
                     LDTTQYVFAFPERQQDLAAHHLLARLSEVGLVYPLLSNDRKCFVLSPDFLHAIHWHAS
                     APLSLTFNHHLLRSASGVSGAGIGDLRREDTDTIITETNFRLFAYTNDADLLNILNQF
                     AELEEIVNGNLHCYRVTRASFAAAMRKGITAAQVLRFLSLRAHPSMLRRHGEREENGD
                     TASPSSAGGASSSFTFSASPRRGAVAGTCGSTTSIDAVSTLVVPQSFCDQMRMWESEC
                     RRVVFEHHVVLLRNMSTQQQKAVTAYLTDAGEVDAVVHAERGYMVIREEVFERLVAPL
                     LG"
     gene            <286130..>287509
                     /locus_tag="LMJF_36_0810"
                     /db_xref="GeneID:5655331"
     mRNA            <286130..>287509
                     /locus_tag="LMJF_36_0810"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686601.1"
                     /db_xref="GeneID:5655331"
     CDS             286130..287509
                     /locus_tag="LMJF_36_0810"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686653.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655331"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1Z5"
                     /translation="MMRRGAPEWFTQGKARERFHRYWPWALSSICAGLYLYNGEPFED
                     AAGAIVTKIRRPLLKTMEWVELHDVDPETMSLELPPDMLFGPLEFPKQMRFLLAALRA
                     DNELADGYLARVIIDRMDLSLDPPILSEGDFLAAGGKELLDFSVEDFTGTKSRAQRKH
                     IFFQPDQFLQFINIIAAYPTLTEYFVNEKDGVELVFQAYRHSKNPYACVMAMRSLTLF
                     SFTQAVDGTVERRILQSNGVKTIVDAYKQSTGDPTETRFPTLLLSSIMRHYPKEGGKE
                     FIDADGVEAVVNNLNIARYKGIPQHIRVLHDAQRLPKQSIGKKSVDARLEEADFLGVA
                     MGLLDTFPEFYEATGDLLKLLTRVVPAHADPLELLEYRAMPILSKYYVRWREDQSFQT
                     DGTRTLVAKLFELMLNDKTCQRCYDPSVASYELLECLRTAKLAVKDEQEKRVMRFPDP
                     QRQPASAAA"
     gene            <288511..>289416
                     /locus_tag="LMJF_36_0820"
                     /db_xref="GeneID:5655332"
     mRNA            <288511..>289416
                     /locus_tag="LMJF_36_0820"
                     /product="ADP-ribosylation factor-like protein"
                     /transcript_id="XM_001686602.1"
                     /db_xref="GeneID:5655332"
     CDS             288511..289416
                     /locus_tag="LMJF_36_0820"
                     /codon_start=1
                     /product="ADP-ribosylation factor-like protein"
                     /protein_id="XP_001686654.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655332"
                     /db_xref="GOA:Q4Q1Z4"
                     /db_xref="InterPro:IPR003117"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1Z4"
                     /translation="MSTEDASIAYAKKHKIHHLFELMATKVLLNRPENPFAYLRNLLK
                     DVEESEKNRVPYDPTEVHFNNDVGAAAPAAGNSGGSGAAAPAAALTSAKKEKRTVTLA
                     TFGLDRAGKTCALSVLESGEADKKYTPTVGFAPIKFPLDDYNLCVFDLGGAANFRGIW
                     VHYYHDCFGIVYVIDSAASDERVAESLKVLHETLQHPYVKGKPLLVLANKKDLPESRG
                     VGVVPQGFLEEAMGEPGAPHRVLATCAIEDDPVLVEGIEWLLEAVSKEYDTLAKRVAK
                     DSNEVKSEKARQRAARLAAIRGEDR"
     gene            <292454..>297937
                     /locus_tag="LMJF_36_0830"
                     /db_xref="GeneID:5655333"
     mRNA            <292454..>297937
                     /locus_tag="LMJF_36_0830"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686603.1"
                     /db_xref="GeneID:5655333"
     CDS             292454..297937
                     /locus_tag="LMJF_36_0830"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686655.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655333"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1Z3"
                     /translation="MNRLRRLFLPVMMRVILRFRRRSRWKDGQPPRQYTPESVVAAIM
                     STKLLLADCPQRMVESLAAGATFMSLTPKEIIVYANESHVSCGIVVLLYGQLEERRPE
                     PGGKKSKAGGGGGSTRPICTQPHRLHKAMSVLCLMPVMCEDRATSFLATRESEEADVA
                     IISSRWFWEVTYSMVQASLTTADVMGRTLREVVLPHRRDLLLADYFPTSVVLLRSWMW
                     SMLTASDRVKLSRSMEVRVLSVGDVLFDEGDYCPYIYVVRRGALAAIVKGETLTVLEA
                     GAAVGEESVLFHDRRNCRVVAVTVCELYALHAHHLLRRFLKYPESARRIIPAAIERQL
                     WWMEEGRTRDVFGLVSILSGVPCLGHTTDAMREEIARCASVLILPQGHTVVSTNTPCT
                     FFCVIGRGFVTLISSMKTAAVAETPSSANGIDRRSESQPVRRRFSAVKPMGIPATEMR
                     RESRSAGDFFGELCLKPHLWPYDVVCDSTVSLWQFDREAVLRVLERNRADAQALEVCR
                     QGIVLYRTQRGETSIIDGFEPPATPNASANGWRSCVGGQRSRAQSTDFATAPPGARSS
                     SAGSRSGRRLSLSHAAAPEWFSRGSPSEGPTPRGGRRAGVDWTPEQWTTYAMTRLQDG
                     LRAEDAKETPPAPSRELRGVDKEVEKTMNEKVLQLVAVQPETPPNPADCDISGDSSEL
                     QSIIVGQLFLIVTEKQSRFLRQVNDSNVRLITEDEDTQLVGVLNDSLDDMSGMDALHN
                     SEALVEVTEVMQLENISASPLEGSHFLPQRAMPSLSAHDSTDVTDYINLHRVDDVLTV
                     EASGGALAGWPMPNASIGRTRRSTSVGALGEASGVMGASLNPRTSLSRSHFVRPSSAV
                     PPSPRCASGRDDLVSPGAIGAMRPASSSEPRVMPPARTRPTSVDFNQLNNKLSVDRSA
                     SMLDRYVKIEDQNYFDNFVKVLPLQRDEMWAPDGVNTDSEMGTGSMVLLLLHVCRCDY
                     LSAEVMQRCARPIVKVTLGERVLVRTSVMGNCTAPRWPIEHSSFISFVRRGTNIVFSV
                     CDADDESRIVYQASFSTASIHENGGVEQRAMSLSELSVAGSPVNAEMDADAKSAESGA
                     RIQRGAKRPRMTMTMLAVTASKYKALRQYLETREKVAEDLPGTPENTKLFLQVMSVEG
                     LKHRIEAAVTAFLYNGAASTTVLKTERVIPKTRSPAWPGETSFVIISGEGGILSFDLQ
                     HRDAVIGTTEITIDELIFGGVGLRRLPLLQAQTGRLVIGHLVVGVLGARLGDSVESRN
                     RDWVTHLAVEKLSLAREGFSINPDPFIVLRSGTGAELMRTPLAFSAFEASWSMSEASC
                     LLQCPRLCGSTVSYQLEVCDSDAKEVIGRATILLSDRGLGPDHVHNLSLDPPGRGVVR
                     LRSLCLPVLELPARSAAGKASAAAALCPPFSSQLHLSEPATLLLLHMSGCAGLPGGAT
                     VELQIDAIGTLSIDAQRYLRTAVQEATTALQWPLSKASVLLRIPSQGDVDDRAAEAVG
                     LRQWQCHHQCHFAVYDGVVDDVSQIGQVAVPLSQLLNTALHTYPLFPRCMDADGGGLD
                     QQPSVGTTTRPRVAAERTLGSLQIFTLLGSLDRQASGTAEQGADALLTSMPAVGGNAP
                     PDQLPYYNPESADIAAARPASALPTTVVLSVSNICDVLPSASEKYVQLVVRHGATVVL
                     SVERQMGVLSHAEWSPTEASAVVSCGALPADAALVVELVAMDVVEGVNGEEEDGITSS
                     AAGAKAQSTARDKARHRTITNGSASVADLPLGHAELPVSRLSSVKAGEVRVVTLMLSR
                     SQCSSSLPDTAGRLPRVAPSMRALEDAQVVWPTVSFCIFGNRA"
     gene            <302089..>304443
                     /locus_tag="LMJF_36_0840"
                     /db_xref="GeneID:5655334"
     mRNA            <302089..>304443
                     /locus_tag="LMJF_36_0840"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686604.1"
                     /db_xref="GeneID:5655334"
     CDS             302089..304443
                     /locus_tag="LMJF_36_0840"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686656.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655334"
                     /db_xref="GOA:Q4Q1Z2"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1Z2"
                     /translation="MIYKAYGSPENNSGNTHMYSMYAPPNAYVQGQGGSRTMYGYAGT
                     GGHGSGHPFGYHANPSMGVTYEYNGGINVHHNGSAYRVGGGTNGRDRGGDVVSLRNLH
                     GYDQQATSDYEVHDNQLKAPVVVTPATVVSTLGSARLFSKPPKPIVYGSRCVVRICDA
                     FQEGRCAAGDRCHDIHVRPEYLAETRMEMSSWLFDRECEFRQTMEMDSEKTFSIFVAD
                     LKEVVEVPINSLVFTKGLYVDPATRAKRARGAGNHAHVHAMMQVPTSCGLYSTDPLQC
                     KWERWCNQVHIDHRWMQVKKAEFDQWFIELQNRYFSLAPDDTFTVHDPQLKSSISLPK
                     FSIAGFSRGLFQGSMKKLASVCLLFQRGKCTAGSCCNQIHVFPQYLSLAREFAAMEQS
                     PDALPEEKQRLRREMELLRGPLMKQEKQETAAMESASLPNVVSSANEGTHSDAMDIKA
                     AAEEDLASCGALFEHVQVDEDVEPVSHLVSANTSLTRRMNASAPDISLSVARHMNSDG
                     SYSFNPYGSVTSLPDGSTSFNRFPGTRGSGQPMDGNGSVQYTPGSVQLLSTDTKGMRR
                     LVALVSPESGNGAVELHRNGDDMGIGGNAGDGGTATVAHDRAPPFAAGHRSNGGYRAV
                     AHPLGDEGGRYDSGTQGEQSCSLHPLDFDASWHFSPTPLLGFDASTTSTHRNGSIRDE
                     DPAMHAHLRLTASNSSYIYPGSSTTSQQNLLSTPMHRGVTSNATTAARVRLAASAASS
                     RTHAHRSATSLPDSSTTNPAMGGSVSSMPTARPTFVGEQLTGTR"
     gene            <310531..>313197
                     /locus_tag="LMJF_36_0850"
                     /db_xref="GeneID:5655335"
     mRNA            <310531..>313197
                     /locus_tag="LMJF_36_0850"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686605.1"
                     /db_xref="GeneID:5655335"
     CDS             310531..313197
                     /locus_tag="LMJF_36_0850"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686657.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655335"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1Z1"
                     /translation="MWSTAVDVGGREVQVRLSPGVYRAAYSAPPANTDTGTDCASTAA
                     MPPKDVTKALSDARSRFHQLRDLRRELSGRPLPNTDGLSAAAGPAVHASSAFSSTLPT
                     ATLAQASLPVTCMPSAASFGLPLDRLSADDPVTRSVLRTAAAERALRLQQAENDELKR
                     VVVTQQQEAAQMQCLVDRLSSELTEMRRTVLRQTATMKSLAAEMERRDVYHLIKEKHR
                     SQAAASALATANASSGTLPSQSSLTHQQRLAQLEQQVGQLTTQKAELQQQVSHLSSHH
                     GGKQWSTPAIEDIDKDDDVMGEGSGADGWVSSARVELQRLVQALGAILQAGASPLARI
                     GADSEPVYELELSCVTRLASARTRRNPDDDAPAPGKVNSVVCICGPYSVRDVLLRVQL
                     GTENTGSLMRRSRRLEGVPQQSPRRCVLYAMRDTCSVVRICLYEGVANTEVKTGERCS
                     TESPAPAATATVAVHTLIATALASGNELETRHAAYSVHTVHLADDKGAPRDTVTFRVR
                     VTEVQHRRYSGYRENSCIDSDLDGRRRASPFPSLRTREPGGVRICERSATPLSSADAG
                     SAEGESVTKNLQRGQRRGPMLSPSRNDDTTLMKGQRLFAHSSFSSSTAPPAPTDEADS
                     RGTAEDAKGILEHVEPQTKPLPALLTLSEDSKEEVTRAAAAIFGSGSTTSTTFDGTSE
                     PEVKDDSPSAAAKTKKLLPLRDAPVPMSSRVAVSSDPPSTVGVHPTPNASDLSWPPPP
                     PVAVVPTPRLSSTPTTTPPAAAACLMRMHIKEVRSLHEGCDDDLVEDMLEHCSLQVAV
                     RVDGETVFTAPTRRNSSHAVWGAEEGSFTRTLTAGQEVRFEVLHDDKARSQAVLPVSE
                     ILNASGAKDLTLLSVGGGRPCGLLTMFFEGSV"
     gene            <315279..>316823
                     /gene="MKK5"
                     /locus_tag="LMJF_36_0860"
                     /db_xref="GeneID:5655336"
     mRNA            <315279..>316823
                     /gene="MKK5"
                     /locus_tag="LMJF_36_0860"
                     /product="putative mitogen-activated protein kinase kinase
                     5"
                     /transcript_id="XM_001686606.1"
                     /db_xref="GeneID:5655336"
     CDS             315279..316823
                     /gene="MKK5"
                     /locus_tag="LMJF_36_0860"
                     /codon_start=1
                     /product="putative mitogen-activated protein kinase kinase
                     5"
                     /protein_id="XP_001686658.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655336"
                     /db_xref="GOA:Q4Q1Z0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1Z0"
                     /translation="MSRLKINLDAIERDGASATEGFCADGVRIGSLLVSSEGVRDNQG
                     NSCVLSLSDLEVVPETAGGFLGKGSSGSVRRAVHRGSKKMVAVKEIKVTGQTHINEIR
                     RELETLHAGDFATPYLVSFYGAFAHEGSVFIAMEAMDGSLHELYKPVPPPVLASITRL
                     MLKGLTYLHRTRHLIHRDLKPSNVLYNSRTGDIKISDFGVSSNLECTKADAHSFVGTV
                     TYMSPERLRGEHYSYGADIWSLGLVVAELAVGVCPYAGLRGGSSEARFWALLQHLNGD
                     GAALELPPEMDSDLADFISACVVKSPDRRPTCTELLRHPFIVRHTAAVPEAEARPFAP
                     TTPTVHAPGELFSPLNSASPAARSAVPRASEGSTLRATSPSPLERHDGETDADVADRT
                     VVARWIHAVMVREVLHGARGHGRKDLHQEPLAAVSASTATDSGEGGGAAAVSAVSLED
                     VQVAQLREFRAERNLDQQSGDGGSAPVEQDCTAGVRSLTCEDLRWTSTGEPSVNLDDE
                     LNRLLF"
     gene            <320082..>322910
                     /locus_tag="LMJF_36_0870"
                     /db_xref="GeneID:5655337"
     mRNA            <320082..>322910
                     /locus_tag="LMJF_36_0870"
                     /product="putative DEAH-box RNA helicase"
                     /transcript_id="XM_001686607.1"
                     /db_xref="GeneID:5655337"
     CDS             320082..322910
                     /locus_tag="LMJF_36_0870"
                     /codon_start=1
                     /product="putative DEAH-box RNA helicase"
                     /protein_id="XP_001686659.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655337"
                     /db_xref="GOA:Q4Q1Y9"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1Y9"
                     /translation="MDKEALRRAQQASRAAFLRKEASERQKAANTVVEQKLRDIEQGV
                     VPASVAEADFLLHRSAEVNTASELFDVARRRQALGGEGEAFDRWSELAAELPSHPHSS
                     TFPIDASQVIEKMRNVHDAGVVSAPASAVVMDATSRPLSSAGYVAMSEAEVAERVAKH
                     AYVREKTFAELQEDRAAALQGQKERLQLQRRSLPMYQTREELVKLIRDNRVVIIVGET
                     GSGKTTQLLQYLYEEGFHLGPRQRKRLLTTPAGAADSSKVKADADGEGDRAIVDEEQD
                     ELRLICTQPRRIAAISVAERVAQEVGCPCGSVVGYKVRFDDKTGPLTRILFVTDGMML
                     KEFTNDPDLSSVRAIMVDEAHERSLSTDILLGLLRDVIRRNTNLKVIVASATINAEKF
                     SDFFDKAPVFTVSGRTYPVELFYSDEPVADYVTESAQTVLGLHLSKPLPGDILVFLPG
                     QDAIEACAETLQSYMDEAKGQLRPLLILPIYSSLPPKEQARIYERTPPGTRKVVIATN
                     IAETSITIDGVVYVVDCGLCKQDYYNPQAMVEELRVVPTSQASATQRAGRAGRTQPGE
                     CYRLFTAYTFHNELPPETIPEILRCSMSAVVLQLKALGIHNLLQFDFLDAPSTASLER
                     ALDHLFLLGAMKADGRLTVTGRRMAEFPLEPSLSKCLIRACALGCGRHMAMAAAMITL
                     DSIFINTRDAKERQHIKSAREHLFGFGNGDVTGYIRLMEEWLRAGPRAGEFCRANCIN
                     ARSMLRARDVLDQILKTFDRIGLDVERVPSKSSSDGKDLDEDDALAKALSAAANQIDV
                     EAVTRALLSGFFFNVAKLEADKWSYLVVRPMDTSVPTGARRSESAGAAEASVAEIHPT
                     SFLFGAGRKSNAHRTPSITTDAAAGVPPVLRERPGLVVFLQLRRSTKRFMTHVTAIGS
                     AEWVLQSAPVNYFRPEELETGLRKRQRA"
     gene            <323430..>324365
                     /gene="NU1"
                     /locus_tag="LMJF_36_0880"
                     /db_xref="GeneID:5655338"
     mRNA            <323430..>324365
                     /gene="NU1"
                     /locus_tag="LMJF_36_0880"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686608.1"
                     /db_xref="GeneID:5655338"
     CDS             323430..324365
                     /gene="NU1"
                     /locus_tag="LMJF_36_0880"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686660.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655338"
                     /db_xref="GOA:Q4Q1Y8"
                     /db_xref="InterPro:IPR001075"
                     /db_xref="InterPro:IPR014824"
                     /db_xref="InterPro:IPR017065"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1Y8"
                     /translation="MHRAHTYLLCIAAHLLLSPPPPSSPSRFVFASSSLSCPGCAFSW
                     VTRFVSSMLRRTLCCGMMQLHALPTPNPLCHTFTIPADSFESFVPQGQSCEVAHRGLA
                     WVHPLSQGLFEQYPQELMSVFIAPRHVSISVYTNVDWSKIEWSISSFLGHYLIFTNAC
                     ISPAKEYTLMEDDLELKDTDTEVLQCIKELLREQVRPMVQRDGGDVKLLNFNEKTGIV
                     SLAMLGACKTCPSSQNTLKDGIERVMKHFVPEVTEVIEDKEHQFYEDYGLLFDSEKAL
                     FKEAARLDRERQAKLRHNLTPMVLSYEVLNEPDGD"
     gene            <325528..>326277
                     /locus_tag="LMJF_36_0890"
                     /db_xref="GeneID:5655339"
     mRNA            <325528..>326277
                     /locus_tag="LMJF_36_0890"
                     /product="putative eukaryotic translation initiation
                     factor 6 (eIF-6)"
                     /transcript_id="XM_001686609.1"
                     /db_xref="GeneID:5655339"
     CDS             325528..326277
                     /locus_tag="LMJF_36_0890"
                     /codon_start=1
                     /product="putative eukaryotic translation initiation
                     factor 6 (eIF-6)"
                     /protein_id="XP_001686661.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655339"
                     /db_xref="GOA:Q4Q1Y7"
                     /db_xref="InterPro:IPR002769"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1Y7"
                     /translation="MTLRTRFESSDDIGVFSRLTNAYCLVAAGASQNFYSVFEQELAN
                     HICVVYTSIGDARVIGRLTIGNRHGLIVPSITTDQELQHLRNSLPDSVKVQRVEERLS
                     ALGNCVVCNDHVALIHTDLSRETEEVIRDTLQVQTFRTSIAENALVGSYAVATNKGCM
                     VHPKTPAQDMDEISSLLQVPVVAGTINRGNAAIGSGLVVNDWAAFCGLNTTATEITVV
                     ERIFQLRRETAGGDEGNLLQNVRETLVDELA"
     gene            <329981..>332362
                     /locus_tag="LMJF_36_0900"
                     /db_xref="GeneID:5655340"
     mRNA            <329981..>332362
                     /locus_tag="LMJF_36_0900"
                     /product="putative protein kinase"
                     /transcript_id="XM_001686610.1"
                     /db_xref="GeneID:5655340"
     CDS             329981..332362
                     /locus_tag="LMJF_36_0900"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001686662.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655340"
                     /db_xref="GOA:Q4Q1Y6"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR028375"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1Y6"
                     /translation="MADGYHNNPVVPKVGQRFGPYQVGDTIGRGTFAKVKIGYHETTK
                     VRVALKIISRKLMDGDARSALKIKREIKIMRVLRHPHITRLYDVVKTKHDIVLVMEYV
                     SGGELFDYVTLKGRLEEPTARALFQQLTAAVAYCHRYRVTHRDIKPENIMMERGCHSV
                     KLSDFGLSSITHDGRFFETSCGTPNYASPEVVSGRLYGGPEADVWSCGVVLYAMLCGT
                     LPFDDSNIALLFKKIQTADYAIPSHVSAQAQDLLHRVLVVNPLERATMEQVMQHPWLR
                     PDFPRYLLSLHYAAIVETTRFASTYYLTEDMLDEEVVRVVASRFRVSPQEVASIIMSE
                     EERIPSMRAVISDEDNPNSMARRYPAANYFEMYSNVLDSKLWPTPVEIAAAEVALRDQ
                     THDIYVSYVILTQKKQNKLTPQEHAANPSFGESANSLLQSQAHQGYGSLNANSLQQLT
                     GNSSFTGLSFKETSSRSHAQASSSPASKKSNHHSGKTLQHLSPPLQHIMSSTVPVAPP
                     GDPWQSGYNVVTAPFLPLHAKGATSTVLGQILRVQELPVQLLMSRRITVKPVKREASS
                     TMFLSPGLQKSTPSFDCISDTGAAPTSMSTALQGNLLQPQRSPTTRTCSAAPTLLHLH
                     SKVEVGLSSSCSPIPTGRPMRSNGADVRHNLATAGGETALDTLYHAETVTRFGNDFIR
                     NGVAFVNSTSHETLQEVYEAMKEEGLLWKVIYDYYFSVVRYPNIKLQVKVYKTKSDEQ
                     LVDVKVSAQSGMAAYDVALSLLERLRTRAVNKRNTQIRERNASALKTLTPDTT"
     gene            <341252..>345940
                     /locus_tag="LMJF_36_0910"
                     /db_xref="GeneID:5655341"
     mRNA            <341252..>345940
                     /locus_tag="LMJF_36_0910"
                     /product="mitogen-activated protein kinase-like protein"
                     /transcript_id="XM_001686611.2"
                     /db_xref="GeneID:5655341"
     CDS             341252..345940
                     /locus_tag="LMJF_36_0910"
                     /codon_start=1
                     /product="mitogen-activated protein kinase-like protein"
                     /protein_id="XP_001686663.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655341"
                     /db_xref="GOA:Q4Q1Y5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR029787"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1Y5"
                     /translation="MHSSSSVMQPEPEATQGMELPTCACKPQHPDLEAPASLHAQSKE
                     INPLVLGPPPCTILCTEHERKTRRSSKSCIASSPGQHQRMGDGVGFKVLNLVTGWNLP
                     RRSSTHRCFCAADGDVTVEPQPLSLAGASTKCPVHTPASASSPTWGPRDENGVLVVSP
                     DDRPEGLVNSRRRYSRESKPAVTGEDGVLLSEYEEDPADAAVRQTLARVRSKNCVLLI
                     VLLVIIIVLAVAGGVGVGFVNKHYTTLTHRMYLESGERIVLNSSIMLLRNYHETLRAD
                     VRNLLSFVRSLMVSRPPESVAMVQNTLYLPFFEAWSTWLFSPSVPSTHSIYVSMCGEP
                     PINTVDCPIMALAIVCMPNSPQVTCFYMHSDEVNRSRMTVNRIEVNEFGIPRIGAFYK
                     YEPLKVSYLHNQTSNDYGYFLDQGCSGSLPQKVHTTLTIRRQIVMGDLLIICDASSFF
                     ERWFQRFERGLQKKKDSHSVLFASDGAVLAYECGAAPRSRELVSPCNTGLVPDNGRDC
                     RVDKTAMMHRIVDTFTEAMQRNKLLKRGRQQKSHVALTRRIDDYIVAYQDFLSFRVGD
                     DKLETVFIAAYAAPLDTSLGRDGFVQISICVVIIIICMFLLGVVAMVAVNQMMRVVEV
                     ISQLSTHAATYDTKRMRSVLDRQKPGMLARVITSADIINCEFQHILTNLNAYRPFLPQ
                     SLLTKSSYSFSDEALERPSSHRIDVALGGNAAGDVVVDKDGAPAKPLPRFHLRNTLEG
                     SVANPVENWRLLQRGFHRTKSTILVVSLSNVALDAGDSVDAVNLFVQTVLNHAAIANG
                     VVEVIEFQKIVVSFNSHFPVPRHQEKACLCALAIREGFRDSGCSISIGIASGYNYVGT
                     TGTEQQKARVIMGESLVVAQSLTSLKNYLGCSILATDQVVFEALVTAVAVDVVQLYYE
                     HNHQWVQYGVSEIIGNRYAVLSPDMQLVKSVFKLVRYRQAEEALEAVRRYMDAAAERH
                     EAPSWPARRIHALVERQQLLIKSGYRRKRLQWQALEGDEIIMSHLSEENQSYNSKRQP
                     RLMATVSTATVDSLVTLSTHAKATPCEFGFVSGDMLNAGREAELARALVGEQSKLSMS
                     RRQLAPIPSSYFSEDALFPVFTVKSSDGDDEERSPVSSMLSSQRDCGTDGNAEASGAD
                     SEEMRPVLLVEPQRLRSEGRHDVRVDALLPPSTVTTSPFRPAHGMKYPCITPGISSML
                     SSSRHRSALDRQRQIAPAPLRGDTCHASAYATSSALGGGGGGKPSISASLATTSAGNL
                     GRTADSALKQSNENAAGLAKMHCSYKLPQRIVSVNGQVFHRTSQLVGRGSFGEVYVAV
                     SETGSLGAMKVFPLNDNNAPQLIREVETLSLMRHENIVGYDCCAVQDNFFFIICEYLA
                     AGTLGSLIQKLGVIPERAARKYACDVLFGLGYLHQHSWLHCDIKPENILVTSDGTCKL
                     TDFGAASLGRSLMDAVSVRGTPRFSAPEAILGTWNQQADIYSFGITVAQMVTGVHSWH
                     KYTEPDHLFVAHYAGEIRHSLQTGMPCAMQPDLPTNLQDKELESAIHRCCEFDPARRP
                     TAEELVTLLS"
     gene            <348784..>350532
                     /locus_tag="LMJF_36_0920"
                     /db_xref="GeneID:5655342"
     mRNA            <348784..>350532
                     /locus_tag="LMJF_36_0920"
                     /product="RNA editing complex protein MP67"
                     /transcript_id="XM_001686612.1"
                     /db_xref="GeneID:5655342"
     CDS             348784..350532
                     /locus_tag="LMJF_36_0920"
                     /codon_start=1
                     /product="RNA editing complex protein MP67"
                     /protein_id="XP_001686664.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655342"
                     /db_xref="GOA:Q4Q1Y4"
                     /db_xref="InterPro:IPR000999"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1Y4"
                     /translation="MVQEWWVSAAQEAVISRKATSRAERIVTEADDPRSGTSHFYDSD
                     ARLCLVCNARLEGSYSAHSHSVDHKPRVALLKRTIGMILTFLEQAGSSPSLPPPPESD
                     SPYSLPGSKRFLVSVSTHTGTPAAPAPSCFHALYAESPLFAEDGVPSRALLYHRPCTL
                     REFDLVDVIMRRWWNTLHNPPPRRGSISFDRLLSLSSAELQMRRWRVRYLLHFLKSRG
                     VLRSCLTLRSDQVNAAPSPNERIHRGEAFERLEMVGDFFFKSLTPDRMHTVFPADEGG
                     LTAELQCFERALDSNHGLLAIYDYLGLDDIVGCFLANNKAKADVVEAVIGELKVLLWS
                     TEVVWGMEYYAVPGERATHVYLRALVAHTIAELGHTVLMWQLESTLRNCRDFLLKHTV
                     EEYLGAEKGNERRASRGGDGCDVPADLPKYSPLPPLLAWNRRRLGVSMRRGEVPLASK
                     QSRSSIPPSPQDPLRRLAPTASCIPEAIRDHYAVGRKKWSSYACKTAIQALCASLTQT
                     ALQHDSGHTADALSLNSSSASLPLSPEPQPSPTTPAYACVPRSVLRALVTANCVVIRN
                     SAPPLARSTSTRRVAG"
     gene            <355499..>356155
                     /locus_tag="LMJF_36_0930"
                     /db_xref="GeneID:5655343"
     mRNA            <355499..>356155
                     /locus_tag="LMJF_36_0930"
                     /product="putative 40S ribosomal protein S18"
                     /transcript_id="XM_001686613.1"
                     /db_xref="GeneID:5655343"
     CDS             355499..356155
                     /locus_tag="LMJF_36_0930"
                     /codon_start=1
                     /product="putative 40S ribosomal protein S18"
                     /protein_id="XP_001686665.1"
                     /db_xref="GeneID:5655343"
                     /db_xref="GOA:Q4Q1Y3"
                     /db_xref="InterPro:IPR001892"
                     /db_xref="InterPro:IPR010979"
                     /db_xref="InterPro:IPR018269"
                     /db_xref="InterPro:IPR027437"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1Y3"
                     /translation="MFTKVFPPCSPRFSFLQNATVCDNFAHPQLHLPPCPLPLHTTRD
                     AVLFSALPCNPPPKPLAEYPRMSLTLIPDHFQHIVRLLNTNVEGKRKVPFALRMVKGV
                     GIRFAYLVCKKAGIDVERRAGTLTAEELEKIAEIIADPAKFKIPDWFLNRQRDPKTGK
                     TEHLSSSMVDTRLRDDLERLKKMRAHRGVRHAYGLRVRGQHTCTSGRHGKTVGVSRGK
                     "
     gene            <357155..>357616
                     /locus_tag="LMJF_36_0940"
                     /db_xref="GeneID:5655344"
     mRNA            <357155..>357616
                     /locus_tag="LMJF_36_0940"
                     /product="putative 40S ribosomal protein S18"
                     /transcript_id="XM_001686614.1"
                     /db_xref="GeneID:5655344"
     CDS             357155..357616
                     /locus_tag="LMJF_36_0940"
                     /codon_start=1
                     /product="putative 40S ribosomal protein S18"
                     /protein_id="XP_001686666.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0930"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655344"
                     /db_xref="GOA:Q4Q1Y2"
                     /db_xref="InterPro:IPR001892"
                     /db_xref="InterPro:IPR010979"
                     /db_xref="InterPro:IPR018269"
                     /db_xref="InterPro:IPR027437"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1Y2"
                     /translation="MSLTLIPDHFQHIVRLLNTNVEGKRKVPFALRMVKGVGIRFAYL
                     VCKKAGIDVERRAGTLTAEELEKIAEIIADPAKFKIPDWFLNRQRDPKTGKTEHLSSS
                     MVDTRLRDDLERLKKMRAHRGVRHAYGLRVRGQHTCTSGRHGKTVGVSRGK"
     gene            <359363..>371881
                     /locus_tag="LMJF_36_0950"
                     /db_xref="GeneID:5655345"
     mRNA            <359363..>371881
                     /locus_tag="LMJF_36_0950"
                     /product="putative dynein heavy chain"
                     /transcript_id="XM_001686615.1"
                     /db_xref="GeneID:5655345"
     CDS             359363..371881
                     /locus_tag="LMJF_36_0950"
                     /codon_start=1
                     /product="putative dynein heavy chain"
                     /protein_id="XP_001686667.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655345"
                     /db_xref="GOA:Q4Q1Y1"
                     /db_xref="InterPro:IPR004273"
                     /db_xref="InterPro:IPR013602"
                     /db_xref="InterPro:IPR024317"
                     /db_xref="InterPro:IPR024743"
                     /db_xref="InterPro:IPR026975"
                     /db_xref="InterPro:IPR026983"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1Y1"
                     /translation="MAANLSVRGEVPRAELLQRKRQRIDTGPALSELLIARGMHAGAA
                     NDLEGIAEGGGAGIAPCAEAGDYATWLPVEAFDDAFRFEELSPGDWAARVAAAPSGLP
                     CLFWKLDHRQHQRGGIWASGRVVEVDADKQLYHVLPDDGRDLRSSQKQKADLNGSAED
                     TRPLVLPRVFVCFAAEDPVNFADRFAAAHKRRTIAEAALRTELYVDSIPLDEYAALDP
                     LVIRRVLDAAVSTPALVESESNLNVAGVLEEVRAGYSRVMNADLFHSITQGGGLSQLM
                     GPSATSSTMLSASPLFVSDTARPVPLYGVPSHQAERFAATVAAFRQQCFWNTSPVLAA
                     LTRAVCQADDALLSGCVFVLYSTTKMKRPLSLMELEEIETTAMRDSFLHARDHWLTPT
                     ADMVKRTLSTFPSTDPVHLHHYDVNTYTGCSTERYLRQIQLHMQDTLQHYLISSLEAL
                     IRFFEHAGDNHVTVHGMAEVEVTRGAHPAPRTPFGADERITAGFLVPPPHPLPPLLSV
                     VLLCTKHVSDAGAKPAQGASETPATEVQAPKPSAGDVPKEDESSEKAEKPSAACLSYS
                     CSVESIRVSLQGLLKRCLTQHRTLRTVERVLFDFLYDPATAFLNVPSESSMLMESWMQ
                     RIDVILDRVAVAMKSYRETYAPFTAVIELDLNAYMATFDERFPSMRGVEAEVQRFLTL
                     QLQVLDGIPVAADLGFVRVDCSELRRELSKKCAMGAAKVLDVMAARALRKEIEVNDRY
                     SELYATLLKLTETPEEVVAAKDFIKTIPERVVDLETAIEESKEIHELLKSFKRPLSEE
                     EFNKKWKAIGWPSQLDNAVTERVEELEETKRRLLASMNRAQDLFEQEVERVQKIVEHY
                     GQHRNAHRMTEIAEDVVRVQEKIRQLRSQASTFNTHESLFNMEQTDYSAVHQLATDFE
                     PYEALWITSASWSAALEKWHELPFMSIDADEVERIVTDTLRIMNTCVRNPQLRPELVQ
                     VAERTRENVQQFRPLVPTIKYLRMEGMQERHWSQLSKELGQAVEPAVTLQSLDDVVRM
                     NLTQQNDVLMRISEIASREYHIETSLAKMKAGWADMRMSVTAYKETGCSVISKDVVDQ
                     MQEKLDDQMLLTQSLSFSPFKQLFEDEIANWEASLKLVQDVLDEWLRCQKSWLYLEPI
                     FQSEDISRQLPGEHKRFQVVNKNWKFLTNKAQEVDLTLEFCTTTERCLELLKENNDTL
                     EVVERGLNQYLENKRASFARFYFLSDDELLAILSEARDPQKIQPQFRKLFENIARLDM
                     RNADNEMFGMYSQMEEYIPFAQSVLPRKYVENWLTEVEHMMKISIRLQLEAGVKNAAA
                     MKRQAFVLQSPGQVAIAVSQIMWTHECEMSLKEQGSLSPYMETAQRNLMVLVETVRLP
                     LTNLQRMNLSGLITIEVHARDIVEQLAKAGVDSVYAFEWVSQLRSYWENNDCVLRQVE
                     AQFRYGGEYLGNTTRLVITPLTDRIYLTLTGAMHMFLGGAPAGPAGTGKTETVKDLAK
                     AVAKQCVVFNCQEGMTYASMAKFFKGLAQAGAWACFDEFNRIDVEVLSVVAQQVSSLQ
                     EAARTRQFRIPFEGTEIVVDPSYSVFITMNPGYAGRTELPDNLKVLFRPVACMVPDYA
                     MIAEIRLFSFGYSDSRKLAQKMVATFRLSSEQLSSQDHYDFGMRAVNTVISAAGLMKR
                     EHPDEAEDVLLLRALRDSNAPKFLEEDLLLFDGITSDLFPGVQLTPTGYGDFLAALET
                     KASSMRLQPTEMFVKKCVQLYEMSVLRHGQMAVGPTMGGKTSATRVLQAAMTHLRKEL
                     KNTRFAEVKTYCLNPKSIMMAQLYGGFDEATGEWRDGIIGEVFRIAARDTTDARQWII
                     FDGPVDALWIESMNTVLDDNKKLCLISGEIIAMTPYMNCWFEVEDLAVASPATVSRAG
                     MIYLEPNTCIGVRNFILSWQQYRLPVTMDPYKEYLQELCEQLFPSLIHFVQTEVTEYS
                     PSSWPNLLVSCFNLLDCFMSPYTPTRTYEVPQDKLDLLREIHLHLLIFSIVWSFGATG
                     DRLSRQRFDKFLRDELRLRNVNIELPVIGCLQDYQFIPEERRWIAWAERLPPFTTQVT
                     QSNFSDIIVLTADVAQYKYVNRILLEHSYHTLCCGPTGTGKTVLMRQLLMHDMPKECT
                     PIFFTFSARTSANETQNLIFSKFEVRKRASPQVWGAPLNRKFIILVDDMNMPLKEQYG
                     AQPPIELLRQFMDYKGWYDRRTREFFSIVDVVLAGTMGPPGGGRHFITQRFLRHFHQI
                     AFPEIEDDSMSCIFLSLLESYFSLFAEDVRGKLSAIVMASIEVFNAAVKELKPTPARP
                     HYLFNLRDLAKVMDGLTNATPTTVKTVPALVRLWLHEEMRTFQDRLTNDADRAWFQEL
                     LGKQLHKHLKLSVNNVTQRHRGDGGAAADSTNPQTLAADMNALMFVDFMGGNSEQRIY
                     QEAPDFEAVVKTLEQQLRDYNQQCVGGRQLDLVMFADAAQHVCRIARVLRKPNGHALL
                     LGVGGSGRQSLSRLAAHLNEYELFQVEIAKGYTMNAWREDLKAVLQRVALQKKQVLFL
                     FADTQIVHEAMLEDVNNLLNSGEVPNLFVGQELDDLLSSMRHVCVAEGLPVDKVTIFA
                     RFVRSCRSQLHISLCMSPLGEVFRSRLRMFPALVNCCTVDWFSAWPQQALRSVARNYF
                     AMVPLLAQQATAVEACTEVCVRVHVSVDAASVRFLAETQRHNYVTPTSFLELLHTFRA
                     LMETQTEKNQTTKDRFINGLAKLRETEDAVAELQQTLSQSQPVLLEKNESIKALVAEM
                     ELQTTEAEKTKKEAQKEREAVATMQAECAAIEGAAQEQLAEALPELDRALESLKNLKS
                     SQITEVAGYKAPTAGVVMTMQGICILFQIKPQMRAAGLMEKKADFWATAKEQLLNNPN
                     LLLQRLIQYDKENIPEKLIQAVMPLVTSDDFTPKKIAGASQACAAMCQWTHAMVRFHE
                     VNKKVAPLRQELAVAQQANQKAQQKLKEAETQLSDVAERLADMQRRKEEAERELEELG
                     QTVKRTALRLERAAMLIDGLAGEKRSWMQSLERIDESAQYLMGDMLVAAGQIAYCGPF
                     TSVYREELLELWGKELDQRSILHRAQYSIYHTLQDAVETREWILNGLPMDTLSIENAL
                     FAKSARRWPLLIDPQTQGNRWIRRTYKDSLEVVRPSQKDLIKRIEYCIRAGRPVLLEN
                     IGEDIDASLNPLLERRTFMEGGTEMLRISDTPIPWNPKFKFFMTTKLPNPHYIPEVMV
                     RVTLLNFFITPRGLEDQLLGVVVGQERRELEMRRSDLIQKNAAMKADLVNTQESILCK
                     LKEVQGDVLDDVELIAYLNESKEKTLEITTRVDEAEAAEVELTASREEYRPIAHHSSC
                     LYFCCSTLSNVDPMYQYSLQWFVQLFIASIEQARRADDVAQRLENLKEYFTYSFYQNV
                     SRSLFEKHKLMFSVYLCVRLMDQRGQVDAAEFRFLLQGPTLVADAKDNPDPSWITPAT
                     WNEWCYLDQNFAPFKGLKAHLCAHLPHYKELFISSAAHRQPMSADWADKLTPMQHLMF
                     LRCVRPDKLMERLQDFVLAEMGEKFIRPPPFDLLTSFKDSGPAVPLIFILSQGADPYD
                     DWKRFADAQNMSKKLYDVSLGQGQGPRAERMVQEGMESGSWVLLQNCHLATSWMPTLE
                     RLVEAITPNTHPSFRLWLTSMPNAHFPVAVLQNGVKMTNEPPKGLQANVSRSIGAYSG
                     EFLESCQKSVELKKLFFSMCFFHALLQERRKFGPLGWNIAYEFTSGDLSCCAAQIKMF
                     LDKYAEVPYTVIRELSGNIHYGGRVTDEWDRRTLNTLLERFVTPDVMSDGYLFCPRLQ
                     EYQSIPVTNRQGYLDYVASWPLNTNPETFGLHENADITCARTETFETLQAIVLLHGDE
                     ARRGDGVPSSSAAASTPDDMVKTFAEAIHRKVAAPFDVDQFRRKYPTKYEDSMNTVLV
                     QEAIRFNRLVTLLHQTLEQLPMAISGEVVMSKELEEVYLALYNNQVPALWSDKAYPSL
                     KSLGAWVDDLVRRLAMVQSWYAHGHPKAYWISGFFFPQAFLTSVLQNYARTMHISIDT
                     ISYEFEWMSTDPASVATPPEVGCYIHGMFIEGARFDPATLTLAESLPKVLYEQAPLLW
                     LKPVINRVPPASGIYECPLYKTVRRAGTLSTTGHSTNYVLAVEIRTPPRADPKHWIRR
                     GVALVCALSV"
     gene            <375357..>377912
                     /locus_tag="LMJF_36_0960"
                     /db_xref="GeneID:5655346"
     mRNA            <375357..>377912
                     /locus_tag="LMJF_36_0960"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686616.1"
                     /db_xref="GeneID:5655346"
     CDS             375357..377912
                     /locus_tag="LMJF_36_0960"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686668.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655346"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1Y0"
                     /translation="MFVHCNQHHDTCSLLLLPTPPPTEPLPMIGCRKLQCRGSWKQAF
                     CSLPVKATAGMTYLCALAAVLACFSTVSAMLYICILGLDDVYSVQNSQNVYYSNESLA
                     VASGALGDTANTAESPTLLFPQLRASVGLHTVCLGYNCFLRSRLSGVSALVANAAQGT
                     TRRRLPRELAAAYEEATYQYIFGFDIGAHCGTPRTKIQSLSTFGVAASALSLVLLFGL
                     LAVSMGLCFVAGTTDFLASDTTADGDFHLTNVDALDVPASYGMRQIHRHLRMKTPLLL
                     SAGILSFFVLCTSACTMGVTVALNRSKSKCGQSVCGAFKQGMEHFYELADSLHVNVST
                     PRTYSCQPGTSYILVFVTFCSSAVCLTMSSAIFFCYRHSRHHEQMLEMRDQLRRITEV
                     QGLAGGRSVARAESRRGTALASKSSLIVSVSSRSQAYSDMHHSDFCADGELARRRYFG
                     NPVEGAQRRSRSVGAGIEQYRLLKQFMAEEEHCRRYIKVMESGHFQVFLVLRETVWLT
                     EKLCRLHKFTLNCFVGPALEICVRETQCRQQLIREHDAGVTEVLASLREDARVASSQP
                     RQPRVGGAVLQEQERAVWDERVRRWQQVRADMSRSFQRTASHAAAEAPLRRRPSSPAH
                     LRTASCAGPNMVEWFQKLEQLDATSVDELFLAGSLAELPPRRNGRHQEACTSTSFSSP
                     TRTRAGLLFSGGDSFAACDVARPNVCTDGASATGTAEPHDPPYEQQGRLNEGLSERPD
                     KLSRQSDVSDARLECSGSACAKVAEKGKQNKSFELLTSPSATFTYSLRGSVSLAPSPT
                     HAASESQSLRPAVSMSNSSSKVDLINVAGGGIRLQTVSHRTDNASAAAEWHKV"
     gene            <381549..>382235
                     /locus_tag="LMJF_36_0970"
                     /db_xref="GeneID:5655347"
     mRNA            <381549..>382235
                     /locus_tag="LMJF_36_0970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686617.1"
                     /db_xref="GeneID:5655347"
     CDS             381549..382235
                     /locus_tag="LMJF_36_0970"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686669.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655347"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1X9"
                     /translation="MCAPTPTITQNTHRGAYTGALLFLVPSKAKMSSKSIDVFNVSQN
                     RLRAASFQDEEERQNAEYAERHNLQALFSEFAAQLREKDPKTEHEAERVLLDLLSHRK
                     AERDRAALRLHFVTSFEVNLDNGRKILKLTSGSETSTLHIVQKTRSVAVDETFTVSLE
                     EAEELTEMFYELGRFVVESGKGELNGFISIDDRDVFLLAGGKDCSDIGDELFNMTFLM
                     KASSKSRGTE"
     gene            <383234..>383740
                     /locus_tag="LMJF_36_0980"
                     /db_xref="GeneID:5655348"
     mRNA            <383234..>383740
                     /locus_tag="LMJF_36_0980"
                     /product="putative 40S ribosomal protein S10"
                     /transcript_id="XM_001686618.1"
                     /db_xref="GeneID:5655348"
     CDS             383234..383740
                     /locus_tag="LMJF_36_0980"
                     /codon_start=1
                     /product="putative 40S ribosomal protein S10"
                     /protein_id="XP_001686670.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0980"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.0990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.0990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655348"
                     /db_xref="GOA:Q4Q1X7"
                     /db_xref="InterPro:IPR005326"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1X7"
                     /translation="MSTYVPKPSRDNVYRFFFTEGVIACKKDRMGTWTGTLGGNTFTV
                     PCIQVMQLMRSLKSRNLIKEQYAWRHYYWTLNDEGIAYMRSYLHLAPSAMPNTQKPSS
                     VNFEKVTEGRGRGRGRGGRGRGEGRGRGRGEGRGRGRGRGFGGERMNYRAAAATSDGE
                     AAPAPAAE"
     gene            <384425..>384931
                     /locus_tag="LMJF_36_0990"
                     /db_xref="GeneID:5655349"
     mRNA            <384425..>384931
                     /locus_tag="LMJF_36_0990"
                     /product="putative 40S ribosomal protein S10"
                     /transcript_id="XM_001686619.1"
                     /db_xref="GeneID:5655349"
     CDS             384425..384931
                     /locus_tag="LMJF_36_0990"
                     /codon_start=1
                     /product="putative 40S ribosomal protein S10"
                     /protein_id="XP_001686671.1"
                     /db_xref="GeneID:5655349"
                     /db_xref="GOA:Q4Q1X7"
                     /db_xref="InterPro:IPR005326"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1X7"
                     /translation="MSTYVPKPSRDNVYRFFFTEGVIACKKDRMGTWTGTLGGNTFTV
                     PCIQVMQLMRSLKSRNLIKEQYAWRHYYWTLNDEGIAYMRSYLHLAPSAMPNTQKPSS
                     VNFEKVTEGRGRGRGRGGRGRGEGRGRGRGEGRGRGRGRGFGGERMNYRAAAATSDGE
                     AAPAPAAE"
     gene            <385855..>389745
                     /locus_tag="LMJF_36_1000"
                     /db_xref="GeneID:5655350"
     mRNA            <385855..>389745
                     /locus_tag="LMJF_36_1000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686620.1"
                     /db_xref="GeneID:5655350"
     CDS             385855..389745
                     /locus_tag="LMJF_36_1000"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686672.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655350"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1X6"
                     /translation="MRTSVRWSETADAVKGIRPPINSLCYSPSGDYVVAACGVRVLVY
                     AASTGTLLHSLKGHQNTIYCVDYASDGKCFASGGADRTVIVWSNKGEGVVKYQHKESI
                     QALAHNPSSSHLASVSSTDWGIWSPDKPKVSKYSLPSKGLCAAWTPSGKTLAIGLLNG
                     TIMLMDKNGDETVLICRPAPVWTLAFTPLREKGIDVLAVGSWDQRLSFYNLSGTPVGR
                     ERELDFDPCSLSYFNDGEYILLSGSDHKVTLFTNDGNRLIEVAGAGDWIWSARQRPRH
                     KQLCYGTNDGTISCIDIAITTVHAIHDDQYVCRKDMTNLVVHQLLLDRKMVIPCNEYV
                     HKIATFLDRLAVQLQERVIVFEFFYDDERNMRYQDIAQIRRRLECSLLCVTTRAIVVC
                     NDRRITMYDFQGSKRREWSMGSAVQFMKVAGGMEGREILLVGLKGGQVMKVFVDNPFP
                     TLLHKGSAPVKSADFSSSRSRLAVIDSTNTLQVLRLGEKNELLFSEDNVTAVAFNVDL
                     EDSIAFTTGDNMLHIKTGSLPAYQQAVRGLVVGFKANRVFNLHYSNVMVLDVPHAHAL
                     YKYVEMRDLDLAYNVACLGVADADWKMLGLHAMSQLRLDIARKAFTHIQDVKLVELLK
                     SLELRRRQSRVEDGVSPTARNGSATSATVAAATDKGDVGPGGESAEARAAAKDSVLYG
                     SILAFQGKYHDAARQFMKAGCELKAVEMYCDLKMWDNAKKICTNEKVLKDLIRQQARW
                     AEDSQNFIEAASLYESCGDYAKAIGMMGQAGQVKKLMKMCRSLPKSEVTLITECANFF
                     RKHNAIPFAIEAYEKVQDHQALIGIYVARADWRNAFTILEKAPTLAREVYVPWASWLA
                     ENDKFDEALEAFRAAKWPKEAMRLMETLATNSVTCRKFRDAAFYYIHLAEEYGRFEDG
                     ETPTDVEKAARIRRGKECVRRADIYYAFSSVYAHTTQPLPYNELSLFRAAKYLFGMCA
                     ECAIPMNVGKGAILYTLSRIANRLEMVRTARAVFEKLQGVILPVSMMEQVDIETLIVR
                     SKPVKDREELLDRCFRCNQLLAQLPMAGDRCPNCFHQCVRSFVNFECLPLVEFILADD
                     LADEEAERIIVSGVGRRKSADDEHNNGQRDAADAKALPKAKEWQSDSGANVISFDDGN
                     IDYEIDQQLVAMGRSKAAANKGNDPFFTQLQYVLRPGRPTAVYQPFVASADILKGFRR
                     DEVFIVRPRYGTLPVPNRYYRLMRSDVNVCLCNGCQHFFIAEDYEAECTKGSGCPLCR
                     YRPGKQVSRSMKQILFDMEAAAAVATTSSSPAAL"
     gene            <390983..>395917
                     /locus_tag="LMJF_36_1010"
                     /db_xref="GeneID:5655351"
     mRNA            <390983..>395917
                     /locus_tag="LMJF_36_1010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686621.1"
                     /db_xref="GeneID:5655351"
     CDS             390983..395917
                     /locus_tag="LMJF_36_1010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686673.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655351"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1X5"
                     /translation="MARRGHASQPRRCWLGPLLIFFILLVSAKGVRLEKGTFLMDEDV
                     EWPWLPQLDLPLPPDFMSGQRILSAPEQWMVLAHVGAPLRVVTDTKMDLMRVLEVVKF
                     MRPADAGVCPSYRTTRRIVHYWFHPEQLSLLFGEERWSALQRLQRPAAWSLVLKDDAG
                     PAVRAAEHFIAKLQALDPPGQITLISRRQGSRLTTTHVSLADFKVLSRVTRRTSTIEY
                     RLTHLTVDAEAPLHRRQTQRLLRAKLQYHEHIKAFDEAVAEAQRDLHASLRELLESEQ
                     AAYTDHMHFKRSYQHFLVERQSRLWAKNEVKDAADEADGRPSMGRNAGSRQTAAMCIH
                     PAAGTSLASPLDDGRDVSCRKVLAAWSTLRATGVCREAEMRVAQLRRLHSRHRCKEPL
                     PELPVASSTARGEAGLSQAAAHVWRDGVAEMKAQRRKSGASPTPAQVFAILYGVWEEE
                     KAATQAAGHAQEATSAAGAAATAVAVNEDFNASAFAAFVEHLVQSGDALTAAPNSRLP
                     RWIRAELHYTLALLQLIRPKTRPPEKHPATASSSVRAVVHLHESLSAGSHHAAGALAT
                     LREHGIFARQQSKAAMMLLVQSMEQAPTHLWRELLLRRSPCRSLEAASAASSRADPSR
                     LLRFEQFYAVDHTFSEVDDPFMTRQSIATLVAVTNENIYTGDEEPELEDVYREAEVGR
                     GDDEYEGRLTARLNRRLLKANMLFSGFKGVQRDAREAQCELLVILRRLGYVCDLDLRR
                     FFSTDAPPHVPDSPPASSAAPMTILGVPLPDSCPEHESELADVMNNGRHTLLSCPGGA
                     PFPPRRSRRQLDVPNSEALFRLLQQTLLALSYVQLIHRQRYDISHLYASLALEMSLRV
                     PRATVKRCAQAANMSAFDEAHHHPGGRNGSWARLFVEAVNRVADSDSEVAWAAEVLLD
                     QLQSIKHAPSRARGDGAALGRSVQRVLRRFASVADPPFVSTESLLLLGTSRWAARGPL
                     SGAAAEVAAFEKDLAEWTMEPFGLFHRLLQKHPRSSTVAATQPTPHPSRSAAVPGSSI
                     GVSLSTTVMDVHALFLVCLAAMKRWKSDFPLVHTLDATTYSARRTDPFVLSSFLLRAR
                     DTVTGAPLISIKKLRDVAYAASPHFLGESPHLLPLVDDTVDSYAARLLRFAARHIHAL
                     EPSVELLRSGGYGIRRTDAGGAASAGMTMSGHWGSSLDDGPPRKSRLQTLRKVKQHTM
                     ENADLQPLLYAADVHDYMNKSRWTSVATVLSAVYNTVVHHFTATASEGLIADMEAQMQ
                     LVTPEERGAELSSRRQASIKESRSKETAEGTARSAGTGVSAFVDAFAKDAALREFFIA
                     GQLLTVALESGMPEGFSLVFLEAANRGNRHLRPIADHLAESVFGRMAPSVWTEHHLTA
                     QWQREEEELVGEGPLFALDTRTPFRYASVEARQELFARVSRWNAAKAQQGDSGDVGVS
                     RERQGTRVSQALDQLLWCAGFLTRRVYKDTHRVYPYAYEGSVFPASDLECVADMNHLL
                     RAQRPAAETAASVVIEGAPTWTLTEWRHAQLNGTALLRDLSERLGYVYDTVEMAPARR
                     FPLSTADFSGSATVEEHALLLAERNQDYPSRFARVSTQLVEPWNRLSKDYSEQVVGYG
                     EGFYYNQRLHRISGYRWGAILHMWWLRVRNMWPW"
     gene            <396996..>398636
                     /locus_tag="LMJF_36_1020"
                     /db_xref="GeneID:5655352"
     mRNA            <396996..>398636
                     /locus_tag="LMJF_36_1020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686622.1"
                     /db_xref="GeneID:5655352"
     CDS             396996..398636
                     /locus_tag="LMJF_36_1020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686674.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655352"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1X4"
                     /translation="MLARFVCVFAIVAAFGLLSPVSADTAHPHHSRSHTVTIESGTLP
                     EAKAFAPLRLGAGEWVYNFNPGEEALFFEPEDAGNRQWQQWKADLRLLQASQEKQRLR
                     NYPAGGEKTDTPDRPANTERQEPGALPIAEYFSDRNVQRRYTERLKEQSLHNVSDAQG
                     AADALVLVEGEIAAMWHLVRLAGSSDSLNDQQFLGLVERHFSHTIANASAAAADATSS
                     SFPFALLRVPLVLEAEVLPFMEREVAHVRELWKSRRAGAATPAVSSVAAESQLQLLSS
                     AVENSKTVGAEVAALAEPLADAAISWVASTLATTREAIVANDESTEAKRSELKQLLKM
                     QSRLRKVRPILEKHSKVYQSVLQRGQLPNAEATLFALQLIVKQRLGNDVSGLVEAVPL
                     LSTTAPLTGLLEQEWRAHVLAPYGMCVLVTAAFVWVCEDIKERFMTRVRARRLCMPLG
                     MPALASGCTRQILMLVSLLELVVPPLLPVIALAVHLRGARVWVWGMIALMRPSQRAVC
                     LASVSFLMFSAHLVATMVQRVFQIIHPSVYRRRLAKKK"
     gene            <400068..>405086
                     /locus_tag="LMJF_36_1030"
                     /db_xref="GeneID:5655353"
     mRNA            <400068..>405086
                     /locus_tag="LMJF_36_1030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686623.1"
                     /db_xref="GeneID:5655353"
     CDS             400068..405086
                     /locus_tag="LMJF_36_1030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686675.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655353"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1X3"
                     /translation="MRSLRFRAVASLHPSQRASAHHDTASSTHCAWRCLSTATENSQE
                     NAAKGCTPPPLEQAFASPLPGPVAAHSVLRSPVDSAILCSRLSQRQMRQRQRKWGALW
                     RYRWESHSPRAVPTPLLVTSASISGSPRTSVCALRTDVSEDTDAKTVSSDAERGALVS
                     TSSPSHSRSLSMPPAECEAKEGTRPSAHRGTAGAATVDSVALSSTRNAAAGASSVEDP
                     LLSFLDSHEEDAALLLAMWTSLHRSCVFGSALSESLALQVRYFLHSLLRHRAIAAAVN
                     FYYRLMGIGVQLRDSDLLLLFSSLTYESAASTEEAQLRKAAETAAMENDRKMWTQRRR
                     QFRESAARTRTGDAPGQNLRTRGGEGRDKVCAGQMGVMNAVAERTGAPAFCEEGPTRV
                     NATATESVQDTASHTRIARATHIAEGGSVAVSSASRWDRGEACDDVHPPRSIARRVAF
                     HQQPEWVKRWILYEASMGTLDDLDEVEDASPPSTPSTSSSADALFSASDVQADTAAQS
                     EQAMRGMEVATIVEHLHLLTLGAMQRDHLSATEASIPQPSPRRPQRCTSKLSRSRSAE
                     QAYWTEALDLVRSAYAAAPRHMALSECDGTSSPRPAEGLLLPTGVVFALQSMLREVQS
                     WEGTLSLLRLSAPEAKHRDAAPPRALAMSPDCFLRGAVLFMALAAPAQPWKTQAKVEA
                     WMHRVMLPRLARDARAPTQAASTVTAATAALHALWLSHLCSVKASRPDEFVALSDEAA
                     AYLTSPSVQRAIHGDLALMMEEVCVNAERAVDALHQTVQRAVQHCRASEVLAKSIRSG
                     AYRVENGKGKHELSRDPESDHMTDPLSMTSVAAPATVVDEMRCSLFSEYATKSPLSPS
                     ALPSSDLADTFALCCAAVKETVWLRFTTAASTSPAAVAVEVLQFVEQSVHGPTGLLNT
                     FQLLYGSPASRMARNGKGATLTPTVNTPAAPECAYVSCVLAITLLQLVQLLCAPPGQQ
                     QRRFGCQVWSGAELVLLVELAAKVLEGIAAAQVQQAPWRWAVEKRLKELATVTARTVR
                     LVVRHLDIHRMNEKVMFGAVADQDVELFALLARMLNTSSELMVASRGSDASRASSHSP
                     VWRILTATCSPRVLQGVHLCFRSSSALGKRVRYRLCRRDADSLDHWIPPPRSHQRTSA
                     RLRGARGATLSSSKGSMKAIAASGASAGGRDTGRDFPLMLSLRESVYKIMSRERTSAG
                     VGQALQRLAASTANWKASLLLCELVTKDVSLARGTCTVDFFATTLDRMAQDVARSSAA
                     ARAEARASRLQGGGLVPSRKSCRTLAAPRALGPPNLWLSAIDVFWSAVDHVGRVEAAA
                     EQHSDSSALATSARTPPSKPVSVDAQERAVLARLLLPLLRFSRAVQKLEVGRQWRRTW
                     AAMYAMQEKKDPQWRRLNIEALSVLGDAAALTHCVADYHICGSEALLCSVAVRHGDWH
                     AALQTVLQTSGAVEERHATVTTYSLVVARTILTLLTKSPMNLSNTAMRLRTVQRETWD
                     EECSLAVVRLLLRGRRWRLAITHVDEALGLPDMQRVRALVLVNPAGRLGQGASSTAPT
                     AATLVRYAQLLTAALQATAIGGDSERAPVYYDAFKALVRYVFGEVVDMDTLHTAEDTS
                     QSGNDALDAALDMTHFTERDEKHASGSEDQVHEAVRELAPRARILFFRAMTKKMLGTH
                     AGRG"
     gene            <406528..>407388
                     /locus_tag="LMJF_36_1040"
                     /db_xref="GeneID:5655354"
     mRNA            <406528..>407388
                     /locus_tag="LMJF_36_1040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686624.1"
                     /db_xref="GeneID:5655354"
     CDS             406528..407388
                     /locus_tag="LMJF_36_1040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686676.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655354"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1X2"
                     /translation="MAQCLTWQVLDQRQTGECLDAVDLEALRAVIKRIDDDRDGALLH
                     SSERTATQVNVLLDLYGHLVLFAKASQFSPFKTSTLFGIVHRVHEASIADRLSRFHSY
                     DLLRELVVRHSVHRPPYSTMVFSVREVQDIDTYMMSTYYRHYKMYVYCFVPREVASLR
                     TVMLNDTAEAPPAQLPPLSAAIREDAWKEKMQEKVRTLEEAEMEEQLIVSDAVSEAQK
                     NAATLDNSRFMAGISAQLEAIRDAVSTKSSERLDLIEEKLTAIEAKVNEAQSSGNRSR
                     QGSRGSSKRK"
     gene            <408600..>410363
                     /locus_tag="LMJF_36_1050"
                     /db_xref="GeneID:5655355"
     mRNA            <408600..>410363
                     /locus_tag="LMJF_36_1050"
                     /product="RNA editing complex protein MP61"
                     /transcript_id="XM_001686625.1"
                     /db_xref="GeneID:5655355"
     CDS             408600..410363
                     /locus_tag="LMJF_36_1050"
                     /codon_start=1
                     /product="RNA editing complex protein MP61"
                     /protein_id="XP_001686677.1"
                     /db_xref="GeneID:5655355"
                     /db_xref="GOA:Q6T449"
                     /db_xref="InterPro:IPR000999"
                     /db_xref="UniProtKB/TrEMBL:Q6T449"
                     /translation="MNRCGVKRRLSLRLPVVSIAGLRRRARRAAGTRSGSVALCVSAA
                     SIGSSTSLASTPGRKAPVYYNFATPVSVLRDAAGSESVSHRRPRREAPAREGGLLLVA
                     PRTPNPNDPLQRLNIFRREFSDFSSAAKLNPNIMVSVDTSTRRFLEMFCDFDAKRCKL
                     CNETFLQWHIHANGIPHAGREGMLLELVRPYCGTPDELIEMWWQRLNSCAAFHRIPGL
                     SHDNPHERKRRLLYLLKVLKDRGILVETFNVSDNQSTNSARSWEFERLEFVGDNVVKY
                     VLNNIISCAFPPHEGGTKGKMTCFQFVMDGNDGLARGYDHLDLQQLASSPRVVSKFKS
                     DIVETLFAELQMYLWSTQHDIGTCPLVFPFTKDIYTLRALVQHVLYELGIELFLYHIR
                     HINGMLQRVMRENHLQFVKADSALKPRAGARTGSLGVSTRRGDWSDDDDDYDCPQSYG
                     TPAVSAPTAALMKVRSQRTHVQGTGAALFFASTNYDNFKRVVPIGGLLPRPFARQDLS
                     VIPNHMPHLRSDGAMTRRMRRVGNAGWSTLHATATALTTLESVADGLALSAETTPRVG
                     SEPVRLSVPRLKDEELIPELI"
     gene            <411601..>414630
                     /locus_tag="LMJF_36_1060"
                     /db_xref="GeneID:5655356"
     mRNA            <411601..>414630
                     /locus_tag="LMJF_36_1060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686626.1"
                     /db_xref="GeneID:5655356"
     CDS             411601..414630
                     /locus_tag="LMJF_36_1060"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686678.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655356"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1X0"
                     /translation="MITARSPYQVYKAADVNGTVAVFNSLPSEELLPYKILSSEETLV
                     ASLSVVEGNEEQRERYAVSTLHAARVYISHLISYIPLSTRSQTAKKVQINIDAVVRTV
                     MLFAANAESLQSVKNMALTNASGEQVSLKDLSDLEGALNAMEKVYRQKAKGAGEKVDM
                     LRKVAPEPVIVSSSPEKSQGTASLRAGEDSGDAASNSTGCSRQLRRRSESTDGPAAHA
                     DLHGDAAALKVAKIEGDTDNAPLAAVFAPKMPGGPKSTRTGGRGGLVCGRLRGLTNSE
                     KKVVAMLHAMIQVLGHIFATKFNDLVPIFDLLDERLRAVQAIVDAERAQYKAKEDKRI
                     PEPFHEVPLDAVQLALQHSSDTFRNDEECRYELDEDLLHPIAHACLRVINHIEGFSTE
                     PFKGPTPEEVLKKQQLRDAARAKREEAKRRILEKAEAKAELERKKEEERQLMRRRLGD
                     GSDEHEKDLEEDTTLVNPSTLGYVAYAAELPLGTPELFEKALYTWSMLSSVPRALNLS
                     QMHFAAFVKGIECVDQDANGLMEEVTKCLLDVSMASLRLRSPETPRIVTRGKNWFDAL
                     VEFVGVASGNKKKRRQQQRRVSSTEDEEESDSDSDNDSDAASSTSSSPPSSSSKVTGH
                     KTSTEEEDSPREGKPAAAMATRGEGAAEAAAEEEVDTDPFSVELKATMDKVAGLRSLA
                     SWGNVDVVDRLNLLQFCVLEALGSDDVRNEADRVQKDREEEALNAEKKLREIREEAEK
                     ELKALLRTLPSVASIAARKKKAQNRTQKAEPVKTGDNQHTDNAEDEKKGIDEAAGDSE
                     TATGKDVREAAERTFEAEREAILKEVDRKREEVYARLLSVQDGKDDGAIVEPLGMDRY
                     RRLYWRFPMHRVVYVQSVPNLTAVTFPVLAEPPELKQRRAPSRSFLLDDEEETSMLGG
                     RRRGGRSATAAGDAARVKDDMGAGQTRWGIIPHDYLGTFVQTLDRRGKREAPLRHALE
                     TLEPYLTALEEPREVRETRARAHMFGYVNLLKVDFTY"
     gene            <415158..>415532
                     /locus_tag="LMJF_36_1070"
                     /db_xref="GeneID:5655357"
     mRNA            <415158..>415532
                     /locus_tag="LMJF_36_1070"
                     /product="putative ribosomal protein L24"
                     /transcript_id="XM_001686627.1"
                     /db_xref="GeneID:5655357"
     CDS             415158..415532
                     /locus_tag="LMJF_36_1070"
                     /codon_start=1
                     /product="putative ribosomal protein L24"
                     /protein_id="XP_001686679.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1070"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655357"
                     /db_xref="GOA:Q4Q1W6"
                     /db_xref="InterPro:IPR000988"
                     /db_xref="InterPro:IPR023441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1W6"
                     /translation="MRTIECEFSHFAVHPGHGRRYVPFAFLSTKPVLTFSRPKCFALY
                     MRKKNPRFIPWTRTYRRIHRKTTTDRVNRRRAARAVRVQRAIVGADLSYIQEVRAARK
                     EDRSAKAKAVRAEVAERKAAKK"
     gene            <416293..>418032
                     /locus_tag="LMJF_36_1080"
                     /db_xref="GeneID:5655358"
     mRNA            <416293..>418032
                     /locus_tag="LMJF_36_1080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686628.1"
                     /db_xref="GeneID:5655358"
     CDS             416293..418032
                     /locus_tag="LMJF_36_1080"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686680.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655358"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1W8"
                     /translation="MPPTSTRSTVGGGRRVYHLGNAVLSVVVFVITLVLSMVMLDPER
                     SSHLLSARRRTPPIDFTNRALVGGFTPVVVGVNKHTVLVVPAAAIHGTRYVSRALDSF
                     FSVGLGSASGTSSAGYHEEKAERHSQGAITLSDVYSAVLLREGVADATQPPDVTAGTV
                     ETSPLSSRRPSVLHLCSALSCVTPYVAQQWSDRAAAALLLANKTNDGAATVRSRAGPV
                     ANFALVFGEARESLAVMRELGEHRVLTAQIPVAHSDHPQSAMPLVGKLESADLQASCS
                     SLKQCSYRSLVKHAQLATLLKAQAQQLPAEASRKRLFKEWVRRNNSHSGALAWGAVDV
                     LPFSFVTFEKSHTLHRFPLDLVHVDVGSGDSVAVLAYLDALASDTATAENLKPRNLLV
                     SVFTSEWVNAIVETLLLLEVGQRYSAIPLRDSCVGLERNFTPHQRWSLSHMRLWMGKH
                     ALEGTYLSPSLERSRAAQIPLCTVLLSRQVNTLDELLQMASKAIDSYPPAASPVERFF
                     YYSLGLSPKDEELLTPLPEAVSGAKAFALARTSDAVRGVVGFLVQYIYFLIPIGVGFS
                     LTRNVCRRRGVCG"
     gene            <419504..>419965
                     /locus_tag="LMJF_36_1090"
                     /db_xref="GeneID:5655359"
     mRNA            <419504..>419965
                     /locus_tag="LMJF_36_1090"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686629.1"
                     /db_xref="GeneID:5655359"
     CDS             419504..419965
                     /locus_tag="LMJF_36_1090"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686681.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655359"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1W7"
                     /translation="MVSFLRTFAVLCIIAGVLLQGGTARAPPRAVRAFETKFNSVSQA
                     CRGVLETECPSDGLARTDCLMEHIVDNANHECKMWLSWRASCFAYATVFLIPQGKCNF
                     KPDQATSQLIRNCLRNTDKSELPAVCSGSPYYKSLTLRSPRRIDSDAAADL"
     gene            <420871..>421245
                     /locus_tag="LMJF_36_1100"
                     /db_xref="GeneID:5655360"
     mRNA            <420871..>421245
                     /locus_tag="LMJF_36_1100"
                     /product="putative ribosomal protein L24"
                     /transcript_id="XM_001686630.1"
                     /db_xref="GeneID:5655360"
     CDS             420871..421245
                     /locus_tag="LMJF_36_1100"
                     /codon_start=1
                     /product="putative ribosomal protein L24"
                     /protein_id="XP_001686682.1"
                     /db_xref="GeneID:5655360"
                     /db_xref="GOA:Q4Q1W6"
                     /db_xref="InterPro:IPR000988"
                     /db_xref="InterPro:IPR023441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1W6"
                     /translation="MRTIECEFSHFAVHPGHGRRYVPFAFLSTKPVLTFSRPKCFALY
                     MRKKNPRFIPWTRTYRRIHRKTTTDRVNRRRAARAVRVQRAIVGADLSYIQEVRAARK
                     EDRSAKAKAVRAEVAERKAAKK"
     gene            <421905..>423563
                     /locus_tag="LMJF_36_1110"
                     /db_xref="GeneID:5655361"
     mRNA            <421905..>423563
                     /locus_tag="LMJF_36_1110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686631.1"
                     /db_xref="GeneID:5655361"
     CDS             421905..423563
                     /locus_tag="LMJF_36_1110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686683.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655361"
                     /db_xref="InterPro:IPR003511"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1W5"
                     /translation="MTSTVTAVNQTQSLAAIRNFVRASVSCITYARGLCSDNAYEQRP
                     FLGLPLRQLIPSTTESITISEWIEKGAFDALNRNYLKEMSLCVYDAACHELLESYCFG
                     FNYTGDGERAQMTLNASQTIADGSKTTAVSQSSGGAVGIPAYRKRRCTKQEVQHLLTS
                     ILERLMDVVESLPPLLSERVLTMRLTYYDAVTPASYEPPCFAPASEHMARLYQAEVKH
                     HVNIGSMDTSHHLFSVAIRHPLLQQIHRQMTGRTTSAVATKTGGSPLSAGKIAAVSTP
                     SDPLRSGWESSFSSDPAVASAVAAAGATVTHGVVASHASCGLLLCADGEGAAFDAENA
                     GEEKAAGSSLGEVGGGGACTARTGETLRPCEVAKLDGVYRLMEKSTSGDERRLLRPAE
                     LTYLLFAAFVFTKAPSARGGRGELKADEVEAYRALRCPFDVSAKTVLLVLQRLSREDF
                     LQPCNARGAPAPKMPKAEEGSRPTPAIRAWLVPDPPASLLQQLMQVDAVTELLTHESH
                     LVLQELSVYLAREEWRRAPRTMTAKATSGRISTTGGSGKRRSSR"
     gene            <424974..>426065
                     /locus_tag="LMJF_36_1120"
                     /db_xref="GeneID:5655362"
     mRNA            <424974..>426065
                     /locus_tag="LMJF_36_1120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686632.1"
                     /db_xref="GeneID:5655362"
     CDS             424974..426065
                     /locus_tag="LMJF_36_1120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686684.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655362"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1W4"
                     /translation="MLRCVSTSRPTLAVLPRSAGAAVGSAAASSAAYVAARRGYHGFQ
                     FASFHGWTLPYGGKSTRVTKEELENQRVFTERPREKWDYHRVDENINSQSEFRRQEGR
                     EQFYQGSREDNSTMSHGSLHTPHKYRLYEYFDEYTKPGVDRKVAAAYAVKEQWDAEEF
                     YYPGEAWQRNRPGFRSVPKELLNRQTWYHWSHTLTKWDEIQPTIRTRSWNPDWPPPGY
                     EVPKLQCKKEFYFGMEEEGLVSEVERYSWFRSWSDNNMRVGWREIPLFMILLGTLYLF
                     ARNAMSVTAMRAMSSNMYYPGRSLIRPFGVPKDWEKECFWWQRPLEEFPNQDQVWYWT
                     QARFGYMNYIKQRDAREKAMADAEAAAAE"
     gene            <427214..>428578
                     /locus_tag="LMJF_36_1130"
                     /db_xref="GeneID:5655363"
     mRNA            <427214..>428578
                     /locus_tag="LMJF_36_1130"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686633.1"
                     /db_xref="GeneID:5655363"
     CDS             427214..428578
                     /locus_tag="LMJF_36_1130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686685.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655363"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1W3"
                     /translation="MQTYHRHMTSSSNPVVIFVFDHQGSAVTDFWAPLLQSVSKGLDA
                     FGIEVAHAPTSSEIGQQLLAAMNAGSGPIILFFQGVGDTPAEGGKGLKMPIAYDGNID
                     MAHIMSWGLSCISSSVTHRVHNDVDLARFFAQYPQYPALPHVLYFPSTSYTPGGYLAL
                     SQHFALDAVFGVVPNAFTAPNATHIAQRYNITSKDELPVLLVLHRSTADAGGGAGESD
                     RVVRMPAAATSLSYREALAFLSTQITDTVAALVAKAESTQNQHFLEVAESRRVYMMGQ
                     LIERQHDIVEEERLQMAREPILVKDQAVWAKECVQLPKKHRCVAAFVDSAQDSAAKDN
                     AVKVLSLVSVKLLEIMGREAQKVSLVVVDRQGSDAVREYFDVGHNGFPDVLFLSLDRP
                     AKYYNFVGTFSAEGVTQFVASHDAQLTQKDVRGGHTFIPRMVPKLEEAVAVPRSGDED
                     KDDL"
     gene            <429719..>430636
                     /locus_tag="LMJF_36_1140"
                     /db_xref="GeneID:5655364"
     mRNA            <429719..>430636
                     /locus_tag="LMJF_36_1140"
                     /product="putative short chain 3-hydroxyacyl-CoA
                     dehydrogenase"
                     /transcript_id="XM_001686634.1"
                     /db_xref="GeneID:5655364"
     CDS             429719..430636
                     /locus_tag="LMJF_36_1140"
                     /EC_number="1.1.1.35"
                     /codon_start=1
                     /product="putative short chain 3-hydroxyacyl-CoA
                     dehydrogenase"
                     /protein_id="XP_001686686.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655364"
                     /db_xref="GOA:Q4Q1W2"
                     /db_xref="InterPro:IPR006108"
                     /db_xref="InterPro:IPR006176"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR022694"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1W2"
                     /translation="MLRCTASALFKSLAVWGGGTMGSGIAQITAQAAVPVTVVEVSQA
                     RLDASRKAIETSLLRIANKQCNGDQGKMKAFVDTVLSHVTFTTDEAVAAGGAELIIEA
                     IVENIGAKKELFGRLDKMAPKSTVFCSNTSSLSITEMASATTRKDRFAGMHFFSPVPM
                     MKLLEVVRTEEVSPAIIEQLTAFGKKVGKIPVVAKDTEGFIVNRLLVPYQMEACRLVE
                     RGVATFQDVDTAMKFGCGYPMGPFELCDSVGIDVIKFIVDGWHAQYPNEPLFKPSPLI
                     DERVAAGKLGKKTGEGYYKYDGKGRKIES"
     gene            <432165..>435233
                     /locus_tag="LMJF_36_1150"
                     /db_xref="GeneID:5655365"
     mRNA            <432165..>435233
                     /locus_tag="LMJF_36_1150"
                     /product="putative endonuclease/exonuclease/phosphatase"
                     /transcript_id="XM_001686635.1"
                     /db_xref="GeneID:5655365"
     CDS             432165..435233
                     /locus_tag="LMJF_36_1150"
                     /codon_start=1
                     /product="putative endonuclease/exonuclease/phosphatase"
                     /protein_id="XP_001686687.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655365"
                     /db_xref="GOA:Q4Q1W1"
                     /db_xref="InterPro:IPR000300"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1W1"
                     /translation="MHLCASSFSLSFSSVLCQLHRALRNTPHTHLSPSSTAFVCLALC
                     AASACCPVPSRASSEETKKVSRAFACLFHCSVIGRLPSHRATHLPLRTEMTEYAGTQT
                     TRHAQSLKSTLPASETRGSMPAATALPSMRDIGVYPRALPPLGENEACSNNNTTCSIQ
                     HDFDSSAAGNVRTTAAMGATVPASSFCSTCTDKDPSGGLPLLRVGNSAPPPLTPTALV
                     TTLPALSGQHALHCPRNATASTGSPRVPVGLTRASLQHHDENDACPHLQSTGQGDEAA
                     LRSSQRACSLAPTENYVNQLADQRPALAVEQGPRRGEATPSLHAAPSRSDNTEVDLLA
                     RQLVQHTVLWSSMCDSVSGCASPARGRRGEVVKSTLRAGSVGTGSGACPHEATATVPV
                     LSTTAATSSPSCVGILNSTNVHSSHHDKTDNATAGSSPLTYADNPTLSTRETFPIPRC
                     CPDDLLRGDDKIWIPGKPLRIAYVTWNMASKRPRTGEVSAHCIYPNAHLVVVGTQENG
                     PYVMSNKRQRRWTKIVSHACLGGQYELVGQHHMWAVQMLVFARRRDVAHYISRAHASH
                     VKTGLLNGLGGNKGGVAVGLVLSLTPKDAAPPHRAKAHLTITSATRAPPLKSKTSGAR
                     GTSIKGSAITPQKPDSSMVTGRETSAAFMLSKSSADCGAGAPPPVMRNPYMLHDADDE
                     YGKLLRKRSLPDANSTGNFFCDDGDTVLENDGVFSPAEMMSRNTLSELTTEHADADHS
                     HRHTQRSENGTDRQERGGGDDDDASSDGRPDSVTPNYMTLLFITAHLTAHQGAVRNRN
                     KDYRKIVYGLQLGRRGPYRKFFKLLLGRKKVLEGDDEEEASDEDDEADCWEDNNPEEG
                     VMPLRLPVVSGVERKRKMRRDVTEEFDLTFFGGDLNYRINGTRKAIEYVIQHHSNIRS
                     ILINNDQLSLERARGKVFQRFQEGDLLFRPTYKYEVSAGGGFTLNEYNFSQKKNRMPA
                     YCDRILYKKRMSSAARRITIRLYTDVPNVRSSDHRPVVALFDIGTRAYTG"
     gene            <437001..>438113
                     /locus_tag="LMJF_36_1160"
                     /db_xref="GeneID:5655366"
     mRNA            <437001..>438113
                     /locus_tag="LMJF_36_1160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686636.1"
                     /db_xref="GeneID:5655366"
     CDS             437001..438113
                     /locus_tag="LMJF_36_1160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686688.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655366"
                     /db_xref="InterPro:IPR002737"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1W0"
                     /translation="MKPHKQQCTRSKHPIRPHSKPATTHHSPGPLFQSTGRPSATRMR
                     FVRPATHAAPHGRGWYEAIPERLKVTIDDYFSEATHCYSDEEQECARMTGLIAPHAGM
                     SYSGRTAAEAFAVFREYLYAKGSKGSELERIFILGPSHTRGFEGCELSAASAYETPFG
                     PLRVDTAVVDRVITDLRKAGVGAATASRRTDEAEHSIEMETPYLSHILHYPPTTTGAP
                     VQPAAGRVAIVPIIVGWTNRQDEKAICDVLKPYMDDARNFFICSSDFCHWGERFSYTY
                     HYKRSEYPNIGDSIIAMDHAAMELLEKRDLERWYAYLQMTKNTICGRAPISIGMQRWA
                     SKGNKARVKFVHYSQSNKCKDADDSSVSYAAAIIME"
     gene            <439913..>441826
                     /locus_tag="LMJF_36_1170"
                     /db_xref="GeneID:5655367"
     mRNA            <439913..>441826
                     /locus_tag="LMJF_36_1170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686637.1"
                     /db_xref="GeneID:5655367"
     CDS             439913..441826
                     /locus_tag="LMJF_36_1170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686689.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655367"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1V9"
                     /translation="MKTHRRHAPVEEVIDPSPFDYTLLSHLYVHSDGTDVIDFSGLAP
                     GKESRCRVNSFLKNRSFAPGMTEAEPEAVGSYLHLRVEENDGSTLDGSECCKIPGAHT
                     SAPPRGGSAPASNLVRIEDSAEHWWFMCQAAEDTAPYARLFNGAGDLLSYLEQHNLQL
                     PTGRSWMSGSSTDAGLPHCGQPQPHHHSSSSVTGSTAPILPLTKWLDIQIDRSNPRSP
                     ERVTQLLNRLPISQETKDSCLYLSTVDSIDISVLATSDVSGAMSDYVFLNVMCTPVVE
                     NHVNGAGATAATTASEEKRFLHGLGGAKFGVSSTDKKKQTAKSGKTGKRGAAHVSSQG
                     GLSTTRSVMEMRFEAVRMGAPRSSVPEPVAVAVIVFADWMFTIHEKPFAEMDDMLRMV
                     KVHCAPSEVTTSHLHYAAALSPTMQRRFTAPFAMSVLLQIVVGHHLDSITLAKAVDAL
                     GDCVFDVRERKRDQDAVLKHITAVRRCFGECGTETARREVLFASLLQPMFADRFFVAE
                     PTIRRELENAQAHLRCFQRDIADCRDTVALSNWHNNVAIQWVLLRRGNRALRMILLLA
                     QMTNIMQPIVIVQTLYAMNVPLPFEADGDPPHTTLAPFFVLAAIFLIYCGLTVGSIRH
                     VLVRKSFETRLLA"
     gene            <443251..>444261
                     /locus_tag="LMJF_36_1180"
                     /db_xref="GeneID:5655368"
     mRNA            <443251..>444261
                     /locus_tag="LMJF_36_1180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686638.1"
                     /db_xref="GeneID:5655368"
     CDS             443251..444261
                     /locus_tag="LMJF_36_1180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686690.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655368"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1V8"
                     /translation="MLCGSRATFARTAVAFFNMKHFQTKKKYNLTPQNIYETFSTVLL
                     PRDRLLRQSVSGGGGSRVLVLDAQQRVKGVYLPVFCMPHPSTVTNGSNSLGVAVADYT
                     RSIEATLAMHKAGGGGGTAPTLPTVLVVLSHPQGLAYGTFRADGTPGVPMKNLALAPI
                     LANARTQQASTNIASTPLRTSGLGTVMPLLNVSHRHAEVVRDIYTELNECEHVAELAA
                     CSTFVWVQRDNMSSMTFEKAQSSERYWERAKNDGDSAAAPPPGAISFLDRRWVLLMDV
                     ALHPDTGLGLYARDPATGDRIVNATGVQSALCRGLLLLDHVPRTVANTARAANRETGV
                     SG"
     gene            <445472..>445894
                     /locus_tag="LMJF_36_1190"
                     /db_xref="GeneID:5655369"
     mRNA            <445472..>445894
                     /locus_tag="LMJF_36_1190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686639.1"
                     /db_xref="GeneID:5655369"
     CDS             445472..445894
                     /locus_tag="LMJF_36_1190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686691.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655369"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1V7"
                     /translation="MRRAKCHVFVRCAQPAAALTPVRTIIAAKGIVENRIVKHYTNRT
                     VEESKAERMESVKKTLHPNPRNRKEELSHLCQHCSYEYVPEFQRWANDMMAVYSDPQG
                     YAHDMAYHYQRIWKAKSLTRRGVEDGSGAFDVCRVHPH"
     gene            <447345..>449225
                     /gene="GPI10"
                     /locus_tag="LMJF_36_1200"
                     /db_xref="GeneID:5655370"
     mRNA            <447345..>449225
                     /gene="GPI10"
                     /locus_tag="LMJF_36_1200"
                     /product="GPI alpha-mannosyltransferase III"
                     /transcript_id="XM_001686640.1"
                     /db_xref="GeneID:5655370"
     CDS             447345..449225
                     /gene="GPI10"
                     /locus_tag="LMJF_36_1200"
                     /EC_number="2.4.1.130"
                     /codon_start=1
                     /product="GPI alpha-mannosyltransferase III"
                     /protein_id="XP_001686692.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655370"
                     /db_xref="GOA:Q4Q1V6"
                     /db_xref="InterPro:IPR005599"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1V6"
                     /translation="MDVLGAFSRWPRPLRSRRLLLLLLLYRVTLCLTLQTAESPDAWW
                     QSEEVAYKMVFGRGQLTWEWEEAIRSYVFPAIFAAPLLLLKCTGTDTSLTVWASSRCV
                     QALIFFAHDCTMLALAQHLDDLRSGLESRRTGRDAFSAPLSSTVSESTKAKRRAPTIA
                     STTLAVVVVQWFLVNTGVRSYSNVPESLFVLLSLYQTSYPLFLLWAGVACAMRVTAAF
                     AAFPIFAMHACRLYGQMGVARHLFIALITVGMAVGISAGVCFVDYSFYHRLLFTPYNF
                     LKFNCLLGVSKYYGVHAPYWYCLALPAMAAPFVFFLAWMPVCWSYVQEAEKHHMSGSR
                     PHPKSTLFSGSSSQTLRQEIKRWAFVGAPTLMVYSSLQHKEMRFIYFLLPLLLLISSV
                     VVVLLCTGSPSALKQSGGVQRRCWCLAVPSADMVRRLFTLSWVASAVFTIVLLYGYRR
                     GAPTLFREIRGSDWHFGHLETLVRCYGTPGYAQLHGKVDRLEWVDCQMRLDAVSGVPE
                     VTQDRLFTEQPKSYALWRYLRLASRVDVEDVGKESVGKLSKDAWWREMRRVMPEGEAP
                     ALPDAIILFQKTAILLEADLLRPMGYRRLVVTLHAPHSFEEHEDRYLELWSRETAQNS
                     ES"
     gene            <450002..>450769
                     /locus_tag="LMJF_36_1210"
                     /db_xref="GeneID:5655371"
     mRNA            <450002..>450769
                     /locus_tag="LMJF_36_1210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686641.1"
                     /db_xref="GeneID:5655371"
     CDS             450002..450769
                     /locus_tag="LMJF_36_1210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686693.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655371"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1V5"
                     /translation="MATSSHRTAMSSLSAAMKQYVQQAAEDDVVCAFGPDYFHGARTG
                     ACVGSLFSATLCWYTFRLLKEDQREVDFLAGLKHGQRNPHFSTWTLLRGLRTQPMLTT
                     GCIALATTSAMKCIKCYLANQRCREFFTDDVQFHMISELSETDLDAAAFLSTVLHNAN
                     GCGVGARNALSTLREDRSEDQPSMSPAPTASASTSTVNGLLHTHSSRLDSKEFTLTHR
                     APTYYDGVAVAFLGSVLDCYLPQKPVQKYYNMRVGTW"
     gene            <451378..>452868
                     /locus_tag="LMJF_36_1220"
                     /db_xref="GeneID:5655372"
     mRNA            <451378..>452868
                     /locus_tag="LMJF_36_1220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686642.1"
                     /db_xref="GeneID:5655372"
     CDS             451378..452868
                     /locus_tag="LMJF_36_1220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686694.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655372"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1V4"
                     /translation="MESLTDRAITTPLGADTAAHATRETHDVDSEDGIFGSPLQLDGS
                     TMGTAELNSALESLSSATVPNTASCSQNNLSLAKNLLADKDDTTTRSWSADHDNATAT
                     LWRGCTADGERQDFSVSNVTGKHDGDVRGTENVSVCVKAPAEGQEMLLPGGAPPTTVN
                     FSTMCNTSQVAASTREFSAMWNPQGMLGGASETLDARPAVGDASSMVAVVLSEEVPDD
                     LPRAPSAYTELRSCPSTPLVNTIHLNLQYTRATSVMSISSPFSASVQSISFLRTSVQH
                     LMSNSQHSYASSSARATANESPLLGEVGAAEPRPLCASLLETGSVVTQSALEPTKRRE
                     VTFARTPVEADGSSEVVPLIDPSAMSAADNASTAQEASPHNPGAPTLPCTPVAHRTVT
                     TSVEGCLLKEEQERRALVDDEASRFKTMVAREVSAYFAMSCQRRMKARQPSENVGVTE
                     QRKSVEEESSQLHDSMRARMRMAEDEHENFMSNYRQMQQAQLHSAR"
     gene            <454711..>456465
                     /locus_tag="LMJF_36_1230"
                     /db_xref="GeneID:5655373"
     mRNA            <454711..>456465
                     /locus_tag="LMJF_36_1230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686643.1"
                     /db_xref="GeneID:5655373"
     CDS             454711..456465
                     /locus_tag="LMJF_36_1230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686695.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655373"
                     /db_xref="GOA:Q4Q1V3"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1V3"
                     /translation="MKSFPLQHKMMQRLKLPYIQVGTCEVMNLASSYNMDSFSVFNGK
                     NRGLYQSTAAAAAQRASTTPTDDPAAWSLSQCQEPFLGEMVAGGLLDSYTGREASTFV
                     SSYLANALSMHTVLPTELRTLRKEDPSNPLLAIMMAALARRRGMHTESGSLVTEWELQ
                     QYAISADAAFFRACEAGRRPSYLSSAQKNRDRDAGAEDPRPSPLPPEESGCRGVWFSA
                     TVTPTWLAEQQRRALTEHKQRLAPSPQRILACAEAADEREVRELLAHTPFCLDVAVGC
                     VGNSRAFGVARNALTGGMQSRLDASRERTVPLSIDHNPLRTSEYRRVVQAGGIVDSTV
                     GDMIDGNPYYNVARSFGHWSMKKDGRRSPVEQKMIALPTVKTWRMLAGDALVLCNHAV
                     FETRHQDDSSMDELAKVVGRGLSLNLPPEAIAASLCDFAVRFGAEHSLQVMVAVAGSA
                     AGTSPCASSGDDSGKTVPEFAEWVDPGPLYLGACQRFPELRRRLQQDCARCEMTLASL
                     IRRRWERVRHLLPTRHSLSLLPYYGKECGALQQIMEEEAIFFEHEILRDVTDVNDPRL
                     DVVFQKLAKRLQPSAPVA"
     gene            <457015..>459333
                     /locus_tag="LMJF_36_1240"
                     /db_xref="GeneID:5655374"
     mRNA            <457015..>459333
                     /locus_tag="LMJF_36_1240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686644.1"
                     /db_xref="GeneID:5655374"
     CDS             457015..459333
                     /locus_tag="LMJF_36_1240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686696.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655374"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1V2"
                     /translation="MRCSSSPTATPTVARSSNLRHYRALLQVMTYAGQREQTAEQVIR
                     DAMVGGVVVPFTVTHNANAPAAAMTTGDPPCITPMDAPVSADNSPREEVGIIALLMPS
                     SKFIGTAASLLADGFFSFAPLSSTVDKSRHTSYQHRSECQVRDLFTLIMLLFPECFIA
                     ETLPRTPLETREAEGSVSETQSSNRAESEVQHPSSVSRVSPPVSPTPPILPRGRCTPS
                     AQRTQTSVTEGRGIVVDAVSPSNSAVDAALGGFHAAPLEGSLGVLTPAKLVTTDAGAT
                     DGEGLGVSSASASMTANMMPLPIVSAVPLSLDVLDVLLESRRSLAVVLLSVINDALRE
                     VQYRQLEQSHTSTTATLSTAAARLPSCEGGVLQFSAEVLLTAKLLLMSVISASAVWRQ
                     RFSKTMEGMKAVLQGAALLPSPPPLPFHVFSELLGEDAEGATPFLTLPVERWSWGKEK
                     DALGQWYDRLLDRLLVATDGAGVRVDAYLKTAKSTAVSCGRSVSSFPALLLHRPSDGQ
                     PAVEMSLASVARLSGSVRLPSLPIQQGELHLLLCPEVQDDKTGVLQARGHELLLDATA
                     SPTADFFQACTSSACSEAQLQPSGDAVPWLFRQRFKDLSSTEQGIVTAALCDPATLSA
                     VLEKNAAMLVRLTLWCRNRWPPSSDASAVLASTASQSDDVVKENKGPKAVHSIGDQVE
                     QHILFQRPFSAAVGRYVRELVTLRGLSKDVLEAWMRHVCTGTDAAAGVAVDGSIPSPH
                     RAMFSALVKFAVLHNRWRLTPEVEALQKEYAM"
     gene            <461147..>461719
                     /locus_tag="LMJF_36_1250"
                     /db_xref="GeneID:5655375"
     mRNA            <461147..>461719
                     /locus_tag="LMJF_36_1250"
                     /product="putative 40S ribosomal protein S9"
                     /transcript_id="XM_001686645.1"
                     /db_xref="GeneID:5655375"
     CDS             461147..461719
                     /locus_tag="LMJF_36_1250"
                     /codon_start=1
                     /product="putative 40S ribosomal protein S9"
                     /protein_id="XP_001686697.1"
                     /db_xref="GeneID:5655375"
                     /db_xref="GOA:Q4Q1V1"
                     /db_xref="InterPro:IPR001912"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR005710"
                     /db_xref="InterPro:IPR018079"
                     /db_xref="InterPro:IPR022801"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1V1"
                     /translation="MRNYNNFNRVWKAPRRPFEKERLDREMKLCGQYGLRCKREIWRV
                     NMTLSKMRRTARLLLTLPENHPRRLLEGSAIMRRCHEYGFLDEEKDKLDYVLSLTVPD
                     ILERRLQTIVFKAGLAKSVHHARVLIQQRHIAVAKQIVTIPSFIVRVSSERHIAFADA
                     SPFGNGRAGRVKRVRAKAAKRHAGGGDDDE"
     gene            <462650..>463765
                     /gene="ALD"
                     /locus_tag="LMJF_36_1260"
                     /db_xref="GeneID:5655376"
     mRNA            <462650..>463765
                     /gene="ALD"
                     /locus_tag="LMJF_36_1260"
                     /product="fructose-1,6-bisphosphate aldolase"
                     /transcript_id="XM_001686646.1"
                     /db_xref="GeneID:5655376"
     CDS             462650..463765
                     /gene="ALD"
                     /locus_tag="LMJF_36_1260"
                     /EC_number="4.1.2.13"
                     /codon_start=1
                     /product="fructose-1,6-bisphosphate aldolase"
                     /protein_id="XP_001686698.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655376"
                     /db_xref="GOA:Q4Q1V0"
                     /db_xref="InterPro:IPR000741"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR029768"
                     /db_xref="InterPro:IPR029769"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1V0"
                     /translation="MSRVTIFQSQLPACNRIKTPYESELIATVKKLTTPGKGLLAADE
                     SIGSCTKRFEPIGLSNTEEHRRQYRALMLEAEGLEQYISGVILHDETVSQKASNGKTF
                     PEYLTARGVVPGIKTDMGLCPLLEGAEGEQMTEGLDGYVKRASVYYKKGCRFCKWRNV
                     YKIQNGTVSEPAVRFNAETLARYAILSQMSGLVPIVEPEVMIDGKHDIDTCQRVSEHV
                     WREVVAALQRHGVIWEGCLLKPNMVVPGAESGQTAAPEQVAHYTVMTLARTMPAMLPG
                     VMFLSGGLSEVQASEYLNAINNSPLPRPYFLSFSYARALQSSALKAWGGKDSGVAAGR
                     RAFLHRARMNSMAQLGKYKRADDDASSSSLYVKGNIY"
     gene            <464364..>464768
                     /locus_tag="LMJF_36_1265"
                     /db_xref="GeneID:12983043"
     mRNA            <464364..>464768
                     /locus_tag="LMJF_36_1265"
                     /product="hypothetical protein"
                     /transcript_id="XM_003722886.1"
                     /db_xref="GeneID:12983043"
     CDS             464364..464768
                     /locus_tag="LMJF_36_1265"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003722934.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1265"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1265"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12983043"
                     /db_xref="UniProtKB/TrEMBL:E9AG14"
                     /translation="MEVLSHPSLRADTYKSIYINIYIHIYVYLCVTGGIAACAQGLFA
                     GSPFVSLLPFNFFFYSSLWRCISSYIQAGTRVHTRTGTHHKENNNNQKETKLGFSSIY
                     LSVYRWEKKTKYNNNGNKEKRKEEKKRELLEE"
     gene            <468203..>468778
                     /locus_tag="LMJF_36_1270"
                     /db_xref="GeneID:5655377"
     mRNA            <468203..>468778
                     /locus_tag="LMJF_36_1270"
                     /product="amastin-like surface protein-like protein"
                     /transcript_id="XM_001686647.1"
                     /db_xref="GeneID:5655377"
     CDS             468203..468778
                     /locus_tag="LMJF_36_1270"
                     /codon_start=1
                     /product="amastin-like surface protein-like protein"
                     /protein_id="XP_001686699.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655377"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1U9"
                     /translation="MKRSIPLVVYVVVQFVAFLLVLAGTSADMFRIPRGSLPTLCITL
                     WGLRLTCNSSGYAAYIDATFRPCPHRIARFRLAQAFALISILVYGAAFVLGLVLLFYC
                     SLLRLVCLVLNIVGAVTLCVVWAAMAVTYNKDEHAFCRALKLTGLYAAGFALFLVAWI
                     LDILNIIFLLLPCTVPATKANEKPESPTAQE"
     gene            <471758..>473536
                     /locus_tag="LMJF_36_1280"
                     /db_xref="GeneID:5655378"
     mRNA            <471758..>473536
                     /locus_tag="LMJF_36_1280"
                     /product="tuzin-like protein"
                     /transcript_id="XM_001686648.1"
                     /db_xref="GeneID:5655378"
     CDS             471758..473536
                     /locus_tag="LMJF_36_1280"
                     /codon_start=1
                     /product="tuzin-like protein"
                     /protein_id="XP_001686700.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655378"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1U8"
                     /translation="MRGRLPSPKKPWNSLAGVLVGVRVTHAASVLEDRPVALGRLVSR
                     LSEAAYKAEMLRTGKRDRDGEDRRGDAAQLPVVDAGTRVTVRTEGDPASGAAVAPSAM
                     HMKGTIAKVNGNATYIILMEKGEVELSVASERIVALQPRKKLLQSARLVALVNWLRSC
                     VHDPRDVEAIALVLFSRGWRAERMYLLEGVDLLPFVFVSRVELDSVSEKARWERDHDK
                     AMQMLRRERVKDTNFRYALAKYKGTMSCIAGVLVVAYVFTANLRAYRRQQRGHQLRTA
                     IETLSKAARPRKEEGMLAAAAEAFEVRREDEEALVRSVLTQMAPSHPRIVALAGGSGG
                     GRCVPCRRAVRVEGVALVHVDVGGTEDTLRSVVRALGVSNVEVCGDLLGFVEEAMRGA
                     TVKASDGVPFLVMRLREGSDLGRVYGEVVSLVSDCQACHIVLAVPMKALTPLNVSSRR
                     LDLYCIPPFSRRQAFAYAEHTLDALDLVCFVEVVGTRSSDVDELCAALRQRGVDPVTY
                     TSLMLARAMRRLQAALGPPGSPARAAIRQLASMPFADGVRDDATGAMSVLGQPDVQEM
                     VLYDPVQHEWRFAQQVYHTAARCILI"
     gene            <475223..>476257
                     /locus_tag="LMJF_36_1290"
                     /db_xref="GeneID:5655379"
     mRNA            <475223..>476257
                     /locus_tag="LMJF_36_1290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686649.1"
                     /db_xref="GeneID:5655379"
     CDS             475223..476257
                     /locus_tag="LMJF_36_1290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686701.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655379"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1U7"
                     /translation="MLPALTWPSSEWSCIHDGGRPVCGNLKADRASLSHSAASFANGK
                     GKEFLSSFSFWLTIRRCQSVRPRSPFACRRCGDFCWGLAPTDNDFFLILSLSCGSHLS
                     NGLPRIPSHAFPSWLAGYPPENVLRRVTNLFVHPSVVAVRGISSAVIGIMMENYDTTI
                     AGKRLTREDLDQHIRRLTAPRREVELRDPFEVCPTKRISPEALSRMTDRLYTQSLQHK
                     QERLAAAEQAAYGAHTRGTLLRASPLSPQDQETSVKRLFNDAVERKQTNMEQLRRQHQ
                     YHRPTNETKVTLNMFVQHMYYDRLEAKKKTEKRLYDTYLAPTEIHTGTISREKADEAS
                     NRLCTTKAGA"
     gene            <476707..>478542
                     /locus_tag="LMJF_36_1300"
                     /db_xref="GeneID:5655380"
     mRNA            <476707..>478542
                     /locus_tag="LMJF_36_1300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686650.1"
                     /db_xref="GeneID:5655380"
     CDS             476707..478542
                     /locus_tag="LMJF_36_1300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686702.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655380"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1U6"
                     /translation="MHTYLYMLSFTPLSRIISSGDDTHDVIESGEVLFILLLFLFLFL
                     PTAYRGCNLPRLSPTTTTHPVFDMADAAAYLKLGKKIQSSRFGRAGVAREEATVSQND
                     GYAAAASDGGTAGVDVTSNSTTSGLVVVQVNDAQREVQQLPMKKKRVAKRSRSGSDEK
                     DRPTALPVKSNSMATAEPATSTGQPPSEDLSTRGVVFEDELNLTNVASPTAPVPPVEG
                     VAQRINLMAKWFPASLQERKLDAAVAPSMMFVEATVDRVNKMREYVLILRYGIEDAEA
                     LLEETRQTQSNVWGKKSVDGNSTHQGPRREYWDLSSSEVRQLVRSVGLPRFTQALAEF
                     SDAVFTSHWSAAAAVYRLLSRRRRVCAPMDYNIRAWHEYLNTHGPESGRAPRLSDFLW
                     LSAASTSAMFTATASRLLRGARSCAEQISVSDASLGDRASRTGSEGDFGSSDRPRFFD
                     NTETAAEEEEPVPTRVWLLSAPVNFPTTLSPDQRAVLSFLRFLMPTSHSSRERTTSVG
                     YGVWLFAAFSALDIPLDPDTDRLAHDLFRTCCRHLRTLAAWQGVSGSTRDLLLSKLHP
                     RRPDAAPPLYASLDDICREDVLALYTIVVVLARFFRQNQDHFMPL"
     gene            <480150..>480923
                     /locus_tag="LMJF_36_1310"
                     /db_xref="GeneID:5655381"
     mRNA            <480150..>480923
                     /locus_tag="LMJF_36_1310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686651.1"
                     /db_xref="GeneID:5655381"
     CDS             480150..480923
                     /locus_tag="LMJF_36_1310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686703.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655381"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1U5"
                     /translation="MFTLLCCADLAGNKVNLEIALDTFPATLRGLESDIARIFNREVE
                     KSGAVEHNANVAEPFQVMSVFVYDDVLLRWTKLESLTQLHEYDQLYVFQPQTQWHVDV
                     QKELPPPRPPARSRASSITGASGTLASLQVNGCASSPWPRSGISTRISAAGDIDTSHS
                     PVPSRSPARAQLEEHRREEERLAHRLSTLRRVREHLEREAQREEEEERRRRSLETYRL
                     LKCKEEEIWSQRDALARAEEEFRQFLAEKQRLMGQSPSP"
     gene            <481764..>483032
                     /locus_tag="LMJF_36_1320"
                     /db_xref="GeneID:5655382"
     mRNA            <481764..>483032
                     /locus_tag="LMJF_36_1320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686652.1"
                     /db_xref="GeneID:5655382"
     CDS             481764..483032
                     /locus_tag="LMJF_36_1320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686704.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655382"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1U4"
                     /translation="MRCGSYAAFRSSGSALRRPKSDYGISLEARDRSNGKVPRKSTSA
                     SSCSAVEQTGQHLGSPRWRFVRETASVTQPTATVARRSPALLSIPPGQRTSTPHHGQM
                     LPRGEQHVSVAGSDDYMDDAASALLSELQQVVVRVSHQMVEERRRAAQQRKQIRALEA
                     IVAEQDAMLDALRTQCDAAQCEKSRLLKSYQQELRWRGADPVQAARRSRDICGTSGTH
                     VSAAQVDNVVQAEFRRLSTIYESCPFSGFDDVSPVVAAVLRSLATQVLQLRGAARNDE
                     AEASDISKDAQPAPVQPHATSSSLRASARGTSTSSLMPAFNRSAPTDGHGKAGVVDRV
                     TPLAALEKRKKASMFAAATAGPNHSPSETAGRTNGEEAELHRVDLDAGRNGDADAAAC
                     MASEASASVASSVCEDAASILSDIRARYGL"
     gene            <483956..>484906
                     /locus_tag="LMJF_36_1330"
                     /db_xref="GeneID:5655383"
     mRNA            <483956..>484906
                     /locus_tag="LMJF_36_1330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686653.1"
                     /db_xref="GeneID:5655383"
     CDS             483956..484906
                     /locus_tag="LMJF_36_1330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686705.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655383"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1U3"
                     /translation="MMSARRWCATTPPHGTGSSGSQSIDEEAVVRAAKWSSSKFEERL
                     GFCAGETITEERLKRHYRILAKHYHPDTAAGSGSSNGVGYEGETSAGRDGAFQNIKEA
                     YDVVSAAVKQGGRRGGNASRGFSAEDFAGGFEFSDEARRRSQMRLLGDAVLLFVFMTV
                     AFIGIVSSHNKSRMQSRYLWHLVGIFFIIQLFPRLFAAAILFAVHSMHLLEKATLQEQ
                     AAISLIVERTERACCVQLDGLRTEAQPNVVVQVTTTADADNEATERVSSTLTFDKGVT
                     AFTLPVPADSSCVYHVKAVDEARKIVLVDRSLSARMPAAV"
     gene            <485854..>487989
                     /locus_tag="LMJF_36_1340"
                     /db_xref="GeneID:5655384"
     mRNA            <485854..>487989
                     /locus_tag="LMJF_36_1340"
                     /product="putative N-acetyltransferase subunit Nat1"
                     /transcript_id="XM_001686654.1"
                     /db_xref="GeneID:5655384"
     CDS             485854..487989
                     /locus_tag="LMJF_36_1340"
                     /codon_start=1
                     /product="putative N-acetyltransferase subunit Nat1"
                     /protein_id="XP_001686706.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655384"
                     /db_xref="GOA:Q4Q1U2"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR021183"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1U2"
                     /translation="MSSTPSTLSVDQQRLFDRMNREYSNREYSKALRTSECILRVVPD
                     HVDTFAGRGLVLYNMERQEEGYESIKQAILLNPKSMVAWHALGMCQRLDKKFGEAVKA
                     FKRALTFDPANTEVLRDLASACIQVRDWPLFLEAREKMVTAKASVRANWVALSCGHRI
                     LGHSRIAAAVMDTMTSIMDAGDNPVEVSEAQLYRVELELESGAPQRALELLKKHDSEI
                     IDVETKLLLRAKAHAQLGQRMEAEKRYIEVISMGVSEADSIAALAHLRKIPLDHYLRP
                     AAGYTEKYMEIIDRVLKACPNCDYAKRHALDCVPIAEFGQRLAAFATPYIQRMIPSLF
                     SVLKSLYVDAERAAIIGDVFAMMERELEAKDFSCFGGEANPCYILWVRTFLASHYRRT
                     GEYALAHAYIEKAINHTPTLELLYLEKAKIFAREGKTAQAAEQADWARRLDLQDKYLN
                     SKAAKYYFRDNQVEKGEATMQLFYKPSVVAGDTYLTALESQCYWYEREVGEAFYRRGD
                     YISALHNLLMFERHHEQNHCELSDFHNYVFRRNTMRPWFDVLDCDDNMGRNKFFLKFC
                     PAIVRTYMRIHEKGEEAVRAAHVPRPELNFDEIAADEVKRVKQQQKDYCISNVDLSEP
                     LVKASRYMGYLLAHRNTQASTHTLAIELYTAADKPLLVARALLALHRQRCSKTKDLAV
                     AFKTGLYTRTAMDSRVQAVVDEILAAVLE"
     gene            <488745..>489602
                     /locus_tag="LMJF_36_1350"
                     /db_xref="GeneID:5655385"
     mRNA            <488745..>489602
                     /locus_tag="LMJF_36_1350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686655.1"
                     /db_xref="GeneID:5655385"
     CDS             488745..489602
                     /locus_tag="LMJF_36_1350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686707.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655385"
                     /db_xref="GOA:Q4Q1U1"
                     /db_xref="InterPro:IPR001510"
                     /db_xref="InterPro:IPR019406"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1U1"
                     /translation="MSRVRVMIDRNQRISLSASAFFFLTHAPLRHGELLPKQRVQRRR
                     RSAMPKLCVEYSKSGRAKCSNTSCGKKIEKHELRIGTEVIMPFSEEGVESWKWRHLCC
                     FTERQISNARSSGDIDAIQGEGDLAPADKALVQNMREGRLVGDMSIVGRIGDVAHSAA
                     TEELKGKGSKAVKPKAKASGSANDGGLPTASTGEKRPRAPPRKPKMPNTKMHDDVDSD
                     STEEYEVAVEAVMGKPKCPYGANCFRTNEEHFRQYTHGDDNGTAADAAVPSDHGSAKL
                     MPVIKRRKL"
     gene            complement(491569..491652)
                     /locus_tag="LMJF_36_TRNATYR_01"
                     /db_xref="GeneID:12982069"
     tRNA            complement(491569..491652)
                     /locus_tag="LMJF_36_TRNATYR_01"
                     /product="tRNA-Tyr"
                     /db_xref="GeneID:12982069"
     gene            complement(491733..491804)
                     /locus_tag="LMJF_36_TRNATHR_01"
                     /db_xref="GeneID:12983042"
     tRNA            complement(491733..491804)
                     /locus_tag="LMJF_36_TRNATHR_01"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:12983042"
     gene            492629..492700
                     /locus_tag="LMJF_36_TRNATHR_02"
                     /db_xref="GeneID:12983039"
     tRNA            492629..492700
                     /locus_tag="LMJF_36_TRNATHR_02"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:12983039"
     gene            492783..492866
                     /locus_tag="LMJF_36_TRNATYR_02"
                     /db_xref="GeneID:12983040"
     tRNA            492783..492866
                     /locus_tag="LMJF_36_TRNATYR_02"
                     /product="tRNA-Tyr"
                     /db_xref="GeneID:12983040"
     gene            complement(<495891..>496553)
                     /locus_tag="LMJF_36_1360"
                     /db_xref="GeneID:5655390"
     mRNA            complement(<495891..>496553)
                     /locus_tag="LMJF_36_1360"
                     /product="putative adenylate kinase"
                     /transcript_id="XM_001686656.1"
                     /db_xref="GeneID:5655390"
     CDS             complement(495891..496553)
                     /locus_tag="LMJF_36_1360"
                     /EC_number="2.7.4.3"
                     /codon_start=1
                     /product="putative adenylate kinase"
                     /protein_id="XP_001686708.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655390"
                     /db_xref="GOA:Q4Q1U0"
                     /db_xref="InterPro:IPR000850"
                     /db_xref="InterPro:IPR006259"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1U0"
                     /translation="MPLFIILFGPPGSGKGTVSHLLVKEYGFVHLSAGNLLREEVLKK
                     SPLGRRCAEIMSEGSLIPDELVVDLVCNRLSEQAVQKHGILLDGFPRNLRQAEVLTAR
                     GFKFDMMIFLDVSPEILLDRCLSRRLDPVTGRIYNLKSDPPSPEVADRLQIRSDDTKE
                     KHERRMQIYNSQKATLIAHYSDIIIEINADPEIKVVFKELQKKINKRLQGTTTQVPLA
                     KL"
     gene            complement(<498032..>500386)
                     /locus_tag="LMJF_36_1370"
                     /db_xref="GeneID:5655391"
     mRNA            complement(<498032..>500386)
                     /locus_tag="LMJF_36_1370"
                     /product="putative Transitional endoplasmic reticulum
                     ATPase"
                     /transcript_id="XM_001686657.1"
                     /db_xref="GeneID:5655391"
     CDS             complement(498032..500386)
                     /locus_tag="LMJF_36_1370"
                     /codon_start=1
                     /product="putative Transitional endoplasmic reticulum
                     ATPase"
                     /protein_id="XP_001686709.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655391"
                     /db_xref="GOA:Q4Q1T9"
                     /db_xref="InterPro:IPR003338"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR004201"
                     /db_xref="InterPro:IPR005938"
                     /db_xref="InterPro:IPR009010"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029067"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1T9"
                     /translation="MADAVGNTNSKVKLNKLIVEEPYNDDNSVVSLNPKRMEELNIFR
                     GDTVLVKGKKHRSTVCIAMEDDECPPEKIKMNKVARRNIRIHLGDTIRIMPCKDVPYG
                     NRVHLLPIDDTVENLTGDLFENFLKPYFLESYRPVKKGDSFVCRGAMRSVEFKVVEVD
                     PGDYCIVSPDTIIHSEGDPIHREDEEALDGVGYDDIGGCRKQLNQIREMVELPIRHPE
                     LFKNIGIKPPRGILLYGPPGSGKTLIARAVANETGAFFFLINGPEIMSKMAGESESNL
                     RKAFEEAEKNAPSIIFIDEIDSIAPKREKAQGEVEKRIVSQLLTLMDGMKSRSQVIVM
                     AATNRPNTIDPALRRFGRFDRELDIGVPDETGRLEIIRIHTKNMKLADDIDLEKVAKD
                     SHGFVGADLAQLCTEAAMQCIREKLSIIDWEDDTIDAEVMNAMCVTQEHFREAMAKTN
                     PSALRETQVETPNVVWEDVGGLLDVKRELQELVQYPVEYPWKFEKYGMSPPKGVLFYG
                     PPGCGKTLLAKAIATECQANFISIKGPELLTMWFGESEANVRDVFDKARAAAPCVLFF
                     DELDSVAKSRGAHGDGGASDRVINQILTEMDGMNVKKNVFIIGATNRPDVLDPAIMRP
                     GRLDQLIYIPLPDKASRVAIIKASFRKSPLASDVDVDQIAAATHGFSGADLSGICQRA
                     CKMAIRESINKEIQLEELKKSGQLDENADIDPVPEITRAHVEEAMRGARRSVSDADIR
                     RYDMFKTSLQQSRAFGASNPPPAEAAAPAGSGAPPPADDDDLYS"
     gene            complement(<503460..>505316)
                     /locus_tag="LMJF_36_1380"
                     /db_xref="GeneID:5655392"
     mRNA            complement(<503460..>505316)
                     /locus_tag="LMJF_36_1380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686658.1"
                     /db_xref="GeneID:5655392"
     CDS             complement(503460..505316)
                     /locus_tag="LMJF_36_1380"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686710.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655392"
                     /db_xref="GOA:Q4Q1T8"
                     /db_xref="InterPro:IPR009003"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1T8"
                     /translation="MGLCAFHPLLGMMHMRSRRLSFSPRRGTRPVSEGPSSWNLQVQG
                     RTSLAKLARRRLCTHKARTSKRVPMTSTLTNSNRINIPAVCRLRERNTNKTVGSGVLV
                     AQGLLLTSATAIPTQSRATHIVATFFEGTKKSAVDVQLQPQRYYFASRYPPEMDYCLI
                     SCEEAPLLNVTPVHMALTGKGWAPVEEGDVVLIVEHPIGDVAGTAAVPLDGKATFSST
                     LSATGDGDFDSVRAPYTEQKRFEEVLRCRGNVSFLKSNGSWRTAGCPAFNEHGQLVGL
                     QSQSRADGEGVVNRILSLISIVKHLFANVQLPHLPQEDVTFEDVWDTWYVTNDITRIL
                     AILANFKGKSMAQQVTWRLCELTAKPQLVKSIASNGGIEVILQNLSLFSSDEKLSESG
                     LRALWNVSIGEEAHLATIIKKEGVQTILDVVESFPANETVLEFGAVLLHNIAGCRAAP
                     NFSEAHGARALKALYPGFQQFRESVVLQKFALSFFATLARLNEDFARDLVQQHVIEHI
                     THLVEEKPKQIFLMEIVVGFVAELAQYPQTVELMCSNTPQYAAASMSYLIDLLIHIIL
                     EYKDLDSLLVSGNRALWGLGNVPTCRGIILENPRGIDALRISLPPLIASTHR"
     gene            complement(<505955..>509296)
                     /locus_tag="LMJF_36_1390"
                     /db_xref="GeneID:5655393"
     mRNA            complement(<505955..>509296)
                     /locus_tag="LMJF_36_1390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686659.1"
                     /db_xref="GeneID:5655393"
     CDS             complement(505955..509296)
                     /locus_tag="LMJF_36_1390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686711.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655393"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1T7"
                     /translation="MRFSVVGGPLASTISLEAKQSDSFESIFKRVQEAVGKATPLDAY
                     DLYTTRRSSLTGELVAAAGPLRFTDTPSALRLDFERSDPHILMLMQRSADNERGSTQN
                     QLLCSTAAAGDASRPDSTAIASTSPSLMTTPRVRDEYRRRMRAMYLKYDPGQIHKVEV
                     ALDRYRGYEEDVLQQLVKRYGPEPAPGEVDLSPKAAAAPSSGPDARESMPSHSASTDE
                     ANPHTKPSYYDRLVAIYSTYEPAKLSKVNGTLRRYAGREEEVIQQLVKKYGPEPSTEP
                     VAAAKVAEAASEQLAPTSGVGRQQLTSSATHAEASAHASATVPAVEEQVAAVPEATEA
                     SAVPLTNTAKVAAATIPAAPPEASAYGDSTVGTQLSNTERKPLATVVSPLDGSLPCYT
                     AVALPNKASAVESMAIGANYRERLVALYNAYNPAKLHTVEGTLKKFSGKEEVAIQQLV
                     RRYGAEPAPLNREEARKLLTTAGAGGVPSTPPSASPTTTNAPGSAASSTAGFEPASSG
                     ERVDRVLETHKSGEEEVMAQSEVRYAAQRAKNIAGEPATSGAGSAAESGSFGAVVTTA
                     QVSAAPPSIAVSVPPSHGNSPSGIVSASTPSTVASTKAASPVGPAGAVVATPQTTRVG
                     TVGPAAAAVPHAQESKAWQGGPPQRRALPLAALRVAAAHVEAAAHMSLRERYWAIWRT
                     HHAQKRAAVLLQQELWVKASAGAAGCYRLNDSVEPAYTVANLSVVVAQEERGGCSAQG
                     RALSSELQIAMRALLASLRHCVESRVIQAQSHEEHQQADTLLTHWAAAENLCPVTDSP
                     ELACALHQAAHLIGKLEDLVTVIRTQAGQLHQLKALHRDVLERMEHAHANTQALGRLQ
                     AQLSAANNDRRALEQELERISAGGAERHARQAPLCRLYPTAEERKDAQVAKLQQELAK
                     TRNLLFLSKEAEDRLKVQLQQSHTREARRKHEEWHRQGKSSRYSISDRAYTQPRSRSA
                     RAGNGPHSSPSNSPYRRYTPVSTPRGAFSYAIAHDTPRGPSTLQVHVNGCPVSSIRGP
                     DAATAEQVSTSMSVNSSTPWPSSRYVMTPTKVDRGPCPNCLTPLTSCCREESGTASEK
                     AAFCFSCRRYFTFGELWTCDGREIM"
     gene            complement(509845..510560)
                     /locus_tag="LMJF_36_1395"
                     /pseudo
                     /db_xref="GeneID:12982070"
     misc_feature    complement(509845..510560)
                     /locus_tag="LMJF_36_1395"
                     /pseudo
                     /db_xref="GeneID:12982070"
     gene            complement(<516012..>517343)
                     /locus_tag="LMJF_36_1400"
                     /db_xref="GeneID:5655394"
     mRNA            complement(<516012..>517343)
                     /locus_tag="LMJF_36_1400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686660.1"
                     /db_xref="GeneID:5655394"
     CDS             complement(516012..517343)
                     /locus_tag="LMJF_36_1400"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686712.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655394"
                     /db_xref="InterPro:IPR003903"
                     /db_xref="InterPro:IPR023379"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1T6"
                     /translation="MTESRWITEALVQFSASPIWLTPIDNFVDDNCCIFSNESEMQLE
                     YTVAHNKFKKLIDSLLTCFLMELGVSMETAVEALQSSLAVSVQTSEGLSEQQAAKKLL
                     KQIFNADNFSHFHTMMVKRNLELDILANAALSSDGVCGNGGAALSTEEVEKETRARAR
                     VQRAIDVNGDVSEDDALRRAIEVSLQDGTAQQQVQAYRKACIQEDANLQLTAVEHQAN
                     SEKAQLEAVLQTQSAQNLPEGEHFRQNHVEPINKQKESQLQPIRAHAMSGKGQKGCDE
                     AEPQKANFNSPESPCPLPALQVPAAASAPVAAPVSVPALPSIGQRQAALPSIPSTITA
                     SVLKSAPSAPAHQAHGTAVSATPAPTPIPTKEELEKRAQYMREQREKLLARNRASRQE
                     QLNTFLQNNSSSTTTSSSAALAATGAAQSVTVEIARRLRGDLIGEARKSSG"
     gene            complement(<518671..>521382)
                     /locus_tag="LMJF_36_1410"
                     /db_xref="GeneID:5655395"
     mRNA            complement(<518671..>521382)
                     /locus_tag="LMJF_36_1410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686661.1"
                     /db_xref="GeneID:5655395"
     CDS             complement(518671..521382)
                     /locus_tag="LMJF_36_1410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686713.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655395"
                     /db_xref="GOA:Q4Q1T5"
                     /db_xref="InterPro:IPR001876"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1T5"
                     /translation="MLPALKATHLAWRGEKGRGTGRPIDLLLAAPMRAAQSVYQHGAL
                     LHPTLRAAPAIPLLLRRHRLQTLPAPWRWNRDFTSRPTDASAHQSPAQEDMLVRMLIQ
                     DAFHPASTSSLAKTCDDVAGGNEQSHRTVAGTESRSCHPSQCATPATEGGGAGGTLGT
                     EIQALGGGRPQPPPGVAVRSEMSAHVQDGLRGQEISGSPVRVDEATASVTDSRASNAA
                     AEPFATIRRGGQGDDMPRALEWLCSACHTYNSLTSSSAACRKCEASAMTSYRSAFPPL
                     RHVVIAPTAWVCQNCSHTNRQTGASAQPHAGRAGVSRVQQEKFICNQCRAPFGGVQDW
                     VCPACSHFCPRAATQCPSCFADRPLAWTCHCCESGLQNSVFAVKCRGCGHERRQKYSN
                     SVVRCTACRGWNDVRWELCATCMAPMESLLLARETRPDAEEAALPTPPLSESALGDTI
                     NVALVPDSAGMLHSKTVLQATELLKAARTSGTATAARGLRQDTEEPASLSPSPPSSPV
                     HEDEERPRVATKLPDNAWWCFTCNVAHRRNVTFCDICLESRDAMLLRNKKEIAAMRAS
                     ASSPSTGVMSPAVSSDPVSLEDAADVVIMPATVEGDWQCPYCRKLLGVRQHECCGHRR
                     EVPYGYWLCDHCCSTNRNDRSLCLGCNERRESVCPWTCQECEWGNDAANAVCLQCGLP
                     RTPCTTADRGTTLSDDSAPSTSIACGVCSAPNHFEKTACYRCRARLRDVEWTCDGCGH
                     GHRTRNALRCEGCRVIRQFDLQEEVWLCEVCTTPVFSGGEIPVRTHCPKCNAQRAPTA
                     THYPSRWKCECGLFNRSRVTECLECGARRRLESLSTTATCPRCFRDTPIDVQERCTYC
                     SASLADCFSRWESSVTLLADTRELAEGCNESEADAVPDDGDDDVVTA"
     gene            complement(<522739..>524424)
                     /locus_tag="LMJF_36_1420"
                     /db_xref="GeneID:5655396"
     mRNA            complement(<522739..>524424)
                     /locus_tag="LMJF_36_1420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686662.1"
                     /db_xref="GeneID:5655396"
     CDS             complement(522739..524424)
                     /locus_tag="LMJF_36_1420"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686714.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655396"
                     /db_xref="GOA:Q4Q1T4"
                     /db_xref="InterPro:IPR001876"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1T4"
                     /translation="MRPAVCTMTQRVVQPAALCHPWTPLWRVSLVASWCSSHFPRGCG
                     ADSARADSARPYTTLTRSLRQSWKSRSLRPWMCAKESCRAVNQGIRKECESCGTEKPQ
                     LLGWKCEGCSTINHAGVRKCKKCADASDKSKEFWMCAVCHENNRVDEIEDNSRCGFCG
                     YDMAPHSVAEEEILRRATEKTVMLQQQQEHFDSVSYTEADEQFTNPLEGAEALDPSLR
                     AIHPGSEAPITGRVLKLPAVAPFVAGGVPETRHSPLHQRRKVHPALQTVLEGATAPEG
                     PPGFDWMCRDSSCGHINPGDEESCLKCGSHITPAEWECPLCASLNHLARSRCFYCKNR
                     IPVCWTCSACQGTTSIYDKACRGCGMDRPAAEPRTFRELERGGGDHVGGYVPQGNRSR
                     GEWYCSTCNALNFSRRTECFQCTSPRPTVPDQGVADSFSAAGWGGTDSSGPAAVAAPV
                     QHNNWMCTYCQTSNFRTRHDCWKCGRTSERAEEWSSQALTPQYEREGFQEGANTKSAE
                     GAMNASWKSAGDWLCAKCYSKNFRNRLECYRCGARKHALSAARGSSVRKPVKL"
     gene            complement(<526909..>527544)
                     /locus_tag="LMJF_36_1430"
                     /db_xref="GeneID:5655397"
     mRNA            complement(<526909..>527544)
                     /locus_tag="LMJF_36_1430"
                     /product="putative translation elongation factor 1-beta"
                     /transcript_id="XM_001686663.1"
                     /db_xref="GeneID:5655397"
     CDS             complement(526909..527544)
                     /locus_tag="LMJF_36_1430"
                     /codon_start=1
                     /product="putative translation elongation factor 1-beta"
                     /protein_id="XP_001686715.1"
                     /db_xref="GeneID:5655397"
                     /db_xref="GOA:Q66NE2"
                     /db_xref="InterPro:IPR001326"
                     /db_xref="InterPro:IPR014038"
                     /db_xref="InterPro:IPR014717"
                     /db_xref="UniProtKB/TrEMBL:Q66NE2"
                     /translation="MSTLKEVNGRLNTQPFVSGFSPSSEDARIFNEMFGSNVNVIQWV
                     ARMASYYQAERDEILNAGTEKKATEPAKKAAAPAPAAAAAAEEEDDIDLFGETTEEEK
                     AALEAKKAKDAEKKKAKKEVIAKSSILFDIKAWDDTIDLEALAQKLHAIQRDGLIWGD
                     HKLVPVAFGVKKLQQLIVIEDDKVSGDDLEEMVMGFEDEVQSMDIVAWNKI"
     gene            complement(<528483..>545312)
                     /locus_tag="LMJF_36_1440"
                     /db_xref="GeneID:5655398"
     mRNA            complement(<528483..>545312)
                     /locus_tag="LMJF_36_1440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686664.1"
                     /db_xref="GeneID:5655398"
     CDS             complement(528483..545312)
                     /locus_tag="LMJF_36_1440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686716.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655398"
                     /db_xref="InterPro:IPR026847"
                     /db_xref="InterPro:IPR026854"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1T2"
                     /translation="MLEGHVAELLAMHLSRFIKDVNANQLRISLWSGNVVLHNVELRS
                     DALERIAALLHGERSGVETTDAGASASGAAGAPSRSSKSHEGSLSTSTLSMRMLLAPF
                     TVVKGVIRQLSITVPWASLESEPVQVDVTGVELVLGPLRARPFNAKEEQEREQAIKQQ
                     QLERYEKERHRLSCEVAAETVSESTSKMTASTESGHVKRGHGSAVAGTNRASGASWFS
                     WLWDFDRLSQIAVRNVRVNLQDVSMRCEFDYEGLHPSCASAFCVFVKQVQLTTTDEKF
                     KDVFNKNLLTPLCKRIALSEVVVSAHAIRQSPRGASCSAREGRNNAVPSAVGEPASCA
                     ASYDTYASRWALSTAILRVHTLQLQVKLVPPECVSRNAIVEEMPMLSASSTELTVMTA
                     DSIEVDVCFGAVQVLESMWRSYQQSLPCARYRKRLHMLRLTGRHATHTRALRQASEPN
                     SASLPQDAATAWRSLAQQRWRFAIRCVLDDVRQHRQIFGLHEWKRCEVVEAMVQFGKL
                     RRAYTAYWKRAKGVMWAPPLSALEEKRLKSMERQLSLWQVVFLRCFSRAQLVLEQESY
                     ARQQDYIEEARQRIKSGLLSSSGTGRGGTPTSFLWDWFFGRSARKNDTATLSRKSLAS
                     VAGCDGMGVISVPTYRGLCFRDLVALEWDLGRRYAPPHYARLAQPRAPQNRLPKLAAE
                     NKLYFTLRALFPKLILRLDPIYWPLTHDSSVPATPSATPLQRVEQRLVVQLRAMELFY
                     TTIPDDRPEKTSLSFFLGAASLTFEGALRSVLLQSKEQFGEDYVVVKRNAQRTHIHVW
                     VAPQLVICQLTHEWAWWYAEVSAFVQWFRAVQQAFYVSGVPEASPGAMPALAEGAQSD
                     LHGAASAGSRTSASSSSTSTPRGQSAHTTTETTVPGASPVPRVLNVTIQSLDVCVPLF
                     ARDIESSDLEIFSRQPSAFSSAALPGSLPGTMPCDSTWKCGESQGQLSTETASGDGDA
                     GDGRPHDEAILQSGDAAPAALWLHTTDSIQSFPVDGDTDGAEYTESLCSSPSAGSGTF
                     ARVAPERCFLKNETCLVLSVSTTRLWTVAPPAKRYKGTENEYYLCIGDQSKAVRVFCQ
                     NGYNTHTHTTSRQLELLSFVAGEVRLNPKELTVLLNKGIDAVADPWVFALVNDALLKP
                     TALAAADAHGQAVRALMAELRQAEYRWSGTRGAAVPWRLATSTCVELQVDSESPPVLR
                     EVPLDYARHILSALSAPLSIAASLATTVVHAISRGELATGVFGGRVCTVGVGVARLLI
                     RSEANVDLGELVLVAPEHLPPATAPYREALSALGAEEPRAIELICNFADSQWHAVEQS
                     SYDPLPLCPAREKVCPRLLLSIPDITMTTTAGRKLLTIEHLTLVQTCTAPTKPEAALT
                     IQTVSAFCDVVLVELLEVLIGTVCTMRSIKPPPQAAAYVVTGASRSDSAASEMPQSRF
                     FGVLPIRVRVHTARFQTPLSRDDVVDAPYVEVTITIDDALCTLEPLTGGTGRGGKHVH
                     LRFSVSEAMQLADYIGGEPEVRSLLSAYPWAACTGDGTAHALQCVADVTLPGSCVGDT
                     DTSTSPRPGVPPSTTCRVELVGGAIHVYCPFLYFYAAAMKADERIVRLGELARSLLLR
                     HGYTRAACFADGTRRSRVVGGAWASREAALPLSLSVEATISDLDVVLATDAAVPIDMT
                     KPNTFCVVHVEQIVCGLQQTTSGSPGASATLETQTHASVDTNRVQLLDLLTARSRDVC
                     LPDVKLRANRGVLLVPKEDLTGYTYQRGAPDDWAFLVGVHPASARSPQRAASVREAAS
                     STASRPSDVTIHMSAQQCRSLVCFFSHNVARLPIRSTRRTPRVGGGHLQHASTAPATV
                     TFPMGGSNPLSSSRHGAEAPSHQQAALSPSVTLLLTIPAVSILIDTDDYAAPDRSARQ
                     STMPRSTKEDEGEFIAPAAPPTRLPSTRRVSYEVGLRRGGQLYSAVGECWSTSPVKNG
                     QLSGVELVVREEMLENSTGGADVTETTSTHVLLTIDLVGLALLERRAGRASREVDGDA
                     RNDAAVVKVAATVRHAHFRVPHIKWWLLLCSIFSGVCSAEGGRQSTAARTPGKSGSAS
                     TIARFGEAGQNGNEGASRLGSSAFGDHRGTSRGEYMDGNKAVWPTPQEHLASRQRRSR
                     RLHGTVEITHTEVSFCTIGCANGDQQPLCRFTVPEARLTASPLPALQEGGRAHLNNAE
                     YLYDEFVLEVPCCPELLLLCVSGEADGAAGLESQLSSGSSYASVLRRRPAEASSTASA
                     APVVKGSFWRQAAAAAVAPASKSPLLSAHSSEACISLGLVSFSDAGSLRSLRYGRCYQ
                     VTDLTLHRTSVVQVRVQRMLLDIPVVPLFSLAREVVRQVMETQSIEGMRPHARAAPPD
                     GRDAESPALTYIDMEAELTDVEVRLSAEATPLGEPAASCDAGRDPVSWSVAVSSARLT
                     TSVQLQSVLTSTRVPALLVGDGLSRGWRVQIWHMIPQLVVQDVVFSTNSDTQAWWRLS
                     DVRIKASLPLTRRIICVRGKGAGGMVDELELSSSAEQLALRWRHGSTANGFQMEPTAV
                     TALNGLHYHVLASLHVDVGVESDGAVGTAPGHQAASVQVRLSTIFALASAAARLVALW
                     RQTRHTCESSVAAAVNAGTTSRPAGWWRPDARQRHGLITWYEFELGLSGRRVELIMDT
                     AAATVSDKAASALTRDCVLCVSVDGAVTVQVDRGAGEEAVKRTTVSDIAQRDAGSDET
                     MAECDGRVDDESAVAVALHTLFRLRTAPVHVHDRAGNLLLHVSAVPQGGMADAMVADY
                     ASAAARLDIDAGRVVIHASSLTAAAVVCWWKAYRALKRRWESAVTCMRQSSACPPEAT
                     RKSELSMGSERVCRWCWLQQINAEVRHIELVLAPAARVCAQRARITFSPTDVGIALDA
                     AAALELRCEEVCVYSMLPQSRAAHETTPIVLARTVSPVLVITRAPKQRPLVQYRTPLV
                     SIMNGDGHSWALCAFRIAKVVTGTVTALAARAEVTSLHTLESDPPTDGAAPSWVAWIP
                     RAEVEIHRAELRCFAPHSKRTCSAASVVCLAARRAVFRCVESASQMDSSSVGTLVGIR
                     MESSAVLSATYSSGLSTDVKAHPLLDDVTTTFALSSSSQSASDPVEVTFSAAAATEQN
                     AVCLRVLAGDALEKTVAALWLLARQKLPRRYAQARAAKDSAAAGDKVRRGSGTLWHVR
                     AAVPRVLLRCVVSSAAVSSSAQTLRHLCSISVDDVRVELYTRRGGSEGGDRQPHAEVW
                     VGSVVGETVVTDAAEELEERVMEMPWTFLELRPLVEPSGDRAPGTAPVTGGATRTRSN
                     DRAGFSVVQRSLSLSTGGEEHDSAAQDIAADDATALVIRLHALHAHPSMTLLKTLMER
                     VLRPFVTGISAASADASLTHILDDLEDTVLRVESATAVLPASGALSRHAGRVRVVEVA
                     TDWHLDEDLRLGGEGGFQLHFCGTAGRSVITVRGGGAGGAGGEKLQGSAVTIFLCLPV
                     GANGEVCPAIRVDPDLTVRFENVRVVVGEKAHAVRQDACVLEAYVELGERSLCLLPPP
                     LVGVSASPSTVATDAQVEEAAARVSQANSGAAASDTAVPQVPTTSLWAVSTIFSVNVA
                     VGFDVSLTAGARRLAATGAVKGRYRFEEKRNPERTLRSEHEGECTIVLHTCVSESGPL
                     TDTPVAATAQMCLAAAENQHLVVLDCGSTRWRLPLGHAHVLIELGRLAQQALCQTPFP
                     SPPQRPWQPPAAGDALAHGPTRHATRLDVRANVPSWALTLTSDAGSALAILLVEHAGL
                     QCCTDMDVADVVLTAEATVSLRDSIELDDESGEDQGATLRYAAERSSVASAMAARVLF
                     SAQPHLSLSLTRFSPGCRSLSVSVHVDSVVATLPLVTAARLLRTSAREMDAGKLVFCN
                     DSGVEMEVAESAQHAGAPLRSVSRWRLLAAPGRLLHTNIPPSCAVLMLTPVTAPVSDV
                     SSTAGRKDGEGSGGVAVNLQALADGAVGRVSLPGYTSALGALDLVVRKSVRDRLEVVH
                     LTSSVVLANVFYAVPADGSAAAPAAAGIVSVTAHGARLTVPPRSARYVPLPLLRECLT
                     VELDGGAYAPVAKMLTWAMMADAMTLLADQAAGGGGETSGGSGNGGSASRKSGTAAGF
                     MLYGNLDAQGRDRADNDNGYGGTLRAPAFCERVRALDAFTLSFPMLLSPLTPAPMKPL
                     CGDGAGDGDNDATFASAPARQSEAAVSSTENTARTGRVVQLTWRRRCSRLVAPLFSGR
                     LSPSEYTVAVGPVWTLWNWTGCRLRLRLRTSRDGVVSSPVKAPQGTLSPPSSLLTSRS
                     SDAVATAEVENGACFQWTPTTLDALQGTVFAFFQLMAPSLAGGSTTLPKSPSSTQWWS
                     VAAPISLQERPPLYIRLQQGSNTTRGAVRIEQHGPSSVVVRCAALLRSALARPVYLRD
                     AEQSQPLLGAGAHGCVLPRQQVPLFYSEYVTTLAPHADLVGFTVVTNPVTGTGARNAS
                     LQESNAYYLKTPVVATLLSAQELAHCTRFYTVSAVSDAQFERPAATLHGKNDKDLGEQ
                     CVPAEALACLWTPEPPTVVQLSSLCRIRNTHVHRTLLAMPFDASAPSNAEGARPAPSM
                     VTLIPPGEEREVTEFCRHAKEPEMQFCYSTIGGKAPAHAWSPPVRLLSLATATQPLVL
                     KHTCVPRDLQGVKSDAAAEEPRFIMNPVRRRVGETVALAVEHFRCLTVLSTMTSVSLC
                     VSVGLQAAPPLKIVNRLNTTLQFAQCAVTTGSDLASSPARRGAVTTALCSCAPRPCSY
                     VVAAGTMSCGCWEVPVLELPGLRVTLYSNVRQGFTVSQDVDLLRCAASPSSGARVGNT
                     DAYVYVSLDHRRRQYTVTVAPSRQLEGRMLFQPRRLTQLEVYVHSCTVYVAAMTLPRA
                     GPFARKSLIAQAARGRLRLRRGARSGESVNRDTVPLIATDEDVLTFLEGHELDVVLLR
                     LLGFYGSATLTERHLMGSASLALLEVVDCTTVEAAYPVILRVGPRAGSGSATTMASNA
                     TVVPDAEAEQGHVSSPILPDVFGGAATLTSSTSVPHFKDPSWFALEVQLTRPGQAAGV
                     DGVVMLPVPRLRVTVPPIVVRADDDLLFTLRATAERLGEEWASAAPSEQGGHAAERRG
                     SLFSTPGAAAADSTTHSSHRACNVFVYALQVSPIVAEVTYTRSGHWRYNPFQGLAQIP
                     EQLIPSVEDLSISLKEVRLQEVELRWSHSLFGIAKSFLWPLYRTQLLLQSYKVLGSLD
                     VLGNPRALLGSWSRGVWDLVTNSSGQSRWTSTREFLRTTTSSTLHSVGVLARSIGNLA
                     GTSPITVAPRLSCGSSSSDVIGHAVLAAPQRRGVLGEVLHEVGGGISDAVTKPIRGAR
                     EGGVSGFLIGIAAGVAGLAGRPVFGFFRGVSVTSEFYARLLGGLGALTEHEARHLGLQ
                     RNYLIVSTSARGAPVWEAAEDVEGQDSGTGAATHVNRVSRASLPRGQYILTHAMYDQV
                     FADVPRWRRGEETNVRLAVGRVGIYNTALHTPYAALCTFLSPSEFRDALPCALTALLA
                     GNIISLLACNCTVGGFRGSAVVEKGNDKAPDASDTGEGQGTQARLAYECERASYIKAS
                     LGMRASHTYVADEVFVQVCSLEEIEAVLKETEAQKKYSRALARAIGAAGERLLAP"
     gene            complement(<547543..>548010)
                     /locus_tag="LMJF_36_1450"
                     /db_xref="GeneID:5655399"
     mRNA            complement(<547543..>548010)
                     /locus_tag="LMJF_36_1450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686665.1"
                     /db_xref="GeneID:5655399"
     CDS             complement(547543..548010)
                     /locus_tag="LMJF_36_1450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686717.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655399"
                     /db_xref="GOA:Q4Q1T1"
                     /db_xref="InterPro:IPR003117"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1T1"
                     /translation="MSAVASDDSAGHVVDPVQHTHRYVQEHRLNELFGHLLQLVLYHR
                     PDDPRAFLAEEVRKIREEKVSLSLFTERDLETMFEMIDATAQRWITVAQLRNTCRNLA
                     TASSAGNVSTGGGDLTAEQEAAIAGAGDAAGRVTMDKFKEVLSSLLLTKNKWS"
     gene            complement(<549194..>551161)
                     /locus_tag="LMJF_36_1460"
                     /db_xref="GeneID:5655400"
     mRNA            complement(<549194..>551161)
                     /locus_tag="LMJF_36_1460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686666.1"
                     /db_xref="GeneID:5655400"
     CDS             complement(549194..551161)
                     /locus_tag="LMJF_36_1460"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686718.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655400"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1T0"
                     /translation="MPSSRAADNTIDRNATAPAPTPNRYQGPFSEPARESAKAADTLA
                     PTQGGDPRRGSAGSIRVIDFHAPGVTSDSDNVCAVTTSSGHAAPLSLEARLAALRSRR
                     LAREARAIGASGSAVSASTAPARLPVALAEPARDAVERPCLGHTLPTFPLPPGPLAPT
                     FTSTTPTGASEPAAQSAAATFTLAPRTANNVNKVVAAVNSTTLGDACWTRYATTSRTE
                     TPNAAPCSSASVQADKAGHHPAQVGRMASQRCFPSTTSSVMTTAFSESPVSTNAATAF
                     SVRGSLPSQAVGAAPRNNDKSEPAPRHRGQRSAAEVSSLRYHPINDTQAARRLFPDDT
                     APSIYVSPLDTAADAIRGTSPEHVEAQHLSPLPAVQPPRMSTLEQDGGCLSRTTSTPE
                     RTGLPSIVEIQTLLPTAISSSTGLPTASRGMARRYGVHASLRCTTGDAPPSTASAPIR
                     PFAPFARLITTPPREGCPSPQPLSDDKSWLSRRDFVVPGVCLHRDSPPTGCTQSTSHE
                     CSYPRRVTSAETTSSTEARSARLYSSSAERDTSVSSAFSGKMPIFSSFRRRVIPAVTS
                     RVSSSPSHARTSARHSLLSSAVCTALLTTAVRSKYKLLDDKTTVSTKESAERDTIAEE
                     LAMQLRLSRLKSELTRQRMEQRRRGGHISTL"
     gene            complement(<551886..>555206)
                     /locus_tag="LMJF_36_1470"
                     /db_xref="GeneID:5655401"
     mRNA            complement(<551886..>555206)
                     /locus_tag="LMJF_36_1470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686667.1"
                     /db_xref="GeneID:5655401"
     CDS             complement(551886..555206)
                     /locus_tag="LMJF_36_1470"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686719.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655401"
                     /db_xref="InterPro:IPR006652"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1S9"
                     /translation="MNGSFTASPALTMLPTLSTDHPLKRTADDQGRQRDGAGAGTPDN
                     NTPSAHRRSLIGVRGSVLPEKKGGLPKTGHVGVCYHQNVYVFGGVNSKGQFSNHVFCY
                     EKRTLQWREIRGVGVVPRGRANHAAVLIGNKIYIHGGHRHLEVFDDLFAYEIETGRWE
                     KIGCERSQGPGPIFLHSMVYIPPLDSLLVLGGIHQREQNSCLGHLLDVRNRVWTGVPP
                     PSSVDAQHLQLVTAAYYAPSAVVVVLGLMDADVMKEDAVPTPHVHVFQPATFVWRRVD
                     TSTAPMSPLPFRMEAMWESLLHLLIPGGGGAYDPLLESWMFPLPSTETDSPVDDSSVD
                     QGLSTPGLGLPPLPLNKYGFLVLDLRSMSWSLVSCNLSRKLVAELNAVNRVTREKMER
                     LVLRNNAATASIALSGNSSQSKSAAQQPADSGALLGMSSASLTYGPSGAASRHSSVFR
                     LQPLQWPRNDSSSTNVLWPRASGSRPAMASGSNEAKMAALLSSSRYRRLFFLDDAPEF
                     MRKYTLVVVRDEPTKSGKLRPLQYVVLHGGLTEPTDYAMLMFAPMLTRSNSNRATPTR
                     GAGLMARSNSFRRRSTASVGSRRGSAYTQSHGGEDDGYGDDSFDDVASLVSSGTLIGA
                     YSTQRNYRRTAPHAPLSDAEALVRSRGGRYSDDDESDTDVEKRMNNGGAAHNSFLLPT
                     LRSGRTRHNYYRFALQFTPGNSIQKESLLPYANIPVAVLQTPKDVQKWSRNYYTDQRR
                     WLSERMKEALIEDRKLRRLRQLSKAQVASSFGAQGNATRAGSAGCDDSSSSESEFLND
                     GLYLAETFIGDPRTHGGAKLSSLHAYENRLALDAADAALTQEEAPKRRLRDFFEEHGF
                     DVFEEADMQQLHERMQLRTALGGKGAKQDRRRKDPRLQERAVVAEGASAKAAKRSETS
                     PLVQKSPVSDGFMPLASEVQIADSGFERLRMKGWQDVGRERIASAVLHDSFISGLTGG
                     TTGDELDFRKLAAYALLRRAVARLRADGNPHEMRWRLAQLRWRYLRTLVCTGEAAYLL
                     YLASQADFRMKGIMVTGTQGLMLAPELHFLSPLQAYRVPCKPVPYNVAAASAPPPASS
                     SRFAQVTASGMVVYNSLK"
     gene            complement(<555977..>557209)
                     /locus_tag="LMJF_36_1480"
                     /db_xref="GeneID:5655402"
     mRNA            complement(<555977..>557209)
                     /locus_tag="LMJF_36_1480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686668.1"
                     /db_xref="GeneID:5655402"
     CDS             complement(555977..557209)
                     /locus_tag="LMJF_36_1480"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686720.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655402"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1S8"
                     /translation="MELLTSVFQRHPPALRLHRELTIALADGDSARAADLASVLATTV
                     QRVVAAEADSSDAATPPEGHANTGHFSQRDIPVAGLEDVEEAVEKTRQTLLREATVRV
                     SSGVARDTGGSAISSEPAAAERSLPFWRDPERLCVTILESMFETEVLGGESQDTLTAA
                     GNRAAEHEAEQVRILDAYLDKEGARWNAQKAAIAKIVLDVTRSLGLTPEDLQAFEGIS
                     ASAGAGAAAAAGERKLNVLRHSNLVIRGEMPSAPLSSTASECVAEGVETELRALEERM
                     SSLGQPLTPWEVRMARYELQMSKSKMRYVVGVHKELQLALDHSAALRASLREKSTAEV
                     TFTTGTEVFMAEVIRALNEGADAYSANVTAEGAQLTVSNVKAREAVESPVLPFTFMLK
                     GSLWFTTAPSRPPSSSSD"
     gene            complement(<559224..>562832)
                     /locus_tag="LMJF_36_1490"
                     /db_xref="GeneID:5655403"
     mRNA            complement(<559224..>562832)
                     /locus_tag="LMJF_36_1490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686669.1"
                     /db_xref="GeneID:5655403"
     CDS             complement(559224..562832)
                     /locus_tag="LMJF_36_1490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686721.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655403"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1S7"
                     /translation="MEEEEELSMVIPVPGSGVSSQRAASEYSEHAGKSSAQDASTSAG
                     NPAVPFSRSTTPVAFRRGPSAARGSDEQDQVSIPTPSIQRMKPSMSPEADGSTAAHTQ
                     RPSGRSAVSSSSIVFSGADSTTGTSILFASDGASSEGVRNGEVSPLSRSPCAVKNGKS
                     GNVAAVKQQTQYDEVAQDAAAVVDLTSDSSFDLHIEEDEQAEEPPAVAAAADEAPQWK
                     RKSSKASKRPTPGSSKLASSISKKEATNKRVEKAGKSTSRATPAVSSADPAPKGSRAR
                     RGAKVAVPSQQASPARASRGHPGTLSASERKANTPGAEQRLASFSRDHDLVASPLLSS
                     RSSSGGSLSHRESRGSVNSVGEESADRFPNREHHRNCGLRPTPGEDTEEDDEDRRSIS
                     RAERVGGHGASRSHKSVIADTGERGRSSRAQREGAKGQAWRTHSGASRTDHCRGRELS
                     REGHRHLSSCSPVRRHGSRRLTVGSLHGGALAHECLMKLRQHSREGGFDWPRPHHRRR
                     SGEAPPHHRCHCRSESRAKAPSPLCADRMPLHRTSFYDDYTDNDVYATAAVASLERFG
                     DLSERCRRRSSREGGDDGYGAAVVQSARSVASSVFSGDDVEEKEELLTSSHFDDRRSS
                     TRGRRVDSALSPRSKARYADSKPGETLCRQELLKYDHGDRRAFELRKGGSVHRRNGTA
                     ARNHRRRGAEWEPDYYYWNEPRRGYSLDSGGCGCSWCPQSYHSPRPAAPPARESPLRS
                     RCGLYRPDSPSDAPPGEVRYQSLRPLASSPVRRHRARSAASGTQATPLRRASQSPASS
                     VASVPLSEKKLLGEVEWKLDALEKQIANEDAERERAMMRSPFERLYHLNNRRDRDERR
                     NKVFQLSLLERIRDRIVSGSLKEDIARKEERLRKQEEMLTSPNGVFVRLYQNSSPRRS
                     SNAAAEGSDCKSVGEGNRDGRASVNTTGVSSQRASTARSRMSAAESQELCNRLYETAA
                     IVKQKKEAMRKQSVEERQRQQAEELLIARLAGQIQLERSRTRASSKRRPKTPAQLEDE
                     ARAALEKLRKEDPEGYEKKVLRGRLLSPAERVMQAERLWKHGYISKAKLEAQKKVLEL
                     KKCTFQPTINEFSGSAGVAGSGETRGKGGGGTNDDKHLSAGTDRAQRHRKANRFEELY
                     RKGIQAKVRGETLREERDREARLRILRSRMVSDHHFRRRVELDPLLAERFMKSLVV"
     gene            complement(<564409..>567249)
                     /locus_tag="LMJF_36_1500"
                     /db_xref="GeneID:5655404"
     mRNA            complement(<564409..>567249)
                     /locus_tag="LMJF_36_1500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686670.1"
                     /db_xref="GeneID:5655404"
     CDS             complement(564409..567249)
                     /locus_tag="LMJF_36_1500"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686722.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655404"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1S6"
                     /translation="MGIPDFVKFIARSSPSALCRVPKGSSRHEPLIFDFILIDATNAA
                     QTLGLDTLRAFLNPDHVMARSAVIFALDSQRDRSGTARAHRHALVGIGDLDVHVQKLC
                     GQLADAYCAQQGCNNRLGAGSGANPYVLMSGRGVAGEADYKLLDLQRCLVTCAIASGA
                     AVLPTFLFISEDSDVLCGALCGPAPQQVSIATKLQDVLFEPSILRLDRVLAFVATCTD
                     AFYAENEKEAAAAAAAKMKAMTERNAAKATRANAFATAPATKHAGEHHSDEEVELSVK
                     DTAVATATATAARDDGVVRRRKQDGPMVSTGVRIELADSSDDDQPEHVETKPTKVPTA
                     TAGASAKAPVSEMGEVPIDGGECVEGASAAPTEGELLVSSIMHTSCVDMVFLFMIVMG
                     NAVNVPSLVRGATKVDSGSCWQAYCKHKYKNLSAADAETGRALLTPSINTHSTNRGTL
                     VLNCHFLHSILDAVHYADAEPRPPVEEEKSSAITYLSNAVYATLRYIVGCNLDRTPTL
                     KQTFLDSRPLSETPIMLPSLSAVMWVLGQESARTFSFPLHGLAKKELLVAASSGASAA
                     NDAADASSKLAANHATFARDASSSTSDLDVGEHLVAPAASNAWAVRGARTSNVSLATL
                     MVNFTSGVDRASSAARSAHYTAAGMWSAQLPSVSEMLKKALQMVSPASLAKANLLFYL
                     MTVWTYALGLGVRRMATLTKAAASVTKAEVGDPELSLAQSPSSAGTAKTLQVAPDTTP
                     VSGHYVYSFELRRMAPVLQAATSQPPSFITAASGRSAIPGRVDSTASSSSEKSAAQQA
                     IFAALGVSYDYSKTPRAPANVVNLPRCAMDEEDIAELQRLRKVAKKERALSALVVDAV
                     PGKKRSANADDKDSASSDNDDGDIDRTRSTKRAKEAKNGTSKAKKRLGKRERLKQQKA
                     TAKAAAAEADGGSPRHAGRAPRVHAPVKAATS"
     gene            complement(<568195..>568719)
                     /locus_tag="LMJF_36_1510"
                     /db_xref="GeneID:5655405"
     mRNA            complement(<568195..>568719)
                     /locus_tag="LMJF_36_1510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686671.1"
                     /db_xref="GeneID:5655405"
     CDS             complement(568195..568719)
                     /locus_tag="LMJF_36_1510"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686723.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655405"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1S5"
                     /translation="MLCRNVSRSYSARRRCRPSVCVAFGALLVEPPQAAYLRRCAVSS
                     RATATAASLSSDHASLSVCKRCEHTTTIATPPERVLTTKEQVDELMDSFAEACELITD
                     AKESVGTTYFADDMEDAEKQTHDVLNRWESLQAALERKGTAEELQKVRNMYDLKIKQL
                     KAELEAVREAGGAG"
     gene            complement(<574041..>575570)
                     /locus_tag="LMJF_36_1520"
                     /db_xref="GeneID:5655406"
     mRNA            complement(<574041..>575570)
                     /locus_tag="LMJF_36_1520"
                     /product="putative nima-related protein kinase"
                     /transcript_id="XM_001686672.1"
                     /db_xref="GeneID:5655406"
     CDS             complement(574041..575570)
                     /locus_tag="LMJF_36_1520"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative nima-related protein kinase"
                     /protein_id="XP_001686724.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655406"
                     /db_xref="GOA:Q4Q1S4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1S4"
                     /translation="MSGGNAGDAMIGRVCRNFPDTFAKDEATAREQEKKYWISRVLGS
                     GATGTVLCAKRVSDGEGFAVKCVDMEGMSEADKNRAQAEVDCLLNCDFFSIVKCHEDL
                     AKRDANNPEMVQMIALVLDYANAGDLRQEIKSRARTGRTFREHEAGLLFLQVLLAVHH
                     VHSKHMIHRDIKSANILLCSNGLVKLGDFGFSKMYANTVSDDVGRTFCGTPYYVAPEI
                     WRRCPYSKKADMFSLGVLLYELLTLKRPFDGANMHEVMHKTLAGRFDPLPSNISPEMR
                     DIVTALLSGDPGRRPSSSRLLNMPICKLFLSGLLEIVQTQPAFHGGLRDSISSQIQET
                     KRLLVTEKRHIQRMMEESSGSSVAASTTILEGATPLTTALGGLTIHEGTVKKQSSDMV
                     WKKRYLCIRAELADGQTVLDMNPKFKTLDMVLAISKETMEQQCISTPFTELEDAFPVP
                     AKYTGCNASFVFAVAFKTGKRLSFQTKSEVERDLWMEKIQDVLGIGDGDDDMSALPAK
                     E"
     gene            complement(<580649..>582154)
                     /locus_tag="LMJF_36_1530"
                     /db_xref="GeneID:5655407"
     mRNA            complement(<580649..>582154)
                     /locus_tag="LMJF_36_1530"
                     /product="putative serine/threonine protein kinase"
                     /transcript_id="XM_001686673.1"
                     /db_xref="GeneID:5655407"
     CDS             complement(580649..582154)
                     /locus_tag="LMJF_36_1530"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative serine/threonine protein kinase"
                     /protein_id="XP_001686725.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655407"
                     /db_xref="GOA:Q4Q1S3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1S3"
                     /translation="MAAPSDALIKKVCNAFPATFGVDTEEERSPAEGRLSRPFRYYLD
                     TVLGSGTSGTVLYARRVRDDHPFAVKVMDVEGYTPQEIMRASGEVCCLLSCDYFSIVK
                     CHEDFVYSDERNPESVSMMAMVLDYANAGDLRQEIKSRSKTNRPFAEHEAGLIFIQVL
                     LAVHHVHSKRMIHRDIKSANILLCSNGLAKLGDFGFSKHYAATVSEDVGRTFCGTPYY
                     VAPEIWRRRPYSKKADMFSLGVLLYELLTLKRPFDGEDIEEVMHKTLAGLYDPLPDSI
                     SKEMQTIVSALLQSEPKKRPSSKTLLNTPTCKLYISVVREIVQSGETGGFSAEQETTI
                     ARQLKQTKEELQVDRRRPPLSMEDVLRTTVKVSLSDSPDRIGFILYGGKVMKQSSDLS
                     WKRRYVCIYGEVEKGCTLTDDVASCLVSLELVQAVSRDTLEQQCISTPFSDLEDVFPV
                     ISKYTGSDAAHAFAVAFKNGRRILFDADDDNDRDGWMRSIQSFLGIGDEDD"
     gene            complement(<586650..>589454)
                     /locus_tag="LMJF_36_1540"
                     /db_xref="GeneID:5655408"
     mRNA            complement(<586650..>589454)
                     /locus_tag="LMJF_36_1540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686674.1"
                     /db_xref="GeneID:5655408"
     CDS             complement(586650..589454)
                     /locus_tag="LMJF_36_1540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686726.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655408"
                     /db_xref="GOA:Q4Q1S2"
                     /db_xref="InterPro:IPR006816"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1S2"
                     /translation="MSLLQKNAVLKKYRREYREQDATRSSSKEEGQTEEGGDDDTAVY
                     PNVNAFQALGSDAGGALASPSSSPRFMRCVETTQMPAIGAPSVKVWSSGVSSGFRGTT
                     AASVSMHSKATATATAGPSTVSTIRSPFPHQDGGGEANHAAPTRSLSPRNHTVNAGAG
                     AEDKYFDLDNFIAPLGPLPLPPLSADGAPPALAPLGRRGADSTGPRCWSSRSDLSGEE
                     DRAIADTHFQSPPTDPCVSPTTGTIGGEAFMSITDVPEASRSNHVTRATATSGLAPSA
                     GESFGLASSVGGLSSFALAAGKPKTPTGGGAHVRSSPQVSTAVQRPIEVLTRVHKGPS
                     GEEVSSSSSSPSSSFTVTEQEDDCGDVDGKPTTLREEAVRQLDLACANATHESHPAKE
                     CKNSSASAAMRLDISDTLLQPPTSILSEPSTVTVQTKDKSAVSHRSCGGAAANGSVES
                     RRVAYAADGADASEEGAFSPVSGMDDNERASYAGMADDRNIPYADNRGVVFMQQVLSF
                     SGTAHSLARIWDDEDVDVDPLTTDSMRLPPRALPPITFYEAYLELTKALRSGDAIAAR
                     QAEERMTDRACSSTVLQQAAPPVMALPTLKKAARAAILSCCGGTASRASTVAKQPQLS
                     TAACNGPKRDELSGVAPAGETASARGGPEEHLRVIRALKSQPLSLQLTTHRRMLLTIF
                     NTLTGKIPWLSRNVTSSEFTPVTSSQPSSSTAVKWESIGFQGSNPATDVRATGVLGVL
                     QLLYLIDYYPAFAQRLWQLCCDPANEGASHSPSRNYRGGEPPVAARRARVSNELPFVL
                     VCFNFTALVLDAAGQHILDEEVQKTANGKRPSFTSHKAAAKTTRPAAHPSLYAGMHVC
                     CECYVGALALFVEAWRARPKAGAALGGNVKLTVPANRPSIADFGDIKARLRGKLLRKG
                     AAKIMREAAFQVRGPVEQQE"
     gene            complement(<593145..>595691)
                     /locus_tag="LMJF_36_1550"
                     /db_xref="GeneID:5655409"
     mRNA            complement(<593145..>595691)
                     /locus_tag="LMJF_36_1550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686675.1"
                     /db_xref="GeneID:5655409"
     CDS             complement(593145..595691)
                     /locus_tag="LMJF_36_1550"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686727.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655409"
                     /db_xref="GOA:Q4Q1S1"
                     /db_xref="InterPro:IPR000315"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1S1"
                     /translation="MAKRTVSKLAVGGDHSGNSTVPDASICSSTVDDEDASQDRPATA
                     LALCEETTSTEAAAEGALSAPLSWPFLCPLCSAVELVDPVDLHERPKDTLSPSSFHSK
                     TVDEAVHCLACRACVEQWLSAVRAFSEGQAETMDHTGGATSATTFSPLSASACDGATL
                     LACPLCNRTCDATILSHSGPIAGVAHALDASVVRNSYTGSQPLSCITKTGSGVGRPSA
                     PAASASPFCSICEEAKAMCVCLQCDFGMCDTCHRATHAKGGFRQHEVLSCEQARRRGN
                     QRCTQHAGMALDLFCDTCSTCVCVTCCFGGAHRGHEVFPLADVASRAAAALTQHSTEL
                     AALQRDADATSVQLASLWPAYEAKVDDVRTEIQQCFSSLRQVLQAREDALLSRLGEVS
                     AVVSRRSSALRSAMHAISSFLGSTGERLRRLPGSVSPATLMRILDTVHEQQQWVSRVS
                     TRVIEQATAVAEGWSYHMCSDSANGCRMASFVLLNSDTPNDDGLRQYKRVLADLGRLD
                     ASADVQLPLAVQGSAGSVGTAKGRDNREEESAAHHLWGGMAEDHTEPRDGLANGAPVA
                     LRGDSDAIFDAGANVGEGEETLLVRPSHIDPATPSLPGQTAASKCREVSMAYRGRDRG
                     GSRQRSMSASTVQSQPRQPHLFPIGASTQSTRGRLLTYELNVDPTLKGAGAVAGPAAE
                     ATTASGTPRLTGVASKWGAVKQDLWEVGGCGSFAAELGALGRQKTGCAAATRDVRDTI
                     PFRVSLPPQRVESHDRMDDDDRSVSEADDQLPWRALKLHHNSSVQDGVRSTATSVPRH
                     GSTARLHYLTELDLRKPSEVAHGALDSSLAAPKQGRAESQRRTTGLQLEL"
     gene            complement(<597926..>599437)
                     /locus_tag="LMJF_36_1560"
                     /db_xref="GeneID:5655410"
     mRNA            complement(<597926..>599437)
                     /locus_tag="LMJF_36_1560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686676.1"
                     /db_xref="GeneID:5655410"
     CDS             complement(597926..599437)
                     /locus_tag="LMJF_36_1560"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686728.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655410"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1S0"
                     /translation="MPAAVNVCVSVALPCRGDGVAAPTPAAQSGEMHDLTLEELKGSL
                     SDLGYNPYGELVYTRSHLASKHLRALPGLQRYVHLQRLCVDDNGLTELDAVRYMPQLV
                     HLHARHNRLTSDVFVSLAVAAAECLEHLHLDDNCITSLDGLEKFPFLLDFTCCRNRVQ
                     HLPARCLATAERLRHFSLSDNALETVDINAFAATRPLRVLDLSNNSLSSINFLYSVPP
                     QIEKVNIANNHVRHLSAALKQLPCLTVLDVGGNELSGLKELRVLRCLKALRTLTFAGN
                     KALEHLSHHAAGERGRLGDPLPTTAQGTEYDAEVVMSDGEDNGGSLCSGGGGGGFNAP
                     TRTTAATAGAASAEVVAAEGENAPDTSSTLFPSASAISKVTRNADNAADDHRAGTKTI
                     TGWKSLDSSAARATTPTTAAYVDLAASEMYAFVHAVGSARRDGELDVRVHHQKEVLAL
                     PQQEQVYLWTLSVLPQLTEMNGRLTRPEEVAKAAFLFRANAAKQEPEKGVFTE"
     gene            complement(<600609..>602039)
                     /locus_tag="LMJF_36_1570"
                     /db_xref="GeneID:5655411"
     mRNA            complement(<600609..>602039)
                     /locus_tag="LMJF_36_1570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686677.1"
                     /db_xref="GeneID:5655411"
     CDS             complement(600609..602039)
                     /locus_tag="LMJF_36_1570"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686729.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655411"
                     /db_xref="GOA:Q4Q1R9"
                     /db_xref="InterPro:IPR010597"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1R9"
                     /translation="MSATHSTAESGVSSLQRSGLSITVGDTKSIVLALQALQSKIRSL
                     EQDRDFHQDQYEVALQAHERYKLDMERQMEQERAAHRKREADLLELLRKAREERAQLE
                     DALSGNKEDLGGCRRELEQMIASEKELASQRESKISMEVAKLRTEIKEEQTHRAALLV
                     TVEKLKEEREAALKTNEQLRVAMDGLLTRYEQLQRRRPAPQAVPHRYSSSGAICETHS
                     RAAPAACAHPRRSVSSRTRSPGYAPPRELQRPALPARQRKVSPSLHHNYEDPTCSSIL
                     RDVRIVPEEAPPCAYPSANSSMHHSQQEAAETTGKATAARSGQGLRTQATAAPSRSGR
                     PSPARRPPETGAAGPSAHRTTAIDEVEAQLRQELAELQHRYDDTIERGSSEEAPREVL
                     AAALHRITALLEQKKEQLKLLKEARMELEEAVSLSASRSTNTNRSMNGGRGDSPSTLA
                     MQDKHTRRALLVNELRSLLAEAAKGS"
     gene            complement(<603667..>609153)
                     /locus_tag="LMJF_36_1580"
                     /db_xref="GeneID:5655412"
     mRNA            complement(<603667..>609153)
                     /locus_tag="LMJF_36_1580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686678.1"
                     /db_xref="GeneID:5655412"
     CDS             complement(603667..609153)
                     /locus_tag="LMJF_36_1580"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686730.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655412"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1R8"
                     /translation="MAGYVLQTPFPATSLAPPPSPLGASAAHHSISLRRQALRQVSAE
                     EDVRLFDDLSLPCFSASQRRPVSPTKHDAHKAGLEISGAVITDASLQMSPGTATNNSV
                     HVSSLRSGSAGLGEWLHVPPLSAFEHPDAWLREYAFLRAKLKRPADSVTVYHDYAASL
                     NSRATMRHACVVHPLPDLEKVQEALRRRFQAQAPATSYEVCEQQCAADSCAPTEWDNN
                     AVSMAAAPETADALRGAHREQRNDMFLPPATLWCVGGSSYENEIVVRNAVTGQRLLRI
                     LDPKMRVAVTALQHAPFRGFMKVHQLHVLPVREPHDVLRLKASQLVFTDYVWCGLQDG
                     SVRLVPANHHHVRACGASSPFSKAPSAALVYELPRYQGGAIVSIVCSPCHDAARAFGD
                     SPKWGLPNRVSNAIQCMTAVLGADVDSAAAAGQADGEPVDPASRQHLSLVCIAATDAS
                     VVIWDARQVYEAVATVQQQRQEQNEGTHSSGASVFRHGAAGSLAVGGTAASGTPFCFD
                     ASASLSGVTGVSSDVITFDCSSPVPGLQNMQVRSSCTLIQVKPLAKLSGGFAGLTALR
                     WVSSLIVAGGCDAPTSHHPRMATRDPCTAPCRGEETPRIELAQTKTRFDKREEQRGEL
                     ELTEEEMQGVERELEHMMPPLAAEPAQSLRVNLLVASDCMGTLHLWNLDEELHRCSEV
                     KESALGWPASFGAFYYSSLRSMSSRCDGRSAASHGSGASQPTSGTSNASARRTSASKG
                     HGGTRRSDRVPKSRRACRGLGLAEARENRARLSELSSNRPTSGHKSDGEAATIRKNLQ
                     RPSIGRSSTEEHYSSQAAQGRSPQTTAEREGLRLSDGHGTVPALPTSRKSLVAPSATV
                     QQCPPLHNALPPHHPSSAKNAVPVSGPVKAKKVKKSRNSVHETSVSMFRSPQQSTSPS
                     RGTAHLPSTSPGRLSESRHPAQPKTGMHSRASVQRGASITARNGCGTGSTGQDLSMPT
                     QAAKCQIRFVQGAAAAIADVAVDLPPHIRTTLRRIPKPSNRVASWQHRPTEEEVDARI
                     LENEFEELTEERALFFAFQRLEMYVAVDGAMSTVRCFPEWLLPDEDEQELFRQRNGDD
                     GREAGGDLATQETTGAAVRGWMAEVAMPDRMNMGAFDLHLRKRLLDVHAQPITQLFLD
                     SWQGLLWVAREDGFAWIFATRDKSVVSRMPHPSADALLAPPSAQEWAKLQEQGLARSH
                     LSDARVANGFGLECHKECRDLPPTHLTQVLPIAVRPQRALLLCCSAAGGCHEGTSDCL
                     AAATVTESPGRSCRRTLSLAEPVAARDPPKPSAPKLLPSLSCSSNTTTNNSGIISVPR
                     SCDAVALVCVDGRSDMKNLAKSREVQQWRWLRQLQLCRAESAAVCQAQRHRYYALCEV
                     IGRKAGHVIQELGHYAFQSRLRTYFHLWKDHLALFRHTHLMRRQRTARLERERALARR
                     LECARMAQVCDAYYARWQRLLAARRCRRQEEVLARFARAAVAVSHDRRTSRGTCCRGP
                     LPTAAMMGHFHRLSALRACWRTWQAWADAQRLQHRCQKGLNALQQYPPPLSSTRSFTS
                     SATSMATPPRRVVSGHRAGADGFAAEGTTTPFHSIHSGGVYLRAASLSSPPASAYRPT
                     ALGRGAVAPQLACTQSLTEAVPTALPPALEALLAELLRARVFVFHFSDARSSATSVLD
                     ESWSVILENAESGAETDDDDDRRFSVFRFALLPLLQGLISTAEEVLPNLFNESVAEEV
                     LSMLVGIVLAMDYVTANAEATWWTLREAAVLTGCSAFVDGTEPMRSTFDASLLVLRAY
                     AVRAFASDPEAAEVLRGLANGKKVLAQFLDFAMERAVARRMEHL"
     gene            complement(<611817..>615446)
                     /locus_tag="LMJF_36_1590"
                     /db_xref="GeneID:5655413"
     mRNA            complement(<611817..>615446)
                     /locus_tag="LMJF_36_1590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686679.1"
                     /db_xref="GeneID:5655413"
     CDS             complement(611817..615446)
                     /locus_tag="LMJF_36_1590"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686731.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655413"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013721"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR020839"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1R7"
                     /translation="MSAKKSTRARGMPSSRASQYPDEADAVSQAYDVSSLPMDDAAAT
                     PHQRSGPRPKKVSKKESQQDSSAAAALDGAIIATPQPTLGEAETASLAESTLQFLVDG
                     TSVVSSVAEAILSVYRGGAKEGALCAVLNVLAKASGVAEVELDASALVDGVEIGPLLE
                     ELYARVPEDSEAYLLVNKDAKYKRFRRTFPEWCASLMQDGFASDVLLDGTFLPILSQW
                     IIAMSESKSRSFRHTATVALLAFVQALSSVAANLQSQLSLLRSKKTIGAVQRKRNKVV
                     EWRDHVFSQAIHQRLRDIAPDIRLAGFQALRRWILEFPEEYMTNKYLRYLGMPLHDKR
                     PELRSEALDTILQALAHVPDAYSRLHLFLQYFTSRLVELSNDVDVRCTELAIRVVAMM
                     VRSDSDVPEGSELLSNERVDQVLLTLFDERPSVRAAAGILLKVFIHCRTAAEESETAQ
                     VSVATELLCSFAATLRSQYREAMPEKYLIDALWTPERPPLLLTDFQPILAAAQSDKPL
                     DAVVGLQLIAALLLKVQGRLTLGPLPKDDRRGGTVTASRKIPLAAKGEADALLHRLSE
                     DAAHALPTILEVHCGSEDVLQAAAEVCAALDFSTFTSQSHQAALSALLIELRKATLNT
                     SCTALEMRESLTKAWHQLAFTEHPLHNEAHAHLQELLKNVMAQFSQAVRASSRSSQGS
                     SSADAADLLHAWARMNLGSALVPMGAHWQQIQTALTGILAAQPAADASLVMLVVGTAV
                     QCLLWQVHSSADEANPALSLSQLKAHVRDVVAGVLQYQAETEEEAQATGSPGAAADGA
                     AVLARAEVFVYLCDLLALPYYDLAQAQQEMLVRLLRGLYERVSAELRCAQDYLKMHVL
                     EHRAQQQQRPSQAASWAPAGLTELVAARRVCSRVEALQLRLVTGVARLFLFKRLDAIL
                     AAPFLSLWTHTSSKAVSDAFKSLFHTLRDRAGDDGFTLERDILLAAYHHCVEVGATPF
                     SVEALYQIGLKLSSVHFVGTDRFYSCCPAMVRFGADFAASTDPLLLQAVSSYAGKLRP
                     ADALHVLRDQLSRCSLFTEATNSYVLALVTALRKAAKLDDSTAPSSMAGGKRQRALAG
                     TTQLAEEEGMLNAITQGLSEGSNAATGAASSSALPVSPGQRISVASRVVTADGWHVRA
                     AGASQGNAEDAVEVEVSQGQRTSAAARPRHSVVNVPTTQETALSSLANGLDSDEVFVA
                     TEEYV"
     gene            complement(<616764..>617135)
                     /locus_tag="LMJF_36_1595"
                     /db_xref="GeneID:5655414"
     mRNA            complement(<616764..>617135)
                     /locus_tag="LMJF_36_1595"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686680.1"
                     /db_xref="GeneID:5655414"
     CDS             complement(616764..617135)
                     /locus_tag="LMJF_36_1595"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686732.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1595"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1595"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655414"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1R6"
                     /translation="MPRKAAAAAKKERSPSEKSVSSVDSISSLPAIKEARTEDATVAA
                     AQVPPRPLSPPASSAAMPAAAEEVVPLAALVAVNVDRNEEASFGLLKEPGPPSADVRR
                     VTKEGEGAPAIPTDLLQLLSG"
     gene            complement(<618206..>618997)
                     /locus_tag="LMJF_36_1600"
                     /db_xref="GeneID:5655415"
     mRNA            complement(<618206..>618997)
                     /locus_tag="LMJF_36_1600"
                     /product="putative proteasome alpha 1 subunit"
                     /transcript_id="XM_001686681.1"
                     /db_xref="GeneID:5655415"
     CDS             complement(618206..618997)
                     /locus_tag="LMJF_36_1600"
                     /EC_number="3.4.25.1"
                     /codon_start=1
                     /product="putative proteasome alpha 1 subunit"
                     /protein_id="XP_001686733.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655415"
                     /db_xref="GOA:Q4Q1R5"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1R5"
                     /translation="MFKNEYDSDITTWSPTGRLFQIEYANEAVNNGSAAVGVKGRDFV
                     VLAALKRSPVAELSSYQEKVFEIDEHVGMSISGLVADGRVLARFLRTECMNYRYMYSH
                     GMPMNQMADMIGEKHQRHIQFSGKRPFGVGLLLAGYDRQGPHLYQTVPSGDVYDYKAT
                     AMGVRSQASRTYLEKHFERFTDCTLDELVTHALKALASATSEGVELNVKNTTIAIVGK
                     DTPFTIFEEESARRYLDGFKMRPEDRVAAADEEEVLQEQPLDVEE"
     gene            complement(<624929..>625276)
                     /gene="UMSBP1"
                     /locus_tag="LMJF_36_1610"
                     /db_xref="GeneID:5655416"
     mRNA            complement(<624929..>625276)
                     /gene="UMSBP1"
                     /locus_tag="LMJF_36_1610"
                     /product="putative universal minicircle sequence binding
                     protein"
                     /transcript_id="XM_001686682.1"
                     /db_xref="GeneID:5655416"
     CDS             complement(624929..625276)
                     /gene="UMSBP1"
                     /locus_tag="LMJF_36_1610"
                     /codon_start=1
                     /product="putative universal minicircle sequence binding
                     protein"
                     /protein_id="XP_001686734.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655416"
                     /db_xref="GOA:Q4Q1R4"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1R4"
                     /translation="MSAVTCYKCGEAGHMSRSCPRAAATRSCYNCGETGHMSRDCPSE
                     RKPKSCYNCGSTDHLSRECTNEAKAGADTRSCYNCGGTGHLSRDCPNERKPKSCYNCG
                     STDHLSRECPDRH"
     gene            complement(<628688..>629215)
                     /gene="UMSBP2"
                     /locus_tag="LMJF_36_1620"
                     /db_xref="GeneID:5655417"
     mRNA            complement(<628688..>629215)
                     /gene="UMSBP2"
                     /locus_tag="LMJF_36_1620"
                     /product="universal minicircle sequence binding protein"
                     /transcript_id="XM_001686683.1"
                     /db_xref="GeneID:5655417"
     CDS             complement(628688..629215)
                     /gene="UMSBP2"
                     /locus_tag="LMJF_36_1620"
                     /codon_start=1
                     /product="universal minicircle sequence binding protein"
                     /protein_id="XP_001686735.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655417"
                     /db_xref="GOA:Q4Q1R3"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1R3"
                     /translation="MPHPLLARSSPPFLHSPPPPPRRTRARTCADSRPLESFPAFSRL
                     LSLSLSHFCRSRPSIIMSAVTCYKCGEAGHMSRSCPRAAATRSCYNCGETGHMSRDCP
                     SERKPKSCYNCGSTDHLSRECTNEAKAGADTRSCYNCGGTGHLSRDCPNERKPKSCYN
                     CGSTDHLSRECPDRH"
     gene            complement(<631832..>636874)
                     /locus_tag="LMJF_36_1630"
                     /db_xref="GeneID:5655418"
     mRNA            complement(<631832..>636874)
                     /locus_tag="LMJF_36_1630"
                     /product="putative clathrin heavy chain"
                     /transcript_id="XM_001686684.1"
                     /db_xref="GeneID:5655418"
     CDS             complement(631832..636874)
                     /locus_tag="LMJF_36_1630"
                     /codon_start=1
                     /product="putative clathrin heavy chain"
                     /protein_id="XP_001686736.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655418"
                     /db_xref="GOA:Q4Q1R2"
                     /db_xref="InterPro:IPR000547"
                     /db_xref="InterPro:IPR001473"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR012331"
                     /db_xref="InterPro:IPR015348"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016025"
                     /db_xref="InterPro:IPR016341"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1R2"
                     /translation="MDSPSISTEVFQLNSVSGGLRPGSISFKNVTLESEKYVCVRDVQ
                     GDGPTSLVIVDLEKRESIRNNVKDAESCIMNPKSKILALRSGRNLQVFDVDASRRLKA
                     TLFHEDVAYWRWIDDRTLGIVTAKAVYHWSLDTATDAPQHIFDRSADYDSSVQILSYR
                     SDEQKKWLVVTGVARDPSGTMVGKALLYSVENRSSRVLDGHACCFISTSTPSEPRKCN
                     VMCLAWNSPQQGGQVMIMELPTGSKTDLSVLRRVYSVHIQPGDFPVAMNVSDRHKLLT
                     VATSRGSFVLMDIFTGTILVEQQFSSSVVFCGAADNKVGGVLCVNNQGAVMRIGPNND
                     GIIDFVKNRMHNAELALRIASTANLGGVDDLFKVQLDNFLRNGNVEEAVRTCLRAPGN
                     SLRTREILMRFMQMPQQPGQPPAISTYFKIALAETSLNECESVELARAVVPKGGIGYV
                     KQQFDEGKLTASEELGDLVQQADSTMALKIFHQGNAHAKVLNLLLQRNETQKAVEYCK
                     RASFSPDWRVIMNNFIRVAPQDAVNLGLMLYREMGDRPVLTADEVVDMFVSAQQIQQA
                     TEFLLEILRNHNDESTMELQTKLLEMNLKYSHPSVADKIFVRKICQCYDGMRLAPLCE
                     RAGLHQHAIDCYIMAQQQDSDLNNLASIRRCLQQLQNFNPEWIVDFFGKLNKQDSLKC
                     LEDLCTDSRQNFKVIVQVATKYSDALGAADLINLFLEHSLYDVLYYYLGAVVPYTRDP
                     EVHFRYIEAAAEMGQMQELERMTRESPCYDAERTKNYLKSKQLTDMWPFINVCDQHNM
                     VNEMVHYLVETGNESFIEQYVTRRNPGKTPQVVQALIECNVSEERIKNMLTVVGAMCP
                     IEELVDRVEEVGRLHLIKQWLEDRRSEKKTDKALYNALAKIYVDIGQSPEQFLSENEY
                     YDAQVVGKYCETRDPNLAYIIYCCGHCSEMMIDLCHRNGMYKQLARYLVKEQSLDLWA
                     SVLGQNSAERQQLIESVQQIALPESESSEEVSTTVRAFMNANLTEELTSLLGQIVVHG
                     RFRKNRFLENLLIMSAVRARKDKVMEYVTTLEDYDAKDIAHVASGAGMHEIAFVVYTR
                     HNMQKEAMTVLLQDMNDISRGRAFAQKTDTAVVWSMLGEYLVKQDEVNEGIECLIRAK
                     NPDLVVEVTSAAERTNQFGDLIKYLTMARQCSRAKDNKIDTALVITYAKTGRLEELEE
                     FLKQTHNVKIGAIADKCFQDKLYESARVLYTVANNYARVASTEVMLNNLPAAVEAAKK
                     AKSIHAYKEANLACIEAGDLKLAGVCAVPVVLKAEEVSGMCNRYESRGLWEELFSVLR
                     NASSHQGAHMSIFTEMGVLLAKYRPEKLMEHVIMYAKKINTHKMITVCEQYHHWVVLR
                     VLHTNNEDWLAATNSMMQHHADAFDHEIFKDAVSHLGASELLYTAIGFYLKTHPDQLN
                     DFLSSIFKRVDPERVMAETTKVAPIHVIRTYLEAAQERNAKKVNEALNNLYIEEDDFK
                     ALRHSVETYNNFDSEELSSRLEKIELFEFRKIALLLHRRNKRYSHAIAVAKANELFEE
                     AIDTAAESGDSELVNKLLDYFAKDYPECFAACLYACYDLLKPATVLQKAWLNQRTEMA
                     MPYMIQVLQDYSSKIEKMEKLMMDAQTAAKDAARRAGPVQDPRSVPLMIEQGGGMPMN
                     GMPPQFGSGRPF"
     gene            complement(<643944..>644351)
                     /locus_tag="LMJF_36_1635"
                     /db_xref="GeneID:5655419"
     mRNA            complement(<643944..>644351)
                     /locus_tag="LMJF_36_1635"
                     /product="putative poly-zinc finger protein 2"
                     /transcript_id="XM_001686685.1"
                     /db_xref="GeneID:5655419"
     CDS             complement(643944..644351)
                     /locus_tag="LMJF_36_1635"
                     /codon_start=1
                     /product="putative poly-zinc finger protein 2"
                     /protein_id="XP_001686737.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1635"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1635"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655419"
                     /db_xref="GOA:Q4Q1R1"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1R1"
                     /translation="MVCYRCGGVGHQSRECTSAADSAPCFRCGKPGHVARECVSTITA
                     EEAPCFYCQKPGHRARECPEAPPKSETVICYNCSQKGHIASECTNPAHCYLCNEDGHI
                     GRSCPTAPKRSVADKTCRKCGRKGHLRKDCPDA"
     gene            complement(<649039..>649854)
                     /gene="HEXBP"
                     /locus_tag="LMJF_36_1640"
                     /db_xref="GeneID:5655420"
     mRNA            complement(<649039..>649854)
                     /gene="HEXBP"
                     /locus_tag="LMJF_36_1640"
                     /product="putative universal minicircle sequence binding
                     protein"
                     /transcript_id="XM_001686686.1"
                     /db_xref="GeneID:5655420"
     CDS             complement(649039..649854)
                     /gene="HEXBP"
                     /locus_tag="LMJF_36_1640"
                     /codon_start=1
                     /product="putative universal minicircle sequence binding
                     protein"
                     /protein_id="XP_001686738.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655420"
                     /db_xref="GOA:Q4Q1R0"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1R0"
                     /translation="MSETEDVKRPRTESSTSCRNCGKEGHYARECPEADSKGDERSTT
                     CFRCGEEGHMSRECPNEARSGAAGAMTCFRCGEAGHMSRDCPNSAKPGAAKGFECYKC
                     GQEGHLSRDCPSSQGGSRGGYGQKRGRSGAQGGYSGDRTCYKCGDAGHISRDCPNGQG
                     GYSGAGDRTCYKCGDAGHISRDCPNGQGGYSGAGDRKCYKCGESGHMSRECPSAGSTG
                     SSDRACYKCGKPGHISRECPEAGGSYGGSRGGGDRTCYKCGEAGHISRDCPSS"
     gene            complement(<650928..>651836)
                     /locus_tag="LMJF_36_1650"
                     /db_xref="GeneID:5655421"
     mRNA            complement(<650928..>651836)
                     /locus_tag="LMJF_36_1650"
                     /product="putative proteasome beta 5 subunit"
                     /transcript_id="XM_001686687.1"
                     /db_xref="GeneID:5655421"
     CDS             complement(650928..651836)
                     /locus_tag="LMJF_36_1650"
                     /codon_start=1
                     /product="putative proteasome beta 5 subunit"
                     /protein_id="XP_001686739.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655421"
                     /db_xref="GOA:Q4Q1Q9"
                     /db_xref="InterPro:IPR000243"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1Q9"
                     /translation="MFADFESVMLSNFTLDDCPRVGPFTYHNMDEDTLEEPLSLCSYR
                     RAPQQTTERSPASCDAVTADPLDSSRYLHGENRCWTLTASCPVPRAIPKIDMKKGTTT
                     LAFRFNGGIIVAVDSRASTGQYIASQTVLKVLEINDYLLGTLAGGAADCQYWERVLGM
                     ECRLWELRNGSRITVAAASKILANITYAYRNHGLSMGTMLAGWDEFGPSLYYVDDKGS
                     RVKQDLFSVGSGSIYAYGVLDTGYRKDLSVEDACDLARRSIFHATYRDGASGGIVTVY
                     HVHEKGWTKISRDDQTKLYDRYFPSQ"
     gene            complement(<652829..>654913)
                     /locus_tag="LMJF_36_1660"
                     /db_xref="GeneID:5655422"
     mRNA            complement(<652829..>654913)
                     /locus_tag="LMJF_36_1660"
                     /product="putative tRNA pseudouridine synthase A"
                     /transcript_id="XM_001686688.1"
                     /db_xref="GeneID:5655422"
     CDS             complement(652829..654913)
                     /locus_tag="LMJF_36_1660"
                     /EC_number="4.2.1.70"
                     /codon_start=1
                     /product="putative tRNA pseudouridine synthase A"
                     /protein_id="XP_001686740.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655422"
                     /db_xref="GOA:Q4Q1Q8"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR006145"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1Q8"
                     /translation="MVDVEKYFPRAVAHLKAVSASAEATEESRARRWHDTTHEVNADG
                     IVTPRKRAERERRESGLGSFFDEGGLDVRGGMADKLKSGAYGSARDPVERDSPDILKL
                     TGGNARRHGGLRLATESNAAPADQTIEGDRGDAGAYREFGDTPVQLTDMLRERLMELK
                     AGKLREERSETFLPQRLRHRPAEELLMLAQQGEAAGVEAGGRVATLQPTPAALQRKVA
                     QARSRAAASTLADLVPKDEEEEEKAALLGDAARDGARRGACDRAILQDGVSPARVANA
                     MQAVSGTDDSVPGASLHDPLRRLAAIAAITGRRASVFGTGDGASVSAEGVERVGFVHL
                     LRTLPRAGFCSRREAAAIIASGQVRVNNVTERNPFRLVQAEDDVHVAGHQSRLRFAPP
                     RLWMYHKPAHVIVSRSDTAGRTLITKHARILGMDHLVPVGSLPMRAHGILLLTNDGEL
                     SRFLENPKSMVQRTYLLRVRPAFDPVLVHKLNTEGVHINGRPYRNAEFFVNPATKSRY
                     SVKVKVRGESMPIAHLMQHLGRTVERGGRISFGPFALSNLAVGSVREVTIPPFYSQHL
                     GAVWQPFIERDWPYFRRQRVSRLRRLCKHRELTPKELEELDNYTYEEVKDALNFESSE
                     LQALAEQRAQQLRRARHLGDDMLPLPDDFPKESCRRSVGDVAVDGATAPFADADEDED
                     EDVIVEDITFLR"
     gene            complement(<656222..>657859)
                     /locus_tag="LMJF_36_1670"
                     /db_xref="GeneID:5655423"
     mRNA            complement(<656222..>657859)
                     /locus_tag="LMJF_36_1670"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686689.1"
                     /db_xref="GeneID:5655423"
     CDS             complement(656222..657859)
                     /locus_tag="LMJF_36_1670"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686741.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655423"
                     /db_xref="InterPro:IPR019438"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1Q7"
                     /translation="MAHSAPPSYTGESVRSSICRLYGQRSDLPLTVLHATVPPVAASL
                     VQQRSHVLDAIFDCIHDQLYPKDSAVGENADTRSSAITNHWLRSVPESLLFDEAAVVN
                     YLGMVVAIDFCHWAEVPCKAGRTATASVGEEVTGFAGFYAAVDPPSGASAVGNGGTTA
                     SAAVAELFAEPPSAVGKELGTLSTAAAAAPTLLRGSAAMMYLLRRAVEVHRLPWFCPD
                     FLQRFRGDTAAATSALRVCFLGCEQDGVTPLWMPCTRERVELLLSLADAFVARQTSYY
                     KLLRACGGLLFAPDAAAAATAPCGFVPTLVRLHRRYADFARVPVEGPGCTGGNTGEAA
                     PDVCIVPVLKLSQLTALAIEQALPVLWRYQAASSVSSKSLHSKLPPSAPANCWLTDRA
                     ARIARSGAESRTAEPESSLSGVFTDSAKLSICCDYQIPKALRAAGLLVYDDHLARIVD
                     RHVLLMPGSAEEVSIRVATLIAAERLLQFLNTPPQRQSSLARELDATAAGVPGAPAQL
                     PAKRLCSGIHLDYALWYVGRYMLPSEARHHLCRTIMY"
     gene            complement(<658577..>660925)
                     /locus_tag="LMJF_36_1680"
                     /db_xref="GeneID:5655424"
     mRNA            complement(<658577..>660925)
                     /locus_tag="LMJF_36_1680"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686690.1"
                     /db_xref="GeneID:5655424"
     CDS             complement(658577..660925)
                     /locus_tag="LMJF_36_1680"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686742.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655424"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1Q6"
                     /translation="MQRYLQRTVPVAPLRLSISGNSSTEGVHADAAPLLESRFLRRLR
                     AEVDREARAEQLCKGTAARAIQQAFRRWAQTRQLQHRHLSIHGIVRPRCEFDPIRAAE
                     LDAALCSIQASLRVWASSRLVEARRLKLLQQITSSVLDPACRTTLRCAASIRHINDRQ
                     LREVLCRQEAVERRDLLRRHFVFLVCCHQAFFNDPRMWDAGMSIRRIPLYTHHGLLSA
                     ETLPVIWGTRTSSSTLNSATEDSVALRGDAVASPLPPESSSFSVTATVDGCIKGWGSP
                     AEPGSSLLEAVGSDWLVGKEEDGGGFDIDAALRLGEYRLLFSPEEWRLLKKLKASSPH
                     PASPLLSSGADGRRAARDAAGLPEAEAGALAAPRGQLQMAPTEAAAKSACSLSYAKAF
                     ASALTFLRQPRMVDPSVRCTVQRLNDIRSSTLEMQQELRVHGYLFAAQVAPLLILGFH
                     YQGLARGDADLSCFTTTSAMKTCRPLVAGRVACAATELRRCLIGAVHYSGGAAESVLP
                     VALEEHKCSGKAAARTLSQRLPPAGVSRSMLLPPRAAPTAGLMRDGFANPGTEALYHA
                     PAKTTRRAGGADPRCGSSHTASRHGSAIRVALAAEWSRRLASSADEVGPYWCEFLSST
                     GLDGLVTAAGRRGETPGEADAAYQTRASLPSPPLPTRVRRGLESHLVHGGSSYLLQDF
                     MPSLMRRRAHSRAGPQPLDAATGSVVVAVACAGASPSTSVSTSTCGMVHAGEWWDAVE
                     RLLLREYTNRRELLTNEAVQRSSIDILRCTAHPSADESVAGV"
     gene            complement(<662060..>662986)
                     /locus_tag="LMJF_36_1690"
                     /db_xref="GeneID:5655425"
     mRNA            complement(<662060..>662986)
                     /locus_tag="LMJF_36_1690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686691.1"
                     /db_xref="GeneID:5655425"
     CDS             complement(662060..662986)
                     /locus_tag="LMJF_36_1690"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686743.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655425"
                     /db_xref="GOA:Q4Q1Q5"
                     /db_xref="InterPro:IPR019165"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1Q5"
                     /translation="MGSLSSSSSSSAATGAGAAASQTDAQEVTPVDSLWSPHDVCEAA
                     VDYVLRHVNTVQYMIQSIEEITGKPFLRDRIKCLPAVPRDEASRNPTMGLTPDRVFAG
                     YMWRSARSDCQAKDVVLLEDHIARLFNTKHATAFLKKDKGVNERAASPPTTSDAAATA
                     ASSLSTTATQSQLQRLLAGSQLPVLEQVERNIRHELVHAFDDARGAIESSDCVHQACS
                     EIRAARLSGDCFVGQEMRKGRFNFFEGGQKCVRRRAVMAVDRNPVCRGFSERAVDTVF
                     QKCYSDYEPFAAPIYALGSYGDSQFANGTLKL"
     gene            complement(<665762..>667402)
                     /locus_tag="LMJF_36_1700"
                     /db_xref="GeneID:5655426"
     mRNA            complement(<665762..>667402)
                     /locus_tag="LMJF_36_1700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686692.1"
                     /db_xref="GeneID:5655426"
     CDS             complement(665762..667402)
                     /locus_tag="LMJF_36_1700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686744.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655426"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1Q4"
                     /translation="MLSDNDLTFHIPSAGLRRMDAWTAPNPSVFSHLHLVGNPDWMSS
                     FSASPQVAAARPALAPPAPVAIEPSAPRPLAAPAAIDAPAPATKKSFLSMFYRGSSNT
                     VSSSVMPPKTSSASFAPMSAPPKALDAFDTPMQRALPVDAQLSVEHLSKLDAVDATIS
                     AAPRREPPHPMALGSDTWNALSSVPVPAKTAAGSARLLAPPASIDAVFSRDSKPLWSD
                     LSFASRFRSTAPTLEAFRNAPPAPILSTPPRSPQHQATSSTATVATAFIPVPPKPVTA
                     SPLRDTAVSSVEAAAPATMPAARREPRAMAHPLVPVGEDAPAVVTPLLKPVQEIPMVS
                     SKSANLAPSTVNATPPVWGPEPLSLASREPEPSALALPTEFAKSISRPTMQEAQRDEA
                     RAAANVRNFISTLFSGSGSDEMDSSTAGNRKADGFNALEFVTNRRGAQAKASQPVDYS
                     TFFNTSLFEDDHDEDSEEGLEKLRRVVLMVMQSAKNSEGTCVSQPTSQSCRRGGGVDA
                     TGVAALTTFPSKYTEFSASYQTANNNNADDNEWMQFAR"
     gene            complement(<669223..>670386)
                     /locus_tag="LMJF_36_1710"
                     /db_xref="GeneID:5655427"
     mRNA            complement(<669223..>670386)
                     /locus_tag="LMJF_36_1710"
                     /product="putative
                     phosphatidylinositolN-acetylglucosaminyltransferase
                     subunit c"
                     /transcript_id="XM_001686693.1"
                     /db_xref="GeneID:5655427"
     CDS             complement(669223..670386)
                     /locus_tag="LMJF_36_1710"
                     /EC_number="2.4.1.198"
                     /codon_start=1
                     /product="putative
                     phosphatidylinositolN-acetylglucosaminyltransferase
                     subunit c"
                     /protein_id="XP_001686745.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655427"
                     /db_xref="GOA:Q4Q1Q3"
                     /db_xref="InterPro:IPR009450"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1Q3"
                     /translation="MSRSFSSSESLASSQQRLEAARYAASTEEESSLPESGDYDRRSQ
                     ETRHYSSHPDHLQRVPSKQITSVSPLWRKVLYERQPFEDNYVDPQQFLEELSHNKDIK
                     NYEYATVVINTLAITQEISIVVLFCHAFMGVFTNSIGKYSLLWIDVLSVLAALVCYVF
                     YQCHQDACKETVERPASLSTRCSPPPRQPSRWLFHAWNFGRQVVSLVTMLALLSPIFS
                     TLTVTYSDDTIVTLSILTMSLHVLLTDYSYLNAYTQRFDPNLSVNMAIYCVTLMASRI
                     SSPLASGALICFGIMCFSLSPIVRHLVKHYSFTAHVAITFGLVGLAIGCLTQIRILAI
                     LYTVTVLMISFGIPWLFVRMHSSVKTQINGPWDEAKPTNSAAAAEWANSGFLA"
     gene            complement(<671439..>684551)
                     /locus_tag="LMJF_36_1720"
                     /db_xref="GeneID:5655428"
     mRNA            complement(<671439..>684551)
                     /locus_tag="LMJF_36_1720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686694.1"
                     /db_xref="GeneID:5655428"
     CDS             complement(671439..684551)
                     /locus_tag="LMJF_36_1720"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686746.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655428"
                     /db_xref="InterPro:IPR000409"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR023362"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1Q2"
                     /translation="MYHYLVNALKGKPGKADGLVARSDPAITDSEAARSARLREEEQA
                     QRVLRERRRAYSDFMTRTPLGHVLSEQMPAVESMTTTPATAFSVCQTSAVLDTRATGT
                     SVSLAAGGERPSPTETGLAHTKLELTMYEVLAPWLSRRTAMMTRRVLELVPHSAPVAP
                     EAARGEQVGTIFTLPPPFPCQRPFVTLEEAKGALLPFLLVLVQLRHWQACLESLSATL
                     SSEAAARSESTTTTSARLVKALQQLSHVLVAITCATELQTAAMRSHLDLLGGEVTACV
                     ATTLQCLRRLTRACGTQEFSLWSERAPAASASAAESMPRESKDAIGGGDRRDGTSTPH
                     PVSAEVVEIQACRLLSLFLYWLHVVHDISTPCLAIEELFLASSTARFNACAATVATAK
                     GATAGAAEAEARETHRCTGLSNAALLRHTDPVPSCVPLAMLLLSGSDASSGSGEDKSP
                     GEGSSPPLASSSDVASSLTALLLFASKGVFEHAQPSSEAHTVIEGLAVEEDSDLGLIV
                     VLTSRLLRYMFVAGASPHLVQVTQAAGPLQSALSLLLARFIAGDRNASALRAVAERTE
                     ASQSTSLRSCGAQPHLDAAADFSFPRSSSLASTSQPPSPARSCCSSRAPVPSEQSGRL
                     TRQLRLLGQLSCGLVLLKTLFQQSATTVLDIMDHSFFFDALVTALQVVGSRFTEPSRQ
                     GAMAARVLDAAGRRDSDAWADWVRGVETVAAQGTVAEGMSVLLNHALGCPLQFSLTVL
                     SSDPYVDEFLHAYLGLLAACRVVRSTPLAFIAPPPQGMLLGSNGAITASARESRALDT
                     LDQLELTLLKTFLTAYGTPTEDTAPAAAAASAAMEFSITLPPCPEQHPVDSEATDAFH
                     LSGDMDGTGSLTFPLASCIYNLLLKHVLWCVGERERRCGQPLPPPPPPLTPPQAPAPP
                     QQHHLALPLLQSSVSSAALRLSPDTPASTATNTPRLVAQAPPTHPPVSPTLSMSIITP
                     ANLPQSAATTLPGHSSLAAITGTGSSDDDPLVLFLVRHGLFRILLHDEHFASAFALAE
                     STAAVDSADSPLGRSRDEEAADRPATTRQRSYLVLYLLSHFLQLRPCDAGSSDGEPIA
                     QLAGAQEGGGASADPNVSRRGACSRSSSNTALSADERQLAQETTEALMTVLRVSTASV
                     SSPCCAVVRCRRRRWCNCLLALLSAATAAPGAAAFAPIHVGEELRAGIEIGAPSAADA
                     KTTPAAAAAVCEALARAGGVEYLLRAAAVAADAGAAGQPANTVSCAWAMQAARSLAKD
                     STASVRMATKCAESLLLPLLWHPLLRSDGQRLLEALLCRPLVGSGTAVDINVNMRELS
                     LSMVSSTGKVGSDSAATDVHAVPPHCRKLCEGVWRTLCDCVNGSAVGGSGVEMPDAVT
                     SGTRAVSATNADEGARQAVLRAVLGAVGTAFRTLSEQRFSDAGEHSGELLPLRTLQRA
                     LFEASKADGQNIYELLLHQLAQSSKAVDNPGTSPRPSPLNTADVAEVAFSPPFPVPFL
                     IAASGAPNAPDTSPAEAMEASTDTVAACRAAREMVRLIVIALVGMTVANPSQREVLYR
                     ATVDEEALVSCIVNAWGTTGGSQALPFSCSMGEGDACGIVRVCSYLIYESVDAVDAFF
                     DNDDESGSQDAAPRRRRCSDDASWAWSLQNPMLLAAVLRCFTRLASLTVDQQVALRKL
                     LVSLTRTVESCYVSLYLAASSAVHDVLAQLLPVVALLPEPAALRFSSSVETEAALPRL
                     DAVLVRLLAALAHCHVDARQLKQLLLLVIHSRHQRDRRALVPLVLQVLSEAVQPPLNM
                     TLLHAARRDPQHFVSLHRGRGPAGFCAALPDFPLEGYSAFLNVRWESDVSSQDVAGQT
                     AGGNTTLRQYDACACIFCLRTADRATLLAFMVERRTGRLFVQYRNLQQQKLRVYLAAS
                     LLPRKWTHLCISHRAAAFLTATAGGQLTLFVNGAEAAVIPQVAYPLMSRGYLYVGCLG
                     HEVDRLSVAHAFYGQVSTVYFFPYVLPEREREVLQTTVGVADTAAWMLSSSNAAIPPL
                     RPVSFAPGRRPGSSASESAADVDGTEQWLAGRAVVCVDTRLSDRGHLYNLSAVLRGRT
                     GRESRLLTLEGSLVCSTQRLIDSMGVLGALTSVLMPLCVLLVNPNLPISSRSLAAAAP
                     IGSLAHRKPGLPPFSSLGAAAVSASSASDTINATVLRVLDLVPPLAAAEAIRTEMAEA
                     RFFVFLGQVLQLLGPALQVVVPAAFVQLLEALAPFPRLFEDALTNLFLSADVIRASPR
                     AVQLTWVKVQRFFLSAHPDALPCLRTLGTSMFVAAELLRVTAEEAKEEELTQEDTLVP
                     AQTQDVVTHPLLSPSSSTSRPISVVASDVSGAPSSATISPFSPSSTPPPPPSLPSCSL
                     QDLENQWMAYFEALTVAPVTLGDAEALQYFVGNLHLTCPKASVQLRLLRRVRQLLVTS
                     NTPYLVQLLGRRNYVVNLMPYLTSASSEAVRLEALLQLLFMVLRSKRTQELMNPVLLA
                     SKDTVVHVVEEVSLSWLKDVLQRFPVNLPVYLALRCGLVERFDVLTLPTQYVPLDESH
                     TIRFAAVLLPLLMLMKRSTDTKLKGHVLTDMAVLLKSDAQAWRRVITVRGWYVSVVGL
                     FASSCASSPVSAPSSLQEACACQESTVPGAVSSPTIPTDSTVSEQVQSEGSGLAFATI
                     SMILSYTIYQVLLHEAYGATELELVVAYLREQRLHRLLHQVLCRVADRYRSRLMAPWR
                     GERRDAAGNREGPGAPRPSNGCAFLGLGSATAVVNLCHFLRVVEVVLFYAGSVPRRKE
                     AITVPVKPAVSPFTPAGAALNGEEFGTHLPVRVGYTEWEQLTLVRSADDPPGGVAESD
                     VYYAGEVDDPHGNVRRAVLRTPDDRWLHLPLAVKCAELLCSHSALLHLGSNGNTTSHS
                     VGGAGSVVGSGSAGSGGPGDLLWSVVLGASAGTGVSKSPTSPKAGGVGGVGFRAGGGG
                     VAPVVLRGGMLRLFGRLFKVLCQMTLRSGTALSSVVELTDVFVRRLDRGQRGSGFLLL
                     KRAVNAEDAREHSPIAITMTLIYCVHNLLLRRLHAAEYGNTSTHFNANAALVDRLKSL
                     VVMFRYSFEQLSAFASSPRSRSGAHSSVFRQSSLLATAAAWLTGGDREDSAGDRSSGP
                     NSTASCARSNLAYLDDLTGETLTAGVPTLQWLCDHRANPRRTVEAFAEVASRVDYNAF
                     VERCLLAVEREQSTDKALAAKLWSEQRASLRRLQELFAENSMSRRLVHDKIQALMAAF
                     NSPPKTGAAGETDSDSGAADLEGHSSTRADGFAPASFTSLFLPRAARRATAAARANAW
                     TRFTFALRDTVWCADAAGLHNTLKYVKLSSQEQQFLVHRKLVYDRDGTNYCGRAMASY
                     SAPRSPVCDDLSSVNVTSFRAVPALLGDEGESGGGLAFGGSVSASTSRASYLRLRGGE
                     SVLLQAIDDDDVGLEEDMMNFSLDGRGDVSTAAAASFSECPLLWEEAAPVSKGAGLAP
                     TSKVDNFSAAPSLLSVPCEVPYMMHCWSGSFTVRGSEVIVLIDDDNKAYNQVVAEEAR
                     AYVLRPRPFSFHLSHITQIAPARRFRMRRTALEIWTRDRRSCFVNFSDTATMNAALQA
                     VRCGERSSYMLTAPSFLRDASGAATAALPTLLHEGTGGVRWHSAYVLQENPRREPLRL
                     RATALWRNRLLSNFDYLLVLNLLAGRTLNDMTQYPVFPWVLSDYTSETLDLTNPETFR
                     DLSMPMGACGNRERRELVRQRYMEMRSLGDVPSHYFTHYSSPAITLYFLVRLPPFTTL
                     AILLQGGHFDHADRMFHSMQATFRAVMTSTQDVRELIPELYYLPELCINENHIDFGRR
                     QDRTPMDDLELPPWAHNDPFTFVYRMREALESAHVSAHLHEWIDLIFGYKQRGKDAID
                     ALNVFNWHSYEELDRNREAGSVDQLLLVDSLDNIGQTPIQLFRRPHQPRLPLEWADPL
                     QLPIRVKVMTLRWGCARVARTTVVSTDRVLVVAGSGAAASLRMHLTPIRQSSVLQRAA
                     ATPPAASPPHAAASTAAASQLRCAPVGDGVAASAPSQNEMTATHASSHVNATAAAVPG
                     HPATPVAVTPVTNHPAPPAMDSGSFDVRDEYERSLAPIPAGVIPNDSAYADGSCTEAS
                     TALLCYDSEVFLVLGGLFDNSVVVRALSGAGRDVRLRAHRGRVVFVARSEDSRYLVTG
                     AEDTTFAVWSCHLQPARQRLEMTMLFTIYGHEGMPSAVDVSSTLDVVATASLNGTLML
                     HSLSTGGLDRVIRHPHGAPIHRVLLQTTCYVPNILFLSHQDEKVYQCSLNGAALRTFS
                     PPGRVVTWATTASQCLLLACQPLASVHGGGPQDGDQTSCILYLHSFFLEVLKTVPVRA
                     EDVVSSVSAHPSNPQVVVAGTESGRLLLLRSVLV"
     gene            complement(<686726..>689581)
                     /locus_tag="LMJF_36_1730"
                     /db_xref="GeneID:5655429"
     mRNA            complement(<686726..>689581)
                     /locus_tag="LMJF_36_1730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686695.1"
                     /db_xref="GeneID:5655429"
     CDS             complement(686726..689581)
                     /locus_tag="LMJF_36_1730"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686747.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655429"
                     /db_xref="GOA:Q4Q1Q1"
                     /db_xref="InterPro:IPR007265"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1Q1"
                     /translation="MAAKPTSCDAGEKSSLMRQLELLLVPLHHRFRYPLPVPTHFTAG
                     EGDGASIAAALTHAPGSPALAVAGATGSSYADPAGTAASHFAGDSAQLSEQQQDERLY
                     RSAMRVVEEHVPDLLTWQARVQRGATQAGNCYRVLERVRNSVSAMQRVTESVQKQSDH
                     LSHNASAMMVRKAKLELVRDSLEQNLAHFTHIDDLCREAGNPFLKAGSARFSTLLQDI
                     AKEMEFLCTNTQYKSAKPYAMKLAVAQQTVSAILKDAVRASFRTMEAETLASPAFEAA
                     TQVLQEDSAILSDSPLTRASTSPSMVSMSATAAPPLQLRPHDVAGSFEEFLAAVNDVF
                     VKSGDGFTSLRRMAELRQGGFGYSGAEAFGEEMLTAGGRLEADPGMREVMDSYCEARV
                     GVVVPLLRYWLTLWYYLDAQQNSQADAKTAGSVAAAVAAVGAASPADTGAGWDQLSGV
                     AEAHTLPQLAEHICRLLQHSLAAESDVLARLWLRDDIVSHLLPRLVPSIAEEVYYMFR
                     SRLLCVDDVGELSRTVESIQRVSLLHNNDVQDSEVVSDLWVRMIQDTQERLVFRTSVY
                     LRQTVSRCTPTREIASVYLRCGTDAYNAEPAASTGDAAQTRMFYIPVVVHALKLLDWL
                     YPTLEFSVFSVFAEEAVHHSLDIIRQLMRLMRQMDSSDTLRDSKAFLCQLAHLQHLQV
                     TLSHVDANITVVEKHISLAALRNRRLELEQSSRESKKEVEMDLLKCSEHLTTAMFALV
                     TQPVSGAAKKSEAERIQLVSEMKGRAAGMERMIAFYVEHEETQQDLMHLLRERVVELA
                     AEMSVDVHAVPAAPVKTAKLETESAAQNAPQRSATEVAVAPLPPASALQPASTAAGGS
                     ADSHHAPLQSSAAPAGAAQPAASAPVASVGATDQFTALPTHAPRAPPEFPSPPTERVT
                     YASAPPATTLCHQPPLQDYAAPTAGARPSSQDDTDII"
     gene            complement(<690432..>695933)
                     /locus_tag="LMJF_36_1740"
                     /db_xref="GeneID:5655430"
     mRNA            complement(<690432..>695933)
                     /locus_tag="LMJF_36_1740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686696.1"
                     /db_xref="GeneID:5655430"
     CDS             complement(690432..695933)
                     /locus_tag="LMJF_36_1740"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686748.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655430"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1Q0"
                     /translation="MNRSSVRLFGNYSRTSGAQQHSQAAHTSSLSSTRSSSVLGSLVR
                     MRNQFHRLRHAQQQQAIAAVLARYRLQPALRTPAASTSRAAGQIDGDDSVGQEGSGEA
                     GGSAASSVLQTAIILCTEALRLLNGEVRCRDNLSDVPKSSPMYGSEVGKLLNIAAAFG
                     ASTTFPRVQHALHWIKLNKESLHTPRQVMSLCMPLLSLADGRTAGVAFVLEELYEPLL
                     LALQDVASTSPESAAESADNAPSDATAAVQQHLVAITSAMGMVAKWSSLRLGSKSKGS
                     LSSSPSEVLAAAKSDATAEELDKMLRIAETCAAALRRQSDRCRGTGPDEAFVAMAHLS
                     PSDVLQWIQCLHGLEKMYALVAPTLGVSRAQAEAASRRLLLCYRALLPLTQRTLELPG
                     GGGGATVAAASSATFATGATATSVRVADVVELIQAGLQTSIEPTHVDLALSYGLQALP
                     GALASATVKDLSDAAQVVNKVRQKRPSALPAPLLLSIQAAFRPALFLLRETHALQFRA
                     SDCGVLLSSLSRWEEVPGVTVSADIVELLSQRFVEQMHVVGASHLVPFVASLARFEER
                     KRPPQRGGAAGQAVKNAAVLGEDLAGESAQLAYSGVAWKTSEGRADRLTSPPVLGART
                     RGAEGVRYRFCTTSRVVSQCVQRAIVLAGDTETPGDPAAPPRLSTADAAQLLTYFVQL
                     SAPQCADFFNKVEPLLAPAIHGSAATPSPASAAIRLRVVTGDAVQRFVRYAAEQREHT
                     WAQCTNPTAQETRKEASVVEVRRATALLRGMSRGLTKLVREAASPKDLVLVCSLLRRR
                     LLDKGAAAGVAVEGGEGALKKLKSAKPTTAVARARTRAWTRKELELATVFAAQASKMA
                     PECKGVELGALASVTSSLCTAGVLPHPVAQQFMRAVWARCAAGLAVASRGEAVGPEAA
                     AALTLSLENCKTIMDASRSAHLTRTVPPVIFLEAFAAQCSELLEESSGAAGGEGSPST
                     ARGTARAYAEAVTKLRRTADLGRSLVSYFGSLRPSRGAAEGDAAMESTTWREAQVSAL
                     ESYLEVAHSVVEAYATEATLSETWWAELDGGNPPPMPLELLSTTANVMAQIYRLVHRG
                     VGSTKRVSSIPATAPTVPDEVPDAEGDVLDGSLTAVDGAGVAVRSELESKALEDDVEP
                     SPLLYHSPANLSTVTLDQAVRDTLGLLGDTIVALARQQQQQLSSSVSANVSGETATED
                     YGRLTTAPGHALVQNPKHLLMLLRAFETVEHPHPEMLYSVLPELRGCADRLDPLELSL
                     LIRALTQLGAWNSRLLSALATAVASKMNQCKLRQCYTLLHGLCWSGCTSPDTYVELRS
                     TPRRDGDSGRGGAANKAAAQEPLQRLAESTLLRLDAFVRTKDAFMSLARTAAVADLVG
                     VVKVLRFFHAPPAATYDAFVVLAVRRLASQAKRLSLGTVVQHTMVLLNAVSELRQPEQ
                     QRVSAQALWTVLRRAFASSTEAGSPGALTAAAGDAFGGVLHLPACWELTRFAALHSLQ
                     YGREATRDFFVPIVASTTEQRAVSCARLTQTRLARFIETHASDLAADARSPLPFLTAA
                     ERAALRRYALHASPCLVRGDRELDAYMCAPLKLARLIADGDPTTLVHAATTAAPAAQA
                     RRCIRLLACLLRTDLWPPSISAATADTQMLVAALLRLWTAAELDGLLRHSPGAFSTEE
                     LLVLAAAADRVHQYSMDAGNLQDDFAVAVRQLCAATTEWRLPAAVDAWMLFAMPFMAS
                     SSIPAAALPNDSDELFVMLVASGDVLVTRFAHAQQSWTTSGARMLPELLRLFRGPGQL
                     DVAMLQSRAVGVDTLSSALPHPAADAPAARVRFVEIYRELLRCFTVCLT"
     gene            complement(<697578..>699212)
                     /locus_tag="LMJF_36_1750"
                     /db_xref="GeneID:5655431"
     mRNA            complement(<697578..>699212)
                     /locus_tag="LMJF_36_1750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686697.1"
                     /db_xref="GeneID:5655431"
     CDS             complement(697578..699212)
                     /locus_tag="LMJF_36_1750"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686749.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655431"
                     /db_xref="InterPro:IPR011042"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1P9"
                     /translation="MPPSSSHSVVTLAAALLLAMFACSHSGHALCPSNGNTHTIYVTS
                     NMGDDIWSFDTLGNYLGPVLNKASFPPGVQVDKLRSMRFGPEGHLYVSSARGSYSRVF
                     AVSGNGLLNGTMEENCTRDYLFTVVEQDKKNPFLDHPYDITFHPATEDMYVSNQNSVT
                     VTRYTRDRTADVMPKAGASGSQRAFYPAWKPAKNVKAAVEANEETVSGEETVVAPKNI
                     PDSSGLFASSWSSSYSMSSVRGLTISPLLPRALVEGGAPSGVFAVTNESTMYYLLVCD
                     VSSNTVHVFDPESGERLFGLNVPSPIQVMFPSRYYIGDSSSLSVSAAGVPTQRFDVPY
                     IYVTSKEDGMAYMVRFSTRQGNTNNNGMQGGVFGEDFIRAHHLYAINHPTPLHAASGI
                     YENSARDVLLIADRNGRRIYSYASPFLTDYTSGYGPSPFLGFFVKHLPDQPEFILLTL
                     LEHQENIPFCYELNKDGKLRYVALCTAASIWSVALALVLILVPSFIAYRQIQHCMHGQ
                     GQQRRQRYLDEDASALFESGSSSPLLGGRAPNYGSA"
     gene            complement(<700520..>702049)
                     /locus_tag="LMJF_36_1760"
                     /db_xref="GeneID:5655432"
     mRNA            complement(<700520..>702049)
                     /locus_tag="LMJF_36_1760"
                     /product="putative aldehyde dehydrogenase"
                     /transcript_id="XM_001686698.1"
                     /db_xref="GeneID:5655432"
     CDS             complement(700520..702049)
                     /locus_tag="LMJF_36_1760"
                     /EC_number="1.2.1.3"
                     /codon_start=1
                     /product="putative aldehyde dehydrogenase"
                     /protein_id="XP_001686750.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655432"
                     /db_xref="GOA:Q4Q1P8"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1P8"
                     /translation="MSKLFRTVGAKGFQPFDWANAAQYASGTTPMMKEPACYINGAWV
                     ASALSDKTVTVEDPCTNQIIGAIPCMGYAETTAAIEAARAVFERWKEVMPRQRAGAVR
                     RWGELMRKHCDVVANILSRESGKVVAEGKGEVLYAQGYADWYAGEAERIYGDIIPGPR
                     PGVQTTVFREPVGVVGIITPWNFPAAMIMRAACGAIAAGCTVVLKPAELTPFTAMALA
                     QLADEAGIPPGVFNVVAGDAPKIGDALVESFDVRKVSFTGSTRVGQHLYRRCSETMKK
                     VTMELGGNAPCIVFEDADLPRAADQLIAAKFRNAGQTCICVNRALVQASVYDEFKSLV
                     ADRVRALKVGSSFDPAVKVGAVIGSATLERMTRMVEDAVEKGATLMVGGKAVEGGGYF
                     FEPTLLTNVPHDTTLCCRNELFGPVLPLVPFDTEDVAVKMANDTQAGLASYFFTNDYR
                     RQHRVARALRYGMVGVNDSALSSPAAPFGGVKESGLGRDGSKYGIESFVDIKYVLFST
                     V"
     gene            complement(<704341..>704661)
                     /locus_tag="LMJF_36_1770"
                     /db_xref="GeneID:5655433"
     mRNA            complement(<704341..>704661)
                     /locus_tag="LMJF_36_1770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686699.1"
                     /db_xref="GeneID:5655433"
     CDS             complement(704341..704661)
                     /locus_tag="LMJF_36_1770"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686751.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655433"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1P7"
                     /translation="MFRRALGASAARSLSSISAVVSRRSYTELSHMKFPVYYGAVGVV
                     LGYFVVMWIIFLRMGSKHTARSEYKNDYLRVWRRRLGTGYQWADAWGPQMDTFFKDLP
                     EEVE"
     gene            complement(<705694..>707931)
                     /locus_tag="LMJF_36_1780"
                     /db_xref="GeneID:5655434"
     mRNA            complement(<705694..>707931)
                     /locus_tag="LMJF_36_1780"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686700.1"
                     /db_xref="GeneID:5655434"
     CDS             complement(705694..707931)
                     /locus_tag="LMJF_36_1780"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686752.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655434"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1P6"
                     /translation="MPLLPLSSTLTSGAWGNPTSSITAFKVREKHEAGMRLLQGGLVY
                     EAIQIFQEASFFDAENVRPIVALAECYVFLCDLRSAVRCYRRALLSLHKQDLDDYCRR
                     ANETPTDAVDEVSATNNCRVVASNSPERTWRNSGGEMHPSDVPDDERGSREARLETAQ
                     DPAPASFQSVGGSSPPDHSIQGLADSLQSAEMAARFSMYQPSQAKSVDSAASEVPATT
                     PSLPAPGAAPTVKDIRARLAGVLDALGLSLYQLGSVDQALRCTTEALEMLDAAAQVGE
                     GEDKDVSSSKLPQFLADPTIALHRGVYLMALQRDEEAEALLEDHFAIFPHWRPQTAAL
                     LVQLYCNRQAFRKARVLLEAQEEKEACNTDSSKAPTEAHGNVDEGLCSARRSTLAPSL
                     PSSTDALGSLAVAKYLFTELYARYRTAALASNDEASITRCLSIYSNDFDLLFRRAQLS
                     VAAGKYKQSVKDLFRCVRETNGEHKEAIEVMTTVLFKIGSSLNGEAEVQDAVTYYSES
                     LKWRPDNVLVLLARGDCYTKIECFEEALADYEAVLGLEPDQRDARQRIASLHDLWGCK
                     LFAQNQPVQAEAEFTNAIKTDGRNPQFYYHRALCRLKLDQGRYALRDVLSCKELHPTT
                     PHLRAFIARYLEPVQPPEASQRRNTPQAPKRRVVAASVCEARTPPPLGDCDEPPALQR
                     RRDRDTDDTLSHPANGGASTATGVLPRIQRRASLQKRSAVVGWVQGCQTMLHQRETGA
                     HAPVK"
     gene            complement(<709059..>711746)
                     /locus_tag="LMJF_36_1790"
                     /db_xref="GeneID:5655435"
     mRNA            complement(<709059..>711746)
                     /locus_tag="LMJF_36_1790"
                     /product="putative exoribonuclease 2"
                     /transcript_id="XM_001686701.1"
                     /db_xref="GeneID:5655435"
     CDS             complement(709059..711746)
                     /locus_tag="LMJF_36_1790"
                     /EC_number="3.1.11.-"
                     /codon_start=1
                     /product="putative exoribonuclease 2"
                     /protein_id="XP_001686753.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655435"
                     /db_xref="GOA:Q4Q1P5"
                     /db_xref="InterPro:IPR004859"
                     /db_xref="InterPro:IPR027073"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1P5"
                     /translation="MGIAGFFLWLQRWYGDCIDNIPQDVVDAAFKGQALPHSHASAYS
                     YDNFYVDMNGLIHPCCHDTAPLPEPENEEEMFERMFDQLDLLVRVVRPKKCLVLCVDG
                     VAPRSKMNQQRSRRFRAADERLESDAISNACADSIVSEYHLPRPRVRERWDHNVITPS
                     TAFMERVALALEWYIMKKLNEDAAWRHLTVVFSDAHVPGEGEHKIMQYIRGLRSQPGY
                     DYNTSHVIHGMDADLICLGLSTHEKHVCILRNQLTETFQPDHNRFCYFNLSTYREKLM
                     QDFANIEGMQFERVVDDFIFLCFFVGNDFLPHVPLVSIKTRGIEMLLDHYVRDFALHG
                     YLTQLGEVDYAHLHIFLMNFTSKCMMKLTKEYYGVVRAKERAKQHVEERVTKTEAQVS
                     EVLGTLLPDRSNAQEVSDALLGLMSSARKERTRFVVDKQPLGFSYLDKTYRDAYYQHK
                     FGWDPSTNRAAFESQIRLCCAEYLRGMQWVMRYYTKGCPSWEWYFPYHYAPLLQDLAA
                     FTATVNVEMRMSAPLHPVEQLLAVLPRLSVHALPEELHEAVNDPKSVLGKFYPAIVDV
                     DFSEANFSYQGVLRIPFINCEALSKACRQLVELEEDFGSTFLYCHESTSLAKQLDALT
                     GPSNSALPLATGLAPPVVPIPSSVASTMPIAGRMGRYEAEWPRHEELQCPDPGMAKST
                     RYGGRIQSNRVNQYRYELSTQADYRPVLMGEENATKNGAAAAASKPSKRLEKEQSPPR
                     HRKRGRDADHVANSNDAKRKRGSSRHDDDGRDRRERHRSNGEREQNGESRRRSKDGNT
                     CEASSSSRHTSSSKHCSGHDDDARRSSELRHRSKEGKKRSSQHQTRSRESKSEAQPAP
                     SSSSSRRAKKSRETKKVPRPSEKMASTKPSRHGHRQQRA"
     gene            complement(<712969..>713850)
                     /locus_tag="LMJF_36_1800"
                     /db_xref="GeneID:5655436"
     mRNA            complement(<712969..>713850)
                     /locus_tag="LMJF_36_1800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686702.1"
                     /db_xref="GeneID:5655436"
     CDS             complement(712969..713850)
                     /locus_tag="LMJF_36_1800"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686754.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655436"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1P4"
                     /translation="MSENVAAAQRRWQAGMHEVEAYLNALDSARADSAKAGLYHRAQQ
                     CMQHMEKIIRLLAKRIAREANIMAERARQALTEQQRLLQRNLRKRWKTKMLVYEENAS
                     AMLAAAEQHHYAERVREDERAHEELRSVRAGGSMAHSRSSKVQHLQSEIQLYLRQHRY
                     REAERAQAQLSRFEKQEQQSQQRNLTHLQEQRLQAMRMKQEEQLAKMKAAYQQEKQEI
                     TRTCRAELDAMTRQHEVALQAVEERRLFLHERVQAILKAYNDADTLDPRAAGQKLIRI
                     SQLLWTSREVQQSSKRI"
     gene            complement(<715264..>718080)
                     /locus_tag="LMJF_36_1810"
                     /db_xref="GeneID:5655437"
     mRNA            complement(<715264..>718080)
                     /locus_tag="LMJF_36_1810"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686703.1"
                     /db_xref="GeneID:5655437"
     CDS             complement(715264..718080)
                     /locus_tag="LMJF_36_1810"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686755.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655437"
                     /db_xref="InterPro:IPR003409"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1P3"
                     /translation="MSTTTARPATSSSRSRLMNMSAPLGSQPTMVDPSNPFPVNGKVG
                     AQHSVSYFSVALTQPALVVIRMKEGNTASRCALFLSCFYPKPDANNAAWRLISPEPVK
                     QIVLHPADPAYCVDTLHIAVHYLEPSGQSNFQLQVRVQREFFAMWLRTNEETRAATGA
                     AAVDHMTAVKTLPSPGASASGKWATANAATLPAVPTLHTMLAASAARLSGSAANSAGA
                     PFTSLYVGDWRGDQRDGLGLQYYAAPEEMLSMTTLTKNNATDFEHSLAGHTDGMDWDA
                     ICTSTSQQAVTVGGVDVAQPLMLLRAFSERHNLPWSAWSIPDTLTPEELARLGFGFCF
                     HSTSRARGGAAATGSTSDHAAVSGKGAAAPSPTGDSSLAGTVALSSTPPVAPCSTTAE
                     GMAALGGVISAFLVGEITSDEADAWKVLPVQPGVEVYAGEWVANQKEGRGAYQWLDRS
                     YVGEWVGGRREGHGFLRRQDGRWYRGQWERHVPHGHGEARLTPEGLLYKGEWRDGRRH
                     GSGALTYPNGMTVHGMWVGDELQPRVRVVYKDGSTYDGLWDPEEACRQGQGTWTDTQG
                     CEHTHEWQHDIRVGAGQEVYPNGVVLHGVWRAGELVDGTYVFPNGDRHVGSLDAVRHV
                     REGAGTTVSADGASVYTGAWHEDKRSGYGVQTVQRPPRACKPGEPAASPSVERYEGEW
                     LDDLRSGQGRLTDGDGIYEGEFARDYRDGNGVQRNTRTGSFYEGSWKANRRCGAGTYY
                     SATQGITYEGIFMHDRLTSIGTATNTALAEQYTGSWLDGLQQGHGSLQLANGDVLRGA
                     WHRGVPDATATIEYIDADPSADGPRRAVAAVSRYVGGWQGGAREGTGTQVFRDGSVYE
                     GTWHANKQHGCGRLTTASGEAVECQWRDGCIVDGCIGDAHFADGSVYHGHVNVAGAPH
                     GAGVLTYPDSTVFDGQFFNGVYQL"
     gene            complement(<720687..>723308)
                     /locus_tag="LMJF_36_1820"
                     /db_xref="GeneID:5655438"
     mRNA            complement(<720687..>723308)
                     /locus_tag="LMJF_36_1820"
                     /product="putative ras-like small GTPases"
                     /transcript_id="XM_001686704.1"
                     /db_xref="GeneID:5655438"
     CDS             complement(720687..723308)
                     /locus_tag="LMJF_36_1820"
                     /codon_start=1
                     /product="putative ras-like small GTPases"
                     /protein_id="XP_001686756.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655438"
                     /db_xref="GOA:Q4Q1P2"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR020849"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1P2"
                     /translation="MAGDFFMSCSTDESAFMPEIRVVVLGDAKVGKTALLRQYLHHEQ
                     PSRSTGHESTLLDSYTHIDYCGMQPYRLIFTDCSSAPSFHEHRAAYLAKCDVVILVYS
                     VRHRKTLLNLRHWMEEVLEARGLTRPARCASTTGDFGEVPIFVVGTHYGEKDSLEATN
                     PTGTDEAESITKECLQSAGYFINENDADTEEALRSNSARPQKARQRHQQRQGPKEKRS
                     PRTFHDLLHKLFHINADGEGRDAGALKKPTSDEVTAFQQRQPASAVRNNGCLSLASST
                     PMLLQPKSDTTNNKTKSSNAKSTLRIPPGASTRLPLFQLSNTDGKAVDMAVRASLTLY
                     LWLQRHEGDSVALSAAHTPQSSFATASKPEDAAAQSAPPHESSKSADDGAGAATESTA
                     APLTVLSATLRAHAISRALHASYVNERSVASFIPPMLALYNLGVSGSVCGESTESQAL
                     RHSRGAFYVMQTAGSSAPAAQQPLQANSITEPSHETAFSCCGNGSSEVTVGARNDVKT
                     TDQTAFGEVCSQARARRGKRTEDRAPSYSSNVNSVRKEGKKDDAAHSGYLQTSMPKTA
                     EPVSSPELGDTAVSGASIKAGELMKGKTHGCLSSPGTNPAAAPNADSREVNSAAGKAG
                     GELSTISGPMMPDGALPLSTAPSVATRSRGDAVTGGGIVAASQQPTLRVRKEMGVGKE
                     GDGAGTDYRGDLPTRKSEPVTKLPVECEPDRDPSSFPILRQSRENDSAGVSAVRAASA
                     GPLASPAHTPNSHNHAPFAAKLSPMDECVPSRSPSSTANTGIGTDKSEAVSNKSAQER
                     EPVTVSWPPRSSSAAREPQASQSEPRRPQKSRQAKLNGTRNPKHWRRPVISIRILIGR
                     QQKQKTTQCTVGGCAGM"
     gene            complement(<726949..>729582)
                     /locus_tag="LMJF_36_1830"
                     /db_xref="GeneID:5655439"
     mRNA            complement(<726949..>729582)
                     /locus_tag="LMJF_36_1830"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686705.1"
                     /db_xref="GeneID:5655439"
     CDS             complement(726949..729582)
                     /locus_tag="LMJF_36_1830"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686757.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655439"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1P1"
                     /translation="MQTEDAAQSPPRKKRGVAVAGPADRDKMTAAAVVSVPPLPSSFM
                     HVPPSSHERHTERKPQPGSKRGRAGKRQSCVGGERPRGSHCHTETALDGIAAPASATF
                     YRPTGTNRTLIYDVESPLLLCTPRRSLQDAAASPPPLVRSIATPARRNAVVLTSTPLV
                     IREERERVAEDDAAAHDPSALLRTPLRLVRAARGLLSPATATLRRRLTHLRQSATGAT
                     GSERGLQRQQSTAARSASPPPPSPWGQLSTIVPATDSLPSCVEEEGGSGSASARAASR
                     RRGLALSSEPLPDAAALSSIPASQRTSVSASDMWRRSGRGAELPELLRSTMQPGSVVL
                     SHSSDDDITASLSRRSSPIVTAVDEARGGSRFQRRRRVDEDLRGAGMVGGTAALRGPY
                     DVRFARVSSLSESLADIVSSSRSTAHSSLTSVAAAAASSAVAQDRISSAGHGSAGDAR
                     EACMPRRSATVMDPNFSSILPDEEELAIRRRLQRGRNRQTPHSRSDSDIRGAGVAALV
                     QERQHPVGARVAAGNVMELFVSRAPQPAPLAWQQPLQPEVRRRTSSGCASGVSVSAAG
                     GMAAAASVHQRVASRAHDADVWPPQPQRRSASSTLLSPPWLTVACVSRLTVALLSALV
                     CVWCVVAVALPLVALQPRYTLSAVARADSVAAEVQFVQTHANSVTEMQALYKIVPASL
                     SADAVVRLHHRTLSEGVERLERATQHLVPDDNAPPWRRLFYLRAMIRAYLALSRNCEL
                     YARSRDGSHWRRYVVYPLADMKRYGVRRFGSIASRSSITTSAAAAWRDRVWTTVVCSA
                     QSEVLACPSVLYVEEAMARDAAQFVYTDVNEAHESPQRKRKLQDWRVRLHRDWTSEVY
                     LETLLRYIRSGVQELTRNYNR"
     gene            complement(<731409..>733382)
                     /locus_tag="LMJF_36_1840"
                     /db_xref="GeneID:5655440"
     mRNA            complement(<731409..>733382)
                     /locus_tag="LMJF_36_1840"
                     /product="putative DEAD box RNA helicase"
                     /transcript_id="XM_001686706.1"
                     /db_xref="GeneID:5655440"
     CDS             complement(731409..733382)
                     /locus_tag="LMJF_36_1840"
                     /codon_start=1
                     /product="putative DEAD box RNA helicase"
                     /protein_id="XP_001686758.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655440"
                     /db_xref="GOA:Q4Q1P0"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR025313"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1P0"
                     /translation="MSARAPTSSLEGHSDKAAEAAAEQSTKKRRRLRHHRCKAAREAA
                     SNTADVPYDELAETVEKNDDAHSVEEAQAAASNVASTKRSEKRRREENSDDDDEADAD
                     ATTSSARPCHPHKRGAAEGGKTSSPSASASPAALSSPNGSTAVSMTQRNKELAKSIPA
                     VTDYKSLQLNPHIVSALEQEFKFKELTPIQSRCIPAALQGRDLLAEAKTGAGKTLAFL
                     IPIVEIVCRSGFRPSNGTAAIIIGPTRELCLQIEGVLLKLLKHFNGSLTFLCCIGGQS
                     RNQEGFKLANGIMIVVASPGRLLDHLKLTTDWHTKNLLLLAVDEADRVLDNGFEEDMR
                     EIVALLPKNRQTFLFSATQTTRVEQLARISFHKTPIFISMKSKKDKATVDTLEQGYVV
                     CTSEQRLLVLYHFVKKNLKKKVIVFFSSRNSVSFHCELFNYIDVPCIAFHGKQKQHQR
                     SATYMQFCNAPSGVLFTTDVAARGLDIPEVDWIVQFDPPDDPVKYVHRVGRTARAGRC
                     GNALMFLLPQEELFLKYLYDDAKVKVNEYIFDLTKLKENVQGQLEQLVSSNYYLRTSA
                     RQAYEGYLLSYSSCQLKNVFNIQHLDLAAVARGFALSEPPPIKMDLSQSAAHMSKKSR
                     HEFSAMRHTKDAKRRDVNAKSMNKRHQNISGEW"
     gene            complement(<734586..>736169)
                     /locus_tag="LMJF_36_1850"
                     /db_xref="GeneID:5655441"
     mRNA            complement(<734586..>736169)
                     /locus_tag="LMJF_36_1850"
                     /product="putative DEAD box RNA helicase"
                     /transcript_id="XM_001686707.1"
                     /db_xref="GeneID:5655441"
     CDS             complement(734586..736169)
                     /locus_tag="LMJF_36_1850"
                     /codon_start=1
                     /product="putative DEAD box RNA helicase"
                     /protein_id="XP_001686759.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655441"
                     /db_xref="GOA:Q4Q1N9"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1N9"
                     /translation="MSSAPRKLTKAMREDDDGGNSGSRASMRAPSTSSVKHQSLGSEL
                     LDDEEFKAKTFQDLGLCQELCAACADAGWQHPTRIQASTITVFAEGRDLIGVAQTGSG
                     KTGAYALPLVNWLLAQRKTPYLSVLVMVPTRELAQQVTAQFVLLGRSVGLRVATLVGG
                     ADMVEQACELSKRPHVVVGTPGRVKDHLSNTKGFKLVKLHALVLDEADKMLDMNYEKE
                     IDAILEQLPQNRRTMLFSATLSTKIDRLQKASLRDPVLLQVHRKNTTVDTLKQYYIFA
                     PFAQMLSYLHLFLTKETGNHILIFCRSAALVHKITLTLRILGHRALPLMGRMDQSNRN
                     IALTKFKEGKVRMLICTDVAQRGLDIPHTDVVVNFSLPDHVEDYIHRVGRTARAGAEG
                     KAVNLISQYDIVLLQKIEQQTGVKCVEYPSLPESEVQLVLQRVEDAEQEAIREIREDA
                     EERSLEKESRQLTTARKGKRDRGDADMGYDDAKHGTSDFATLRMRREHESIFEMTKKE
                     QHKSLWAKRREAKRQAKSR"
     gene            complement(<737034..>738329)
                     /locus_tag="LMJF_36_1860"
                     /db_xref="GeneID:5655442"
     mRNA            complement(<737034..>738329)
                     /locus_tag="LMJF_36_1860"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686708.1"
                     /db_xref="GeneID:5655442"
     CDS             complement(737034..738329)
                     /locus_tag="LMJF_36_1860"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686760.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655442"
                     /db_xref="GOA:Q4Q1N8"
                     /db_xref="InterPro:IPR005324"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1N8"
                     /translation="MLRPTCPVAKNLTSFATKGTMRGGIPRIYYTWMKPGSATRRRFE
                     KMRNPFVNLETGTSLYFRDTRDSAEAVAHAADSKGLKGMDNGVDLYNEYKIVPDLYPE
                     GFQWKHKLNTEYNQWRSNTWLTPELIPQEHRGRFLCNFQLNIVAYDMRVVKFSPKDHR
                     QWIYCVLYVGTGKGIAGFGRAVAPSTQEARNEAIREAFSNIIAVDLEQEGPMYPVRIN
                     ADGARVLLYPARRIIANFRVADILCAFGFQNAGCKINLKASNNPKAPTHTVEGVFEAV
                     KALRSVSEIAASRGKVPHSLVYNIYPYLEEMRRRKGMMAMHPPGKDGIFMPNRVVDNR
                     MPDHLKKGYYDDVYWKDFFAGSKEQLNEPKMGLRGDELRAQLEESQGRTAKRSNRRTL
                     DDVLRRLGKTSRDLGALQVVNPRLDAKLPTHMKRNYLLH"
     gene            complement(<740006..>742636)
                     /locus_tag="LMJF_36_1870"
                     /db_xref="GeneID:5655443"
     mRNA            complement(<740006..>742636)
                     /locus_tag="LMJF_36_1870"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686709.1"
                     /db_xref="GeneID:5655443"
     CDS             complement(740006..742636)
                     /locus_tag="LMJF_36_1870"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686761.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655443"
                     /db_xref="InterPro:IPR002499"
                     /db_xref="InterPro:IPR021870"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1N7"
                     /translation="MTETVLRLGPQEYAHLTNLNTNTTELILGPLNRPVASHESVALP
                     PTKFVVVPPTQYCLIANPHRTAVDPTTGIAQPVRDAYGQVQVRSGEEEYRWHVPPFPL
                     YPEEAVVKLEDLKVLSARAALQIQVLAAYNVPACSASDSMPSPVRREAGERYLFCGPG
                     TYYPRVEEHIEEEVMAYTVERGSALWCTTSETFTDSVTGLKHYAGDKYMYVAEGMHFL
                     QPFESLQCFVKGVVLSAEEGLHVQPTKTYADPRTPFRENGITRKANEPFLVTGDLCPC
                     FVLHPYDKLLKTVKRTHVSASQYAVILHPVGDDGNASVGARRIVTDTSFFLKPGETLE
                     KDHPRSAYLLCEQEAVLVTALGSFTDSSCTPPVQRYDGDRWLVQGPCSFIPSDLMRVV
                     PNAKTGAEVRRPYLLSEGDGLYVRNSVTGVVRCLPGPCSYLLTAEEEVWEKPLSAQVE
                     RHLAQLVSHAAYIELERDKERKVLQGQTERAVSYHIPYRSVTQLYNYKTQMTRIVFGP
                     DRVLLEPDEAFTVVSLSGSPWDPAKPTKCMPKHTNYITALHLFLGPSNMTDVVHVETR
                     DHAQLALQLCYDWYFDVTPGDTEAAKECFSVNDFVGDACSYIASRIRAAVASMPFEEF
                     HKNSARCLRRAVFDVNPATGQPNGLLRFPANHLVVTSVDTQEMEVLDERTRQGLQKSV
                     KMAIEITTHAQEAEAQQAAMAREQEAHGRLERQRMHDKVANEEQRRVLLHAESSGLAI
                     VSSGKSTAMAEALSSASRIESEASVEAATVRAAKELLLYNTMNEMQNKKRLLLAEQEK
                     KVAAMTLAYEKALEEVRHTLVGRVVAALGPETIAEIARAAPELQAKLLASLGLEGYLV
                     TDGSSPINLFKAASGLVGHA"
     gene            complement(<743443..>745347)
                     /locus_tag="LMJF_36_1880"
                     /db_xref="GeneID:5655444"
     mRNA            complement(<743443..>745347)
                     /locus_tag="LMJF_36_1880"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686710.1"
                     /db_xref="GeneID:5655444"
     CDS             complement(743443..745347)
                     /locus_tag="LMJF_36_1880"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686762.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655444"
                     /db_xref="InterPro:IPR005612"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1N6"
                     /translation="MQRYLMNTSYLQGQLKSLYALHNKTVADYGELVQNLNEECTILC
                     DVVPSYRISSTLENEDGGGQRKQKEVYNVQKLEHEILTQYTHFLQLLRKLSRKSHPEQ
                     QALGSRLCARLVKSSAPEFNHADALLSLAIDFANSKSVRVAQPCQTALSELLDDQKVS
                     DTTEHIVGALLRIVRKRSYAMNPKLLNLLLHVRVAMVDVHREDLAEEKAKSKRLKKED
                     KELARQLQKSKARRDRAEIAAKQTRILHRIFVIYLRVIEASKTCSPVHQTKILAPTLE
                     GLVKFAPLVNLELYQQLMEALKDLVKGGGTSRTRLRVGGTEGGSDGDNVDDKHEEETA
                     TSVTTRLHALVAVATLAQRDATATASEWRVDLSYFHEVLFRCLGEALELPSAESSSSA
                     KMTREGEQEASNGDMDEVASQGSTSSAGSLSSQAFSIAQSMTQGTLVHQNASREWTFH
                     VGLVLRAVDLLVLTQKHLPVARVTAILRRLIQATPLCPPHIAMSILALCHRIVLRYPL
                     AGGVIVGGSDNVIAGRGAYNPEALQTASANADSSFTWELSLLSHSYHPTLRQVAETMC
                     KHYHKVSKHQHGQAPIVTKQLDSLGPYEVIEEYDPSLGNLKPAAPLPTALKAEVRKRQ
                     REEAQAYEVA"
     gene            complement(<746536..>747075)
                     /locus_tag="LMJF_36_1890"
                     /db_xref="GeneID:5655445"
     mRNA            complement(<746536..>747075)
                     /locus_tag="LMJF_36_1890"
                     /product="putative endochitinase"
                     /transcript_id="XM_001686711.1"
                     /db_xref="GeneID:5655445"
     CDS             complement(746536..747075)
                     /locus_tag="LMJF_36_1890"
                     /codon_start=1
                     /product="putative endochitinase"
                     /protein_id="XP_001686763.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655445"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1N5"
                     /translation="MAICVGSRLGVVRALLVVAIVCGLRAAAVTAEESSLSSPIVCTC
                     RCCYQGGCSPLTNVSWTVSSCSECSTKMCNEYISSQQVRADTARLFEGIQGEKPLNDT
                     VVVQECEVIAVLEAATCTTKSCKRTSTIKAECYDRNAPLIKYSIISFVLLTIFAVILG
                     IIKNYIPVFQSLNEKYFNY"
     gene            complement(<748585..>753552)
                     /locus_tag="LMJF_36_1900"
                     /db_xref="GeneID:5655446"
     mRNA            complement(<748585..>753552)
                     /locus_tag="LMJF_36_1900"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686712.1"
                     /db_xref="GeneID:5655446"
     CDS             complement(748585..753552)
                     /locus_tag="LMJF_36_1900"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686764.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655446"
                     /db_xref="GOA:Q4Q1N4"
                     /db_xref="InterPro:IPR015898"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1N4"
                     /translation="MVLNLFSGAALNGHGSTHRRGRASSSLSSTGTGCRPQQQRYQAS
                     RSATDGASMQADGAEQSGSGVRAEAAEDRVLFNNCVAQVQRHLKTHADSPSTLHTLAS
                     YYTKTEPFIEGRPFCVTLSYATFLFHMQMARISVADVELYVQLVISALSQITEDDQLH
                     HPFVQQVLRDHVFGLPSPTCRGAAHSVVLLSPQQYRAFATMTTALISLAVVPLSIVYQ
                     FHDRLETYCECASPLVANRALALLVQTVGEVRMDEQVTALQYILKTKPVKMNVDFLLA
                     CYERLKRAVIDPAHGPSFGRALSIHCSELFLRFRSPVRRDYVERFLYPSLCHSDMASF
                     LEIPATRKHLLRELLSKCTPGMGTMNPFYMCLCAVLQSCFDNETDGALETVALIDCHM
                     PHAAYFMSTLAVDSHMSVPMFAKVMISLARGAGMAMTGRETPDEVAASINENRTSVYN
                     VLFLLREVVRSCSTTASRRATDMLKALRVAVAPKTIEALGKLSSEAFEAVSDITLDPQ
                     LLCAELAMVLHQDHIAEAMDSAVEYFRDVRSRCPCCAAARSSSLLCPVNGTVHVAGQS
                     SVSRVLSTLSECAGAKAVEEKLISYLRDPALQMESAVHYLIYHIIANGGQHRNTLFVA
                     VEPYVRSTLLALVSADRSGVRGLVDSTLKANVLMLHVKLVTLLASSIDPSYLESILKV
                     FSELRVRNNHDALALWYMGNVLLRSCRGNLELLPTDPQENNYCVAFPGCAPASATTAD
                     NAQLVLKLLHRAHSFSPEMHKLVGCCVCKLIQDFNMQAPNICSTLLSPFGFFPVGLES
                     LNAFALPAGASSTFWSFFLQQMRSAAPARTAFMATLAKSLSRRFRIASPRDALAPHGV
                     EPTGHLFVIMVYEAMKRNPPLARVLLYMVSHWMKQAGHPPGKLACLVYVCVQLITVVV
                     DRAEGPAAAEVEAETPQDRQQFDDAVKKAARVLKSQQARLDRLAPTARRENVEFFHLL
                     RRLQRRVRRTVAAASGEIVVGDEAAEEDDDHDDAVDGSSAGGHVRQDSITDAVCAMQE
                     LQNAADNSVFDDYADDVDHEDDGAYGNNEGACDAASPGIGRSAQTGGSRDRAEGPSAP
                     MRIRHLPQGITSILRSPARSSSNKSDWGATGAEKGLTTSVNTCRETNRQIDVEDVPHD
                     ADGDDAEMRGRDGKTAHSCALGVEPRTRSTSRGVQTDASLNSPALPGHAPQRNVGTSP
                     IQPAGTSSHISVTRRNGTQLPCRAPADVGSARTPSSPLHQPQRSHTRPPEADGVLSEG
                     TRTPAQRGSTWREPDLVDYVDGDTTPIDDYTGVPRLQATTTSDGIVLPSGMVLEYLRT
                     HQGMDSLQHELRQFDQQWMVQQVAEYVSQNGGMVGAAGPSSALRGGVSSVQSVTVESR
                     ANNYSRPHADPTELAPTRTVRTEVRMIGPATSYSRPPRQEEHGPVVAAAPGLPEEGEV
                     DVVDGEHPIRAVSGPPDESDLAGRAGDNDTTKRRRVEATEGSATTPLPPPVSPTSAFR
                     GRNFFLNQHTQQEVDSTLQDIRYLQRRQQTNMSALAKAQSAAETVESAGDDGAPRKTP
                     HQGQSSTGVAGEGVPPTTPYGQLILPTWIVEQRNDTAVRELRQVMGAHNPNDSRLSTS
                     AGKRSRIHGSGAGDGSGNSAAWWAEMSSAPMPNYAADPQYSMELF"
     gene            complement(<754923..>756167)
                     /locus_tag="LMJF_36_1905"
                     /db_xref="GeneID:12982071"
     mRNA            complement(<754923..>756167)
                     /locus_tag="LMJF_36_1905"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722887.1"
                     /db_xref="GeneID:12982071"
     CDS             complement(754923..756167)
                     /locus_tag="LMJF_36_1905"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722935.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1905"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1905"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982071"
                     /db_xref="UniProtKB/TrEMBL:E9AG15"
                     /translation="MKGLDMSTPPHQSCAASTGASTTTMSSASPPAISTMCVDVRELL
                     RHSAAASKDVPSDAQAAVSGRQPYTAVAPSKAPSQPPRQPQATSPSCRKESTFWSPSY
                     PPRGGFAGNSGPPPLSPTDATILHSILGQPTLRKTVLSSFDQLIGRTSSPLTREPRTR
                     RPSLASTSPPPIDSSSTWGTSAHAEDGVQALKVGAATPLSALSEKDTSPPTPLRDVME
                     NYLDGEGSHSAGAAASMDFSPAGQRTMKSLLGQLNSYASGLAAAHTRAVTEMPTSSNR
                     GGVAVWPITYRQAAMKFSAAGPSAASPLPFSGASAHRRKGGAAATRPTVAQLWRRCPA
                     LAASTFSRVDTSPQRSHDTVQAVVAPPQGLAYDRPHVAADRSTVPLRKALQSPPRTVP
                     PAFRRQLQFTEEAPTTRRPKRR"
     gene            complement(<757201..>758580)
                     /locus_tag="LMJF_36_1910"
                     /db_xref="GeneID:5655447"
     mRNA            complement(<757201..>758580)
                     /locus_tag="LMJF_36_1910"
                     /product="putative T-lymphocyte triggering factor"
                     /transcript_id="XM_001686713.1"
                     /db_xref="GeneID:5655447"
     CDS             complement(757201..758580)
                     /locus_tag="LMJF_36_1910"
                     /codon_start=1
                     /product="putative T-lymphocyte triggering factor"
                     /protein_id="XP_001686765.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655447"
                     /db_xref="GOA:Q4Q1N3"
                     /db_xref="InterPro:IPR025593"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1N3"
                     /translation="MPPKATTAAAGGKQREKGKKGGAAAVDSVMELRNMEDIHEVLAK
                     AQQLRNYFQVERDKVNGMWDITKKELENEQFSLQNAESELEELEREHQVEMKVYQQKV
                     RHLLYDHKVTLKQLRDESDAALRQAEAAHTQRMHQLEVERQQRMTGMQSAREAQESRI
                     VDQRDGHQYMLTVTKRRNHEKELARLQASYEAKLSTLREDLELRRRAEVQDAEERYHL
                     HINHLIQQHEDKFNEMKAYYNHITHNNLEIIQSLKDEIVTMKKNDEHNEGLMFEIEKE
                     NENLVAPLEQLEKEVAELQVKKQQHIQDKQSLRSFRTRYKLLQQQLCALRQEKEMLED
                     QYKNVYDEREDLRAKFESALREAMDVVADRNNSLQQNLIEAHARLEQRDAQLEGVLRA
                     MGLEPVAMELISNEIDAELQGKNQVIKDLHFEMRRLEKKVNAMVEEYERRCRTVGVPP
                     LDRASVMQV"
     gene            complement(<759668..>761158)
                     /locus_tag="LMJF_36_1920"
                     /db_xref="GeneID:5655448"
     mRNA            complement(<759668..>761158)
                     /locus_tag="LMJF_36_1920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686714.1"
                     /db_xref="GeneID:5655448"
     CDS             complement(759668..761158)
                     /locus_tag="LMJF_36_1920"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686766.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655448"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1N2"
                     /translation="MERTNLGHGAVGSLAQLCDELRKSYAAAKEIEQRDTTLTKSETA
                     NTLKETSNLFALGMEKLISSDGNVVEVKDAIALAEDAEREVAALRAEKARLQSTEDGH
                     RSKLSATGSDAEVEAFVAYAKELSELHDHLFLARVVFKGVLTKRLEDIRDDRLSQQDK
                     RFTDPKSWDVKKGVLERMLQSLRTKTAQLQLSAKTYLDEDEALFLEVMNLATEAGDHV
                     RRGDAMREARDEKLKVFYAECAKLTGWCRQQLTNLEAMQEPDHVQEYCATLADNYPTM
                     SNNFAVLFNSVQEYVQASLIPVHKALLEAEEVWLYLQVSTLERLSKTLFEIHPQSPLD
                     VEVEKYSSYPEHAAKFLQDLERYLAAQHRQQDEVAELDSVHKECQEVLHTLSGQFAEL
                     PSEVHAFAQRAQALRAGYQCFREALLQRLTYVSPAASTVVESKRRQEEFENCVRELKS
                     WAAEASHGESWRDIYSKIVEIKQMIKSEQASLEMKRERAVASGQSR"
     gene            complement(<762638..>762916)
                     /locus_tag="LMJF_36_1925"
                     /db_xref="GeneID:5655449"
     mRNA            complement(<762638..>762916)
                     /locus_tag="LMJF_36_1925"
                     /product="60S ribosomal protein L37a"
                     /transcript_id="XM_001686715.1"
                     /db_xref="GeneID:5655449"
     CDS             complement(762638..762916)
                     /locus_tag="LMJF_36_1925"
                     /codon_start=1
                     /product="60S ribosomal protein L37a"
                     /protein_id="XP_001686767.1"
                     /db_xref="GeneID:5655449"
                     /db_xref="GOA:Q4QC01"
                     /db_xref="InterPro:IPR002674"
                     /db_xref="InterPro:IPR011331"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="UniProtKB/TrEMBL:Q4QC01"
                     /translation="MAKRTVKMGVMGRYGTRYGANPRKRAKKLEVSQHAKHFCSFCGK
                     FAFRRKAVGIWRCDGCSKTVAGGAYTLSTPNNSTVRSTVRRLRELAKI"
     gene            complement(<765421..>766323)
                     /locus_tag="LMJF_36_1930"
                     /db_xref="GeneID:5655450"
     mRNA            complement(<765421..>766323)
                     /locus_tag="LMJF_36_1930"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686716.1"
                     /db_xref="GeneID:5655450"
     CDS             complement(765421..766323)
                     /locus_tag="LMJF_36_1930"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686768.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655450"
                     /db_xref="GOA:Q4Q1N0"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1N0"
                     /translation="MTSTSAPAVDFSCAICLDTATEPVVTRCGHLFCWECLDHWLHSA
                     AGAPECPVCKGRVDERMAGDIIPLYGKGRQQATKAGSGQGTVSAPVTTTAAATAATES
                     AATVSVSAQEAFFSRPSAYSFAPARDARRSAEASSQQQQPEQQPHHPRPNADRAPPRP
                     RPQQRHQFQNVHINRGGMPLTMGSGIFFFGGGTGVLFSILVVAIWTLYHYAPWREWVQ
                     VSAHWYNRLRGHPEPANTSQAEHEATTDRPTRARTPPAAARPASAASSMEDPTNDASP
                     PTIVRHLIISLFLVFILIQLLAYV"
     gene            complement(<770331..>771830)
                     /gene="NT2"
                     /locus_tag="LMJF_36_1940"
                     /db_xref="GeneID:5655451"
     mRNA            complement(<770331..>771830)
                     /gene="NT2"
                     /locus_tag="LMJF_36_1940"
                     /product="inosine-guanosine transporter"
                     /transcript_id="XM_001686717.1"
                     /db_xref="GeneID:5655451"
     CDS             complement(770331..771830)
                     /gene="NT2"
                     /locus_tag="LMJF_36_1940"
                     /codon_start=1
                     /product="inosine-guanosine transporter"
                     /protein_id="XP_001686769.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655451"
                     /db_xref="GOA:Q4Q1M9"
                     /db_xref="InterPro:IPR002259"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1M9"
                     /translation="MTGQSAALQGSNSALPWYRMGFHTLAEFNTYATFVLLGMSIMMV
                     TSAVTSAPDFVTKYFIYATGDPDAVAEAPLFWNNANTFYNAGTYAMQVVTEIASLTPF
                     MRSIPLGIRLFLGLGIPFVELVVIIAVPAATISSQNGAIAVIMVVAVMGGLSKALCDS
                     CTNALVGPFPTKFMNGAQWGLTVIALLMSIIQIILQVSMGSTFQDVLTISRIYFGIGI
                     GIQVMAIVALVLLRYNPFAQKYIAEFRAAALRRRGHVEADDLQDSKEPATGDVAEAPK
                     AGEKEVAADDTEETDEVRAVPSDAFVVKSGAVLQATGDADQMVDLDQTKNITSTEQML
                     RASVWSVFKRIYPMLLCAFTIFFTTLLVFPGVFFLVPARSGWYMTIIVTLFNAGDFVA
                     RVLLMIRVLRPSPKLVIVGTFGRLAVIPLIVLCVRGFIPGVTLPYILIFLFGLTNGYF
                     GTMSCIHCPRTPTLHYAGERSVAAMLSGISLMLGLCFGSNLSLAITLTY"
     gene            complement(<772867..>775911)
                     /locus_tag="LMJF_36_1950"
                     /db_xref="GeneID:5655452"
     mRNA            complement(<772867..>775911)
                     /locus_tag="LMJF_36_1950"
                     /product="putative mismatch repair protein MSH8"
                     /transcript_id="XM_001686718.1"
                     /db_xref="GeneID:5655452"
     CDS             complement(772867..775911)
                     /locus_tag="LMJF_36_1950"
                     /codon_start=1
                     /product="putative mismatch repair protein MSH8"
                     /protein_id="XP_001686770.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655452"
                     /db_xref="GOA:Q4Q1M8"
                     /db_xref="InterPro:IPR000432"
                     /db_xref="InterPro:IPR007695"
                     /db_xref="InterPro:IPR007696"
                     /db_xref="InterPro:IPR015536"
                     /db_xref="InterPro:IPR016151"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1M8"
                     /translation="MVLVNGQVDVNSVGFTYPFLEGIDPTAPPSTISIPHKYLDAMAN
                     MERQYWDIKSKHYNVVIFFKKGKFYELYDYDAVIANREFGLKMVLDTSNRGKMRLAGV
                     PEQSYNEWARLFVYRGYKVGRVEQMKESESEAQAAKTKVVPRELVEVLTPGTLKDPSM
                     LSDHREVFVLSLAPVCRDGELVIDAFAVDLSLRIAYRCPCSSRNREAKTGCDTISSEL
                     SIKRENGVCGSLKDSTLRTLSALLQQLSPKEVIIPSSDWVPKDAERRQAFEHTCDEIT
                     KWTESEGFSVEHISSRALQSLSMTAMVTAEQVMASYFTFLRLASDIAIFSTATEYTAH
                     LSGAIGADSGTAASDATLNMAASGKTSIMAYERRFDKGLVLDATTVSNLEVLTNLHDG
                     SDKHSLNECLNRCSTNGGRRLFRSWLLRPSASSRVIAARQDAVRFLARYNLLHSLRDM
                     EVSEQVGEKRSRSNEGLSLFSSVVSVDFERFLSRLSDIKQNDSRNIAYVDPMVQYKKN
                     LGIILSSVQALSAMVGWGKQFLARCREVACEQGTGIPALLGELLEEVTTAEASSKRIE
                     GLFDRQAAEESSLLIPSPGTSSVFDAATAKLRHVESKLHDVRRQLQQDVFRGAQAHFT
                     DLGKDLFLIEVAVADAPKMTPAGMVERARNAKSVKYVVSSIEALVGAHKEATAMKAGA
                     LLTVLCSVASRICDEFPHLFSASRALSYIDCLLSLAQLHQAFPTVSYPRLCTAHERDV
                     AVVRGWDMIHPLLTAKNPVANSLNLDDVEGRVLLLTGPNMAGKSTLMRTVALNVLLAQ
                     LGGPVLATKMELSPVDRVFTRIGARDASHKGQSTLYVELSETADILHSASARSLCLVD
                     ELGRGTSTHDGMAIAYATLHALATAKPAAPLTIFSTHYHSLAMEQARTATPTPTGAHA
                     SAVQLGYMDFVLKSETAAAFADEETNDTRRSCAPGSCVSNVVFLYRLVRGICARSYGV
                     EVAVMAGIPHTLVQLAKAKSEALSRETAFHEDVRGIENFIRV"
     gene            complement(<777530..>778681)
                     /locus_tag="LMJF_36_1955"
                     /db_xref="GeneID:12982072"
     mRNA            complement(<777530..>778681)
                     /locus_tag="LMJF_36_1955"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003722888.1"
                     /db_xref="GeneID:12982072"
     CDS             complement(777530..778681)
                     /locus_tag="LMJF_36_1955"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003722936.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1955"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1955"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982072"
                     /db_xref="InterPro:IPR006571"
                     /db_xref="UniProtKB/TrEMBL:E9AG16"
                     /translation="MSCSRWGLFSYIYICIYIYTYIHIYIYIYIYMHIYVDIYACLTV
                     SSLPEQLLLRLFPHAGLPSMGQSFNTPPPGSDGNECDDCSAKEDAKVYHMPPDLPSPE
                     IVGVNDADKGVLALTPKLAARLADALPPSCRCGAFSGVTRWYLLYSSFLHGKSFQRLV
                     QCIISRGPTIIVIKVKDSPRVLGAFCESDWLTVAQREKNAKSAAAACVRATREGQKQR
                     ATAAPENQSNTFFGNVNCFVFRAYADGTDDVSTEGEIYHPHSSMNSNFMYLFDTHPLE
                     EKIGIGMGGQPGYYGWFIDRWLENGASHGARCTTFRNPRLSSTESWVVESVEVYAVKK
                     DIVEQLLRTGSNRTSGVSCVNDNPDSKADQMLLELNGTHEFNHRDHTEC"
     gene            <779754..>780497
                     /gene="PMM"
                     /locus_tag="LMJF_36_1960"
                     /db_xref="GeneID:5655453"
     mRNA            <779754..>780497
                     /gene="PMM"
                     /locus_tag="LMJF_36_1960"
                     /product="putative phosphomannomutase"
                     /transcript_id="XM_001686719.1"
                     /db_xref="GeneID:5655453"
     CDS             779754..780497
                     /gene="PMM"
                     /locus_tag="LMJF_36_1960"
                     /EC_number="5.4.2.8"
                     /codon_start=1
                     /product="putative phosphomannomutase"
                     /protein_id="XP_001686771.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655453"
                     /db_xref="GOA:Q4Q1M7"
                     /db_xref="InterPro:IPR005002"
                     /db_xref="InterPro:IPR006379"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1M7"
                     /translation="MTSKVILLFDVDGTLTPPRNPETQDMKETLAKARAAGFKLGVVG
                     GSDFAKQKEQLGDSILEDFDYVFSENGLLAYKDGTEFHRNSLLKALGNEKVVAFVKKC
                     LHLIADLDIPVQRGTFVEFRNGMFNVSPIGRNCSQQERDEFEQLDKERHIREKLIRNL
                     KEAFPDYPLAYSVGGQISFDVFPKGWDKTYCLQFVENDFEKIHFFGDKTSEGGNDYEI
                     YTDCRTIGHSVKTYKDTIAILEALLEESR"
     gene            <781112..>782005
                     /locus_tag="LMJF_36_1970"
                     /db_xref="GeneID:5655454"
     mRNA            <781112..>782005
                     /locus_tag="LMJF_36_1970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686720.1"
                     /db_xref="GeneID:5655454"
     CDS             781112..782005
                     /locus_tag="LMJF_36_1970"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686772.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655454"
                     /db_xref="GOA:Q4Q1M6"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="InterPro:IPR027450"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1M6"
                     /translation="MDEHSSACSCAGIRFCAKCRGSSRVQQLFNGSVPLSSARSVIEK
                     QQDNERLSSCSFAVIGKSSLSFCIECASVFKSEVPIKSCADHQGAVATGITISGLAVF
                     RDTLTEEDETAVIRFLDDSRPFPPWKESQSGRRKQDYGPKRNFKKKKIKVAEIPGMPL
                     VFESVFAVISSMVETFTGKAYRIAEVSALEYMEGKMSNFDPHVDDTWLWGDRIAGLNL
                     NEACAVTFVNPEGVCCDVYLPRRAFFLMSGNCRYRWMHGIRPEHVRGRRISLTFRELS
                     DEILVDTKASEMVLSAASHFV"
     gene            <782393..>783616
                     /locus_tag="LMJF_36_1980"
                     /db_xref="GeneID:5655455"
     mRNA            <782393..>783616
                     /locus_tag="LMJF_36_1980"
                     /product="putative serine/threonine protein phosphatase 2B
                     catalytic subunit A2"
                     /transcript_id="XM_001686721.1"
                     /db_xref="GeneID:5655455"
     CDS             782393..783616
                     /locus_tag="LMJF_36_1980"
                     /EC_number="3.1.3.16"
                     /codon_start=1
                     /product="putative serine/threonine protein phosphatase 2B
                     catalytic subunit A2"
                     /protein_id="XP_001686773.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655455"
                     /db_xref="GOA:Q4Q1M5"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1M5"
                     /translation="MSQANMKCSAVGGRNLNGTPVERSTLLSDGKLSLESIMLQFLCG
                     EQLRLEYAMEIVQQAALVLRTEPNTLSINDTVVVVGDVQGQYYDLVKILAACGSLDTT
                     NYLFLGNYIGNGGFNLECILFLLAAKVAHPQSILLIRGSNESKFMADVLQLGKECQLK
                     YSSTLLTQILSVFNCLPLAAIIRKKFFCVHSGLSPDVSHVDDIALIHRFRHIPTRGAM
                     CDMVWSEPDWDTNNQLYNNVEEPSGETYVPRLGLFETRPLFITNKQRGLSYVFNFACA
                     KRFVSANNLLCIIRAHEVHELGFKLYRPHPNHLFPCIISLFSAPNYCSSFGNKGAVLV
                     VSKETICFKQFDSSPHPCVLQGRNAFSWSLPFLESNLMSIFLTLLSGSDYDPTVADRS
                     EKGSSNGEGCVTPLT"
     gene            <784015..>784515
                     /locus_tag="LMJF_36_1990"
                     /db_xref="GeneID:5655456"
     mRNA            <784015..>784515
                     /locus_tag="LMJF_36_1990"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686722.1"
                     /db_xref="GeneID:5655456"
     CDS             784015..784515
                     /locus_tag="LMJF_36_1990"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686774.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.1990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.1990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655456"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1M4"
                     /translation="MRYTGISFLFVFISLIFSIHAFLSLRLPLHSQACRLTSTQKPAL
                     LRFGKGSSSICRAARVLRFWPFSMTESAEALQRRINHAIENQMAPPEANYISELLAAS
                     LALDNSNEQLRLLDYRWQTYLDKQYVQSQRLDEFLEGLVQHLLKKKPDRPLEELLLYL
                     ECERRQ"
     gene            <788830..>792666
                     /locus_tag="LMJF_36_2000"
                     /db_xref="GeneID:5655457"
     mRNA            <788830..>792666
                     /locus_tag="LMJF_36_2000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686723.1"
                     /db_xref="GeneID:5655457"
     CDS             788830..792666
                     /locus_tag="LMJF_36_2000"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686775.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655457"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1M3"
                     /translation="MSDTSLDFLLSEILSPDNVQRAAAEKELERRGLEVPGFCFSLAR
                     YCRTLMGNQSSHAVALVALAVLKRSVTASDRAEELEQVVSSLLSDLTDIAALPGGAAA
                     AMRQWSSTVCTTVRRLAVLCASPTAAPAAGQATTGAITAQLLGAFDQYPNADASGLLS
                     VFSHVWLLRTMFEEPVPELMHAWCAELLLNCAPPLFEILCAGTAATLSMASSDSSAFA
                     ADSPEVYARCSLLTLIAQTLAALYEWQFASSGRKRFPAELKQHFLSAYPLLQSFMCTP
                     CARWLSVCVGATSSASALPCAQARAANFAAASLAALEYVSSVLQLGGWYKRCVSAQLF
                     QALLQSLEADAACYGVALCVDVEEEAESLTASAGWTGWPHTGSGGGEQGDDASSHSWT
                     TVVRRRATQCWSLFLDAALLPFLKVGLVDVVGYQCGLQYYKLLLAYAVPSPVDVGSWL
                     HDPNTFLREEEEREDRVRWSTRNTVAQLYADSIAALGPLFLHASLEDLHERLLAPIPD
                     NDGRTCGDGQTSLAYDGTVMLTASQQQREAALFFMETVLKHRSRQLRECGAVDFTPLA
                     THLWSNDVASASAHPGLTARTLMLIAAIVRFTHATLVATEPAASADAAAATNTEAAAE
                     GFMATVVADSTHALSLFTGTSKETIAASSSSCTPLVAVLLCRVLQRTLPYWSDVLLAQ
                     HSVAWQVSLLALLSSEAGLTDEALYNTVEQLTDLLKISRAARKKSAQPHYGRVSTAAA
                     APPMLDALPRTVMDCWRRHVSDPNLADAVLGLLRHVVRDGESGASFVLQELPWINGVL
                     SGFAESTAELCAVPYFLHLLKCLFEHAPDEVANCAAAMMLDSLCQLLLCTEESAILGV
                     SSSCLAALLRRCLAVQSVQVRVVAATVEAAMAGGATTDEGGLSGAVGTTARLADAPRT
                     VYPFATVIVAFVLRTLAGRLDEASLMDVGDTLVAIMQKYTSFSEAELIRIIHATVRRL
                     SIVRTDTIAQQLLAPLATLMALHPAALLRTLTQGGFLVETMSRWLPRVEHFSNLRATF
                     VSCEGLLKMLSCLSQPSSSPMLTAEEAQQMAQQPVTCRWLLPEELTESNKGSRKASRR
                     GSKGGSAAATRRVILSSLTPGTSVETSLPLYAGVLVGVGRGLLALLAAPPAVLWRASQ
                     AAGDTATPGTGIGAGVFPSDEDGDDSNGLFRGDSVDGSDPEAEDTWEEDVDSFSDDET
                     QGDARELEAPDINAYSPETTDRQRLLRPMGAQMLPWMQTHGAEVASFFTLQEAQTLTS
                     FFTSCAASGECGPSAA"
     gene            <793740..>794843
                     /locus_tag="LMJF_36_2010"
                     /db_xref="GeneID:5655458"
     mRNA            <793740..>794843
                     /locus_tag="LMJF_36_2010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686724.1"
                     /db_xref="GeneID:5655458"
     CDS             793740..794843
                     /locus_tag="LMJF_36_2010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686776.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655458"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1M2"
                     /translation="MRLHAGNHSPVIRPGARAGAHDGVTASVFSEVHLAAASPPSSAP
                     FRPAHGTDRQGLVRGRTVPTVVDAPHDSRFPLSLEIEGVQTGEEVVVDVPSVRQRSST
                     SSISNDTAQLQRLRRQLEKVTADLKAAVNTNRRQKQAHQQQREKWLVLSNESDARLLN
                     VQSNQESRERLLCSELRDAIAHLLGEFKAQALKERAADQAHAGDKAEWDAKHAVLLSE
                     LEAARAALATQVTAANSADTHKEEADQLRAELEALRRSSGDQQRSFEEKIMQTQSALQ
                     AKQSELNRYLQERDQHNYLVAQCRLFIQQVCQPGFSVVKGPSLEPVETQRPEPTGFVL
                     VPLAVLLHGYALLPEGDRQALIDHYDGKAKSLK"
     gene            <795457..>797154
                     /locus_tag="LMJF_36_2020"
                     /db_xref="GeneID:5655459"
     mRNA            <795457..>797154
                     /locus_tag="LMJF_36_2020"
                     /product="chaperonin HSP60, mitochondrial precursor"
                     /transcript_id="XM_001686725.1"
                     /db_xref="GeneID:5655459"
     CDS             795457..797154
                     /locus_tag="LMJF_36_2020"
                     /codon_start=1
                     /product="chaperonin HSP60, mitochondrial precursor"
                     /protein_id="XP_001686777.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655459"
                     /db_xref="GOA:Q4Q1M1"
                     /db_xref="InterPro:IPR001844"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR018370"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1M1"
                     /translation="MLRSAVCLAGKDVRFGEEARRSMQKGVTRAVAAVATTLGPKGRN
                     VIIEQAYGAPKITKDGVTVAKAIEFKDRFENMGAQLVRQVCNQTNDLAGDGTTTSAVL
                     VDSIFGEGLKCIAQGTNPIDMKRGMDVAVHYVQTSLLKQSRPIKGTEDIVRVATISAN
                     GDKEIGEMIGQAMDKVGRDGVITAQDGKTMATELEVVEGMKIERGFLSPYFVTDAKVQ
                     KAELEDLNVLVSKKKISTIQTLLPALNHVAQQGRPLLIIADDVESEALTTLIFNKLQG
                     KLKVCCVKAPGFGDTKEGMLEDIAVFTGAKVVGDENTGVELDARSFDPSILGSAKKVT
                     VTKDDTVMLNGGGDAAAVKERQQLLRDRIEQEAVEYNREKLQERLAKLSGGVAVIKVG
                     GGSEVEVSEKKDRVVDAVCSTRAAVQEGIVAGGGTALLRASKELEALANDGSLTRDQR
                     TGVTIVRNAIRLPAMKIAANAGKEGAVIVEKVLEASEESTGYDAQNDKYVNMFEAGII
                     DPTRVVRVAISDATSVASLMMTAEAAIVEAPKESKAKNGKRSAAAETEDDEELFGSY"
     gene            <799749..>801437
                     /locus_tag="LMJF_36_2030"
                     /db_xref="GeneID:5655460"
     mRNA            <799749..>801437
                     /locus_tag="LMJF_36_2030"
                     /product="chaperonin HSP60, mitochondrial precursor"
                     /transcript_id="XM_001686726.1"
                     /db_xref="GeneID:5655460"
     CDS             799749..801437
                     /locus_tag="LMJF_36_2030"
                     /codon_start=1
                     /product="chaperonin HSP60, mitochondrial precursor"
                     /protein_id="XP_001686778.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655460"
                     /db_xref="GOA:Q4Q1M0"
                     /db_xref="InterPro:IPR001844"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR018370"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1M0"
                     /translation="MLRSAVCLAGKDVRFSDKARRSMQKGVTRAVAAVATTLGPKGRN
                     VIIEQAYGAPKITKDGVTVAKAIEFKDRFENMGAQLVRQVCNKTNDLAGDGTTTSAVL
                     VDSIFGEGLKCIAQGTNPIDMKRGMDRAVEVILKSVAKQSRPIKGSEDIVQVATISAN
                     GDKEIGEMIGQAMDKVGRDGVITAQDGKTMATELEVVEGMSVDRGYVSPYFVTDAKAQ
                     KAELEDALVLMSAKKIQSIHSLLPALNHVVRSGRPLLIIADDVESEALTTLIFNKLQG
                     KLKVCCVKAPGFGDNKTAMLQDMSVFTGAQLVGDEGTGLELDAENFDPSILGSVKKVT
                     VTKDDTVMLNGGGDAAAVKERVELLRELIKNETSDYNRDKLKERLAKLSGGVAVIKVG
                     GGSEVEVNEKKDRIEDALCSTRAAVQEGIVAGGGTALLRASKELEALANDGSLTRDQR
                     TGVTIVRNAIRLPAMTIAANAGKEGAVIVEKVLEASEESTGYDAQNDKYVNMFEAGII
                     DPTRVVRVAISDATSVASLMMTAEAAIVELPKDDSAAAPMGDMGGMGGMGGMGF"
     gene            <805406..>807454
                     /locus_tag="LMJF_36_2035"
                     /db_xref="GeneID:5655461"
     mRNA            <805406..>807454
                     /locus_tag="LMJF_36_2035"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686727.1"
                     /db_xref="GeneID:5655461"
     CDS             805406..807454
                     /locus_tag="LMJF_36_2035"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686779.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2035"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2035"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655461"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1L9"
                     /translation="MRNPTDMGTAVASQSPTDVLRPSTSVETMMSLTVPAASSRQSTS
                     SWLPTRLTSSYCVLSAAGLQEDFYTSCLSWGTNQIALALQEDLVLFHPSHPRQASSTA
                     RISTPPALGEADSNTGTGSSAAFSGPRRATAVAMTRFQETSCFLGMSNGAVELYEGRG
                     DGTLQRTVAFAMPPPPTGYLSSLVLGSEDCGGAASPTSRAARALCLLRSSVSSISCVG
                     TSSRHPWLGSAATAARGLITLDARQVQPAIRFGTDAELSRDEGAPRSSSVSASDSSAV
                     SGGLSKLQRAASFLRKHDRLCSVSWNATGSLVATGSGSGIVKVWSLSAPQRPLHTFLV
                     DQDCSVKALCFHPGSPYVLLVGASAGAAGLRTYDLSGAEPVLTSTGATAAPVTQALYD
                     PEGNYAVTGAGVPLSPVSSSLPPPPFPVLAAHAELGATGGGSGSGFHEHGTGWHRSSS
                     TRPSATSSSSAIGASGGATLLHDSWGEMEMPASPLSATLDTTAGLAGALASESSGNSA
                     AAHSAPPNALVVWRCGTRLRENYLRDALLQRSDRRRNSTGGRDDFARHGDDASDDDSD
                     DVAQVDCLARGGLRDSTVVADDGHSSDIGYPRSEWMPMYALPGHRARPLLICAPFPQS
                     PFAGCYASIAGGEDGTIRFWRFFETTSDATHWQHRRQAQQQSATTQEDMDLLATPVLR
                     "
     gene            <809726..>811069
                     /gene="ALG3"
                     /locus_tag="LMJF_36_2040"
                     /db_xref="GeneID:5655462"
     mRNA            <809726..>811069
                     /gene="ALG3"
                     /locus_tag="LMJF_36_2040"
                     /product="putative
                     dolichyl-P-Man:GDP-Man5GlcNAc2-PP-dolichyl
                     alpha-1,3-mannosyltransferase"
                     /transcript_id="XM_001686728.1"
                     /db_xref="GeneID:5655462"
     CDS             809726..811069
                     /gene="ALG3"
                     /locus_tag="LMJF_36_2040"
                     /EC_number="2.4.1.130"
                     /codon_start=1
                     /product="putative
                     dolichyl-P-Man:GDP-Man5GlcNAc2-PP-dolichyl
                     alpha-1,3-mannosyltransferase"
                     /protein_id="XP_001686780.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655462"
                     /db_xref="GOA:Q4Q1L8"
                     /db_xref="InterPro:IPR007873"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1L8"
                     /translation="MRFMDVALAAEAVVIITVILTVPYTEIDWKAYMEEVEGFLAGEL
                     DYRNLKGGTGPLVYPGGFVWVYSVLYYLTKKGEAIELAQWIYAGVYLVTLTIILRLYT
                     RSGLTWKTMIPLFVSKRIRSLYVLRLFNDCWAMLFLFAAVSFIAGRPSGAAKRSRQWF
                     IGCLCYSIAVSIKMNVLLFAPGMLYVMLRTLPFGRVAWYLLVCAAWQVAAGLPFLAYD
                     YRAYLSKSFELDRVFLQRWSVNYQFLNAEIFVKPEFGQALLAMTVATWVLLWRTRWAA
                     RTYLTDAEAQVLHPAISDTRRQNTPLRRGTADGDETMDDEAQEQAVYAATLLTFFEAN
                     LVGVIFARSIHYQFYTWFFYMVPFVLAYTTFPRVLRLVSFALIRQGFESFPPTPKTSM
                     MLQGGFALTLFAFLFLGREARPAATREEAHPTRDNEPKLPQTQGTADATGGEKIR"
     gene            <813976..>816672
                     /locus_tag="LMJF_36_2050"
                     /db_xref="GeneID:5655463"
     mRNA            <813976..>816672
                     /locus_tag="LMJF_36_2050"
                     /product="putative serine/threonine protein phosphatase"
                     /transcript_id="XM_001686729.1"
                     /db_xref="GeneID:5655463"
     CDS             813976..816672
                     /locus_tag="LMJF_36_2050"
                     /EC_number="3.1.3.16"
                     /codon_start=1
                     /product="putative serine/threonine protein phosphatase"
                     /protein_id="XP_001686781.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655463"
                     /db_xref="GOA:Q4Q1L7"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1L7"
                     /translation="MPSFFLFGRKKDKKKKTRDGATDEGDAATPSLTARENSNGSKES
                     ATKHGKGSTTSHDAAGGSTPPGLDTPPADASGPATETSPPLLPSTKQRSYSKNTMQEL
                     PPPPPSAPPATNSPSLRASAVHLTLHHSTLNDAPVSTPRSVDLFPRELSEVTIPQLTE
                     VFQVFRTFLDNCTSTEVKQKSVSQLRQVLPEIAAVDTTVSAERIKAQNFHPTFSIEPI
                     LNHLLAQPAPLRARLCLAIYRFCGELCEELEGDLLCQETGLFSGLQCMNPNLRPAADG
                     NYGISGDPRQASLFGGSFTENGTAKIERCPDIDLPKIYNSLLHKEDYLPSAEELNEIF
                     LRVQELLRVEPNVVMVAMPAVLVGDLHGQIRDLLENVLTLGGPLVSNEALALASPKSH
                     AAKSKAPTSKKSGKAAGAAKTFSGAPKGDENRPTQPPNYLFLGDYVDRGPSSLSVIAL
                     LFTAKLLSPNTVFLLRGNHECPNTNRFYGFLDECHRSYPIVNHKVITLHMCARSASEE
                     NTDGAAANRSGNSSPGANSTCKGDSGALSTIDTNSSVEPTAAGMGRHLGRDCEASPDD
                     MGWDMKDHPLWLVANDALCSLPLCAALYEEVEDDDRAALPPAPTAAASNTEDMLAADG
                     TENPVAASKAKKSTKAKAVKKSTRCSIGNASFAESFKSPNLVAGKSPTLTDGNARTTS
                     NKAASTSTEPSPLSPPSASAFVAKPKKTRQVVRVSAMHGGLSPFIDDSFDGIIAIYRF
                     RNIEHGALADLTWSDPSSSAAADGATASDSRANESQPPLSKFQSACVFNGAPIGFTGN
                     PRGTGHIFGEDATIDFINTNHLYFIVRAHQCVQEGFQWNHKDRLLTVFSAPNYCGMRN
                     KGAVLLLDKNGAPTLKQYAHTEAEEKSHATTTGAPQPPRLFS"
     gene            <817741..>819261
                     /locus_tag="LMJF_36_2060"
                     /db_xref="GeneID:5655464"
     mRNA            <817741..>819261
                     /locus_tag="LMJF_36_2060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686730.1"
                     /db_xref="GeneID:5655464"
     CDS             817741..819261
                     /locus_tag="LMJF_36_2060"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686782.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655464"
                     /db_xref="InterPro:IPR002763"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1L6"
                     /translation="MLGAQAVPSFLLALASSSSAPQCTQPQQLIECRPHDTLVQHSPY
                     GPSRNTTYGWGNLFQPPMTATVPGHPCIHIGISSLNGVPTVGKSDRSMRSLLTQYRKK
                     FNCLEHCHPYHKVGDAGTWKAWADMVRNSNVADGGRIHSLETVSAPPPHTVEGAAAAG
                     VASAGATPLCPLAVNANRFLYTIKANNLLTHVKQLQMDDADVLAHVQVFFQERCPLLE
                     PFLGPVLVQLPPSFGYSAANVQRLTRLHQLLSQEEVLLLEATSVSPTAFSSSGTSSTP
                     APSSSAPRSQRRLRVAVEFRSRSWYRDETFALLRSFRWALVVAHHHDDPTYSQVIDTG
                     AGFLYVRLHGPLGRNVGDYGPLAMRLWAEKMVQYLHSERSPTDGDASSAVPGETTREV
                     FIFLNNSDSNVGGTTSSVVDATCLAEQMRNLLQCTSSRPPPAKTAAASPSPHVSAEPQ
                     PVVACVEAETSMAVPEDDCRASVAQHVRDEAVTPPPKRQRTAQRSSGTREDEIVID"
     gene            <820688..>821680
                     /locus_tag="LMJF_36_2070"
                     /db_xref="GeneID:5655465"
     mRNA            <820688..>821680
                     /locus_tag="LMJF_36_2070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686731.1"
                     /db_xref="GeneID:5655465"
     CDS             820688..821680
                     /locus_tag="LMJF_36_2070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686783.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655465"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1L5"
                     /translation="MTEKPAKEPPLPRDLKAQFDVLAGTRWDGVGDDADAAEQLSQLR
                     QEWKALGNACYGKGYFLAAIRCYSRLLEVPGGDTAQIRSNRSAAYLQSPMLVGPSLAL
                     KDAEKAVELDPQWFKAHLRVGDAHRKRGHFAEAEAAYREALARQPECATALAGLRALQ
                     VESAGLPAAAATFPRGHAERTPYHNAPPSPRSLSSRTTAHAVAVAQAKEEELQLTQEQ
                     LVHKWKADISTREGRTGCRPRQASLSQADRQHGAAIKQALLARFRDKLESNGEFSAIL
                     RNRCEEAMLRGEGINYRDADKLRNTYSHATNGIGLGISSDAYKEYTGRVDHRTW"
     gene            <825651..>829517
                     /locus_tag="LMJF_36_2080"
                     /db_xref="GeneID:5655466"
     mRNA            <825651..>829517
                     /locus_tag="LMJF_36_2080"
                     /product="streptococcal hemagglutinin-like protein"
                     /transcript_id="XM_001686732.1"
                     /db_xref="GeneID:5655466"
     CDS             825651..829517
                     /locus_tag="LMJF_36_2080"
                     /codon_start=1
                     /product="streptococcal hemagglutinin-like protein"
                     /protein_id="XP_001686784.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655466"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1L4"
                     /translation="MRITAATATAPVGAPGAKVRKGKAKTIRAVAAAGAVWRPQSQLI
                     FTSNATSVTAPSNGELGDSKTAGAISTNGSINGYTGTSSALALKAAGTGGSGSCGVAS
                     VLPIPTAPSSGSAQVPPLPSSGCAAVENQILRNDALEAVRRSGAEGFPPSREKGVVSC
                     TLPAAEKQRRVSDIARANELSTDNPNTFTPAEVPPWVAGGAPVDASKAADTGGGASAA
                     SFEGVMDNSPFVSSSSLAPSDTGCTQRTKASHADQRPSATQRCDNGAFAERPQLLLSL
                     AQDNRGFLNPGYSCDSSDWSSEDSDASSGRAGADGSAGSARRQRTPSAAPSSRAAPSE
                     QRGKACGGAPPPVLTTRLSSGRNRTALAVFPLTAAEEQSARQAYDTYRAQQEKAGYHR
                     SDTSATKLRSQRSASVSPSALSTSTSVGKRELLRLLHGLYHRAQAMMASTTKTAAPTS
                     APPQRKAMSPTMSVGTADLLHKFPSTKYLLNAAEACFGSRRFRTLMAAVVADSDALVP
                     IVVRNNDGGASAVPTASRSRLSSSSQGLTVEEALSFFRHLKHEMTSDVARHRERRQAE
                     ASAKPEAASGDKRRNRPAKAAPLQPLLDLQGSQKTRSTSAPSCQAASQVCRLPSAQAG
                     RRSGRPPPTPIALMAARHVTSASFPPSSTPPSPSPQLSSSPSRPGIPGAMTLVGPRKP
                     TGRRKGPRRKTALPPPSPHPFGSNSCTPDATYMDDFIHTYVQRKAFAEIAEGQGFHDS
                     TTVTLGKLIKVLHWFELALDPSVIEHLCGVQVQPARESPDISIDFSTFVKIINSGLWC
                     QRYSGGSGSSAPGSTSADNNDDPESNACVPVLPPEAPARASPVALPIPGLTAADSASL
                     STGGGGAPCAKAASSTISVRDIGGSNPSPLVLAPVSAAAHRRLSSLSSMSTSTASSPA
                     SGGSMHRSFVDTDDAYPLVAHDSAIAALCRSIRQRLRRELRRSVSSGSNALLRPRDNQ
                     GSGNGAGDGAAQKEGSDPQYSPSSRTAPASSCSWRSLSLASSAASSMSRGNVSVAGLV
                     GESESASARDDGEVFSASPHFSKWRSDTKCSTPLSHQRLREQQSPSPHVGHRLPPHSH
                     PYTLTPTPRAPRAQPARRGEGAVASQWFPTAQRWQGHGHRLAAPPPARPATAQRPSLS
                     TAVARRCRRHQESMHFITSLSPYSNSGHGARRSASHCWSRIATLSALSRSRRSSSLHS
                     CDTQSVVNSFQFSESGLSAAFLSRTLPAQTVSRHPKRNRPSSAYTRLTTAPTHDACTA
                     HVSHPPLSPAIRSSPLPYRRRLFQAC"
     gene            <833679..>836495
                     /locus_tag="LMJF_36_2090"
                     /db_xref="GeneID:5655467"
     mRNA            <833679..>836495
                     /locus_tag="LMJF_36_2090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686733.1"
                     /db_xref="GeneID:5655467"
     CDS             833679..836495
                     /locus_tag="LMJF_36_2090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686785.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655467"
                     /db_xref="InterPro:IPR024224"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1L3"
                     /translation="MSIRFDLDIGPKIEFVSPPDAITEEGKVKLLRCAFPDCNPDCGY
                     NFIFYFTMPDCTTAAAQSFSQTVAPPTTGNTVPELYGAAFYRQKHDPNVPRCYVQQVL
                     VLLSHLPYYNVHEIILRVVAPRFCQCCPLSPDTGKVPVSSSLIPVPEAYFEFDQSYSA
                     EHYTQEGVLSDAMAELAQWPSPHPQTRYTVTLLQQALVFITPAHSQRQSSRATRSSCA
                     SVRSAMSVDKRVEFMEVARGSPRHRASALGSDFLPLFRLLGEQLHHLTHVWELLIRHE
                     PLFILSNTPCMASAAAFSIASLVLPIEFSGTLRSYFTVQNEDFPRLSRMGKVLSFPTN
                     EGLIVAGTNPFLLRSFSGWPSLMVVMDGNTSIMVNGSIASPPPSAMAGAIPPLPQASP
                     LRSQRSGACTAVSLASSLLRATLPGGPIAKTSPRPPLNGAHARTASGQEPLSVAMCSS
                     NSTTSLGSGSTSAHQHNSLGAPVTVVPSSFSSFNGNGDVFADVASRKPIVSSASSNTV
                     DLPATYNVESPTYISPFASSTSRDSARRVEAAQQAQRSEDGSPAGEHASTCALGESPA
                     QPSSGVSSHAERFSHGREYARLGSSDATLAAAAHLAPAPITMPSPVDFSVTLFTTDHY
                     KTAVESVRAAEHERRGSANHDDSRKSLQQRLHNYFDSSVHFLLNHEEQTQMLLKRLQM
                     VSLLDEDAQRASVSLSLSHWHGNPRTVSSPTTSSKGLLFASPTPPLSSANTNSASGHC
                     ADPAAATNGITSCSHFSVADDMVRKFFTSLTSEFLTPVTAWFQRVTAPYTAFHLCDRA
                     FCDTLLTPSSFLDDFAQRHRETAPSMWTQRHSYKTYKVVYERFAYGCLFKAYVLQLVD
                     GSLRQQMEDFQVEDWVTRVPSDAERIDLLINLFNTVQRELNETLDPDVLFVTSATSVL
                     ASMAVVLQQPHREQFMLKIGELKL"
     gene            <837416..>838531
                     /locus_tag="LMJF_36_2100"
                     /db_xref="GeneID:5655468"
     mRNA            <837416..>838531
                     /locus_tag="LMJF_36_2100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686734.1"
                     /db_xref="GeneID:5655468"
     CDS             837416..838531
                     /locus_tag="LMJF_36_2100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686786.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655468"
                     /db_xref="GOA:Q4Q1L2"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1L2"
                     /translation="MLSEEEQATLLKYYSTVKLHETQMDQLAQAYWAATREERGEIAK
                     VYAHTFVDPTFVQRLIFFHDYRMSLTAAGAGLSSSTGAAVGTGSSFAGQQSGSESANS
                     PLMAGPPSSFMAESPTTAANHAPRRTHAQHLLRSTIQEHFPKLTGPGPYALQFGCVQS
                     EKEREEVIELYSSQFLHPDPPELHRIVALPSSFSTRTRKRISGSYSWYLRCLATQELV
                     CAVTVTVHQQETIRFAEMPLFATGVGYKKNGFGRLLNAALLAWCAEVGLEFIMISADV
                     QAIPFWRHLGYRAMTRGEKNRIDFFYQHDCCKFKGAETMIGYCNVDRGNGSLSGGVGR
                     RAFHSGGSTEVLHRSVRQVLAQLPRFVVEGPAKLPTE"
     gene            <840111..>840971
                     /locus_tag="LMJF_36_2110"
                     /db_xref="GeneID:5655469"
     mRNA            <840111..>840971
                     /locus_tag="LMJF_36_2110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686735.1"
                     /db_xref="GeneID:5655469"
     CDS             840111..840971
                     /locus_tag="LMJF_36_2110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686787.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655469"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR015399"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1L1"
                     /translation="MNAMTDTEVVQYVLQNKSNYYKVLMVGTDATDAQIKVAYKKMAL
                     KCHPDKNKHKQAADAFKLVGTAHTTLSDATKRSIYDRHGAEGVQRHESGGARRSANGA
                     GVYRHRPAGQRDFFEEFFFGNGYHANGQGVHPGAGGARYQAEVNINPNALLFVPIVVF
                     LLVAMLLSSSYTDVDASNPLFGGGLRGAGMAGTSFSFTASQNEGFVVQRTTSLYGLRV
                     PYYTTPRMSEMIDRRKEVYLSMEQKVLETWRDSLGRRCEAESLKYRSRGRNEVPPVCG
                     DYQHFRRALG"
     gene            <844367..>846346
                     /locus_tag="LMJF_36_2115"
                     /db_xref="GeneID:5655470"
     mRNA            <844367..>846346
                     /locus_tag="LMJF_36_2115"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686736.1"
                     /db_xref="GeneID:5655470"
     CDS             844367..846346
                     /locus_tag="LMJF_36_2115"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686788.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2115"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2115"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655470"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1L0"
                     /translation="MPLSPLIRPMSPLQTQCAPSLPEPYSLADIVLQPFSAAASSTPA
                     GAWDEDTSFVAVTGAIAPELRRSSPTAPLSGVDAASVPPMAMWTPAIPPLLPHTLAPT
                     FHSMVGDALSVEMLRESYAAQLQKGCQYRSVVEGPRCTSDGAAARARTCSGSDAGAAE
                     VFAANDAVHVGHSRRAPLPSLALSSPIHPYVSGPTAHTRVAPKTPAEELSSAATSSSL
                     LHSAATTAMAAARPSYGAALLRKHPPAQPTGRREGCRLHLPAQKQVQRSSSQSLFERR
                     IHDRWEVVSPTSPLSSCGGASTAAESSETGPSKPNITVPFTASATCYHGTAASDCTGR
                     SHAISIAAPPVVKKGGGAAATNTPAGCGARVSNSGVVSALGQAKVEAFGTLPCYAPDS
                     ACGSGEVGDTFFDPPHGLSRKARQTIQPGPATEPVRKPAAQNQGKAARGTAPTTRSSG
                     GAASGPATGSAASRAAEFHLPRYVYPALEECRRLLHEIRIASPLMHRCLTPPRPLEGS
                     SGGGSGAATAASAPSTFSPARAPSRNIPAPPYSSVFPSLAAAATAAAPPKPAILAPKP
                     EARRLYHWDAATAAEDLSFMRGPFQQSSERFAASVNCQLRRLQALGTRLYGKTHDMST
                     SQAEVHAAARGRWSLPSPTPLTSRWDSAVPHFDDD"
     gene            <848091..>852692
                     /locus_tag="LMJF_36_2120"
                     /db_xref="GeneID:5655471"
     mRNA            <848091..>852692
                     /locus_tag="LMJF_36_2120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686737.1"
                     /db_xref="GeneID:5655471"
     CDS             848091..852692
                     /locus_tag="LMJF_36_2120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686789.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655471"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1K9"
                     /translation="MEAIMSSPLLQRGPLQQPPPPSPSGSHSLQEEVEEHHQQLMQRS
                     FEGVPLPEPFSFTGSTESTVADIKHGSSGDGRHDGKWRLEYGDDNTKSSPALFGCHDY
                     DGAHNEDADDMSMVCEQGEADCSLGSAPHQAEMRTAHWPLCKRGETEEGQEKAWGVIS
                     ARQRTSSAPRRGAGIGSYSCASSNAEAIADCSSSGGSPIPNSDGGRAALDRRELIRAE
                     GHPVVSEEEDKGDRYCGTPHSSSHGHNADCNGTAASQRFEHAAQQDLLLRTSRKLVYS
                     NSATMLSPTVVDTAVEGSDTAVTPVAAPTKSDGVHDDQDGVTAVPTVKRLEGAAVSHG
                     KLSPLYLAASDVNGASPSAHWACSALPCHNALQAPSAVEAPTLPSSSSAAHAKVVPLC
                     GSMEQGSGETANLQDTHRRLPPSASAPSEVDRVDAEIENAMLEMEKRLQRHCHHAGAA
                     TTGADSDGCVASHSSTPSLRRSEGDISKRAESDRMENQRAHPSSFSATHEAAADAASV
                     KSAHEEDWLARRRCKQAGVCDAEGVGAYRRGRALGEGAPAWASAAYTFFSSQLRPPED
                     RRGRIYELAKALREDGAHAALRGPGGGLLASPPADEQSPGRVEGAAPLRVPCAARGTS
                     VSLGDAVAGSADMAMFRSQSTPVPPVQGERFAPHQQEFTAAGLQVYYSRCSLSSGEKE
                     PRRCPRLSGSTLLGSSVVEGMPSAATAEGVSTAMAAAAALTVDSSGTSSCTPFTSRRQ
                     RPPPRMLCPPTPSPSPSPSRSTAMDAVLAAVANAEEGKESDAGVMEQSVFAEAAPGAE
                     PQLQPQSRNANVLPGQSSLEPCTVSLGVEAADTMPLEAATAAANPATLSPWQTLLWSS
                     SSAPTVPADTVVPAAASAVATTSAADVDSDAGVSVIRSSSSCLKRAVEGNDGADTGLQ
                     GELANREGALTEPRPEADTSVSVGDADGPLPLSPRCASSEPSKLQLHGGHTFASSAYR
                     ADSAPQHAGVVAANSASSLGCERAASGAASHHSASPPSAAVTAAVPLMRHDGAGEDSL
                     LLPICATSFPQGGQSTGRMSLPPSRRDGCGGAFSSWSTSSAACEGAGADNAVDVANDA
                     TDDGVQGHALTIRQSANTRKSPSTAVAEGEEHPQVPMRFLSSSAVSPSPIRPSTGGAS
                     GKERLHHELPILHWRAGGGGEVGGGQHDDADSSDEYNEAHLCCDDWASSPAEPAAAAA
                     TFQTRQSDTPDGLHVDSDDDDNADDDGGEDTAGQTWIEEALRRAEAKCAVLRLELTFA
                     TERAVAAEANARARERECAELHALASRMQAQLAAAQMTAEWATANTRADAEVQVAACT
                     ASLDDIAASAFSSPNSPNRLGTTSLSMRKGTALADGTVWRRRHDIVAQELATLKVSMA
                     EQLAVLDRLGMQPPFSEELVCAAERRLRHVKVAHAPGTAMKASQPDATIPGTPHTLTR
                     STCVDSAASADLSAGGASVTATTKKIQVRNGNKIAALLNLRKQNRHQEKPAAAAADAM
                     ATGVTDSATTPSTSAPPVKRDGSEDCRTTLDAKENHYVV"
     gene            <853926..>855647
                     /locus_tag="LMJF_36_2130"
                     /db_xref="GeneID:5655472"
     mRNA            <853926..>855647
                     /locus_tag="LMJF_36_2130"
                     /product="putative DEAD box RNA helicase"
                     /transcript_id="XM_001686738.1"
                     /db_xref="GeneID:5655472"
     CDS             853926..855647
                     /locus_tag="LMJF_36_2130"
                     /codon_start=1
                     /product="putative DEAD box RNA helicase"
                     /protein_id="XP_001686790.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655472"
                     /db_xref="GOA:Q4Q1K8"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1K8"
                     /translation="MAERNYSPFSGFSTTSRGGGGSGAHRKGSAEGLGSKLAPVNWST
                     KSLVPGKWKVVDASAIRKAASVKDDHGASKVKHLSDIEAEEWRQANSITVSDSDQCPN
                     PVTEFDMLTAVPQYLKAKLLAQGFTAPTPIQAQSWSIVLSGRDLVGVAKTGSGKTLAF
                     IVPALAHIALQEPLKVGDGPMVIVLAPTRELAQQIEQEAIKVLPQSIRCGCIYGGAPK
                     GPQLGLLRQGVHILVATPGRLIDFMEIKRVNLLRVTYLVMDEADRMLDMGFEPQVRAI
                     CGQIRPDRQTLMFSATWPREIQNLAASFQKNWVRINVGSMELLANKDVTQHFILTSEA
                     AKLDELKRLIERHRNQRVLIFCKTKKTADYLEFQLKRNGVDCMAIHGDKEQRQREFIL
                     ERFRKDPRLCVVATDVAARGLDIKELETVVNYDFPMQIDDYVHRIGRTGRAGAKGASF
                     TMITKHETQLNASTVFQLVELVERAGQEVPGWLREWAEQGGGYHVPKRNRNMMGSFGR
                     NGPRMRMPGDSPAAGTGSSGGHFGLAPHAKGSQAFGMTDSTIQNKKFDYSSDDDDSAR
                     PAKRARQ"
     gene            <859013..>860083
                     /locus_tag="LMJF_36_2140"
                     /db_xref="GeneID:5655473"
     mRNA            <859013..>860083
                     /locus_tag="LMJF_36_2140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686739.1"
                     /db_xref="GeneID:5655473"
     CDS             859013..860083
                     /locus_tag="LMJF_36_2140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686791.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655473"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1K7"
                     /translation="MLPASLSPIPHASGFAVAHTRTPIMGSLFLLIDIDNTLYEYSET
                     GFHHEMHDRIFAFAQQKVGLTAEQAECLSRKYWLNYGLSLYGYVKEYNVDAKEYSDFV
                     HQCSYDKLHYNKPLIDMLLIMQYAPEAARGHDGPRSTNIDHLYYFTNANHSHARNVLD
                     AQGLRPIFTRPRPVGLPVKENHPASEQAGAEDQVEWLGFSYEDQWQLTHPEIANKPMR
                     QAYEAIYKAIEDQVAEDAALVATTTTAGSGSAFASSSASRNSDIAEEVKNKRARLRPE
                     NFVMVDDSLMNIDAPLELGWSAVWYAHDTQELPTDVKDNASAPLYAAAVASGRLQVIR
                     NILELRAAVERIREVNSRSASS"
     gene            <861163..>861969
                     /locus_tag="LMJF_36_2150"
                     /db_xref="GeneID:5655474"
     mRNA            <861163..>861969
                     /locus_tag="LMJF_36_2150"
                     /product="putative ER--golgi transport protein erv25
                     precursor"
                     /transcript_id="XM_001686740.1"
                     /db_xref="GeneID:5655474"
     CDS             861163..861969
                     /locus_tag="LMJF_36_2150"
                     /codon_start=1
                     /product="putative ER--golgi transport protein erv25
                     precursor"
                     /protein_id="XP_001686792.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655474"
                     /db_xref="GOA:Q4Q1K6"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR015720"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1K6"
                     /translation="MMSSSNRGARVHWSLQGIPRLLLLLAGFAVALQATTSAQALTYH
                     FVDGKPLCFSEIIENVQTSQITGVYNWKPSAHSPASQVQLRLSAKDGTGNVYYDKEMM
                     EGEHSFAVQLHPNVLSGEQLICFTASSNFVASEDKPVKVSIELDQAPKNEFNADKVVV
                     ETIQKRRQIDGLDVYTYQEAGGELKDILQPRAYLETIDRELSATKRLLDQLVTNLGIS
                     VMKESRMRATSESTFTRVWVCALLLIGIISGVLWMQFRFLKSTLRKKKLL"
     gene            <865645..>866034
                     /locus_tag="LMJF_36_2160"
                     /db_xref="GeneID:5655475"
     mRNA            <865645..>866034
                     /locus_tag="LMJF_36_2160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686741.1"
                     /db_xref="GeneID:5655475"
     CDS             865645..866034
                     /locus_tag="LMJF_36_2160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686793.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655475"
                     /db_xref="GOA:Q4Q1K5"
                     /db_xref="InterPro:IPR001372"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1K5"
                     /translation="MADEEDYDFEVNKKETDKIERPERLIEVLQHDTNQTLTEEMVEH
                     AQAVLDFMPVEYTYKDVAAKLKCRLDGAYGGTWHVIVGKHFGANVTNDDDTLINMKIN
                     GVYFLAMRSGPPERPQESAENEAVTAE"
     gene            <867241..>869532
                     /locus_tag="LMJF_36_2170"
                     /db_xref="GeneID:5655476"
     mRNA            <867241..>869532
                     /locus_tag="LMJF_36_2170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686742.1"
                     /db_xref="GeneID:5655476"
     CDS             867241..869532
                     /locus_tag="LMJF_36_2170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686794.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655476"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="InterPro:IPR023267"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1K4"
                     /translation="MPAPKNKLKSFGKNRREIRSATTTYDEHGNWVGTPHQDKMRLVA
                     NKMFANYYDTLQQLGRVVARTVYPTSTDARVSSATSSCATAQDVSAGVAASLWMREME
                     LFRTPLLTTFWINDTDPLAAHVRAYMESLDPSLVEPISWYPIAGMGWRILADKAEFRK
                     RPEMQPLRQYLIRQTALGTISRQEEVSMIPPFLLDIQPNDVCLDMCASPGSKTAQMLV
                     ALGRHKVVPFNSDASPFPFQYDSDGLVIANELDTKRANMLVHQVKRLRLLFPFALFTN
                     HDARYFPEMSLQSQPGDADKTTAAGTEVLRFDKILCDVVCSGDGTLRKAPHIFKLWSP
                     KEAINLQKLQIEIALRACHLLRVGGRLVYSTCSLNPVENEAVVAQIVHRTRGAMRLVD
                     ARALLPQLACAPGMTRWTVTDAKGCVFPAPEGNMHEALFPPHTPGGYSSAAVDALDLS
                     LCMRLFPTHCKGGGFFVAVLDKVSEYRLKRLEAQKAEEKSAPAESTAEAATERQTIIG
                     STAPPKREKKEMHSVSSDGTEATADAGADALEGQLTTAHEPVKPKSLPPQFVGVPAEI
                     QRAITDFYEISQFPMQLLFVRTAQGERELRLTPGSVCSIVSRMAAQVLRHKTDNVLIV
                     SAGLRVIAFECLDKGWRIASESAVLFAKLMRRSSRLVRVPVSLIQDMVGSGGKLKEKL
                     LESVEDTRLRSRLERLPIGAFLLEIEAPKALGGVLYSVALRARSRIQLLVDHEDLEGV
                     QLRLGEDPVEPAEIPKAESADDA"
     gene            <871206..>872777
                     /locus_tag="LMJF_36_2180"
                     /db_xref="GeneID:5655477"
     mRNA            <871206..>872777
                     /locus_tag="LMJF_36_2180"
                     /product="protein-tyrosine phosphatase 1-like protein"
                     /transcript_id="XM_001686743.1"
                     /db_xref="GeneID:5655477"
     CDS             871206..872777
                     /locus_tag="LMJF_36_2180"
                     /EC_number="3.1.3.48"
                     /codon_start=1
                     /product="protein-tyrosine phosphatase 1-like protein"
                     /protein_id="XP_001686795.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655477"
                     /db_xref="GOA:Q4Q1K3"
                     /db_xref="InterPro:IPR000242"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1K3"
                     /translation="MSHDVSRVSRPSLLSNSSSRSTTEPPDASLQSAAATAAATPPPS
                     NTQTSGDDVAGSAEYTCGNYDLDGSTSTVDPLIDASCSKRERNPEFDMYKLPIEAQFN
                     LIEEEFAAIEASTMNPRLYNFTTSNANPTKNRYINVLANEETIFPPTSLTSAPPTTGG
                     SRLSTSGSPPSMASAPSPMKSLTGRAQKIWGVAGQRLFGTRRGGTLPRDVEGNEKFTT
                     GCVTKKYPQWYINANVVDTSVEPVFVASQAPVQECIDDFLAVIYSCEVTLVLMLTELE
                     EAGFVKADRYWPEDSAPADRIESFGSMCVYKDEQDPYTCDAAHELVRRSFYIRPSAAS
                     QARAHKIVMYQYVGWPDRGVPDSTESFEELLKIIQGYVMASPAPRVPAAGPESAAHSS
                     IATNSGGDGSTSNTGSGEGSGKLTPPVFVHCSAGIGRTGTLIGAYTAVKLTEAGLLTN
                     TSIRRIVTDMRKARFGMVQRVEQYMFLYMIVLQHMGVDARKFSARMQPRADLYNMRWM
                     EARQKALLGARAAKR"
     gene            <875333..>877093
                     /locus_tag="LMJF_36_2190"
                     /db_xref="GeneID:5655478"
     mRNA            <875333..>877093
                     /locus_tag="LMJF_36_2190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686744.1"
                     /db_xref="GeneID:5655478"
     CDS             875333..877093
                     /locus_tag="LMJF_36_2190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686796.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655478"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1K2"
                     /translation="MSNSVGACLPRAPVRGEGLGEGSATRPFAARRGLLPRPGVGDAS
                     TALQPQHSPNLASLQHAFRRLNRTTTASDEEAEQATFNCETEEDEDAVADDETGEEDG
                     GGGRGSVVQSDPLRVVVDFAEVRRVAARSKTAAAAAASSNGALQQAEEAEAMLTDAQK
                     GSESHQQAQQDNANRLGLEAERDARDVASARAFLEKRARADVHRRATQAATTPAPPSE
                     LLLDLLQHLPSTPGRAIYDRSSCPPTAAASGFNEDFHKCVQQLMTQIVLQRDGRAGDA
                     KPPSVSLADAAAAQQASASPRHRSRMQRKASKQKQKEGEVEQLVEAAERGIADDVRDV
                     VAYARFVMQERLHQEQRMGSERLSPPSKTAVGESEGSLCPDGDTQTPKQHQLLAELRA
                     VVEKKLSLMRAAAEATDKEAEPESATLRRKRAQSTGGSEDDADGIPGATDAARQDSKA
                     VFVAAHTRFMDVVRSSAANRREKVEAAQAAEQRLEATVASWRKSYDKLLTRELSRHRA
                     GKRPDKQSRTEALLQAMQPQQEKHQKRQHHQPPTDLWEMTKGMPKKERKHLNKLVKAA
                     ANVFPLPPFHYPPAPPHFSP"
     gene            <877698..>879629
                     /locus_tag="LMJF_36_2200"
                     /db_xref="GeneID:5655479"
     mRNA            <877698..>879629
                     /locus_tag="LMJF_36_2200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686745.1"
                     /db_xref="GeneID:5655479"
     CDS             877698..879629
                     /locus_tag="LMJF_36_2200"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686797.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655479"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1K1"
                     /translation="MEALFYDHAVASTATRQADLRQALQAFLADAASRSAVQLIALFV
                     HIPVPSTVSVASHTASGSRTSSRTSSSREGGSAAARHAATGKAASAASPSPPAASRRR
                     CNAAKLAWCAWEADRRLRQAAEDASEMNKWLAHDDLSASRKAGAGIARSYCRGAFVVA
                     VAFLAPCTRDDIVVYESWQRCTEMCAEASAADVARGSASRTTRMLSPLRHARLIALSL
                     GAPSLLLSWAERPTRCHLDSLLLPHQSLLVDLSWWVATASGSAGTVSDAAAGSRVSNS
                     VLRDIFISDVQRSLKLPKGDSRCAVWISYATLLESLHPQVMGRIDGADGDGVSVDMRV
                     AGSASRRKRGRNTLCGEFSGVDEQAFMMTYARIRHLLSSLNASQAGAVGHTRFLRVVL
                     SYGGPSSALRRQLVHTCSRTEHGVTAVDAALLRTRSLVDVHALFGVLAGQDTVNVYSE
                     AAAFVRTARRRASAGEAAQQRHQRIAVQSARVEVTSSPSSGPPGTEHEGVDSGAGNLC
                     HNAFVERGARALARRLRLWERKRLGKRGKRGVHVRPRDKAARRPMKRGHAGTNDADSE
                     RVLVHAVERASRAAATPKTGNKRRAEPLASVDGRPSASATRALLPPQKQRRTDAVAVS
                     PTLATDTALRWSEDVAGSG"
     gene            <880651..>882105
                     /locus_tag="LMJF_36_2210"
                     /db_xref="GeneID:5655480"
     mRNA            <880651..>882105
                     /locus_tag="LMJF_36_2210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686746.1"
                     /db_xref="GeneID:5655480"
     CDS             880651..882105
                     /locus_tag="LMJF_36_2210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686798.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655480"
                     /db_xref="GOA:Q4Q1K0"
                     /db_xref="InterPro:IPR007603"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1K0"
                     /translation="MSSGADAYGNGAHTQYPQAEPHYSGVGGPPVDGTPLYPEAASNP
                     VQAPRLSRFRIQGFKDVWATFVFAIFVIFSIVWSIVQLTTYHFDADPHSQSPFSGANG
                     PRVGYVVIACLASAVASVISSIVMLALMQRIPVHMIYVANIMTIFMFLASAVLAFLRI
                     NVVVGILMIICGVFQAVWLFLVRDRIPFAAALLRTAARLISTYKLTVVLNLMLCTLSF
                     GYITLWGYGVAAPVDRMYKDQANGGYMFVVAVLVFSMLWMSQVTPNVMHVTTSGLVAT
                     WYFAGSDNMPRNPTLASFKRATTTSFGSICFGSLVVAIIQFIRWLVESAGSDYENGFL
                     HCLLACILQCIERIVEYFNRYAFVHVAIYGCSYIEGAKRTFTLCKQCFFAAYFNDCLV
                     SPTLNMFTLAVSLVFALIAGVSSKSWPIGVLVFVVAVLVHSLFFVPVDSAVTTVFVCF
                     AECPEALRESDLQLYATIHAADANGTHNNAPPPL"
     gene            <884021..>885148
                     /locus_tag="LMJF_36_2220"
                     /db_xref="GeneID:5655481"
     mRNA            <884021..>885148
                     /locus_tag="LMJF_36_2220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686747.1"
                     /db_xref="GeneID:5655481"
     CDS             884021..885148
                     /locus_tag="LMJF_36_2220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686799.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655481"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1J9"
                     /translation="MFRGHTFLLSLAASPLTVVELTQNGGRVVYDLDDKTPVTCAIIA
                     SDNQPGTPAHSSRGSGPSKELPKSLESRVRSSRLTVVYEHWVHQCLRENRLLLPCQDY
                     PDTIAYDPYLFTGVHFTTTQLPLQLKANIIALMQFYGATYHNHLLDTTNLLVYSHMHL
                     SPAAPRHAATAPLALRLLAAGSREAEAPLSTKEMEAANTSPSQQLSAERSGDNSTEAA
                     QPSLTKLDVARQRGLACVTPQWVQLCLKTGELKPASSALAAAPLAQTPSPPSTNSSST
                     IRADAPVPIVTAADELRHHEEEVDRWVGEVLTSTPPLARPHSGGATTGVCAAPLPGPS
                     LCTVPGRQKEAAEVREALKLAAQLSLSGASASRIRKRRRAH"
     gene            <886920..>888599
                     /locus_tag="LMJF_36_2230"
                     /db_xref="GeneID:5655482"
     mRNA            <886920..>888599
                     /locus_tag="LMJF_36_2230"
                     /product="vacuolar protein sorting-associated protein
                     45-like protein"
                     /transcript_id="XM_001686748.1"
                     /db_xref="GeneID:5655482"
     CDS             886920..888599
                     /locus_tag="LMJF_36_2230"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein
                     45-like protein"
                     /protein_id="XP_001686800.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655482"
                     /db_xref="GOA:Q4Q1J8"
                     /db_xref="InterPro:IPR001619"
                     /db_xref="InterPro:IPR027482"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1J8"
                     /translation="MNRILPCDTNMKVLLVDDGALPMIATAFSQTELLKHGVYLVESL
                     NSAARQRNLMKMLRCYILLRPSLTSVEAACVELRMAKYRSYHIFFCGATSAEMLDRLA
                     NADNDSLVEEVQEVFCDFNAINKDAFVLETPPPQSLVSSFLSASQVRRLAEGLASLMV
                     AQRRRPRIRYQKNSPFVQRLASELVNVLKSDPELYDYPARDTVLLLLDRNDDPLTPLL
                     TPWTYQAMLHEHIGLRSNTLQLPADVQGAEKEGYVFSEHDDTFFANNMFNNWGDLCNN
                     VKRYVDQCKEALNLDRPTATLEELKAFMQKIPQTKSLTGSVTKHTTVTTYLSGVLKKR
                     NLLEISLLEQDMIASSDQSNHWTRLQSFASRPSTSQEDLTRLCLIYHLRYEKSRGTSQ
                     VAPYLDRVNSNYALLLSKLRQYYGLHRNTDRLFAATGVMAKIVKTFVDVGNIYTQHEP
                     VLKRTLQQLYSGQLDTAFYPYLEQLTSSSGGGGVANAEHKPMEVIVYMCGGYTFEEAA
                     LVHGINARTAYKPADAASFAAGGSSIKASIGGEAVLNTHSFLSLLDQLSPS"
     gene            <890931..>898682
                     /locus_tag="LMJF_36_2240"
                     /db_xref="GeneID:5655483"
     mRNA            <890931..>898682
                     /locus_tag="LMJF_36_2240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686749.1"
                     /db_xref="GeneID:5655483"
     CDS             890931..898682
                     /locus_tag="LMJF_36_2240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686801.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655483"
                     /db_xref="GOA:Q4Q1J7"
                     /db_xref="InterPro:IPR007259"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1J7"
                     /translation="MMSEADLVVLPSACSDNEPRSHGSYPDSPPVTSARRPAPLLPSG
                     AAYRAAPSTLVTAPGTQASVLNLVTALPLLLSLDRSHYTATLDNAQGGVLDIFTASGA
                     RGDGRLGPLSWTTITTDAATAAVRAVLYARGTPSWQAKRRRLRRLALDSFFRSTVSAR
                     ISVRRDCGAEGGDGVREAVVRLLHHTRAVMSDISPTQAHLVDLFAAQIMCGAQGAGAA
                     VEGLPRAAAGKATDEPTDAEGGQSLGAAPAPTAMMRERSKPAFEQRGIMKSSVSASTS
                     VTASPRHAQGENISTPASATVAEQLLYIILRTSIAANTPRRPLVMHGDDTPALLVDGL
                     HTPPPQGTDGATAVGSLTRKKPRLDSLDCIRPANLSSENGQSIYRYSNDAGGASPASA
                     LPYQPHCWLAPSTVALVERSQALRRHQRWTCDLDPVIEATIAGEGSSTHSSHLFRGAG
                     TRSAAVVSLLDSMRSSWAPLPGMADSDDAVVLTALVRGSGLPFATASTSAALGVAHEA
                     GPASHSCGFQWGQTMMGGEDPAVEALFADGRARRVHSHREEEDGIPGSEGATQTRQRE
                     ADAAAAALPACRIPFVSCLPLYNEVVYAQVHLALHWCAAGLADPFCLTHIDNTAGPNL
                     PALRVRDEFYARSLPANGGAGAAAAATAISGLASLLEWGCYYGTLLRRLHRLCDVADN
                     VTLRGTLGSYGRCAMSTLRLLLCLLQRQIGELGYQAGGPHRLSFPELLTAYQRLQRAV
                     EQVEVLAAFFGVPAAAAVPEAWDPVDVLEERCSSALLISRLYECFTAYHADALGQHGS
                     AATHYHALQQERLAQLLASLGSEDSEEVPLQANTPGGGVDQQRQKMRAALAAVESGTA
                     SPSVNTSPVDTGDSYGAWEQHRKDLLSYSIDAIGLLLRSTLRPLNAMLHRWLTAGELA
                     DPYDEFFVVPSHGQTHSGFTLEPSPQRLPVFLSVAAATDLLHAGVSLRVLRVAATHVV
                     LSAQKDARRLEGMAEVNEAAAEDYAGELLDTQTLRRAIEQFIKQLVHGAPTADAVHDM
                     GRSGTGANDEGEVTDAAPMPLPPRVDLLSSYGAINWWKEHYQACTRVLLEVVEEAANP
                     VEGSGEDGSTEATPDPSLWLHADEEEGLRSAEEASAAENEHVGGVTSSETHTGHAELS
                     LSGATAAPAVRDDHHRDRSPHVTAAFPSNESTSEAPSYITIFINSDDDEDRGAHSGMG
                     RAAGGRQGADSACIASSSSRSSTTATASVLGLRRIASSRFSTGTTVTSTASSRGTMAL
                     YGAITEELRQVSLLEQQTEADLGQCRHALRAELDAQLWRRRRDSRLSDWKAQRLALRL
                     RRVRAMEGIVEELRDVYMIRAAGHTEVQEPASRPIEEAEQDAAAREPSMAGPAMTEMR
                     IVVPLRQLPPRRVAPPVILYATPDDEYGVDGVTGGRRGSRLFPDRSRRTSFAAHPTIM
                     ELPATGARDTPQSCGQQRRSLSASILRTNNWPRTSGSPSLSARTARRVSAAAAGAGAV
                     TFIDPLSTGAAVQHSDGVGAGPGIIRQLRDVAPAALSTFGVMEKGNPVEPGQSTAAKL
                     TVPSASTPPPMPPSKSSHPRCEQVEAAMLREHVDMPAAVAADEAHAAAMRRDELGYAH
                     PDSLFRVADINDDEFLLMRTGPKGYARREAEAAALAELAERQAQLAACTVDEPGYLRQ
                     LAAAAAAAVSDPCRDSPKDSATLPNSGLSAKRRSRASIKTERDGAARDHRVDAADSAV
                     HVGGHTNLPLELDPAWQQDDPHRGSREARATMTRTKAMGKSFTDELWSWTATEAHHWY
                     FDDLVPLHHVLTGAEVDRALIVDVSLTCDEAEALQRCSGYYRALGQYTASFLTQKALQ
                     LTLLPPYGSLYCLTTQLLDVCLLQRAPIAVRLMDLWITLVDAALEMTAEAEEASMMQR
                     IISGETRLSALAALTDTRQGLNVTEALSSLNSAFQHEWATCVTNGESTVKLEWRLMSS
                     GGEGHERLSSVEEALGSDANFTEGDEAAEEGVRNVSSASRLPRQPTPLSQGSAEKASN
                     ESFPIHSFLASLSLTAASPWCSGAWLLPDHTLHCTGAIFRALLFWKSAERIVLHTWRA
                     GMDSGLSSVFFFCTTVRQVLLSSLQETVWVRLAELTAVYRESLRFEAGVLYTYRALES
                     FTIDHAAFLRECEFYTLCGPQFQCRVRPVLQAMVDTVEEAERALRFAQVSIRVARRQY
                     MATFRSLVSSASSSESDGDTGSDFCRQARGRPTVASAPQHVFTPSRWSRRARKRQSDG
                     KAPAGGSVAWASPWYLQPLEDALARHSEKLSPPEATSGRLADVDAPDTESEVDFDSAG
                     TPRRRAEKGRKGQAVTAERSPSSAVSSATTARFTTPVFDKSLLAVPGTAGGGEETYRE
                     GDSASTPTPRKKRRRGGSQPAGARQPTTATEAPMATTLRASATAQRSQTPKCSRSAGV
                     SVRQPPAPAKVSSSTVTGAAKTDTLAMKRPRRGRRQQRRMPSAERKERRCKLRAIAER
                     KIKEEVDHQRRLVRDMISRQLRRFAWLTQSLRNALADVIVEEDVKNMEDESIAAAATA
                     TSDGASLKSIKDLHKAQRQHMSRNTYISTILRKLDALIEVMATQV"
     gene            <899839..>900945
                     /locus_tag="LMJF_36_2250"
                     /db_xref="GeneID:5655484"
     mRNA            <899839..>900945
                     /locus_tag="LMJF_36_2250"
                     /product="putative developmentally regulated GTP-binding
                     protein 1"
                     /transcript_id="XM_001686750.1"
                     /db_xref="GeneID:5655484"
     CDS             899839..900945
                     /locus_tag="LMJF_36_2250"
                     /codon_start=1
                     /product="putative developmentally regulated GTP-binding
                     protein 1"
                     /protein_id="XP_001686802.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655484"
                     /db_xref="GOA:Q4Q1J6"
                     /db_xref="InterPro:IPR004095"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR006074"
                     /db_xref="InterPro:IPR012676"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1J6"
                     /translation="MSSLQKINDIEAELARTQKNKATMAHICALKARLAQLKRELIAS
                     ESKKGGGKGEGFDVQKTGDARIGFIGFPSVGKSTLLSKMTSTHSEVAAYEFTTLTCVP
                     GVVNYRGAKLQMLDLPGIIEGAKDGKGRGRQVIAVARTCSLILIVLDIAKPLQHKLII
                     ERELDGFGIRLNKSPPDIVIRKKDRGGISISSTCPLTHIDQETIKIILGEYRMANADV
                     TFRGDYTADEFIDAIEGNRAYIPAIYVLNKIDQISIEELDIVARIPHNCPISAHHEWN
                     LDGLLECIWDHLNFIRVYTKPKGQVPDYDAPVILKKSPQPSVESFCNRIHRQLIRNYK
                     YAWVWGSSVKHQPQRVGKDHSLDDEDVVQVVKKV"
     gene            <904028..>905017
                     /locus_tag="LMJF_36_2260"
                     /db_xref="GeneID:5655485"
     mRNA            <904028..>905017
                     /locus_tag="LMJF_36_2260"
                     /product="guanylate kinase-like protein"
                     /transcript_id="XM_001686751.1"
                     /db_xref="GeneID:5655485"
     CDS             904028..905017
                     /locus_tag="LMJF_36_2260"
                     /codon_start=1
                     /product="guanylate kinase-like protein"
                     /protein_id="XP_001686803.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655485"
                     /db_xref="GOA:Q4Q1J5"
                     /db_xref="InterPro:IPR008144"
                     /db_xref="InterPro:IPR008145"
                     /db_xref="InterPro:IPR020590"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1J5"
                     /translation="MSVAPKAPMPAISSVAAASAARKASQQAVGPLKGTVALRRLVDV
                     LLFVGPSGCGKSTVIRRLQRDWPTLFEFSVSHTTRCPRPGEVHGQHYYFVTMEEFQQL
                     VDAGHMIEYSRLCMPETSSSTPPLSKPVGNLYGTSKKALNTVLACNRVVLMDTDLLGA
                     INIRRYCSREVASTSPVTVSRAQRSIVQHDGGAAPAAQAPLTLSTPRHVAVSVENEHA
                     AVLMSAYSSKDSILSSSPSCAAPAVTRTLRCMIIFIAPPSMQVLEQRLRERKTETEAS
                     IQLRMTLNRQWMQWARENQSFFDHYIVNDHLDLCYAKVKEIVRAEVLMVESTL"
     gene            <906375..>907760
                     /locus_tag="LMJF_36_2270"
                     /db_xref="GeneID:5655486"
     mRNA            <906375..>907760
                     /locus_tag="LMJF_36_2270"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686752.1"
                     /db_xref="GeneID:5655486"
     CDS             906375..907760
                     /locus_tag="LMJF_36_2270"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686804.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655486"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1J4"
                     /translation="MAEAKVVKDLAEVCASGAETYSAWTTAKALVQRRYLSAKAQGTF
                     EDCGKLLASLTRVLQTYLRIDLAQELLSDVLFQVMEHFSAKQAAGATAAVVKDGGAPQ
                     SSFDLAAANFLQHMFDTLLSATTRTYTLMGPMPLVVEWNRDADSGGVEAAVAQSKHAA
                     PWAEAVVLEFAVRAADFLSQRPQSADVLSHWAQNLFVSYEQLLALRLALPSSPPSTPQ
                     DGKAASAAAPSPSVPVPTLASQLLRMSTFNRASRTGKESSDSTSAATTPLTAAVYWLT
                     HFAREPNAVNHLFAQYVYFDILGRGQQRSSTANTTPGNSGAPAKMLRERVNAALEERC
                     TLTRREAISMARAAVEAYWQAFPLVLQQTSSVSSPQPSSCAGESSKEDANVDPQDVHL
                     YRWTWFLDSLTLTFAYSGSASASIDEDAAVQQRERQKHVCAQLLELYADVTAELPGLK
                     WQELVAAYIGA"
     gene            <908857..>910344
                     /locus_tag="LMJF_36_2280"
                     /db_xref="GeneID:5655487"
     mRNA            <908857..>910344
                     /locus_tag="LMJF_36_2280"
                     /product="putative Bardet-Biedl syndrome 4 protein homolog
                     (BBS4-like protein 4)"
                     /transcript_id="XM_001686753.1"
                     /db_xref="GeneID:5655487"
     CDS             908857..910344
                     /locus_tag="LMJF_36_2280"
                     /codon_start=1
                     /product="putative Bardet-Biedl syndrome 4 protein homolog
                     (BBS4-like protein 4)"
                     /protein_id="XP_001686805.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655487"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1J3"
                     /translation="MQTIGGRKPDVAPLSEMGSSRNGLGTELGATVASPHRDSSASAA
                     STAANAQQKLVQELQAIRERRNWLIHLLYVRQEYSNCLQVIEAQLRETGGTCEYALYV
                     KGLLKRLEGSLSESLELLQTAVIISPENAATRTQLGRALHLLGRHEEAIQAFQEAASI
                     RVVKGLGADWAIEYYIGLCHLHRRHYRRAMDAFLQSITIQRHDCAYLQLGKAALLAHD
                     YATALQVYDEAVTLSPTNPDLLAMLGHLYLQQGNPCAAFDYLGRCLTISPTHIDALVA
                     ASSIIQDSGDYDVALSKYRIVVAQQPDSAQVWNNIGACFIGKKMTYAAVACLRKSVFL
                     CPFDWIGHYNLGVAFLMIGRYCSALQCLNAAVHLHADHAPAFMLLGICLGEMKDLPNA
                     CRAYEHALAMQDDFLVYLNYAVTLYKGRSVQEAYSKFRVFRNVWDQLTPEQRREQSSL
                     IPGVIRQLEDLLEPPPEPPMSTSDAVPEESAAAALATAPNPESLP"
     gene            <912965..>914395
                     /locus_tag="LMJF_36_2290"
                     /db_xref="GeneID:5655488"
     mRNA            <912965..>914395
                     /locus_tag="LMJF_36_2290"
                     /product="putative serine/threonine protein kinase"
                     /transcript_id="XM_001686754.1"
                     /db_xref="GeneID:5655488"
     CDS             912965..914395
                     /locus_tag="LMJF_36_2290"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative serine/threonine protein kinase"
                     /protein_id="XP_001686806.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655488"
                     /db_xref="GOA:Q4Q1J2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1J2"
                     /translation="MRMPSVFTAPSTYMADLEVGAATAYHVHSEAAMAGESDTCKPAA
                     TTASPRPPMTPHAEDADARNGVELSISSTAVAPAYQLRGELGRGQYGCVYLVEECVRH
                     HLLAVKATYNPIQVAALRERQRRQERQQQKPSKGSVGCVREAALSPYAPHEEDHAAVP
                     FLPQMPHFSNEVMCLRECHSPFIVRLEGVDKGENGEDLLLMEYVDCGDLRREIRRRRA
                     TDTPFTETEAVFVFLQLCMAVDHLHQLNILHHDLKPENVMLSSTGIIKLGDFGFAKKY
                     TEPVSQRVASTGCGTPYYLSPEALRGDRYSLKSEMWALGVILYELLALTGPFAAATRA
                     ELRAKVHSSHYAKLPATYSNELRSVCYQLLTLDPDQRPSTRDLFQDNEYLREKLNALR
                     RISECSVNMSTEAKGSMFHSISAALRRKPPSAKGPATASFNLGWGGSCKISSHGQGSA
                     RPEAAPKPRVERPAEMTPVARARRVC"
     gene            <926759..>928195
                     /locus_tag="LMJF_36_2300"
                     /db_xref="GeneID:5655489"
     mRNA            <926759..>928195
                     /locus_tag="LMJF_36_2300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686755.1"
                     /db_xref="GeneID:5655489"
     CDS             926759..928195
                     /locus_tag="LMJF_36_2300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686807.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655489"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1J1"
                     /translation="MEEGAPANATASLPPSYETVLAFLTTLAQWLKHARERLTCRDEV
                     GRHAIAVEALTRHRERAYEQLTESVWRHTAAAGDMSTSLLPSASVELTAWVLLRLLVL
                     LLTWWLLMRLVRATTLPRLRARQIAVHPHVHLPTSVGSAQVVEAFIHPDAAQRGINAT
                     LLLTVSACVSVACLLILCLLAMHVWVDVVLLRLLQHWTAPLWQAQTWLASHVLWPSNS
                     SPQGSLQAPATPVEQYATSFISVVSGLNSSLFHKLAWLRRLTQQVKLMYLWGMVGGTM
                     LGVVLWLLGYSSTLLRTYNASLPYFEENDPLLRWLAQQEAEAAQQRTNAAFAALLESQ
                     HRQERVMERLASSLAPATPRERQRYLQMTEEGAGSHCFVEDAALASATSDATEDERRN
                     GETAAGGADAVIINNGCSGDGNAGKLRVASGPSPDSDLAAAFEVAASATRGEGAAEAS
                     CGTTPQAEEEGAATTALRMAKEGESPGS"
     gene            <929190..>930167
                     /locus_tag="LMJF_36_2310"
                     /db_xref="GeneID:5655490"
     mRNA            <929190..>930167
                     /locus_tag="LMJF_36_2310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686756.1"
                     /db_xref="GeneID:5655490"
     CDS             929190..930167
                     /locus_tag="LMJF_36_2310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686808.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655490"
                     /db_xref="GOA:Q4Q1J0"
                     /db_xref="InterPro:IPR001648"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1J0"
                     /translation="MNRIPAATRNAPMYATAMSQFAVCRQPWNEYISLLTKDDAQPFH
                     TTPQEKPAYRGRKRGREGWLFGQQVQLHYHRFPDEQLFTNLTRWRMGDTVGDVAIQQF
                     RNAQPFDIEDKDPQGFQRPAPEVYMKLNYKNPATISRFLTRTGHMYPQDIMPLNPEAV
                     VKLRVAKAQAIRIGLYPRFGNPFWFRSQSFRPKAYQENYDPTTYSTKHTMEHFAYNWV
                     QTDRIRQYFKGLEELHQSRRATASSGGGGVTSEHKQQSQLYALDNMSIEMHRNAPSYR
                     ADVERSIKKPTVPGLMSTKGMKKKFHNLYSSTSTKRMGFSNPTLGIKKV"
     gene            <931395..>932630
                     /locus_tag="LMJF_36_2320"
                     /db_xref="GeneID:5655491"
     mRNA            <931395..>932630
                     /locus_tag="LMJF_36_2320"
                     /product="glucokinase"
                     /transcript_id="XM_001686757.1"
                     /db_xref="GeneID:5655491"
     CDS             931395..932630
                     /locus_tag="LMJF_36_2320"
                     /EC_number="2.7.1.2"
                     /codon_start=1
                     /product="glucokinase"
                     /protein_id="XP_001686809.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655491"
                     /db_xref="GOA:Q4Q1I9"
                     /db_xref="InterPro:IPR003836"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1I9"
                     /translation="MPLTDEIQLEQLAPTIKGDASWSTGPIYVVCDVGGTNARVGFAR
                     AAQHEGSGLHIIYVRFRVTKRDIRQLLEFFDEVLQHLKKNLPYRAGPFLRRVASGAVS
                     VPGPLTNGQLAGPFSNLKGIARLADYPVELFPRGRSALLNDLEAGSYGVLALSNAGML
                     SDYFKVMWKGTQWDALSEGKPVGSTIGHGRCMVVAPGTGVGSSLIHYVGVSDSYVVLA
                     LECGCLSMSWCANEDSKYVQALAGYMASKARVKGLDSTVAPIWEAAANGSGLEFNYAY
                     EKEGPKASAPLKSAPEVAKLAKAGSDPAAVAAMDRLYKNLIGLTAETTMQFLPLTCVL
                     MGDSIVSNSFYFDNPENVKKLQARINEHTMERQLKFLSRTTFLRQVRSVNINLLGCLE
                     FGSQLSNRADQLAPTKSNL"
     gene            <934541..>935725
                     /locus_tag="LMJF_36_2330"
                     /db_xref="GeneID:5655492"
     mRNA            <934541..>935725
                     /locus_tag="LMJF_36_2330"
                     /product="putative endonuclease V"
                     /transcript_id="XM_001686758.1"
                     /db_xref="GeneID:5655492"
     CDS             934541..935725
                     /locus_tag="LMJF_36_2330"
                     /codon_start=1
                     /product="putative endonuclease V"
                     /protein_id="XP_001686810.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655492"
                     /db_xref="GOA:Q4Q1I8"
                     /db_xref="InterPro:IPR007581"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1I8"
                     /translation="MGEKPPQQQCPASKDAADALGRSAEAHALNAPPSAVAPHPSEET
                     RRAWEAEQLRVGLLADVPRTEYYYCRHLSNHGNSTVQLHAPHNEGAAPGGVFVHQRFA
                     LPNFEASLLARPQACATDNSAAHDADSTLCVPSSFSSPWEALWCQLRFDKARQSAAAV
                     VQPLPTLTLVGGVDISFIPDSDDGVACLAILRYPSMEQVRAYMHRCTLREPYMSGFLS
                     FREIQPFCELFDSVRVELLATQTMPQLLIVDGNGVQHPRRCGLATHLGVALDIPTIGC
                     SKKMLQVDGLTREAVEAALETLGEAASSSPSLPRLLPLLGTSSPTQLYGYVVHGHLNS
                     VKKCIYVSPGHCVGFAVATALVVTMLRHRIPEPIRAADLGSRAYIRDALSSAATTSSH
                     PT"
     gene            <936286..>937515
                     /locus_tag="LMJF_36_2340"
                     /db_xref="GeneID:5655493"
     mRNA            <936286..>937515
                     /locus_tag="LMJF_36_2340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686759.1"
                     /db_xref="GeneID:5655493"
     CDS             936286..937515
                     /locus_tag="LMJF_36_2340"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686811.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655493"
                     /db_xref="GOA:Q4Q1I7"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1I7"
                     /translation="MILLAFICGALWVIWSVASFLMYRPRQISGATVVVTGACTEMGR
                     RLCMQLYARGARVIAWDYSKIKLQELQADVLKATKEAESLDAAGLPDGGRAAGSFHSG
                     AFVVMTVDVSSRLQVQRAAKELDGPLDMIVHAAHTYPSKRLCDRADDSAERLIQTNLL
                     SPLMVVRQLLPLLLSASNSSSNAGGLHKAAQRRGDYAQVVTLVSAAANYTLSSDSPEY
                     AASQWGMVGMHYSMREWIFQQRCEYMTGSGSGAPSETKTTAAAGSRTRRPAREVRTTL
                     LCLNEIQYGVPTVMNSLMSSSPGVSTTVRATSPTMSSSSAVSPESEEGGSIGSRGWSA
                     STYRDSYTQLLQKRNVELDKAAACCVRAICRGQERYCYTSAWATTVVYPLLMACPVPW
                     AIRLLRWIQHTPAAAEN"
     gene            939192..940190
                     /locus_tag="LMJF_36_2350"
                     /pseudo
                     /db_xref="GeneID:12982073"
     misc_feature    939192..940190
                     /locus_tag="LMJF_36_2350"
                     /pseudo
                     /db_xref="GeneID:12982073"
     gene            941562..941633
                     /gene="LM36Cs1H2.1"
                     /locus_tag="LMJF_36_snoRNA0058"
                     /db_xref="GeneID:12982074"
     ncRNA           941562..941633
                     /ncRNA_class="snoRNA"
                     /gene="LM36Cs1H2.1"
                     /locus_tag="LMJF_36_snoRNA0058"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461160.1"
                     /db_xref="GeneID:12982074"
     gene            941675..941744
                     /gene="LM36Cs1H3.1"
                     /locus_tag="LMJF_36_snoRNA0078"
                     /db_xref="GeneID:12983049"
     ncRNA           941675..941744
                     /ncRNA_class="snoRNA"
                     /gene="LM36Cs1H3.1"
                     /locus_tag="LMJF_36_snoRNA0078"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461180.1"
                     /db_xref="GeneID:12983049"
     gene            941765..941832
                     /gene="LM36Cs1H4.1"
                     /locus_tag="LMJF_36_snoRNA0072"
                     /db_xref="GeneID:12983051"
     ncRNA           941765..941832
                     /ncRNA_class="snoRNA"
                     /gene="LM36Cs1H4.1"
                     /locus_tag="LMJF_36_snoRNA0072"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461174.1"
                     /db_xref="GeneID:12983051"
     gene            942201..942298
                     /gene="LM36Cs1C1.1"
                     /locus_tag="LMJF_36_snoRNA0062"
                     /db_xref="GeneID:12983053"
     ncRNA           942201..942298
                     /ncRNA_class="snoRNA"
                     /gene="LM36Cs1C1.1"
                     /locus_tag="LMJF_36_snoRNA0062"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461164.1"
                     /db_xref="GeneID:12983053"
     gene            942323..942414
                     /gene="LM36Cs1C2.1"
                     /locus_tag="LMJF_36_snoRNA0084"
                     /db_xref="GeneID:12983044"
     ncRNA           942323..942414
                     /ncRNA_class="snoRNA"
                     /gene="LM36Cs1C2.1"
                     /locus_tag="LMJF_36_snoRNA0084"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461186.1"
                     /db_xref="GeneID:12983044"
     gene            942466..942540
                     /gene="LM36Cs1H1.1"
                     /locus_tag="LMJF_36_snoRNA0086"
                     /db_xref="GeneID:12983046"
     ncRNA           942466..942540
                     /ncRNA_class="snoRNA"
                     /gene="LM36Cs1H1.1"
                     /locus_tag="LMJF_36_snoRNA0086"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461188.1"
                     /db_xref="GeneID:12983046"
     gene            942660..942767
                     /gene="LM36Cs1C3.1"
                     /locus_tag="LMJF_36_snoRNA0071"
                     /db_xref="GeneID:12983048"
     ncRNA           942660..942767
                     /ncRNA_class="snoRNA"
                     /gene="LM36Cs1C3.1"
                     /locus_tag="LMJF_36_snoRNA0071"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461173.1"
                     /db_xref="GeneID:12983048"
     gene            942792..942863
                     /gene="LM36Cs1H2.2"
                     /locus_tag="LMJF_36_snoRNA0059"
                     /db_xref="GeneID:12983047"
     ncRNA           942792..942863
                     /ncRNA_class="snoRNA"
                     /gene="LM36Cs1H2.2"
                     /locus_tag="LMJF_36_snoRNA0059"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461161.1"
                     /db_xref="GeneID:12983047"
     gene            942905..942974
                     /gene="LM36Cs1H3.2"
                     /locus_tag="LMJF_36_snoRNA0079"
                     /db_xref="GeneID:12983050"
     ncRNA           942905..942974
                     /ncRNA_class="snoRNA"
                     /gene="LM36Cs1H3.2"
                     /locus_tag="LMJF_36_snoRNA0079"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461181.1"
                     /db_xref="GeneID:12983050"
     gene            942995..943062
                     /gene="LM36Cs1H4.2"
                     /locus_tag="LMJF_36_snoRNA0073"
                     /db_xref="GeneID:12983052"
     ncRNA           942995..943062
                     /ncRNA_class="snoRNA"
                     /gene="LM36Cs1H4.2"
                     /locus_tag="LMJF_36_snoRNA0073"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461175.1"
                     /db_xref="GeneID:12983052"
     gene            943431..943528
                     /gene="LM36Cs1C1.2"
                     /locus_tag="LMJF_36_snoRNA0063"
                     /db_xref="GeneID:12983054"
     ncRNA           943431..943528
                     /ncRNA_class="snoRNA"
                     /gene="LM36Cs1C1.2"
                     /locus_tag="LMJF_36_snoRNA0063"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461165.1"
                     /db_xref="GeneID:12983054"
     gene            943553..943644
                     /gene="LM36Cs1C2.2"
                     /locus_tag="LMJF_36_snoRNA0085"
                     /db_xref="GeneID:12983045"
     ncRNA           943553..943644
                     /ncRNA_class="snoRNA"
                     /gene="LM36Cs1C2.2"
                     /locus_tag="LMJF_36_snoRNA0085"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461187.1"
                     /db_xref="GeneID:12983045"
     gene            <944761..>946104
                     /gene="TAT"
                     /locus_tag="LMJF_36_2360"
                     /db_xref="GeneID:5655508"
     mRNA            <944761..>946104
                     /gene="TAT"
                     /locus_tag="LMJF_36_2360"
                     /product="tyrosine aminotransferase"
                     /transcript_id="XM_001686761.1"
                     /db_xref="GeneID:5655508"
     CDS             944761..946104
                     /gene="TAT"
                     /locus_tag="LMJF_36_2360"
                     /EC_number="2.6.1.5"
                     /codon_start=1
                     /product="tyrosine aminotransferase"
                     /protein_id="XP_001686813.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655508"
                     /db_xref="GOA:Q4Q1I5"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR005958"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR021178"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1I5"
                     /translation="MTIDAQAAPAAQALKASNSTGSLTEERREVEQRVAENASFRRIT
                     SSKHAQRTLQPLNNLADNMKPSRSTKSNLRLSIGDPTVDGNLKIPEIVTEAVVDVVRS
                     GEFNGYPPTVGADNLRQVVSTYWRRFCQTKSRQEALKWENVIITSGVSQAIVLALTAL
                     CNEGDNILVCAPSFPHYKSVCESYGIECRYYYLDPSKSWECDLRSAAGAVDRHTKAFV
                     IINPSNPCGSNFSRAHVSDIIDFCQHHQIPLISDEIYAEMVLNNGIFTSVADFDTSVP
                     RLILGGTAKYQVCPGWRVGWSILIDPMNVAGDWAVGMERLTQLIAGVNSICQEAIART
                     LLKCPTECTEHIVTQLEAGAKVYARLLEHDIGISMDAPQASMFVMLKLNLSYFQDLKS
                     DMEFYEKLLDEENVQVLPGEIFGMSGFIRATISRPSAVLNEAVDRIIEFCERHKK"
     gene            <957077..>959941
                     /locus_tag="LMJF_36_2370"
                     /db_xref="GeneID:5655509"
     mRNA            <957077..>959941
                     /locus_tag="LMJF_36_2370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686762.1"
                     /db_xref="GeneID:5655509"
     CDS             957077..959941
                     /locus_tag="LMJF_36_2370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686814.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655509"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1I4"
                     /translation="MFSLNIKTAASTSSAAPTPAPGVNAGEAPWATIDVDEADSFEST
                     PSTNSSGNQSGRHHYQHAAQPSHSPQSPETPIKFDHGVYPHCPIFIPSKGRSDLDRST
                     MAVLVRDLVPFVLVVEREEAEGYRAMLDRLVGQYFGFAGMTFAASVDDGIEGATKTGA
                     GVVESSSTTPADLWAFPCACCCGSTSVAGSPSSPTTPGLSADALRALALRLSAAFHHG
                     YVFEPTSAAAGNHHGAVESKNVSPPVSISPTTPSAASGGARRPSAAFVLRNVDEVRAL
                     FVIEVLPETNRGVSYVRNYILQVLVPRLMVACGVDRSGNVEELRLCGPGEHNTLTPAA
                     LRMAALEPDVYSALEWKSETESYLDVRRASTTTNMVTASTGSAAGTKDGGVSASVGAL
                     SAPTGQTLAPALSSSSAPRSSTASSAAAATRGTPRLLHGLFGFYWVLDDDIYGFYQSH
                     GSSTKNERISTRTMMREVEVRLRQLRHNADVASPPPPSVPPSCFQTPPTPSSGSAAAS
                     PYVLSNQQQQQNFVFTCKEDALQNNIISGGKGRLPTLQNYSLYYTTACFSLEYNRFAL
                     DTAPDTLSVNSYNNIACLFNYALLHNPPQMRYFPPGVPHVRRPEDALVGYLDHSMLWY
                     RFAVREDYDFTLQLIARGLHTLRFRSIAFDVPQMMKVRGGMTDYYRNCHEEIRQQNDR
                     FVLQWPAVAQHWVKGKEGSRRDDIRVRWDLLSPARTKHPGAFLYLSAPLPQLQPQRLS
                     DDSTGGNGSVISSSDSAATATAVEGTETETRKRLRPPSPTAPTAESSHAPAGRRPCVP
                     AATASAPAMSSTVARDWKGGYVVERWRDISREEARQHAGLVALSNDDIHIGRTVAVIP
                     PFFDQKPSVVRATVIERAVEPTDSHASSGRAGNTSTAEAGDAQQSLTPRVIWTAVAQD
                     VRGMPFLHVDTCFEVPAEGIEKAAASIDQFFAKMESEPGS"
     gene            <961263..>962324
                     /locus_tag="LMJF_36_2380"
                     /db_xref="GeneID:5655510"
     mRNA            <961263..>962324
                     /locus_tag="LMJF_36_2380"
                     /product="putative sterol 24-c-methyltransferase"
                     /transcript_id="XM_001686763.1"
                     /db_xref="GeneID:5655510"
     CDS             961263..962324
                     /locus_tag="LMJF_36_2380"
                     /EC_number="2.1.1.41"
                     /codon_start=1
                     /product="putative sterol 24-c-methyltransferase"
                     /protein_id="XP_001686815.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655510"
                     /db_xref="GOA:Q4Q1I3"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR013705"
                     /db_xref="InterPro:IPR025810"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1I3"
                     /translation="MSAGGRETAPMNLLRRRNKDEINGDVNAAADRFRNRFEKATLEE
                     RKAATTTMVNEYYDLVTDFYEYGWGQNFHFAPRYAGETFFESLARHEYFLAARGGFME
                     GDHIVDVGCGVGGPARNIVRLTRCNVTGVNNNDYQISRARRHDALAGMSCKIDYVKTD
                     FCNMSLADNTFDGAYAIEATCHAKDKVKCYSEVFRVIKPGTCFVLYEWCMTDKYNPND
                     EYHRTIKHRIELGDGLPEMETCKQVIEYMKEAGFVVEEAIDVISQFESSPIKSIPWYQ
                     PLVGDYSSLQGLRSTPIGRILTNIMCRVLEFVHLAPKGTYKATEVLEEAAESLVVGGQ
                     LGIFTPSFYIRARKPSKQA"
     gene            <965198..>966259
                     /gene="LmSMT"
                     /locus_tag="LMJF_36_2390"
                     /db_xref="GeneID:5655511"
     mRNA            <965198..>966259
                     /gene="LmSMT"
                     /locus_tag="LMJF_36_2390"
                     /product="putative sterol 24-c-methyltransferase"
                     /transcript_id="XM_001686764.1"
                     /db_xref="GeneID:5655511"
     CDS             965198..966259
                     /gene="LmSMT"
                     /locus_tag="LMJF_36_2390"
                     /EC_number="2.1.1.41"
                     /codon_start=1
                     /product="putative sterol 24-c-methyltransferase"
                     /protein_id="XP_001686816.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655511"
                     /db_xref="GOA:Q4Q1I2"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR013705"
                     /db_xref="InterPro:IPR025810"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1I2"
                     /translation="MSAGGREITPMNLLRRRNKDEINGDVNAAADRFRNRFEKATLEE
                     RKAATTTMVNEYYDLVTDFYEYGWGQNFHFAPRYAGETFFESLARHEYFLAARGGFME
                     GDHIVDVGCGVGGPARNIVRLTRCNVTGVNNNDYQISRARRHDALAGMSCKIDYVKTD
                     FCNMSLADNTFDGAYAIEATCHAKDKVKCYSEVFRVIKPGTCFVLYEWCMTDKYNPND
                     EYHRTIKHRIELGDGLPEMETCKQVIEYMKEAGFVVEEAIDVISQFESSPIKSIPWYQ
                     PLVGDYSSLQGLRSTPIGRILTNIMCRVLEFVHLAPKGTYKATEVLEEAAESLVVGGQ
                     LGIFTPSFYIRARKPSKQA"
     gene            <968576..>969592
                     /locus_tag="LMJF_36_2400"
                     /db_xref="GeneID:5655512"
     mRNA            <968576..>969592
                     /locus_tag="LMJF_36_2400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686765.1"
                     /db_xref="GeneID:5655512"
     CDS             968576..969592
                     /locus_tag="LMJF_36_2400"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686817.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655512"
                     /db_xref="GOA:Q4Q1I1"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1I1"
                     /translation="MLNESEHHLVAVAFQSMDPNNTGMVALSEVKKRYFAHAHPRVKE
                     GSMAPSAARDTLDYHFSVCAADHEGSITFDEFLAYHEKLADEAYDEHVGDVAAFTKKT
                     IMGLWRLGDVLLPTGVRPAFPVTQTPTGLYAVTLMTLVWVERRQMAASPASGQQSPSS
                     GGAAHDDLFVLRGIKDVVRPIFTRGDLPDELQGYFAYPEELSGMAIDYVAPRLSIQRW
                     YDFTWEYSEGKYCGVEGIISTRVDLESLPAGLRQFVCEHATAVSRGTTWMQTRLVMNP
                     MYKKTSSAYGCGVNEECRKIHHWKVKTFEGKQYGSQYQGLCGKYFSKLGAPLKSGTAT
                     GINI"
     gene            <974149..>979926
                     /locus_tag="LMJF_36_2410"
                     /db_xref="GeneID:5655513"
     mRNA            <974149..>979926
                     /locus_tag="LMJF_36_2410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686766.1"
                     /db_xref="GeneID:5655513"
     CDS             974149..979926
                     /locus_tag="LMJF_36_2410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686818.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655513"
                     /db_xref="GOA:Q4Q1I0"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="InterPro:IPR019559"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1I0"
                     /translation="MTVSLHDLIKEWEVVNAELYRASLESHQRYSFPASSHGRSNDSD
                     CSAEEPSLSPPPLSSTTTYARVYNLLSHVRQIAEDARYNSFCIIQHLLWVTVVAWANQ
                     MASASSNLIRLPSELRQYYEPSPWCATRRDGINDDTAGKKVPSASTPVQRTSFPCSLL
                     PPLEFWDPSVLEEMAGASSPAPEVVRNASLHRAPNLPEVWSNAVQRIFTLWCATPMAG
                     SCAGAVQPCTAQSTCSTVPPGTLEYAHVWVIVAQHYHRFKSLLSLFFLRYDVVLEDAE
                     ELLQRRGRQQLQEQQDRRLSDLHDEEVQRAGTHSARPLSPPLRRRGETSLVSSFSISP
                     GGAASAAGADNSMSRSSTPAALSTDREATKTTDKQARLSACPPSSLPSTANLLGHLMR
                     IIVNENLAKIREVTGEVLLFLLLPRVHCARLRSQVTTPASDTGNPRQLSHCAPPQDNT
                     ETGEADTGKEASLALKTMRQLSGVSSWHSDEQHDDDDDRVVWSSPPSPLLSYTAASFG
                     HGNGDTPAPAPRAGILTSNPHVRERAQQEEYVARHVFKLLFLVEHCRVHVLQHWLVEN
                     GKRLAFFYGSQLAANLFDNTAGQQAALAHDPSSCDPSVTTIAATRTLAGANRVLRETL
                     QAYIRLRAKLLFLNAGTTHFLDALTPWGRTRMLESLNAFLCGFCGVILPSSFPSDGGA
                     SDKSTTESSKEPRNQAASSPLDGCDESVLFTPTNAAVADFVQRWGVPLWIAMCDEAQQ
                     RMEALKHVEQKRAKRPKQRMPLPENECLCVMPPAKYQQQQQQRHTMEKWSGGDMGEKD
                     HWRGGLCNTGTSSAPVTSSLTTAVVSAVDDDRAEKPDTRDRHSVASTELEDAVSRTTS
                     IVWPPRSPTVANEGEAGSGGTGIHRHGGAKEADRAFTRRRGRGLDLKRVLQQQQQRRA
                     RLGNVKLPQQGVTASRVGAPLASSEDGGGDVVESLYTEETASAGDDGSVSAAALGARS
                     DGANVGRLRDNNGAAATAARQRGGNDLTTAAGSHVKRFSRSAQLHQVATLPDEGFPCL
                     LYLMPRRSRFPVLDKAAAALQQQLFTRFSANVQAYLTDYLTECETAAAAAVAADQRAA
                     SALQKKKREKAAHVTTMGGHAGAGTAATSSIAVVTPFPKPVLARMVFLLEMTYAALQG
                     RDGAASESCGHHTEDNHAIGNGGSRRPLMETGLTATGQELGAAVLEQCNGEFDGVVST
                     TLSAPTSPALLAIAAVRKGFQGFLISLEKRAVLALVQALYGLIQQGAAQQPPAAQLSA
                     VDTILNMASLLNSKDMFVLLLKGYLAPQVMMCRSQSEILVESQVVSRMAYRLGAAVAA
                     PCMTLLRDLQLAMSDPRSTMRSSPPSGARADLAEDRELNATHGSLSGEGRRGDGGDFG
                     GASSRDIAMECAQLAATQDAETLGDIRPLQHGAFGLIHRVRVLCQAWWQPHTAVVLSS
                     RRLRQLWEQHQLLDERMVDAVLSVEWQYDGHSEPFRGYGRQVKLRERENTSPLHPPSR
                     SSGGGGPKSLRSSLSDAPHGSHWRHGDGGQNSGPLAAGTQLRTVTAAAVVRGFSSALG
                     NAVRRTGRQAGDFGYNDSDNESEDYREAYGGLLTLSTLQQYRSAYAPSNSSYRGSNLS
                     SVGSPGAVGGLGASGEHRGTSDGGQSTTVDDHASTAVPADGQLERRRLRWPLGNGQLA
                     FYIFSRGAASAGRSVSQAVQIVGPPLALLVCQLLDRASEQPYTFDALHKALPVQAPKP
                     LLAHILHELVKADVVVRSVAAGARQLTYQLRDDTREVRQRKVIVDVRAAARQQWVAQT
                     MDMTAADDGEDDSSEKGGARNPAFPANPTEAATAFPASSLKPARQARLDAPVNAKAAP
                     SAPGDEPSSPTYSADSAHKIKVCIVRIMKAERVLPHRELVERVALALEGQLVVTPSQF
                     KCCVAYLIEKEFLQRGEQGEYVFVS"
     gene            <980511..>983069
                     /locus_tag="LMJF_36_2420"
                     /db_xref="GeneID:5655514"
     mRNA            <980511..>983069
                     /locus_tag="LMJF_36_2420"
                     /product="serine peptidase, Clan SC, Family S9B"
                     /transcript_id="XM_001686767.1"
                     /db_xref="GeneID:5655514"
     CDS             980511..983069
                     /locus_tag="LMJF_36_2420"
                     /codon_start=1
                     /product="serine peptidase, Clan SC, Family S9B"
                     /protein_id="XP_001686819.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655514"
                     /db_xref="GOA:Q4Q1H9"
                     /db_xref="InterPro:IPR001375"
                     /db_xref="InterPro:IPR002469"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1H9"
                     /translation="MPPTALKSSMNELSRYMDAFTSAAGKPQHLTIVGDRVYWTQGKQ
                     QELYSAPVGLEVAEAVRVIASDEQEVGEEKQFTKEEEMLRERTRSQTTGIANFHVRCN
                     DGAIFYTSGVEVYVYYQNGPRAGKAPLKLFDYMSEEDKTHFKAMGSKPNLFVQAIKSF
                     DEAHPSTHTVMTFVNNNNVYKATLTESPASEEAPLAVTVEQITHIGDDLHQCGVADYI
                     IQEEFSRYTGHYATDRYIVFSYIDSSHMRSVALLSSLGSPEVPEAEPACPTYATEMEE
                     MPYSRVGDPNARTTLIVYDTATKKMRLLPDVAIRKVAPWTEYILRFGFKDAETLYVSV
                     ASRAQEDYAVMSCPIAALPTIAKEEDLRSLYSEKDGKVTANIIGDAAAPELRVEWKQR
                     IDFAWVECQPGVPVHYGKVYDVLCRHAAETETAHYHLYARPAGDGNPETWKPLTAGAW
                     NVCAGTQHVCEDRVYFLANAEGRLKRTLYSVPLSLESAPHIADALTRLTPLDEHVYSY
                     CAKGDHLYYVSSTAAAPAKLYVSCVSAPQKRAEVTVPSWIATTPGTDPATTADPTRYF
                     GGLPVVTPQIVTVTNRRGVPLSAAVFVSPSAPKDAPGPLALFIYGGPHAQLVFENDYE
                     TRCKAPVQVLLQHGISVAVVDNQMSNANGLRDLSICKKNFGNFETHDYVDVTQYLCNT
                     PESESGSPANFRFDAKRVAIFGWSYGGYATLLAMCQAADVFRIGFAGAPVGDWKLYDT
                     GYTERYMGALYGEDGSAESGASRNRNEAYMTSAISHYAGGFPEECNRLYIAHGLLDEN
                     VHFGHSCHVVKALVDNAKPYSMLVYPGERHGLRQNRQSRLHHDALLVKTLEEQL"
     gene            <992063..>992782
                     /locus_tag="LMJF_36_2430"
                     /db_xref="GeneID:5655515"
     mRNA            <992063..>992782
                     /locus_tag="LMJF_36_2430"
                     /product="putative caltractin"
                     /transcript_id="XM_001686768.1"
                     /db_xref="GeneID:5655515"
     CDS             992063..992782
                     /locus_tag="LMJF_36_2430"
                     /codon_start=1
                     /product="putative caltractin"
                     /protein_id="XP_001686820.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655515"
                     /db_xref="GOA:Q4Q1H8"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1H8"
                     /translation="MQDAGRALYTVTGQRVARSELLKLIAFAQDAVAKQQQELQNGQD
                     QVSSQRRSVTTSAGSKSSPDATTASDGDATRFVISTRSSSPAGESISTFSVGESPLTT
                     QHGTTSTFAASATISPAPPSATASVSQIRFVSPHSHLLDSSDGIDLDVFEQMVLRKLK
                     HRSYEEELTYTFALLEDKSYPGFITKESVRRIAAETGEPLTEAEIAEMFDPLVTGVST
                     AAVDLSTFTDLQLKARKAEDS"
     gene            <993894..>994595
                     /locus_tag="LMJF_36_2440"
                     /db_xref="GeneID:5655516"
     mRNA            <993894..>994595
                     /locus_tag="LMJF_36_2440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686769.1"
                     /db_xref="GeneID:5655516"
     CDS             993894..994595
                     /locus_tag="LMJF_36_2440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686821.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655516"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1H7"
                     /translation="MTLWKHICDVCHRTVCDDCAPRNTESVDAKGEKATLRVCKTCGT
                     TGHRLGSAVGGHSAADGAQGTGAARPDPHSEAERERRARIIEERSRAQKNRGRPQRAG
                     GEGDSRAAVASERPAPPARAPSSPTSAPPRASASPPAAPPPLPANSGSQERLVNPALE
                     AAMRRQQQQQAHGRTAPTLPAANMSPEKTRLLCEIEALLAKHLEDPPFGLRAADEAKL
                     HGYLQFLKKKYHLSE"
     gene            <995958..>997313
                     /locus_tag="LMJF_36_2450"
                     /db_xref="GeneID:5655517"
     mRNA            <995958..>997313
                     /locus_tag="LMJF_36_2450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686770.1"
                     /db_xref="GeneID:5655517"
     CDS             995958..997313
                     /locus_tag="LMJF_36_2450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686822.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655517"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1H6"
                     /translation="MQDWQIAVLVVVIVVFVALATPLIFLIYRVGSNRRRYSSKRTNK
                     TTSRYADSSYCAKHGIVDAGDAFGQLFRCDPRIHPSTHLLYFLDFQGELHWIDFNRKP
                     AAKIDTESALQQYIFETFHPMVEEGNRVVPLRPEMLALSYMNDQQSLLVLDLNRLLAR
                     DTEFGARMRHTAERPLLLSRLVADVADGAVFTALSRYGYTAGDASVPPVTQTSMQCRA
                     LVAASPPQQHQQQIEVDLSTSRANPMAAAPAVSASMPDTHVPPPTVRPPVAPHLPPPS
                     NFSSPYACDASGMAPAPVIHPYDTHHITTSTPVSITATSYMVVNANGSRTELDAMNTA
                     RIEGARLRWDRRQSLVVPFTSGVLSGYHCIIDPVTEEVTLSTESAARAANVNGMESIV
                     CQRADALYYTVERVNSTQWLPFVKAFYLPAGRWCVRARATLYCDNSSKTIAKVFTVSV
                     I"
     gene            <999238..>1001358
                     /locus_tag="LMJF_36_2460"
                     /db_xref="GeneID:5655518"
     mRNA            <999238..>1001358
                     /locus_tag="LMJF_36_2460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686771.1"
                     /db_xref="GeneID:5655518"
     CDS             999238..1001358
                     /locus_tag="LMJF_36_2460"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686823.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655518"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1H5"
                     /translation="MLQGILGSVPSTGIREAENVLRQSWPSLLELKDEAQTRFCAEAE
                     SFLKAQLTNRPVPSDTLAIFTTVYVTAVHAIHSGLAAPIRWTKAQDSPFRRPMPVERA
                     LPSGMEAARIVASVCERLLLANAKVAGAYFSQLLRETAMGVPLLALVLRAYGEAAVEV
                     LSAHSEGPQFLQSCIHHLFLSTCKFTVAMSGDALTIAHPILLHVARVSGRTQDAMQLL
                     CRPIYSVSPMLTGIGLSDYVAYHAEAALLLAALEQYESAMYALVPVSRLSSTHGTREG
                     RIGSRGGAGEGDLPPWSNEVEDEEADVRDAIPRSGGCAADASRAPVTGADSALPAQRS
                     VVLYPWYRTECIGETRKYTGSTDAKDRTAESNAVVWRDVLVPSAIEREMDRRAVTWAN
                     RLGIVLLAAAFGGGSPRGVMALTASVGRRVVDDEEASSIWTGMASAIAGHVCFPHPLF
                     RLLAETTPVSLRSFVHVVTTDKTTSARAYADFLVAIARRDTNNAHQCLGNPANVALFT
                     ADLTVDVVRATVLRELPRHILLDVARMYAHVPMQMLLDRSQPTRTAAKANGATPSNER
                     AEDEERQRDAATVDSRHALVQLLVKMCATGDLASSHVCVTAAPAADAAAKEHATFYPV
                     EEVARQLNSGTASFCGSTASVKWTLPSSAARLQRCARVVEFHIHQYPSANLDTSLVPM
                     LAQLQELQRVVDADAEEICDMGIV"
     gene            <1002889..>1004226
                     /locus_tag="LMJF_36_2470"
                     /db_xref="GeneID:5655519"
     mRNA            <1002889..>1004226
                     /locus_tag="LMJF_36_2470"
                     /product="putative acid phosphatase"
                     /transcript_id="XM_001686772.1"
                     /db_xref="GeneID:5655519"
     CDS             1002889..1004226
                     /locus_tag="LMJF_36_2470"
                     /codon_start=1
                     /product="putative acid phosphatase"
                     /protein_id="XP_001686824.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655519"
                     /db_xref="GOA:Q4Q1H4"
                     /db_xref="InterPro:IPR000560"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1H4"
                     /translation="MNVARLVSAFGLHSGRRNKPSTAPETSYPVHPPVNINWTQQSLD
                     SNITKAERKEILKSKLVLTKLVVLNRHGHRAPNAPFWKMCPNDINSKKRYDVSAEDLT
                     GLGMEEEYNFGQYVRNTYHAFLGDKFNRMLHYFRAVGEPRILQSAMAMAQGIFPDGFG
                     PGGYLPSRPQFVPIFSDMDTHEYLLDDVPCFRRAENDSHRWIDKRYQNFIDDPNTGRV
                     LKMIKEVCGEYIGAAEGYAYIKTVADGLTFNSDIGLKVAKGRLTPEMLFSIRNVSLQL
                     LMQRLYGTDEQQTYMAVDLPRNILQTLNHTHVGDTPEQLNDFTDTRQESTFYFMHREA
                     LYAFAQFFGFQYNVAGLPPGELPVASSIIMEKLVPHRDQYSHNASHIYVHITLWTPYN
                     GIYTIPISTCRIPELCELKELQYIHDTRVNRTGTWEQLCNYTPQEIDHTTDIR"
     gene            <1006411..>1007190
                     /locus_tag="LMJF_36_2480"
                     /db_xref="GeneID:5655520"
     mRNA            <1006411..>1007190
                     /locus_tag="LMJF_36_2480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686773.1"
                     /db_xref="GeneID:5655520"
     CDS             1006411..1007190
                     /locus_tag="LMJF_36_2480"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686825.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655520"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1H3"
                     /translation="MDPSKRICLKNLPEGCTKREIAELVRNRTGTPIHSIDLGLGADG
                     KTRRYAHFSCEGAKHVLEVLSAGVTLRDSTIYAHPAKSHYSFRYAEARRKREREEAEE
                     KAQLEAFWAAARQRFLDRTNGGELPRNKIPKDFYAAKRKYARIAAEIAQVSRNAHAAA
                     GGDAAYAEHPRGAAHAAPFFSGADCGTNSAPRATSKNHATSGGGDANAAKKCASTLTA
                     AKSKALAAVPPPPPPPEPTKEERKLSGLQAKLAALKEKLKK"
     gene            <1009006..>1010487
                     /locus_tag="LMJF_36_2490"
                     /db_xref="GeneID:5655521"
     mRNA            <1009006..>1010487
                     /locus_tag="LMJF_36_2490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686774.1"
                     /db_xref="GeneID:5655521"
     CDS             1009006..1010487
                     /locus_tag="LMJF_36_2490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686826.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655521"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1H2"
                     /translation="MPVATMLTKDADCEKSQQQKLEEDIKSPCTPSFHWVSDEDPKSD
                     RATNHGCAKPLDWSPQTPETPPMSVAELRVTTVADTSETETTSESATHGNELRANEGE
                     SSASGTLEKPAGGVAAAGGAAPAAVPQKTEERGSSVPLKHKRSYGASDAVSSSSCHVD
                     ALGDLAGSVRQHHPTSTHTLDTSSSNGVGDAAKHAVAAGHVDESLPPPLSGVFFPFTA
                     CDAVTTASLVTLISSYCDVLTLVQLMRVNRSAHLLATSDAVWKPLLVSMNLPPLLAAY
                     ERDNDYYDFFVKDIITTRALHGHYTFQAANAASGSRESVSTTSGSRSAVMNRNYVSRD
                     EDSLQDDIFNIASLQLLISAASLGQSNHLIGRVQLLITYKNESMEVLQGSCRFSVHRR
                     CFSLCCSAFGTVKRGPVFTVAVATVTKPWANEGFQHFREHKNGIRLVMAPVLWEGPSP
                     GSQITENDILVVSRPKPVPSLITSTTGSAAANSSLGAPTASRG"
     gene            <1011834..>1013858
                     /locus_tag="LMJF_36_2500"
                     /db_xref="GeneID:5655522"
     mRNA            <1011834..>1013858
                     /locus_tag="LMJF_36_2500"
                     /product="chromatin assembly factor 1 subunit b-like
                     protein"
                     /transcript_id="XM_001686775.1"
                     /db_xref="GeneID:5655522"
     CDS             1011834..1013858
                     /locus_tag="LMJF_36_2500"
                     /codon_start=1
                     /product="chromatin assembly factor 1 subunit b-like
                     protein"
                     /protein_id="XP_001686827.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655522"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1H1"
                     /translation="MGSHNTEKEEARTGAHVEGAGLDGEACCAPHQPLRVRTIEILWH
                     FNERNEEAELLGLQSSVTEGITSVDYNPRCHRIVTTGGDGNIRLWEVRVKAVDAWLEN
                     TANDMLACCRHLCRMHTSWMPLTARWSPQGEMIASAHCDGKVCLWWRDPAGGSAAAAE
                     ASDEGSCCSGLQGASGDSDGDVEEWKAYRHLTGHISDIYDICFSADSRYLLSGAGDGS
                     IVIHDLQGSTMPVLQLTNLHTKFCRGVAWDPWTRFLHTFGCGPSLLCFTHVPKSEGHH
                     RRMHLAGQRKCQGDYIGESCALSYRRLCWSPDGLLLAVPYGKVTRAGQQQAPSTANLL
                     ALIEAKEKAEATLQATKDHPQDTSSPTHRTEAARGKNLHDAPVTTIGDAGDDALDDML
                     HCVYVYTRGAPDKIACRLGVRGLSEVRGVLWAPCFFEPLHADEVLEGCSQQPTALSTA
                     ATHGAAAEATTTLSSALPHSASAATAEALPSQLAALEAARQRRGAWGPAEYFMALAVW
                     TSDAVIVYTTDSSSRHSDFTDLHMRSITDVAWSHDASHLYTASLDGYISVIAFGDSLT
                     AAHRLPYFSASPAVRSLCGLLERIERVGVSVEAGRSTGAFSAGAARGCRKAGGDASAS
                     AAAAAVAKSSVAVVRKKRKVEKTSGGAAAPSVMAAKEVDMQQLEALISDI"
     gene            <1014555..>1017257
                     /locus_tag="LMJF_36_2510"
                     /db_xref="GeneID:5655523"
     mRNA            <1014555..>1017257
                     /locus_tag="LMJF_36_2510"
                     /product="putative nucleoporin interacting component
                     (NUP93)"
                     /transcript_id="XM_001686776.1"
                     /db_xref="GeneID:5655523"
     CDS             1014555..1017257
                     /locus_tag="LMJF_36_2510"
                     /codon_start=1
                     /product="putative nucleoporin interacting component
                     (NUP93)"
                     /protein_id="XP_001686828.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655523"
                     /db_xref="GOA:Q4Q1H0"
                     /db_xref="InterPro:IPR007231"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1H0"
                     /translation="MFSSTSDLAPRRLGSAGPGGDDASALRVMPSAGDPTDEVRVSLA
                     SLTARAQRLVSERGAEQLLRNGFGLFEASRKAAEEARHQANKCQSTSEGYAPATHASV
                     ELFMTQHLGFDAQAQQRLLRQLQHRHAQLGVDLGPIDTLPGAEASGFTGIADVDAVVA
                     ELKNDILLDVQHAVHQRQTSIVRDQVDTLFKAAWHPFYVRVADDYEALSMGANELAAG
                     KAGASGRLSSTGTAAPSANAFGGVGSGASSSLVDILNSGSSLATELNRRVAAFAAIVE
                     EYAPAQWITHFTAYVTETSLDGANDLTVLWASIVQIIEPMQRRGSEADILSYVASSRR
                     VMERKSLSRLLERVLRMDPIRFEEVENMSASHLMDVIARSCGATNHWMHAFVAMRVGR
                     YDVAQLVMDAIGIQSVRDAMAKMAATPPAERNAMPPASDLQPVYAEAKTKEDPYRQAV
                     LMVLLAGRTGESPAAVLRTILSLAQRVTDSLEDALWLRLSCIRGVDKSAQVTPVQSLR
                     TLQRAVLDDMQDLVCITQGNACRLASFLIHALLPSTGLRLLLENNITHVDGFHMALCF
                     SAQSLLQGRLHSALEAPIDIARHMNRYCSVVLLGVDRRIRATVFAGTAIFAYFHKSGL
                     TEAFVECCLKDTICARLLGSRNAVGGQDALLLRAGTGALSEELIKALMQVAEAASARS
                     EVAKATHVLLAVAFLASQLCRPELQQRALRRAVQMMSPALAQVLHLPSRSSVVSDVLS
                     RAAQLQQAVNAVPRHLSEEAVDAQDYQTFALLCRMADVYAFNVSGNASDAVDAFLQLP
                     FVPPPNTAVTGGVDAYVEAYCNAPGSVQLGASAVLRIAISAAGQLLQHYARNITGGGA
                     DVDEKRPRLLHRMQTLLEWARQCCARTSVAYPAVAEEFERTYLC"
     gene            <1018544..>1019596
                     /locus_tag="LMJF_36_2520"
                     /db_xref="GeneID:5655524"
     mRNA            <1018544..>1019596
                     /locus_tag="LMJF_36_2520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686777.1"
                     /db_xref="GeneID:5655524"
     CDS             1018544..1019596
                     /locus_tag="LMJF_36_2520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686829.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655524"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1G9"
                     /translation="MPRDTDRERLTAFAKDYAQLYARFANHFAIPERATIDDFAVLFD
                     ASHIEYLHYCGGTTLERPFFPVITSELLMLSSAYLSIPEAVAPRGVRTFGLLLSFFIY
                     STQPARQRPKVPASVATEGKSLPPVQSTASFVESALPRSGGPRASRIAMMADSLTSSS
                     TQQPQSCSAEERTAATAPPSPPVPLSLRLPMQPVPVSVSCMRLLLSRLSIDAGSGVMS
                     GQPSAGVPPLRTAVAVAPASASPAQLSHTEAKVVLALRRATGWHIEPYLQQGKHISAL
                     LSAHQACAVPLVQHVTPVPRSLFAATLTARSMLNASAAPEEVGGPDSLFRDPDFVRLR
                     QGYEAARRRLLLGERR"
     gene            <1020367..>1022475
                     /locus_tag="LMJF_36_2530"
                     /db_xref="GeneID:5655525"
     mRNA            <1020367..>1022475
                     /locus_tag="LMJF_36_2530"
                     /product="putative DEAD/DEAH box helicase"
                     /transcript_id="XM_001686778.1"
                     /db_xref="GeneID:5655525"
     CDS             1020367..1022475
                     /locus_tag="LMJF_36_2530"
                     /codon_start=1
                     /product="putative DEAD/DEAH box helicase"
                     /protein_id="XP_001686830.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655525"
                     /db_xref="GOA:Q4Q1G8"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1G8"
                     /translation="MLGESVAPPLKAVLQDNSRNPSAWQPLRGASSAPSTDAGGEGRI
                     ADASAPAWSQHIQQVVRHAVLDPLRNAPSHIDGSASHDENRRESVAPPSQLDLPAQYK
                     VIVVDALGMPADLPRGAPQSFEDLLELSPSILRTQLQKLMERKRYRVLTPVQAAVIPL
                     MLEYRDVLCIAPTATGKTLCYVYATLMHLLLKDINDRPAAAAAAAGDEGGGVSLNRRQ
                     VETFLQEKIDKGEVCPYCELNLSEVRVCPMTGFPHPSASELETDLALRSKERRAKRLE
                     ELQSSVAEPRVLVLVPNGQLASQVSAVFRSLHCDYRIHCMVRASSAEEQRKYLQALEG
                     GVDVLVASPETILPALYKHKLSLRRVQTVVMDEVDDIVSVNHFEPMKIILGALPKGVQ
                     RPQRLLLGASLPPVAYEMIKTKMLLPSHRFVLVDLKTPAELSRAAPSARASSLSSSSP
                     DKPNAGDAGDPPVAALSATVTGGFLTARTNLCHLVFMVGRAEKVQKLAWLYETGKLNP
                     DQRTLIFCNSRHNVAYVCDKMKELVSQVNFTTLTSHASSSAREGVLKMFRTGVSTSLI
                     CTDLLSRGIDFQGVVYVVHYDMPTDMETWMHRCGRCGRGGSLQGRGYIYTFFQPENIK
                     LAKPLVGYLRQHQQLVPPRLREYAKQSFIDVFNNSLFHHPTRPHRKDDPQNSTPVLGR
                     GTRRFPDYKQGTIHKHFRPH"
     gene            <1023294..>1024502
                     /locus_tag="LMJF_36_2540"
                     /db_xref="GeneID:5655526"
     mRNA            <1023294..>1024502
                     /locus_tag="LMJF_36_2540"
                     /product="putative C-4 sterol methyl oxidase"
                     /transcript_id="XM_001686779.1"
                     /db_xref="GeneID:5655526"
     CDS             1023294..1024502
                     /locus_tag="LMJF_36_2540"
                     /EC_number="1.14.13.72"
                     /codon_start=1
                     /product="putative C-4 sterol methyl oxidase"
                     /protein_id="XP_001686831.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655526"
                     /db_xref="GOA:Q4Q1G7"
                     /db_xref="InterPro:IPR006694"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1G7"
                     /translation="MVLAKKQMKIPPIHKLRPGWSAVALHTVIYLLRHDFFTAIVATS
                     IVQPLYHRLILQNTYLQRLSDPALFTLVFAVLCHCVPWAFFNGIFLFFDSIHPQYGIE
                     GLRNNALLAPLGRRMAAYKLPRKPQQLPSAALIFSTMLHTAINHYLIIPVVLYAYLVH
                     TNSCALRAPPPESAIVGFAPEDVVNYMSGSNLRQIPISLVTITSHFLIANVINEMGFY
                     IVHSMLHSSPTLYRVFHKKHHMYTGTISIAAEYATPLEGILANAIPTTAYFTFMFFHY
                     TREEASKSSFVTSARAWPLFITWMWARLWETYEVHSGYCFSDTWLGKLGLLHGHRARF
                     HDFHHTHNVCNYGSGLFMDALLNTMDPYLIYRYPDKHPHTTALKEEDLKEPRDLEVGS
                     EAMDQVRACS"
     gene            <1027170..>1028291
                     /locus_tag="LMJF_36_2550"
                     /db_xref="GeneID:5655527"
     mRNA            <1027170..>1028291
                     /locus_tag="LMJF_36_2550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686780.1"
                     /db_xref="GeneID:5655527"
     CDS             1027170..1028291
                     /locus_tag="LMJF_36_2550"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686832.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655527"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1G6"
                     /translation="MSCEPNSPVVDTTAAAAAPKLMTLKEAIDRDGVPATSSSKQRRL
                     MDIHVTAYPGLVNQHMLPKHNTAVNDFSSIDPLQYRKAHTVRNNNAASYSEKEENVLD
                     MLTTNQCTNRMTRLGMQLREERAKNPKGMPSISSLAPRGYRSRFLSPSFDERSTYRWD
                     YCQWEPDGFHDTVRRELLAAYRDDWTEDEKADVDISMKIPYLTMAVSSDRLKDKATIY
                     RKDFMEDATQADYRSLSYKTNLEDLGTSYAYSAYSIDDPRRKVLFDASVAALKTPHSV
                     LEKTYSPRNSFLEKSLSTKQQSSAREELDRLRTMRREALHLSAAKRSAAESTDDGTTT
                     KTVVIPGIKGSGYRRVPKGNDSYVCLSRDHFCYQQVDNF"
     gene            <1029410..>1032190
                     /locus_tag="LMJF_36_2560"
                     /db_xref="GeneID:5655528"
     mRNA            <1029410..>1032190
                     /locus_tag="LMJF_36_2560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686781.1"
                     /db_xref="GeneID:5655528"
     CDS             1029410..1032190
                     /locus_tag="LMJF_36_2560"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686833.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655528"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1G5"
                     /translation="MSSAEMLLDATSLTPSLSQLLAVDSVSSVLLYLVQDAIVDDPDA
                     RLQALSEVLAHVSTSPKSDSAVSANGLGADGTHPSSATYTRVHGARWKWADVVMRGVT
                     DPWSRIRSLAAPVMADLLDAEVELVLQRHDSSSSTHPRSSDSTPRSSSVARTTPRSAK
                     KDWKNELTATESSLPKSVSAPLEYVWHRWRGTSLWYEQDGIVHMLAKLYSRSGTPSGD
                     ALRTDEAGLRCLLFNVIFPALRNPQLPVRESAALLLGILADRRSSTSLSPAITSFVVD
                     HVCRTIVRVPTPTRRHSLETLVSVEDTRVLEGNLLALNELVDADVIRVEDADVMPLLL
                     RLSNYPASSVRQYVAQILRPPSLYVFTYLMQRLCEHQNCMLQHAEGNGDSSSSVPGGG
                     ENDDSDELSWQRLETLMMALQQHLLYLHTTSATMQDLFHVSSDTKGILTPVVFETSLS
                     VVFQATHSPRFEVARMGLQLFPLLLQLSLRFCPPVALPRVCEACCGSDGCVQAELNRI
                     AACGAFETLAKAQTYVATFVVPVMWWFLTIRRLVAEVREKMTPSPTTGAPGETRAQVE
                     DLVRPYATLEQILFASQAHLSGKVSSSAALPRHTATCALLPLVTYFATVMGPEEWHLC
                     VDELLAPSWWAELLADPARQEQARVGPDFVRAVHRRGTSNEVQRVVELVPTLTSALAD
                     APTHQQCLLVAMIRVAVVAHTARTVAVEEHALCFLYHEAYAAPALVEGGDAVPLGHVW
                     LKHFMPTQEAIPTTALWGESVQSRGGSIVFVESNSTVFEAIEKRCYQELYQSPQTEPV
                     VLRELRSLMMSMLHPSMSMPSGTHVYWYAAALAAVFGRLEKVCLQWRETDTAATAAAT
                     AVVSGCEDDNECWDDDEDGAAQGIYAAEEVRNARAVVLVLRERAAASMEARDMAAAED
                     RFRPEFAVLAAL"
     gene            1032512..1032582
                     /locus_tag="LMJF_36_TRNAGLY_01"
                     /db_xref="GeneID:12982075"
     tRNA            1032512..1032582
                     /locus_tag="LMJF_36_TRNAGLY_01"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:12982075"
     gene            complement(1033226..1033297)
                     /locus_tag="LMJF_36_TRNATHR_03"
                     /db_xref="GeneID:12983034"
     tRNA            complement(1033226..1033297)
                     /locus_tag="LMJF_36_TRNATHR_03"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:12983034"
     gene            complement(1033360..1033430)
                     /locus_tag="LMJF_36_TRNAGLY_02"
                     /db_xref="GeneID:12983041"
     tRNA            complement(1033360..1033430)
                     /locus_tag="LMJF_36_TRNAGLY_02"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:12983041"
     gene            1033504..1033575
                     /locus_tag="LMJF_36_TRNAPRO_01"
                     /db_xref="GeneID:12983035"
     tRNA            1033504..1033575
                     /locus_tag="LMJF_36_TRNAPRO_01"
                     /product="tRNA-Pro"
                     /db_xref="GeneID:12983035"
     gene            1033771..1033886
                     /locus_tag="LMJF_36_snRNA_01"
                     /db_xref="GeneID:12983038"
     ncRNA           1033771..1033886
                     /ncRNA_class="snRNA"
                     /locus_tag="LMJF_36_snRNA_01"
                     /product="small nuclear RNA, U4 snRNA"
                     /transcript_id="XR_002461158.1"
                     /db_xref="GeneID:12983038"
     gene            complement(<1035960..>1037504)
                     /gene="MBAP"
                     /locus_tag="LMJF_36_2570"
                     /db_xref="GeneID:5655534"
     mRNA            complement(<1035960..>1037504)
                     /gene="MBAP"
                     /locus_tag="LMJF_36_2570"
                     /product="membrane-bound acid phosphatase precursor"
                     /transcript_id="XM_001686782.1"
                     /db_xref="GeneID:5655534"
     CDS             complement(1035960..1037504)
                     /gene="MBAP"
                     /locus_tag="LMJF_36_2570"
                     /codon_start=1
                     /product="membrane-bound acid phosphatase precursor"
                     /protein_id="XP_001686834.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655534"
                     /db_xref="GOA:Q4Q1G4"
                     /db_xref="InterPro:IPR000560"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1G4"
                     /translation="MRRGIAFLYPCAVVVAVVVSAAVVLAAPMYKVELVQVVHRHGAR
                     SPLVDDNHTLICGTEFPCGFLNYEGQAMLVNLGEYLRHRYTEDRSVVSTPYFPYSWYN
                     LSISYTRSTDVLRTLQSANGLLRGLFPNNSDFFPAIHTVGSEGDVLLHSSMVPMIRAR
                     FNYAKQERRAACDQVLDRLMSFDQLQAVAAEVHSQGFCANYTLRSRCAERLCDIGRAY
                     ESTGRLGSLPLLNRHLEDVCAVTAMSSHFCFAYNASNPVHQKQGAPFYHLAKLLVSNM
                     LAHQQRETAPPYKLYEYSAHDTTISPLAVSFGESSMEAMLPPFGTAFIMELLSLTDAP
                     AASSRFYVRLLRGHSGAKPESNFTFALSHFDMRCRDATGNTYIATDNICPFTDFERFI
                     DSTAPTSPMGTCYLDPGLLLRMDCPIDTSGDNRSLSEDCLFYRKHCSNYSCGTGYYLD
                     AIDYNCHRIPANNSTTVSSPMSSGGIAALSIVLFIIGGVASIGGMEVWKRYKKFKGQQ
                     SEVLIV"
     gene            complement(<1040351..>1043326)
                     /locus_tag="LMJF_36_2580"
                     /db_xref="GeneID:5655535"
     mRNA            complement(<1040351..>1043326)
                     /locus_tag="LMJF_36_2580"
                     /product="related to multifunctional cyclin-dependent
                     kinase pho85-like protein"
                     /transcript_id="XM_001686783.1"
                     /db_xref="GeneID:5655535"
     CDS             complement(1040351..1043326)
                     /locus_tag="LMJF_36_2580"
                     /codon_start=1
                     /product="related to multifunctional cyclin-dependent
                     kinase pho85-like protein"
                     /protein_id="XP_001686835.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655535"
                     /db_xref="GOA:Q4Q1G3"
                     /db_xref="InterPro:IPR017946"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1G3"
                     /translation="MSLMNVCVYGLSSQMLEAFFVRECARSVQPLVASASSELRFGLV
                     GAGESMGVWGLKWPVALECCQCQRTPCVRVPYLSPLPHLCEDGQESSVEHYVAQVRLT
                     SQEIDGLRNQQSVAEPLSMLCRLVILEDAFFRVPRTPESNICATPGTVIAGVDQRYSQ
                     PSSLCITPFEHEKDAFTEGSGEALQWLAVLDVCRRHDASVTVDGNPLGRSRRGDAATA
                     SVCFGSTGEQFAFLYNLPALPPRPIPPVPVTVSSGMAFLASEADADTSVCSASDSIPP
                     FCECGPDGGECATVGNPGPLLSLTFYANDPTQPFDQAAWQSELTWHQSEVMRRRMRET
                     PDGVLPTTVCQVTDVRPIPVEGSCWCHSKLPIPALLEQQLNEMRMRRSSAAAARNGGR
                     DGYRASIPAMSSTSSVCTMNSSHSGRHHTHVESSRRSARGGATQPSAGFLAKGWCVRP
                     LQTIKPVLPLTGNVDSTGRAPLVTARTQHVWTCLLNLHELDDFAIEVTVKVPYIADGT
                     ELSLQGNTVLFSGMLRSSTSGTVLLPVYCPAPEGAPAGVTSLWMKLYVQYLLVFPLEG
                     CGQHGPLEIVRSSETFAWLTVPTLIGHRGLGKTYARSPSTSRGAPFVIKCSENTIPSF
                     QAAHARKCEMIEFDVMLSKDRVPVVIHDPLIELMALKREGVRACPGKAEYTPVRAEVH
                     KLNYTRLRDLHVQCCKSVDRVFPTKDLLIHHWDSLLSWARKCQPKVMRGSSSSSQNDM
                     CGGSSARTVESSLMGVEDFPNGVPSLREVLEQTPPSLHFNIEVKYPFQPLIDSNLFLQ
                     SDAFEVNGFVDAILRVVFEFSDNGRKITFSSFDPNVCLALALKQSRYDVLFLSDTKEM
                     RDLKDYRSFYVEGAIQFASAQHLAGVSVNAGTLLSPEDEAVLPNIPEEPLHGSAERGP
                     VTAELFHADDPQHAPPTVPSSFGAYGRAMVAEMHHRRLKVWTWGDMNSYLYFAYAQAA
                     KMRVDGVIGDRMPVFSSTS"
     gene            complement(<1046527..>1048242)
                     /locus_tag="LMJF_36_2590"
                     /db_xref="GeneID:5655536"
     mRNA            complement(<1046527..>1048242)
                     /locus_tag="LMJF_36_2590"
                     /product="putative membrane-bound acid phosphatase 2"
                     /transcript_id="XM_001686784.1"
                     /db_xref="GeneID:5655536"
     CDS             complement(1046527..1048242)
                     /locus_tag="LMJF_36_2590"
                     /codon_start=1
                     /product="putative membrane-bound acid phosphatase 2"
                     /protein_id="XP_001686836.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655536"
                     /db_xref="GOA:Q4Q1G2"
                     /db_xref="InterPro:IPR000560"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1G2"
                     /translation="MACFARLGWAAVLAAVLIACAISIAHAQSTIARDGAADAKDIMK
                     VLQVNVLHRHGARSGLPRENTTEICTESPCGYLSWAGIEMLLKVGSFLRTRYNTDPSV
                     VSSPMFESPNYDLDVAYSRSTDVLRTLQSAEAFLRGFFPNMSSLYAAIHTMPESTDVL
                     LNSNTQPWLKFFYSNNKALLRAVCNPLTDELFPNWKDITKIGAEIYQEGYCSDYETRS
                     DCVRTLFDIAAAKKAIGELNQYPLLEANFEKLKRVTTALFDYEYHYNHSDPLMFRQGG
                     RGQPFVQQLVTNMEGVIEGSNKYKLMHYSAHDTSLGPVWGTLGDRTPDGMMPPFAQVL
                     VAELLQNSPTGAHYVRILRGNPGQSPDTKFEFEWDSKWEMQCIDALGTAYKAEGNICP
                     FADFKRFVKWSEPADARGYCYLDQVSIDIAGCPSEPVAYGTPPTALVSSTCQFYRSAC
                     PQFACGIGETLNSVSMQCVCSKDSCLGGKTNEESSGDAAVDTDKKPTLRESNGLSAGA
                     VAGVSLATFCAGAIIAVAATAAICVCKRRSQYQQHVRMSSTVEEGNQLNDEREGAAKD
                     FKEGI"
     gene            complement(<1049558..>1051720)
                     /locus_tag="LMJF_36_2600"
                     /db_xref="GeneID:5655537"
     mRNA            complement(<1049558..>1051720)
                     /locus_tag="LMJF_36_2600"
                     /product="cyclin-e binding protein 1-like protein"
                     /transcript_id="XM_001686785.1"
                     /db_xref="GeneID:5655537"
     CDS             complement(1049558..1051720)
                     /locus_tag="LMJF_36_2600"
                     /codon_start=1
                     /product="cyclin-e binding protein 1-like protein"
                     /protein_id="XP_001686837.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655537"
                     /db_xref="InterPro:IPR000408"
                     /db_xref="InterPro:IPR009091"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1G1"
                     /translation="MFAVVPTAAAAPTEAALYSLADSAKSVADALRPFLDASPSPTAS
                     LMPLYTIEKVVSCKAVYSALLRSDGVLLLLSHPAADGAASSAHVSVLESGGEAVVDVA
                     AGESHIVYCTVSGSVYSCGYDNTYGQLGDGSVWSSNDAADGLADEQNVGGVREPVLSA
                     PRRIAGFGEGALTDGAQREHLSSEDTGTPLSSLKDYRVAIDLAPLPSSLASCTRSPTA
                     AAKSTSTGDSAASWRHVPPPADRHIKQVACGAHHTLMLTQSGRCVYACGTGAHGQLGG
                     SRPVLVQSTFRAIKLLFGIDMAQVAAGDAHSFVLLRNGLLYAFGDNTCGQLGLGHTKR
                     VSHPTTVPLPQKEEYKAPIALDHAAATTKGHRQLDAKAYATLRAPYASTESTYYPLRV
                     PRLQDNGKPHAITGDDDRDSGAAFTAATKYGAHSHELEASNSSVRVVRVYCCVSWTLL
                     ETTNPGVWLSCGVPLTRGVNRADVATTAARIDGCGVLGRPLLRNKAEAYVFQPVNWAA
                     TLFSTRQNVDAATDALAAPLAWVGNEQQVFSADPSHGAGEGTSDAPQLPGVQIHHRTP
                     CSISCEGDSSSCTPVVTTAPAAGHCSTADSRISSDAVLRFSHANKGIEKAILRVRDTL
                     VSAYPTSLLVAFSSANAGGVGCDGVVTSMLIQSGSPAVVALEVRPDSSSGVHEVRGSP
                     THASMDGPLSAESSGTTVLQVNSTHGAVIPLPSYVLVM"
     gene            complement(<1053250..>1054863)
                     /gene="FPGS"
                     /locus_tag="LMJF_36_2610"
                     /db_xref="GeneID:5655538"
     mRNA            complement(<1053250..>1054863)
                     /gene="FPGS"
                     /locus_tag="LMJF_36_2610"
                     /product="folylpolyglutamate synthetase"
                     /transcript_id="XM_001686786.1"
                     /db_xref="GeneID:5655538"
     CDS             complement(1053250..1054863)
                     /gene="FPGS"
                     /locus_tag="LMJF_36_2610"
                     /EC_number="6.3.2.17"
                     /codon_start=1
                     /product="folylpolyglutamate synthetase"
                     /protein_id="XP_001686838.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655538"
                     /db_xref="GOA:Q4Q1G0"
                     /db_xref="InterPro:IPR001645"
                     /db_xref="InterPro:IPR004101"
                     /db_xref="InterPro:IPR013221"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1G0"
                     /translation="MSVSTLHPGVLAAGSAGRASPPPPPLQRAQSRVVVHNLGEDGCA
                     GEGATSAAAGVSKRRHRSFKDAMEVVERMTGRRPNRCPDGFETTKRFIDRLGFAPILE
                     RIRFVHVAGTKGKGTTSAYTAALLQAYGFKVGLFTSPHLTDLRERTVVDGRLLDENAY
                     AQYFFDFLDKYEALQYSDSQLDRDIASPSRANFFRFIFLLSLYIFEQEGVGVAVMEVG
                     IGGRIDSTNTIPSEVSIITSLGYDHMDILGNTIQEIASEKAGIMKPGVVCFAAPQTDH
                     PETRSVLEKHARKVGAPLVLLDQNVLPIRSWPKLAIGGAHAIEDSKLALMAARRVASI
                     PPILPLDEVEKSVLQSMTYAGRSQIAAVDGGTNITFYLDGAHTVESISSATQWFLDVS
                     ATNTRDPAPRRVLVFYTSRDPKRVLKAFMPYVPHFCKVVIAQVANPRMTSRSADPGDV
                     EGKMSELRERMVTTTEHWRNMYREVTCLPCARPFSALEDILDLVVPAASDNEDASKPA
                     QVFVCGSFFLVGDIIKLLKVYEAGGRRPE"
     gene            complement(<1058459..>1063636)
                     /locus_tag="LMJF_36_2620"
                     /db_xref="GeneID:5655539"
     mRNA            complement(<1058459..>1063636)
                     /locus_tag="LMJF_36_2620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686787.1"
                     /db_xref="GeneID:5655539"
     CDS             complement(1058459..1063636)
                     /locus_tag="LMJF_36_2620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686839.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655539"
                     /db_xref="GOA:Q4Q1F9"
                     /db_xref="InterPro:IPR014883"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1F9"
                     /translation="MSADADRSPTDPFLNPRRSTGASRSRADNDGAMVVEVVHDGQTT
                     PSSSAAPAAPFATRGRPSATVARGESPKESMAHLASNAATSTSAAAMMPHSRKRERPA
                     VALASAGSPTSTTAAPPLVQKRRIARQQKSGATPSLSRRAGSAARTIVDRGQHSAKDR
                     CDEDALAEGAGGECGSDHAEGYASDDDEEGDAEERALVSASIALMAGQGALTAPSAAS
                     ATPHSWLVTDAFHVCLWYVLRYAGRALSVEDLWACRALLSLTAVDATEEEDGGERATA
                     PFAAEQARSANMRFDDWAWSGSEESELLLRLLLRHAHSFTARHLELRYGDWLHVQLAL
                     NALTQRRFLWWATKQASLDSAGGGAEAVCLHGAEEDAATDLTETPLIPADELACTEMA
                     PSPLVEHYDGARVARLLLSCCDEDWPQHRHATAVSKSASTFSSVETVIRVAQAVRATE
                     LRTFLTTLRHCSKARALMDERARGGDGCITTRAIAPTTTSTLGTSGNVLCKDGSVGGG
                     IMAEPTPVLRPKSGDWTDDVACVRPGQISHNSLYDVIPGRKRDMIRYLAERRYSVWVP
                     SSTVNSSPAASATTDAATTDTMMPSHGPPPTEPHALSSVPLTTRPSPRGAVRCTSVFA
                     SAPDRSPFRRCFPTVSLEADAVAQCWDRIIGSVYVPHSGLRQHLTWITELFHVLTSNN
                     GAGMVSGQGAKAVAATMTVATPPTLLMVRPQLLLLLQTLGAARHQARPSLTEPSPSTA
                     AHPDPKAFKESVPHALLPQWCSPPPVVKATKVALPRVCGQLHRDISSNGRAANKTESQ
                     PRPDASAKLNDSHSSLMDTIVHTSRSFQDFGAAEDGTVTQVWPTPPHVCLFSSPVTLQ
                     EYRRALSTQRELYCVTEGAVTVAQRHRGKSSTFVSHMYDTVMAAVRAGVAAVKQHPHH
                     ARTAASASLASVKATHLGSMHPPVPPVVSEAAPLSKHFTQSVTASLESLVYQQGCHAE
                     HLLIFTPLYRWFACLELLFPLLQSARRYDDANACLHHLLYEPIFVLHHMPVSSARCPI
                     SPVTYAFRYKPHKRGKWLARLAQNLSHQKRYAEAFAVLEEAQAGYRELASHTADDARS
                     VTNDKWLPCDVMSNSTAAALCDVLAGNHSPASESALPLKVQRRGRMLRVLWPAAASAK
                     FATGDNNASPPAAEGLSPDSLALLHAAWEYVRDRYYRRQDRLTLERLLAMTHRKVRQW
                     TPLAAHLEFATRRFVDVAMRRIGGVRDKLDRMLWREPSGQAPGCPSASAGGVAEAAKP
                     TTPSGVLHPQRRPALPVELLVLQHYLSRWNGTSRTTAADSNPAADPQHRRRKGTLTTN
                     SANEQTEGRDNAGGAKLTSLWCGVHCEGQWIACLARALLWDCYWAFPFVSSPLDSFPV
                     SARDHESDQPLPPTSPTHEVLWLSAFQDGPLDLTTPIQFLWRRRALIEARLAQLERCT
                     REELIAYVGARIKVEGNTDDKALPSKLKTQGRDAGVEAPRKEAHGVQRADEDKGYSRD
                     EEQARRRRSRDEYGCGPHSHSYTAKVEEEFRGSNGEDSVQIAPSLPATPLLSTGSETS
                     LLVLGRVEQERNAEAQRVESVKDSADASLSPRAPTLAVPEAWKVPVRPLPLLDILRAI
                     PLKPLWRLLRCLYLSPVTEGVPLAFSGFPDLVFWLTGGSGGSECGNAAVQPSVGSDSA
                     ALRTSFCLMEVKGPSDFLSTKQIAVNDLLHRCGFEVCVVRVDEVYDDGQRVSTKRIR"
     gene            complement(<1064874..>1075253)
                     /locus_tag="LMJF_36_2630"
                     /db_xref="GeneID:5655540"
     mRNA            complement(<1064874..>1075253)
                     /locus_tag="LMJF_36_2630"
                     /product="putative protein kinase"
                     /transcript_id="XM_001686788.1"
                     /db_xref="GeneID:5655540"
     CDS             complement(1064874..1075253)
                     /locus_tag="LMJF_36_2630"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001686840.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655540"
                     /db_xref="GOA:Q4Q1F8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1F8"
                     /translation="MTLNQLKSWPSKYPTSALEDTAPVRLCANSPTTASASPATAPAT
                     SKTPMSVLYSVLLRASVSRSAVAKNPAERSPHPHTVYGIDSTVREAVRAEVERLFPYR
                     GAFAESRGGADVDKATPAQRFFGSASTVEEGERSGCLSACVARVNVYRHISEPDTHNP
                     RAPEPSTTTAVAATDTPSSSAARETSTSVLQKLSGGPRVIIKSLQRKKTLAVMGATRV
                     PAPSKPESAEAPKKLFAPLLAENSIGVGGVIRDHKASSCTSPSAIADTSHCFTVVSAT
                     ELPDMQRHLERLFDDFAVAVEQCRAALDQQQLRSSSPAAWQTTRGTRGVASEEPSESL
                     LGEEASASQHPQLPHCTNSNHRPGNPTLLSTDVLPRHNSHHPISDLLSSECIPDEWRH
                     DYDTGTTTNGSRCTPSARSASGESLRMADGSAPETKPSLEAEDFSTGIFMIAHTIAEH
                     LHAILHPTTTLAALEEEAVAALRGQGHDHSSGGGGPTALNAVPTARRRIHTGAEGEDS
                     KLTNPASFSSLSPLPALRSNGLQSPSGGSSASLELRALRQLVHSLFWSRITAFLSSVS
                     LKAPGKDCPMWLSTAAVEQREACAYVQLPFWIWLYAACGLATDVIRAQQEAQRAFPIP
                     GQVTEPRKTLTSSSATASAPPPPSLSQLLPTVETLARQLQRRQYERVESTAGTLLTAN
                     TFLSFTGVRMTDKAVMKRLFPLQSGAAASDALGFAILSPHSAQCITHEASVVTESSSE
                     SLTTGAFDSAAVPTLINNTSSGRPISAEHTVSVLGGAGSNVIHRSSSSDGGAPVSSSR
                     QGQVAISVALGDTGNTAAYVAEEEAPQVYSGSYSGPSTVELYLQWLESADAARLAACS
                     SQSEAERFPDRVDAEADAAGEVAAPSPTSRPYRPDTIGCMQPHVLSYAEDGQVSNGDG
                     DIAKGNSSSREDRNSSDSSFSYTTVQRPSEPFRVAAVMPAAGLAPCLGRVEKELHQAR
                     SAVQFARKLGTLYATQDMNTLLQLLPAVAYEEPVSPNVNLVSTRADGGAVESFGGAFS
                     PRSGTDSTGAPAAPATPAEGVHSQYAWTGTPTTSSPMTGSVPPLVTPPQVAADRMPGN
                     HALFFHRVKASATPPALFPSVTSLSLEKRLLMERLDSCAAAIVSSSYQLFVDSARALE
                     VSFSLAVVLLSHVMGEAVPKGEAASAGQAAAVASGSDNSPSAISAKTGAATTTMVVLK
                     RLPAKVAAAALSDKSKGRATAKTAAASPPPRPLSMDLAKVFGFGRSHLRWQNLSAYVR
                     ETLISVALRALQRKDVAMTQELLQCITLDMAIAHHYDQVRRHHPVLKPARAKGVGDTR
                     KVSGSTLKKGRCAFKAGGRKVTHLSAPPHESSASFVNVWFSSFAHLADTTTHLLHGDH
                     NAPSSLKGTVWHLAALAHYFLLTRARGYDMYGGQSHLCSTTLCGHGSGNSAGVGVRTS
                     SATSSAALQSFITSQLVEPAGKVLGVVVSFMESVCQALSAEIESGGAAERQFREGVMF
                     VDNSSDDESLFMCRAADDSVRSGSAGESTSLYSDGGDGGYDMAANRLETSGLQTCWME
                     LAIHYFLEIVDVLLDAALHLPEKPLYLYQLTVSACNPGSPSIDFADTLSAAVLAGGAG
                     SPLLWGLGDLSSSVAATAPQVAADSPLDRVQEFLSMYTSMVLQSAVTHFTVESRHAHS
                     QVATARETPLNTTSVADETSEDDWLRTFWERMLTSVAAPANPSALDEVKFTARQPLPS
                     ASTPTSSPAANPAVSLEAPASRSYTRRTMWWPDVRFHRYSHLIRIVEHAQLVSLYLNS
                     CAGNAPAQTAPLTSYLEVSRAPRDRAPLLQVSAVTSLLNISTGPCAQLLSIPYACPPS
                     AVDTRSSSLVSGSARTTSYERCYFHCTGSPADQSPPRFLAGAHRRVPADRAMREVCGG
                     LWIRVELLRLLRLAAAPLDADTFMSFTKTATKVATQVRDRAMQSHYTAIASMKAGVES
                     VLPKTYASTYVRLLFLRYVQAFYADVHALSVSRAATAPDHTTSERVDGTSNATPLTRS
                     IDQRTALATHADLSTHGDVTPYRTLGSPQTRSPVSKLQHLRQRLWTHYCHELLWALRE
                     LCCSCAEAHETAANLSVASVFGRLLQMISGRGELEGDEVIDDYDDEPEDKFPDEPHLD
                     LKDVGVSVIASDRALEPYSTAEGVRMEGFVDFEVSSLDSSVTVVPGMSEGRRRPPGQP
                     PNSGSSDDFESRLEPSWSARRSPVSKVSVEAEQQVMIGISDQTPVCDFKERRRLGSND
                     HSISGGTQAMVRGKTPLATSSTPVSTSPRSPVTAPPVVQRLSLTGLKPPLYFTSSGDT
                     AAAQENDFYKEQSEQRQMAKEPMEHFLSTTGMSVVDTASHLSQDDDGECDVKYEARPD
                     ALESTSEHTLLKSTSHEPRESYSTANASADSATRGDAPKPPALTIPKLFLGALSPPLY
                     FTSTGDTAVFAERPMSPSLARPPAQVFSALNWPTAAAPAVVSAAHVDPAVRGAPLKGA
                     AEAANAPTLTPPPAPVLPTSSSTTVNGFVLPKLSFGSLGPPMYFTSTGDTGSFVEAQN
                     QKPHAVAGAAKSAQILSDTTRLQSGLTAQGTASGGAANTATATAEAITASSCPTAATA
                     TAHFHGSHSSDESSLHPVFSFADFAPTGGKVSRSGNASDEGGSYAGCVDEQYSERRAA
                     RRRRDSGLSLNSLTAPEGGPFSMLTGQRHCKRVPRTSRPVLTPIVAPAVTVELILCIC
                     SIIIQQDSGMIQYAYTVSSLTQKRVLPGKSSSSQRRWHAGSGGAAGASGSAFTQRSDA
                     AQTDRWRYTPQHSPSSFHVIQAMHNYLKDSRNSLVIDLLEEWVLDEYAAMERVRMEQF
                     ESAYPSLRQQECSSQPPHPSCSHSESGGNTGNGVHHHSLHQPQAGGTGGGRSGKPSAA
                     VLAGRYVLLRLLLPRAITPLITQQNERRIGAGGYGTVTSGFVQKPGTGGDTRLPPGWG
                     QRGSRWRPATTRGSTAASGSGAGGGGTTPQSFHMGRSVAPTAERIAPGVLDGLRVPWR
                     TAVQRIAQAVCKCEVAIKHIPLNVQGSESGNLPLCHAEVLSMYRLRGHQHIIPLLSFD
                     NTKDEYILVLPHYTQGSLRLWRQKHYSLGCAVLTLPPGIRDSCKSGPMPTAAPVMTSS
                     TPTPAAAPSTSLFATCARCLLQVLKGVAFMHDHHIRHGDIKCDNVLITATDASAERGE
                     MDPPMLPSSVCLCDFGSCDTCDDDDIQSLKHDIMAGEARFLAGRWGVGRGTEAIQPPE
                     LMSAKRRYALFRRIVTALAPAAAATPATSSLFTLSERAERGSRASSFAGASAEDLPLR
                     SRGGELIESTGPQIMELLRRAELSVDIWACGCLLYEMLTGRMLFGEARLGRLLVLAAV
                     DDGEDQDPETAASKTSAAAGPLPGESRSLQKATVPTTPSVGADAGSIFTPSVSQKALD
                     DRERRDLEAAVGKRVVDFMSTLLDLDPLQRPSAHEALQYWKTIMVEAGLEI"
     gene            complement(1077909..1078010)
                     /gene="LM36Cs2C1.3"
                     /locus_tag="LMJF_36_snoRNA0068"
                     /db_xref="GeneID:12982076"
     ncRNA           complement(1077909..1078010)
                     /ncRNA_class="snoRNA"
                     /gene="LM36Cs2C1.3"
                     /locus_tag="LMJF_36_snoRNA0068"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461170.1"
                     /db_xref="GeneID:12982076"
     gene            complement(1078049..1078120)
                     /gene="LM36Cs2H1.1"
                     /locus_tag="LMJF_36_snoRNA0082"
                     /db_xref="GeneID:12983057"
     ncRNA           complement(1078049..1078120)
                     /ncRNA_class="snoRNA"
                     /gene="LM36Cs2H1.1"
                     /locus_tag="LMJF_36_snoRNA0082"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461184.1"
                     /db_xref="GeneID:12983057"
     gene            complement(1078162..1078280)
                     /gene="LM36Cs2C3.1"
                     /locus_tag="LMJF_36_snoRNA0064"
                     /db_xref="GeneID:12983063"
     ncRNA           complement(1078162..1078280)
                     /ncRNA_class="snoRNA"
                     /gene="LM36Cs2C3.1"
                     /locus_tag="LMJF_36_snoRNA0064"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461166.1"
                     /db_xref="GeneID:12983063"
     gene            complement(1078352..1078447)
                     /gene="LM36Cs2C2.1"
                     /locus_tag="LMJF_36_snoRNA0080"
                     /db_xref="GeneID:12983061"
     ncRNA           complement(1078352..1078447)
                     /ncRNA_class="snoRNA"
                     /gene="LM36Cs2C2.1"
                     /locus_tag="LMJF_36_snoRNA0080"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461182.1"
                     /db_xref="GeneID:12983061"
     gene            complement(1078511..1078616)
                     /gene="LM36Cs2C1.1"
                     /locus_tag="LMJF_36_snoRNA0066"
                     /db_xref="GeneID:12983059"
     ncRNA           complement(1078511..1078616)
                     /ncRNA_class="snoRNA"
                     /gene="LM36Cs2C1.1"
                     /locus_tag="LMJF_36_snoRNA0066"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461168.1"
                     /db_xref="GeneID:12983059"
     gene            complement(1078893..1078994)
                     /gene="LM36Cs2C1.4"
                     /locus_tag="LMJF_36_snoRNA0069"
                     /db_xref="GeneID:12983055"
     ncRNA           complement(1078893..1078994)
                     /ncRNA_class="snoRNA"
                     /gene="LM36Cs2C1.4"
                     /locus_tag="LMJF_36_snoRNA0069"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461171.1"
                     /db_xref="GeneID:12983055"
     gene            complement(1079033..1079104)
                     /gene="LM36Cs2H1.2"
                     /locus_tag="LMJF_36_snoRNA0083"
                     /db_xref="GeneID:12983058"
     ncRNA           complement(1079033..1079104)
                     /ncRNA_class="snoRNA"
                     /gene="LM36Cs2H1.2"
                     /locus_tag="LMJF_36_snoRNA0083"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461185.1"
                     /db_xref="GeneID:12983058"
     gene            complement(1079146..1079264)
                     /gene="LM36Cs2C3.2"
                     /locus_tag="LMJF_36_snoRNA0065"
                     /db_xref="GeneID:12983064"
     ncRNA           complement(1079146..1079264)
                     /ncRNA_class="snoRNA"
                     /gene="LM36Cs2C3.2"
                     /locus_tag="LMJF_36_snoRNA0065"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461167.1"
                     /db_xref="GeneID:12983064"
     gene            complement(1079336..1079431)
                     /gene="LM36Cs2C2.2"
                     /locus_tag="LMJF_36_snoRNA0081"
                     /db_xref="GeneID:12983062"
     ncRNA           complement(1079336..1079431)
                     /ncRNA_class="snoRNA"
                     /gene="LM36Cs2C2.2"
                     /locus_tag="LMJF_36_snoRNA0081"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461183.1"
                     /db_xref="GeneID:12983062"
     gene            complement(1079495..1079600)
                     /gene="LM36Cs2C1.2"
                     /locus_tag="LMJF_36_snoRNA0067"
                     /db_xref="GeneID:12983060"
     ncRNA           complement(1079495..1079600)
                     /ncRNA_class="snoRNA"
                     /gene="LM36Cs2C1.2"
                     /locus_tag="LMJF_36_snoRNA0067"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461169.1"
                     /db_xref="GeneID:12983060"
     gene            complement(1079877..1079977)
                     /gene="LM36Cs2C1.5"
                     /locus_tag="LMJF_36_snoRNA0070"
                     /db_xref="GeneID:12983056"
     ncRNA           complement(1079877..1079977)
                     /ncRNA_class="snoRNA"
                     /gene="LM36Cs2C1.5"
                     /locus_tag="LMJF_36_snoRNA0070"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461172.1"
                     /db_xref="GeneID:12983056"
     gene            complement(<1080921..>1082576)
                     /locus_tag="LMJF_36_2640"
                     /db_xref="GeneID:5655552"
     mRNA            complement(<1080921..>1082576)
                     /locus_tag="LMJF_36_2640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686789.1"
                     /db_xref="GeneID:5655552"
     CDS             complement(1080921..1082576)
                     /locus_tag="LMJF_36_2640"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686841.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655552"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1F7"
                     /translation="MEHQYFFIEATWLEAAAAGICSRNGIILKDAIAKAEKGIPVQIK
                     NDSAPTMRSLIQTTHASLEQACERYLHQNARNLRLTRASKPTPAVEALNEAERASCRE
                     LVVRIAITGALTQYQRCTRKCILQDSSSLSPSLSHPAVSASKTVQGNGVTDKQLERSF
                     QTTLLKGLLYAFESFQECHSMNRDHYPPRVDSNTPGTVGWDTLVLLYLVHRIPQVARH
                     ASGSAIDDCIGQVIRTWRKLLVALQSVDAQEAPEHSRRRGALSLVNGLLIILFQRYNT
                     HQCAVLLGAVEHAETVAESSKEPARSILHPSRHMVSEVVTYHYYQGRMRLYERKLDEA
                     HRILRIAYTLLPPAGFGNEPQRLNKERVRFFLSVAGVANGRRIPDEILRADEDLLPRL
                     FGSLTAAIERGDPVCFSAALDSHASTFHRRGVYLILQQAKILCYLMVVARVHAAMAAL
                     SDVDNSRITIPTLLAAYTYITSEKPQSGKSSAESKKRSRDDEAVSPVSEARMAESVMD
                     EDRMALWIAKLIARGYVRGYYSHEHKTLVLSKKVPFPLLQEEV"
     gene            complement(<1083310..>1084332)
                     /locus_tag="LMJF_36_2650"
                     /db_xref="GeneID:5655553"
     mRNA            complement(<1083310..>1084332)
                     /locus_tag="LMJF_36_2650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686790.1"
                     /db_xref="GeneID:5655553"
     CDS             complement(1083310..1084332)
                     /locus_tag="LMJF_36_2650"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686842.1"
                     /db_xref="GeneID:5655553"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1F6"
                     /translation="MSANCAGPASTPDAKKARVEADVITEADRVPAFPLPPTDAAAYE
                     REHVHNVYSAIADHFSSTRYKAWPQVGAFLEGLPPFSLVADVGCGNGKYFSAAQRLAL
                     TAPSHPMTTSGASLEMKSRQQAEAQPSPPLVSFAPAHRYVLGLDYSEELLRSTQRQLV
                     DPNMHHAQRRRRLSGKRAKNEAEAVATPVSAEELPRTDTVRSDALRCPLRSGVFDAAI
                     SIAVIHHYASRERRRLAVRELLRLARPHGGRVLIYVWAREQRGHTKRLVDPETGDGLV
                     RWERNQKYDGAQQVFRRYYHFFAEGELEQLCKDAASDDGTGSIPVAIRKSYYDKENWC
                     VMLERC"
     gene            complement(<1088003..>1089394)
                     /locus_tag="LMJF_36_2660"
                     /db_xref="GeneID:5655554"
     mRNA            complement(<1088003..>1089394)
                     /locus_tag="LMJF_36_2660"
                     /product="putative dihydrolipoamide acetyltransferase
                     precursor"
                     /transcript_id="XM_001686791.1"
                     /db_xref="GeneID:5655554"
     CDS             complement(1088003..1089394)
                     /locus_tag="LMJF_36_2660"
                     /EC_number="2.3.1.12"
                     /codon_start=1
                     /product="putative dihydrolipoamide acetyltransferase
                     precursor"
                     /protein_id="XP_001686843.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655554"
                     /db_xref="GOA:Q4Q1F5"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR001078"
                     /db_xref="InterPro:IPR004167"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR023213"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1F5"
                     /translation="MLRCRAVSKLATLAALRFLTITPIPMPALSPTMEKGKITEWCKQ
                     PGDFIRPGDTFCNIETDKAVVSYDNATEEGFFARVITSPGEETVVGQTVCLIVDEKEG
                     VHSDEVKNWKPEAEEAPAAAAEEAPAAPAATTPVAAAPVAASGDRVKASPYARKMAAE
                     KNVSLRGIKGTGGGVGRITSKDVAAAVASGTASSAAEVAAPAKTAATAALAAPAKPAA
                     AKGTPPANPNFTDIPVTTMRSVIAKRLHQSKNLEIPHYYLFDDCRVDNMLALIKQLNA
                     KGNGEYKITVNDYIVKAVARANTLVPEVNSSWQGDFIRQYATVDVSVAVATPTGLITP
                     IIRNAQAKGLVEISKETKALAKKARDGTLQPSEFQGGTCSVSNLGATGIPGFTAIINP
                     PQAMILAVGSAKPRAEIVKSEETGEFEMTGRVENVVSFSASFDHRIVDGALGAKWFQH
                     FHDAMENPLSLLL"
     gene            complement(<1090331..>1091776)
                     /locus_tag="LMJF_36_2670"
                     /db_xref="GeneID:5655555"
     mRNA            complement(<1090331..>1091776)
                     /locus_tag="LMJF_36_2670"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686792.1"
                     /db_xref="GeneID:5655555"
     CDS             complement(1090331..1091776)
                     /locus_tag="LMJF_36_2670"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686844.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655555"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1F4"
                     /translation="MTFEIVLLALRAAALRVALSKPEPFHSSPSIALVLFSLSSFLSM
                     PLPCACVRERGRAERCRARAQRRGGCRPITCAPPFSSILLALEADFYLSKAYGLDQRS
                     YSSVHFLCVFCVAMTVGAAALCEYYGYLPRLVRHTGLLPSTRTSVTSSMAATVLQSSL
                     YEADPSPPVRSGEFELPSTYSLHKPLVYDIAALPPKPVSSLRLVIISDTHERHREMSV
                     PNGDVLVHCGDIQEGLNFVRDVKAMLIDFSAWFTDSALHPHPVKLIIAGNHDKAIAAM
                     STEDVRRLFAPAVYLCEDSVVVEPAGVRFYGSPRSISNSRWSPNTAFQGKKAWKRFVF
                     ASARQDDEAGAVSTASRCSSEQPLRSRLEGATPGGPVDVLVVHQSPDIPRAHHSVSEQ
                     PICAYAQQVAPRRVLLCGHLHGAHGMHRLPVPEHVRKSFRIATRGGGGQPEGVVRMDE
                     IPHLPCINAAMMTGRFGQNVLLPPSVVDLEL"
     gene            complement(<1092218..>1095235)
                     /locus_tag="LMJF_36_2680"
                     /db_xref="GeneID:5655556"
     mRNA            complement(<1092218..>1095235)
                     /locus_tag="LMJF_36_2680"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686793.1"
                     /db_xref="GeneID:5655556"
     CDS             complement(1092218..1095235)
                     /locus_tag="LMJF_36_2680"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686845.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655556"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1F3"
                     /translation="MSLEDAINLLREVYASTNNDRRKSCTLQLLQWEKALRAADAVRI
                     GIELLKTSNEGVAVQAYGAVLLRHALHARVLQPTQLPLMDLLSWYCNEPTLGPLLRAD
                     LMELLIECVIYSDDAVIGQVLGSLCTGIESQLRRMLLLSEMTVALVDPDFDRVPRECI
                     GKLKRSVTKQGSQLLNAATMSLYTYYMTSGGEQSTALAPDLEPCVEAALKVIGALAPQ
                     LPFSVWQEHNLAATMEVLLRWAPAQRPVLACATSLLRCYSAGDAHKAAILRVLLSIVL
                     RKIPALVASGDIAALDEILNLALELPKDFVQLEGVLLVQSIMSVFSIPSILFGQEAVQ
                     LMERMGEEAFRHVDTIEIYNGLRLLLPKNLCHPMHGTNPEGQELSREQFGFEQLFEEV
                     FSDFRRGASKILTQLARMYPERTNQYLLSLLGDLPDPQGTPGDPRTRSRFVRQSSLTF
                     VYWEATQFMMEYLSAAFECSTVSVNACVSTLLAHEPSDAVLRPVYFNMISYFWKVRDG
                     DVMNVWEGTINILLNCINDESSRYTDDIDVSAARRRAHTLLVQMCVEHSRRFLPQMPS
                     LIKQLEPTLMRANGMERSLLYEALIALTAVLPAHESDAYLQTIVNPLVNMLATSPALK
                     DQNAFNNIMCAATADDKDARGVLQGCLNTIAAVFRRCQMTPYVVEKATQLFPLVGQLL
                     LSIHSMQPSDLPPEYRSILEQEAGERDLFLPGKTRKSDAHVVNAVRGARATLMNIRIA
                     LYQVFGELSPILPAERFGEVITALTTSARIPTHVTRSLTEKCLLPIGKEHPTLLIYIF
                     QLLHRFFAQRKEQVRQQRTAEANARNTRDDVVESKQWLYYAKDVTKFIRSHVLDSHLW
                     KRDKTLFLATAEVAMSIFESGADNRTAQSFLISIVNLTTDTAVLPEVEAALSEVRVVV
                     YSRLVSYVTLTPDGELTPSERENVAYAISEPYVRLFPNLTPSLTMAGMSQEQQETLHA
                     HLLIVGNFAGQRRKVKEFLINIAKANAGVSGRV"
     gene            complement(<1096072..>1097040)
                     /locus_tag="LMJF_36_2685"
                     /db_xref="GeneID:5655557"
     mRNA            complement(<1096072..>1097040)
                     /locus_tag="LMJF_36_2685"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686794.1"
                     /db_xref="GeneID:5655557"
     CDS             complement(1096072..1097040)
                     /locus_tag="LMJF_36_2685"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686846.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2685"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2685"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655557"
                     /db_xref="InterPro:IPR001646"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1F2"
                     /translation="MRGTTSRLLFFCFLISHHLSTLPNTEAALLHERRDCAAMSRRVN
                     TEAVSQILEALVLLRSSRLAETSTAGSASSVSSGYSTLEPGSTSEAAVDCARRLLRDC
                     VVSAIEIEPTQPDPSSLLVAEADPSMAAKKSPFSLSSAAAWRPRREIGAVLEGRDLHR
                     IDLSGTRLSASFNRSDLSEAVLLGTYFAHCTFNLCDLRKANMAGAQFHSCTFLSTDAS
                     AAAARRAHFSHCMFHRADLSDWDAAGATFFQCSFTLSDLSRWSLDGQTTVVSPTDWGR
                     CRRLDWVMKPGSSVRECRVFGDANAANALSLAPAEKSSCHPSQRHH"
     gene            complement(<1097624..>1098643)
                     /locus_tag="LMJF_36_2690"
                     /db_xref="GeneID:5655558"
     mRNA            complement(<1097624..>1098643)
                     /locus_tag="LMJF_36_2690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686795.1"
                     /db_xref="GeneID:5655558"
     CDS             complement(1097624..1098643)
                     /locus_tag="LMJF_36_2690"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686847.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655558"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1F1"
                     /translation="MPLVKAETDASFVAEVAESVGGACARMNDHISVMIEEYLRRRTQ
                     QVRDDVKQELDAVRVHLERKIADAEAAKAVEEERYHKKKVQVLQAAVELQKMHANLHL
                     QRLFHTWRRCADVRQERRRLAEEAHIHIGRLSLFHAYMQWRLFAAALRQKRLEAKEAH
                     KRDCREQELLGQIEGYQRQLEGERAKDASLNEKLKEAFVRGMCALNREAVHVLHGSEE
                     NQDADVEAIAEILSRESHSRHRSVTPGHMDSSTLSNVHGHGVCPVHHIDAKGSFYHPC
                     FSPGYCEYDRHSGSRAPVSSAVPPSASGPFVVSADPKSARSIDSSPPVPFRHLSKSST
                     TRWRM"
     gene            complement(<1099569..>1103885)
                     /locus_tag="LMJF_36_2700"
                     /db_xref="GeneID:5655559"
     mRNA            complement(<1099569..>1103885)
                     /locus_tag="LMJF_36_2700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686796.1"
                     /db_xref="GeneID:5655559"
     CDS             complement(1099569..1103885)
                     /locus_tag="LMJF_36_2700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686848.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655559"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1F0"
                     /translation="MMSKARSGRSARCFSLSCKRCAGYPTQWSAVRHQSQSSLGRSRD
                     RQRGQPNADPNTGSQISVVESPDLTPHIQFGLNNLEHVKLPDMSDEARRRSDIDKERE
                     MRAKFGEYGPGERLTKSSPQMRRDMLEEQQDVDGLPWEVRWRKSLIPTSEEVIQDIRD
                     RFDLFVQDPIEREQEWYLHWKDRSFKIQKDRMIWPQGYTDYLDHYDENGRRRVLPTDQ
                     RWSDSSWKHLADTRYKDRMWLIEGEERKAVHQSLQTDRALLNEEEQRQSEMGDVYHGI
                     LSGVVDLDPDQTYQALSGTADPLEVAKTKIKLQAYGAHQALTAGKSELNPAQIDPISG
                     FPKTDMEPLPTGITVEQGAAIATQANIQYEMLEQGAEAARLAGHDPAVAMMKAHHNTS
                     KQYGDRPMLRAQVEANIQKIKELEAERQPLEAGKTADGEMVEKIESPLLEETAGGQPA
                     VSQIHIKASVTTNESGSGAVGASTPGGFIHVAERPKNVEPDVPNELFRVPQSRELNEM
                     PKWYRETLVETEPMIRQYGMVHDPLEEKQPEKEYYVPPPLRDDERVTLDDAPSGASAF
                     DEVKMHKLKSLPELVVGYKPLPLFREVSKNDSLEAAAEAQEKEAKEKKLVGKDGKPMK
                     RSERQRLERQERLRKSKLSYDSDILLPNLPWETDSIVDPYRGVEAVDAVEFNKEDLEK
                     TWRAYRDAFQQALTEFGNLTQVTSEDKCEKMLYDTMERFREGRVGDHPEVPKEQDEVF
                     RLVFEAHTKHFLADFYKFKGNRATEANAVKAEADEILRRASAKSKLLGRNFMNFVQEM
                     TSLELETIRKNPVQRYAVMVRDRKYEAISQPFMKWIKNELGEFMITEFQSAEQLEAHK
                     EFLHRHLNDAYIRCPSRVEGISDASRDAAVGAFYQWCRGALAFYTGKKFHSMFLDFAD
                     SRFRSRAEELYEDSIELFSNYAKAGKDIVQIPVPDSDPPYEYDEKEFLDGENAVFAEI
                     SGHLDKAEALWHSGSSKRWYPMTDETEYMWFNERRGRLTLATDISDRCLENVNKKTHP
                     SIHPFPESARVFLEGAPLTQETAEHLWLRYMGDLYWEHSEFMQRQGRFQTSRSYRDKC
                     LNLYHLAVRTARERLPASWKAPLLTEAKYMLRVYKPGDHVLQHLQDVETVVDKLFAQG
                     EPRHWVEPFSELPYRLAVVHANLPAYGEAITKEVHRRLKWQPSNELLMKDMEQRARGG
                     AVTPELVPYYNTLNAVAETVFRRKILQWRSKEYEGSDPFLFWTHMYFAFRVHPKDRDE
                     VQRMWDMYEPAYVYIYTQCALASRVRGHRLINDALRRLCQILLSGDRSQKLVLMEELT
                     KVREKMAHLIDRRELDRTINALEAHLENPAQQAYTYGTALLYKEAVLHEKITRNPLLR
                     TQMAAKEYTELRKRQEELRVNGTTLDPQEAAKMQEKEGGLDDAHLDAQPSLTTKEMFA
                     EK"
     gene            complement(<1104954..>1106669)
                     /locus_tag="LMJF_36_2710"
                     /db_xref="GeneID:5655560"
     mRNA            complement(<1104954..>1106669)
                     /locus_tag="LMJF_36_2710"
                     /product="metallo-peptidase, Clan MA(E), Family M41"
                     /transcript_id="XM_001686797.1"
                     /db_xref="GeneID:5655560"
     CDS             complement(1104954..1106669)
                     /locus_tag="LMJF_36_2710"
                     /codon_start=1
                     /product="metallo-peptidase, Clan MA(E), Family M41"
                     /protein_id="XP_001686849.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655560"
                     /db_xref="GOA:Q4Q1E9"
                     /db_xref="InterPro:IPR000642"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005936"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1E9"
                     /translation="MSYGQPQQQPLPSDLGTKERPIVVVSAPQKASWATRFWMFLLFG
                     IALSCFISLVEEFNDRFQEGQPANKSGFARSGISGLFGSVDVKPVNLDNLEVTFDSIR
                     GCDEAKKELEEIVEFLKDPEKFYNLGGRLPKGALLTGPPGCGKTMLAKAIAKEAGVSF
                     FYATGSEFDEMFVGVGARRVRELFAAAKANSPALIFIDEVDALGGRRSRSDHSTSRMT
                     LNQLLAEMDGFDSDEAVIVLAATNTPETLDKALTRPGRLDTTITVDPPDMKGRAEVAQ
                     VYLDKIKTDSTVNAMDIARGTTGFTGAELSNLVNLAAIRAAVLNKAKVTSEEIEYAKD
                     RVMMGAESKKIVPEEERRVTAFHEGGHALSAILLKDEGADPVHKATIVPRGNGIMGLV
                     QQQPDRDKYSQSKRQCLARLKVCVAGRVGEEILLGPDDITTGAGSDFQQATNMARHMV
                     RQFGFSDAMGFVDYGTPDTAEGAYISDETKLKIEKEVHRLVEQAYIETKELLLSHRAE
                     LENIANNLLKYETLSGKDLEKIIKGEAIPERPPRLSQAAESKAAPPRGGNSDQANGRR
                     TVPIS"
     gene            complement(<1107311..>1110127)
                     /locus_tag="LMJF_36_2720"
                     /db_xref="GeneID:5655561"
     mRNA            complement(<1107311..>1110127)
                     /locus_tag="LMJF_36_2720"
                     /product="transportin2-like protein"
                     /transcript_id="XM_001686798.1"
                     /db_xref="GeneID:5655561"
     CDS             complement(1107311..1110127)
                     /locus_tag="LMJF_36_2720"
                     /codon_start=1
                     /product="transportin2-like protein"
                     /protein_id="XP_001686850.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655561"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1E8"
                     /translation="MYTPTQGDLVSVIQLLHNNGVEVSNSKAAYAQLKQYESNPAFCI
                     LLSTVFGADTNPVTDMVLPVSWAQYRQLAGIALKNNLASARHALGEGAVKEAARFALK
                     SLTNPPDTRIARTSAQVVVKVTALTSLEWWVGSGVGDLPSILLNDLLPGGGLKTLAAL
                     YCLQYLVEDVSKQIGESSEHIILRVSQLAASQSAPMTIRKAAFRMCFNIYEQASLLDW
                     NVDTLSPLQMGLSKASHSLSSVCTSLLECSCGEDSAFVILVLRTCSFLLDYFDFFGQM
                     SQNEMQRYENWWITNSAQIICRSPNSISGKQELIAAAIDLIATTVDLYDRNGGETTVA
                     FLVSGVPQLIFSLAPALVRYALLSAEEVANIMDTDDYRVRDSTAVSFEVKGGTKDISE
                     DDMLDDDAAAMTLRSSALKLVDVLSMFSSDATYQAFIGPIQQLWSSSEWREREAGIVL
                     VGTIANGCAHELRAVLDSLVDQFLQFISNQSEHVCVVSIAMWSLSRISETVLNSSPRT
                     MDTIIPLLASRLQSTSKRIQITSVSALNVIYGVLENYGSTAVVMPHLPLLLDSVCACL
                     SVYSTTNLSLLVDFLNKLISLLNDRATAERLSSVLQGERANRASLFEQSYTAMYIREE
                     PNVLLDKDVFSLDRAIIAFISVYPSNEMAVANLSTWNGVLADIKNRSVTDDADLVFNT
                     LLICSAYTNTVSTTILEEWLRSTSWALPVSAAHFLTTSRIHEVKVAGIKILCGLLRAV
                     GSGALPTGLHDTLMRWATSEVSEAEDPQFKEHLVRLIGQTTSCYPGQLSTVATEALKS
                     ANAALRSDVFGDSSYYFSAMAFDLCGALGAVPNYAALFRIDTMSQLMAQAENTVDKSE
                     ATIYLFQALVQLPTDAFSGVFSSAIKIVYSWQQAAVNYPGTKEAIQSFLFHAGKTCPG
                     IFQSILEGLPAAFRNMLVSFYQLQ"
     gene            complement(<1116528..>1116986)
                     /locus_tag="LMJF_36_2730"
                     /db_xref="GeneID:5655562"
     mRNA            complement(<1116528..>1116986)
                     /locus_tag="LMJF_36_2730"
                     /product="putative D-tyrosyl-tRNA deacylase"
                     /transcript_id="XM_001686799.1"
                     /db_xref="GeneID:5655562"
     CDS             complement(1116528..1116986)
                     /locus_tag="LMJF_36_2730"
                     /codon_start=1
                     /product="putative D-tyrosyl-tRNA deacylase"
                     /protein_id="XP_001686851.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655562"
                     /db_xref="GOA:Q4Q1E7"
                     /db_xref="InterPro:IPR003732"
                     /db_xref="InterPro:IPR023509"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1E7"
                     /translation="MKAVIQRVLSGSVTSEGEVVGSIQKGLAVLVGIARDDTADDTEY
                     ILRKILGVRVWSNEDGSKMWCRNVKEIDGEVLLISQFTLMHVMKGNKPDFHNAMPPED
                     ALKVFNALRDKLRCEYAPHKIATGNFQHYMNIHLSNDGPVTLILDSKKRS"
     gene            complement(<1117516..>1120575)
                     /locus_tag="LMJF_36_2740"
                     /db_xref="GeneID:5655563"
     mRNA            complement(<1117516..>1120575)
                     /locus_tag="LMJF_36_2740"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686800.1"
                     /db_xref="GeneID:5655563"
     CDS             complement(1117516..1120575)
                     /locus_tag="LMJF_36_2740"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686852.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655563"
                     /db_xref="GOA:Q4Q1E6"
                     /db_xref="InterPro:IPR016182"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1E6"
                     /translation="MDASGIAASWTDLLAQSPSSPGDSSRVALSEAAALCLALEAPKC
                     YAVYRPSNSGSGIHRYTSPAPALATPQHFLQLLARLREALSTSAEAARIAEVLVDLLN
                     KPPHPHQPGPWDLTQNEVRAVKATAIQHVMDSMQGGGDALAWITRLLRLTDTCVGEGE
                     VTESEVPLLSTALSERYGLHGGSPTHRVHCGDADGEWLLTCSPVVLAAIAAAMLRSTT
                     KGMKAHALELLEAAALTRLSWTSLSSGKAVAGSYYRSDMQRGAPKALFDETVAVRCAE
                     AAAVQGDAETVTRLIFLLYRARGALGFATLAEHRQRRRSGRGGEGTWRRTSSGLLPRT
                     SSWFSARWSCRDDGAMAKRPALVEDDAADMRFELAVVRLLKSAMQALLYHPQRMSDPV
                     VCTVEEALSLWDGLRGAISWPGIAAIGAELLRYLADQHARLSVAADAGNGGAASDDVH
                     VRRAALQVYGHLCRAAPVRQRTAAQRDELNHFTSLMLRIFSAELAVIGSAGMLVPVAA
                     SITAAERILRLFANLSGPRAQEVALPYALAASLAIFAAAATQKGYSVPPSLLAPLAAY
                     FSETQSLHYYCVAAASAEVPAHVAVSGSLVLLHLLLWSSVPEGEWARGDGELWPLLQR
                     MQKVNETGQGADTVAAAPATAAAYRVTAWLRVSGDQQRSLLWLLLLSAKQRDTSWCSA
                     VVNVFSSPASSTVVNCAVSSVYAQLPQAELKSVVELLYACGNNDNPTQASQTLDRVVS
                     ASLQLPIRALTLQTLDAQLQKFSAGRQATSVLVLGAASIRALAERCATTLKKDADDEL
                     TVEGFLRVLQPLLVGPTAALPLRFTVVVLTPASLVELQRMYTGADDAPRHASAFVRTM
                     HDALVSRATPSAYQVRAASSWPLLPSLALALRKQKELQSVDGLREATAAARHLEHTLP
                     KESRPLVCLWVERETLFDSPHALSAKAEVLRHYGVREVSTHRAHVEKAKRDIFSLVRS
                     GAAGTVHPAGAQVAGEAALTEAKAARRTRHHSLLSAVSERSRRQRSA"
     gene            complement(<1122609..>1123085)
                     /locus_tag="LMJF_36_2750"
                     /db_xref="GeneID:5655564"
     mRNA            complement(<1122609..>1123085)
                     /locus_tag="LMJF_36_2750"
                     /product="acetyltransferase-like protein"
                     /transcript_id="XM_001686801.1"
                     /db_xref="GeneID:5655564"
     CDS             complement(1122609..1123085)
                     /locus_tag="LMJF_36_2750"
                     /codon_start=1
                     /product="acetyltransferase-like protein"
                     /protein_id="XP_001686853.1"
                     /db_xref="GeneID:5655564"
                     /db_xref="GOA:Q53HX3"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:Q53HX3"
                     /translation="MSAAGVTVRRAEREDTQRMYDLIMELAIYERAPECVVVSKAQME
                     EEGFGERPLWSAFVAELQETNDVKPRVIGMALYYYRYSTWRGRMLYLEDFIVTESHRG
                     IGAGKMLFERVLQQAKEEGCHGMVWQALDWNAPAIEFYKKYDAEIDPGWVNCMLKF"
     gene            complement(<1127356..>1129179)
                     /locus_tag="LMJF_36_2760"
                     /db_xref="GeneID:5655565"
     mRNA            complement(<1127356..>1129179)
                     /locus_tag="LMJF_36_2760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686802.1"
                     /db_xref="GeneID:5655565"
     CDS             complement(1127356..1129179)
                     /locus_tag="LMJF_36_2760"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686854.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655565"
                     /db_xref="InterPro:IPR010658"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1E4"
                     /translation="MFDSFKHTFSQTKYVAHREACGLHVIDEVKRFRALVCVLFCSIC
                     VSLVFAFDLFSEEFQSRFHLSDGDLSTISTVGVVFCYFVIPYGVLYDHIGPLPLLVIA
                     GVMGFVGCLGLGLIFDGKIKGNTVTISIFYAFMNTCSGLFDAASIVTLVELFPRNRGP
                     VIGLAKVMTGLGSSVISSINRGFFSNNISGFIYLIMVLTVVVALMAMLLIALPPYFVN
                     WWRARNKTEGQIAALTSLKDIYAKKFVPLRRIAYGYVIVACLVIFFATTAPILAYTKV
                     SRGGKAVVGGITVVLCMSFWVMALPIPWLGGVNEPAEQQSSTFDDTEGSKPNVLTSVE
                     PLETSNKPLSTSPLSDDDAARKQSLVSVEAVIEDGPQDPRYGGTIWETLMRPDIWLIL
                     IAFVCQSVLGTIVTYNGSTIYVARTGRPRTAELGSLYTSLLGVGSAVGRTSMGLFEAY
                     VQQQDPKNRKMLVTIALPVAPIIATIAGILILVLPGDALLLPYILVYFEEGVFNGVRA
                     LIFPCIFAGHHGILYNMSFFTNVIGVICFNRFLFGLTVDKEREKMGHTVEQGCTSHAC
                     VQTPIIVVTCTAAFAVLLATAVHLRYARFVKQCRKALKAAS"
     gene            complement(<1133012..>1135252)
                     /locus_tag="LMJF_36_2770"
                     /db_xref="GeneID:5655566"
     mRNA            complement(<1133012..>1135252)
                     /locus_tag="LMJF_36_2770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686803.1"
                     /db_xref="GeneID:5655566"
     CDS             complement(1133012..1135252)
                     /locus_tag="LMJF_36_2770"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686855.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655566"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1E3"
                     /translation="MSAGRASSQHRDRPQSSSRRRYYEDEAYMQPRDERTSHSTLHRR
                     HSSPQQKPHRHSSASKQRKGLRHISRELHQYLKDDYAPEDGVPPLRRESTQPPRRRSS
                     PTYHYNGDNSGGGAYHRRAVASTSPRRRSTPHRRRSSSRHTASVYPALRTAPVAVGDG
                     KRASPRRSARTSTDGTPRRSRRQHEPSHAGYDSVARSPRQRHRHSSASPHRSHRSKES
                     PTHPERRAPSSSGKSRHASTEQHVRSSQGSVRRHRHSHMTSSTAPAPATEAAHRHDAL
                     RYRSSHQVEVAAKREATPHRSRRHSRAKVDGSAEKEARSPRRHTSAHRSRSSQPESRH
                     HSKRRHRHHRTPTPDSVDEGSRRPRHTSLFGPLAEDPYVAPPPLTGSTHIRSAANSHT
                     TSRPRSGSHIEVISVHSACRVSANGWSHSRSNTARSPRRPYDNGPPVVIPSPRGQQIM
                     QRIDSTRHWLQNMKEEVKKDREREPQHVQDVARERATRHSARKEYLDSTSRAGSASRH
                     RTLSTGSRRHTRGETRAAAQVTSRQYAGEAIPPTASSERSHRAPEQVSPPMPEKRHCS
                     SQRHLGRPTAPAAAPRAPTPDPDLFREPVDAVSSSREEGIECPILSFMSFLDGNTFDS
                     TASLCQYNVNLADSLSDEHLEILRAAVFNHNEEAFAELLYGDDVEAEIDGAAAALGHS
                     DDPTVQHELVVLQQEAVRRFNDKCAKALKALLSAEGGLAEAVQVAASELEHQAYQADG
                     SLVAVP"
     gene            complement(<1136862..>1138334)
                     /locus_tag="LMJF_36_2780"
                     /db_xref="GeneID:5655567"
     mRNA            complement(<1136862..>1138334)
                     /locus_tag="LMJF_36_2780"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686804.1"
                     /db_xref="GeneID:5655567"
     CDS             complement(1136862..1138334)
                     /locus_tag="LMJF_36_2780"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686856.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655567"
                     /db_xref="GOA:Q4Q1E2"
                     /db_xref="InterPro:IPR002815"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1E2"
                     /translation="MSTTPTSHGAPYHQQLQSHIEALLILFIRDFCAEGASPTRSGYR
                     ASHLQAIAQTFYVLQIVQCSTAARCAQETPYSLLQTGGGTGRLDVCTERDLYYRNRPL
                     FAPRGQRATHESIKRLCGWLEVVARVPPHQQRGEGPVLTSLFRSPRCLLSRPWKGTQG
                     AASRTPLYTRESLGITAAGKSLLAGAITLELCDPVELIDVSAHGSVGITLTYSLAARM
                     VGCRETGVWQAARNGISSSRPYKLVLIEKESVHHAVLQSMMKSGTPRTYSWILLCTKG
                     YPCVAAREWLRRVHALQPALQLYIMVDGDPHGLDIALTVMGLLSSKGYPSPIASSQPK
                     PTLSSFSSLSGTTPASAETAKVKELLPLRFLGVCPSLVWSCSIDSEAPLTAGFLGGLT
                     SSQGIPLTMHDVQVLKRITSIVQAALASTPEASDSATSLRECDTAIVRHTLQRVLKEA
                     EWMQRARIKCELQFACGPIGPLTFMEQHVQRCDAEVSEGC"
     gene            complement(<1139047..>1147140)
                     /locus_tag="LMJF_36_2790"
                     /db_xref="GeneID:5655568"
     mRNA            complement(<1139047..>1147140)
                     /locus_tag="LMJF_36_2790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686805.1"
                     /db_xref="GeneID:5655568"
     CDS             complement(1139047..1147140)
                     /locus_tag="LMJF_36_2790"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686857.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655568"
                     /db_xref="GOA:Q4Q1E1"
                     /db_xref="InterPro:IPR001564"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1E1"
                     /translation="MTSIFVLIRPHAWSPAVVDRVRTCLANVGACVDAEDTVSASTLL
                     STSTVERYFGSIHYWAASATDAVLRHPLSASDSVTGEEEQPAFCAAEEDLKSLFYEFY
                     GELWDSALDDGRLRTAFDVMRADNVSAAELASRCTSAGDDAVLALPLGLTVTRILSSD
                     ERERAAPLHYVVNGAHPAVLEAFRRGSGDASGAAAPCWWCVASWPSQAALEVSQEVTE
                     RLMRLPPILAEATSTPHGIDVFTGALEALACRVCWMNMPLHDDPFARLLVQRGLPLPW
                     VAALLRGPTLHEHGHFTDVFDMMAGKGEDDVAVTLMALYDALRYPDNAAEGRNAVNDA
                     AALYDWENGSVDMTAASSGPLAEDPIPSRTYAVALVHPRLWSRKEIVHLLEEKLEQLE
                     VCVEAVREVSAEELEAKIDLHHGDVARYALDQEALRRFAVDENKAVAAEATACFEKNC
                     GVPWEVAMQEGRIWSASLAEDLLGAELAAAVLKHCATSTHTTHQLSATLSITVLSRQE
                     LMTELNPACPVDAVSSASDSANLQGKRKEAVTPNRPYSLTSESYFVVNAAYAVYRRDV
                     LETSISACASERAGGLWQLSWRADAEQQSMAVRCAAISEALCTAASVDPVSIMDGRNE
                     TLGAEHAAPYGAAVTEPVSAAYPLVQVSADCFSAMRARHLWWGIPYEDDVVSRDLVRS
                     QGQSWVTLHASFSASPTAESTAHEAVLALLPPVATTAEVIKLTLATLEESGVLVVEEA
                     DIFGYDAFDYVFSGSTALAVARQLAQKTGTGLWAMMSDDMQVTLRAAAAALADETAQP
                     FTPENLYGGAMVCDALHIPLGALETGWRRTEPLCVGDNCWLGYLATYEVWVVNGHVPL
                     LEHRYHAETARVHLLRIQWDASAVSWNEMREALVGQCSNCNEGETGICGNSAAGSLTR
                     LLSRIADCSPANATRLVGEPLHIFSPTAYHALVDVLRWPRIGSSGPLSSEVALEDWLV
                     RQPSVQRLLHRGASMLTVVVQHVRETLKTVLQPLLPSQDSSPATPCWTSRFAQSQRAV
                     QLHHGFIWLHPSSTTPAVRDAVPALLLAHRVRVRDSGAVPLQVALERELLDVLHDSFF
                     KNAYVRSAAEVPVTNAEAQAFARHFNLGWMEAVQLGLVLNAKEAEQKYGTVHVMMWWE
                     GLAPEHQVKLSDSLFVGYMTEEGLYVMNAPYSYQRSRLHVGSHEVVWYAVEWNAADMS
                     WADFLRDVIGAADPAAAAAGSLRQHFGAHWTRYSLAGQPDEIECVMHAAKTPLAALAE
                     RCRWLAQSPRQDPYGCLLLQSGVHPSLLSTLLTNPSVYSRDTGVITEAFHVLPQEDVH
                     ALVRQLRDAQCTRTVLMLQDRTRLVPPATALATPPPPDAPHPRDAEGADEGTVDLTIL
                     AQLRAYRHVVLTGAVDPFLQCGFATAHRQNLPSPSSPFRCSAVLYLDPTCVPAAERMP
                     SSYHTLRSLLEQQLRINGVRIVHERVVQCASAAEASVLYRCHQHREYRYGVAIPAIES
                     LTNSMQWQIRFKEHFGVSYRHASVALYNAAEMTRVMQVSEREVAALCRRSKSRHPHDT
                     AVVGEGCVIQRLQPGKPFYVMNGDVMEAEKEFVAAQATVGVRVWMLAWDSARADMGYA
                     KLQHLVAELQAPTGVLRQWWAPEGGEGDLGRASGLSTRDHDSPFLHVSESAVAAVRQR
                     QLWWRLPVWSDPTVATWVNGVAGNETARSSTDVSALSPRTVAWALQDPLISVAARDDD
                     GPVYLWDTVIGMDARHACARIGCCWAAVVADERNDETTRDTAVLTLAPQVATNSAVYH
                     LVRSVLLDNGLRIDAYGFIADHGEDIATLKRTVQYLYPEDWSYAMEEPQEIQLNADEA
                     ERAARTFGTSWEALLHGGRLLPASRATKRLGGMTAPQLQLFVKTAKNSLWVRPHLHVA
                     ELEEYGVYVINAHVPYLAHTIAGAITEYPLPYYLVSWCPSLWSWKECLAQVFGCAEPT
                     LAAPGSIRGRLYTSWSFLGLHAAPEMAEGGGGGVCVSEGPLQSLLSRLHVQWPPLDYF
                     DSDPIGSVVLRQPEPSGATALLRAWLRNPVVMCDGIGTGVLSHLACWSTREALHLVET
                     VTVTREKASASEALLLPSALDKARNEVHEAEARRAAEAAWEAAFQKRYDLPLLPTFSA
                     AAAAPPCVQTSDSTAESALLHRNVSTLLFFSHQLDTAQRALLRQHLQQHSVAVMAAAN
                     YEEEEQECTAALLDRLYATEAFFADCPNVAAVLSESGEVTVEDQARFSAVFGDEVPWP
                     ELLARSALSQEAEHDADTSLVCSASEDLHQRSHIYSAADAMKIWRLTPHELWAEMRQG
                     VSMRLSEGLEVTRLCRMTPGCASDTNERAVATDPGAPWKGHYVVNALYAAVRDALQAP
                     AATRDTSSASHAQAPPSLTKWNVTWDAQTLSWHDFCQCVIGYADCAQAASSSFNALLA
                     ESIVDARASHEENKDEALSPLSCVGVMAASGPLAAFAVRRYWCWNANHHDMYLPDPFL
                     RAVGIAGMDHDVVLKEGWLLNPVVAVAPSMRRLRLFDWTRSCDTPAVLDWMHSREQML
                     DHTSIETTEARSASPAPEEAPHDSEESASIVAVAQAVAAELRPPSPPPRMKSQLQMAW
                     VYDALLHASTYADCKLLWQHYRSLSAPAAAAAAAGEAASAHEMSNTISFALFYRDFKY
                     LDNFGVPCMSHELKKLFIDIETQRRGRMTYEEFAHAIALYHSL"
     gene            complement(<1148440..>1151028)
                     /locus_tag="LMJF_36_2800"
                     /db_xref="GeneID:5655569"
     mRNA            complement(<1148440..>1151028)
                     /locus_tag="LMJF_36_2800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686806.1"
                     /db_xref="GeneID:5655569"
     CDS             complement(1148440..1151028)
                     /locus_tag="LMJF_36_2800"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686858.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655569"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1E0"
                     /translation="MAHTPMYSPYDAVYGHDTTYIRRMTVEEYVQELKEEEADVRGVT
                     PPLRAAGPASEKNASATPTYSTPARRATRQYEQRRLALSSCNPNVVFFSKYPMYDRLG
                     RELCVAFQMQDMAVQQELRRLENEDGRDSRRSGVRLSAELLMESDTTGGSRPMSVRAS
                     AATAEGRELTQTEEVSRVVRPSHIDGDTLVDIDVSATSHYPSVSAICTSFCPASARPS
                     DFSIFRDSSGTVAAGMSRGALIKRHSCVPVRSVAEEEGIRIHRSDGGGGSHRAASMPS
                     AALPRVPDDADGRRSQWRWRSEKRHRSRSSGGGGRHSRVRFINDDQGADDIQREEQPP
                     QQRVHGALPLPPRLSTPPPVPLLEGDKTRVEETAVEDATRWTATSRASAAVRATKQLF
                     RSTTHANTSTASRTTATPSYRQPIASSAYGLSATVIAASKVGDAVEHNVQVCAAAMPP
                     QLYSEEEATDVETTPELQCGSVVRLGSAWYRLVHFHLVAEVYVAVRISAPAQTAGSPI
                     QTDSQAAPDQRPIGKELMAEAVTDTEQQQDRSVGAAAPEFPMQPSVGEGGDRVVVAST
                     AAPAGPVTGAERNYVPCTDDAESCPLPTSTDSACVGEASSQEYFVYRWRVAMLPRGGD
                     EARRAALGLSLCAPPVHVHGIRYADGGGITVLSMPLGYRAVPMSGLPLSLRSYTTLMR
                     VVLKAFSTMVARRTVHGNLSALGELFLAWPMVSEKSSSLPRVEEEKQRAEEGNGNVDA
                     QGATRQPFMLLFHWERWVDFSMFVDRNAGRTIPFDFEDGTSPSVTTYGKDLLGSLQLF
                     LEHPLAAELTSEQYILLQKLIVIATEPTQVANYLIQMKNLMMSLPTDTEALHQSCDAA
                     VVHHAR"
     gene            complement(<1151611..>1153551)
                     /locus_tag="LMJF_36_2810"
                     /db_xref="GeneID:5655570"
     mRNA            complement(<1151611..>1153551)
                     /locus_tag="LMJF_36_2810"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686807.1"
                     /db_xref="GeneID:5655570"
     CDS             complement(1151611..1153551)
                     /locus_tag="LMJF_36_2810"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686859.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655570"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1D9"
                     /translation="MRPSLIQCFPHPFTRQWPATSNPVTCECRQLYALVSVCCCVPNT
                     HLLVLHESAYLNTNLITSMPKGPKYVDFAITPRTTPEDLCSFLVRAEMAATGPPFAAS
                     AGNGGVVGTSTSEEVSISHASPGESLYEGLAPTATPTSASQTRSQWSPLSRSTVAQRH
                     VVVVCLHGIADASAAVQSALMDLLMFEQVRNHHRAVRVPTLRIVAFCSSRNYAILLPE
                     TLRALFTLSTYVSTLASDSAVVLQTATATSSSIVNKRFMLEVMTASDGQSLLETVTLS
                     GTVTRYLRHLLLVVRGSVAAGMSPGALALRRIPRWMTILKALAILFMPDEELLRSRVP
                     QTRSTLLQSYSRVTSSTTFERTMNSATHRTETPVSRSMSPETQAVHQQPRGLQSVGSD
                     ERRQVDHTAAATVESSENSKSGGGGDSAEIKSFSHVVVSPSDIACVLHCLVGHLMTMP
                     REMVPSEEILSATSTMMGNAAGSGSLVEAYGRMLDVHRYGKVGLSLQDPAMWDAVAAS
                     WTLRNLHGIANPTTDPVTGLDSSLISSGTYQNYNTTLRSLESVEATGEADPGLRRSHG
                     TRYGGNPEQDALAASSHAPHEQCFQTLNNRPFFSVAEAWKWTAANKFGILDVASTPML
                     NYWEVREAIRATLLCRSAPAPG"
     gene            complement(<1155226..>1157001)
                     /locus_tag="LMJF_36_2820"
                     /db_xref="GeneID:5655571"
     mRNA            complement(<1155226..>1157001)
                     /locus_tag="LMJF_36_2820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686808.1"
                     /db_xref="GeneID:5655571"
     CDS             complement(1155226..1157001)
                     /locus_tag="LMJF_36_2820"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686860.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655571"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1D8"
                     /translation="MFFIYPTPQYPRRALEFVFKSLYMFANTMHLISLVVLISDFYTR
                     LSNSMPSYYTNRDLVISDAILLVMENCIYTGSIRLGNVHGTVEVTAGNIGYGLMTTAQ
                     YVTGLFVLEFLLLVNNFLVAFNYTKGNRHLRIFGVHVPLYHITVMMTQVYSIAIVVLV
                     WAFDGNRQLFQRALQHCAEEMRKTRYEQLLKSEFDGYTIFSTAVYWPFAATCVAELIY
                     VSAVVFLCYFSNDEGIILFSEADAPWESRGLLCNTSKPLLKLHTAQRNAIIEDARNAI
                     KEGQKVRIVRSYQLITEEAFEALVQAMREQVARALKEKQFEQLKRTFGDNESQLDNMG
                     FAWRENLMASHLDEVSGGVGNGLGNSFKAGPADQFFNVPFEDYFTDNGGAAGRPEVPC
                     SVDPLSIQEGGLGDDDGAYGDGNNGFMLDPADGGSETVDAWSPREGANMVNTVGEIYD
                     PPQPQQHTQHASHTKHRSRRRRRRGDHAEEDDEDYQVEPDPRDPSQQQRGDGKSDIDG
                     GNAYTSRSNYFDANDDMVYVANDMGGSGGGYVSGAGPGGRLDGTTGNYPLSTRESRQR
                     QQSRGRQAGLEQEDDVADELSDELG"
     gene            complement(<1157860..>1161126)
                     /locus_tag="LMJF_36_2830"
                     /db_xref="GeneID:5655572"
     mRNA            complement(<1157860..>1161126)
                     /locus_tag="LMJF_36_2830"
                     /product="putative dead/h helicase"
                     /transcript_id="XM_001686809.1"
                     /db_xref="GeneID:5655572"
     CDS             complement(1157860..1161126)
                     /locus_tag="LMJF_36_2830"
                     /codon_start=1
                     /product="putative dead/h helicase"
                     /protein_id="XP_001686861.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655572"
                     /db_xref="GOA:Q4Q1D7"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1D7"
                     /translation="MNVVDDTVAAAGGDDDAIAEQQNMSFLMKLQELYCKTVLYEQLE
                     QMMGHPATQEESDGYLDDVEGLVKLYCSEREAAKKKAPQGDGADAAAQREEVTEQHIL
                     HSLSVAINGEAEADEGPDIPMSSIQRLCHILRDCLTTETVETGLAVGSLLLADDAKRS
                     AEEAARLAYQQQQRHMHGGVDTASMSTSTAERKNAMKVSPEEMFRLAQHVRSGLADEA
                     ELLKLRSEDNEEEGGGAQDVELNDEEPRFLRNMGFSSMLHRRINYRAPLPSQQLRDAR
                     TPQHRQAILDRLAQRQQGDSSKLNSMEVVAQMQEKTNMERRIIARKAQRTQQRSREYD
                     FGATMSGRDDRSVLDEDRYGRKGGALESEEYSAPPTLLHSELNALPEEGGFRPQDMPT
                     KLAPWMKHSFGRKLRFGLPETMQTIQEQRTSLPIYAKKEALLNFVDAHRVTVLVGETG
                     SGKTTQIPQYLAEHGYADRGMIACTQPRRVAAETLAMRVAEEYGCRLGEEVGYTVRFR
                     DVTSSLTKVKYMTDGMLLREALLDDSFQRYSVIILDEAHERSISTDLLFAIVRQALRK
                     NAVLKVMVTSATLETEKFCAYFGASEPFRIEGRTFPVETYYLTEPTTDYVRVALQTVM
                     MIHLQEPPGDVLVFFTGQEEIELGGEQLFRWMEMLRRQVSTPLPDLMVLPLTATMPQE
                     VQSKVFEPTPPGCRKVVLATNVAETSITITNLYYVVDSGFCKQNIFDAKHGIDQLKVM
                     PVSQAQAKQRSGRAGRIGPGKCYRMYTEQQFTTDMVPETVPDIMRTSLFHVTLQLKAM
                     GLDLLNLELMDCPPKEAIVSALEKLRYLEALDDDGLLTPLGSRMAQLSIDPSQSKTLL
                     TAVDLGCSEPVLTIVSMLAVQKRGVFYRPRDQQDASDAARRQFMQPEGDQLTLMAVYD
                     AWVENGMSEDWSKHNFLKHRMLVEARDTRDQLKEMLVRRNQHISHENDANLDEVRKSI
                     TAGYFFNAARRVDSHTRSYVTLSDRREVYVHPSSVLIDDPPKYVLYDDLRMTKREYMT
                     ELLAIEPKWLVELAPAFYARPKEGRLTKEQAAERFTPILKSWETGSSWRISRLKKQRR
                     "
     gene            complement(<1162256..>1165693)
                     /locus_tag="LMJF_36_2840"
                     /db_xref="GeneID:5655573"
     mRNA            complement(<1162256..>1165693)
                     /locus_tag="LMJF_36_2840"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686810.1"
                     /db_xref="GeneID:5655573"
     CDS             complement(1162256..1165693)
                     /locus_tag="LMJF_36_2840"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686862.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655573"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1D6"
                     /translation="MGSAPSVQEHLQKWETALGELEQLCSVNRRLMDQDRIYGSGTAL
                     NDIHRTTDDEATSDRGGARRPSSLVSFSPTTTAVTPEAGMGVSAGSFHRLNRSGASTA
                     VTAPLPESRTGFGFTAYSGAPGTSTATTLNFAQGGGTALPGNATNDVTNRSAGSASVG
                     QQQSKHTRQQVLEIRKARMSLFRSYEAENPDALTDLMQCSHFGAAAVALSYLLGGDAN
                     CKDRRRRVTLEDIFFATQSPLHMLHSGSPHLPIMTGIIREFLDVDNRFKGDYSLEAVH
                     LDVSPTMGQVELGPNEVGDRQTRMQLPEFQRLITQDCEEETQAIRIVNYDPYVLEQAM
                     LVDAFEDEDELNSPLATSVLGPNPHHLERQYSPRNEGAYAAVVDVRNAVQLMVTIAEG
                     VVNDSLHVKLKEVPVASLFKAMMTAKEGHRARGFIRVFKKELNPEFTTDEIKTFWTPE
                     LRSGKVLGTTQLGTNAVAISHHISPHIVGVAWAMHLLAGVRPGTHGYGNGLPVSDIIR
                     TMKLPAEVFVDGVLPLEQVYEYAAGYVQRSNRDVDVHLYPVLTKIFREDAVPTISVFD
                     LESILINVKDANADPECPEHVMVIMYNACVAHNVLYIAEEPQWCVLAGYDQEMQTAVL
                     IDAHPKTFSHTWSCPLDRLHKAMTGNGYLIFSKRSTNPVSRRVGAPATMAPTVESRLE
                     LVERQHELSSSWEGKTAFAVPKAFTFPSLPVMPTMVAMTCTRLGVPTTFDDVVQRLPF
                     EISALVIRNLTLEIMHVCLKQYLRVVGLQDEVQVKAYHGESNADGFLTLQLPQLEELI
                     QTSLDGNHVLLLHFDASRLLVNGASHPFGTLGMVVGYDAELGSVRVADANPNSFLREW
                     SALLPEVFESVLDSDVTRKHRTRGVLLVSRVAAAEGEAGPVFAPPCSRPFRLELLPVL
                     NVFLVSPSPHFQGMSFAFSQLGYYYSPEEIFYEAYLKTMDDQRRRGSQAFAWRDVEVS
                     LSIINKKIDASFMAEGCRKFLESRNGHQSGAQETISVQVLEDIDVDEELDELLEKSTR
                     SSDTVLLLNYDVLRTHQLSNLGRSVATVKSYNKEKQLVELWDAEYAVFGLSFVVTKQQ
                     LIEMGDLENVGSSPYGFVQLKRVAAGAAPKKLGLMSAPSTLEEEAELETAAAAAGVK"
     gene            complement(<1166590..>1166868)
                     /locus_tag="LMJF_36_2845"
                     /db_xref="GeneID:5655574"
     mRNA            complement(<1166590..>1166868)
                     /locus_tag="LMJF_36_2845"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686811.1"
                     /db_xref="GeneID:5655574"
     CDS             complement(1166590..1166868)
                     /locus_tag="LMJF_36_2845"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686863.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2845"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2845"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655574"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1D5"
                     /translation="MSTVAELQAQLDALRARNAQEVEAAKATLAKLQQDLNYMQEDTE
                     ALEREEEALCKQFGKSRGTSTALSASQHTDIIAQGLSALVECDDSKCC"
     gene            complement(<1170216..>1170998)
                     /locus_tag="LMJF_36_2850"
                     /db_xref="GeneID:5655575"
     mRNA            complement(<1170216..>1170998)
                     /locus_tag="LMJF_36_2850"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686812.1"
                     /db_xref="GeneID:5655575"
     CDS             complement(1170216..1170998)
                     /locus_tag="LMJF_36_2850"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686864.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655575"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1D4"
                     /translation="MFRMPAVKKPLSSHRPSEARKPTEGPAPSPYVPATPTSVKSVTF
                     DWVQACPIYTIKGNSVWHKGGGELPYRPVIGDLAMRPNTGKYFFSYRINTDNSRVGFC
                     TSCVYANDADLQNVEFGKAVTVDSETSESLLDQNPAQPSFLQAIGAVPALPSTRWEAY
                     MDLQTSKVFVNGVEKRSFWRLFVPISGGVASFVVDTDAGAVQMFMNGKYVGMMLDAQS
                     GLKGNTVYPCVGISGCDMANRSIQSGCMGAFVEPAHAFDCLY"
     gene            complement(<1172453..>1172866)
                     /gene="S24E-1"
                     /locus_tag="LMJF_36_2860"
                     /db_xref="GeneID:5655576"
     mRNA            complement(<1172453..>1172866)
                     /gene="S24E-1"
                     /locus_tag="LMJF_36_2860"
                     /product="40S ribosomal protein S24e"
                     /transcript_id="XM_001686813.1"
                     /db_xref="GeneID:5655576"
     CDS             complement(1172453..1172866)
                     /gene="S24E-1"
                     /locus_tag="LMJF_36_2860"
                     /codon_start=1
                     /product="40S ribosomal protein S24e"
                     /protein_id="XP_001686865.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2860"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655576"
                     /db_xref="GOA:Q4Q1D2"
                     /db_xref="InterPro:IPR001976"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR012678"
                     /db_xref="InterPro:IPR018098"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1D2"
                     /translation="MVFQKKKAEVCIRTSQFKVNKLLNRKQFIVEVNHPHWCGTVPTQ
                     LIRKKLATLYKVPDASQVSLFGFKTKFGGGKTTGFGLIYDDLASLKRFEPNYRKTRMG
                     FGKARLPARKSVKERRNRNKKLRGKAKGKQVAKKK"
     gene            complement(<1173715..>1174128)
                     /gene="S24E-2"
                     /locus_tag="LMJF_36_2870"
                     /db_xref="GeneID:5655577"
     mRNA            complement(<1173715..>1174128)
                     /gene="S24E-2"
                     /locus_tag="LMJF_36_2870"
                     /product="40S ribosomal protein S24e"
                     /transcript_id="XM_001686814.1"
                     /db_xref="GeneID:5655577"
     CDS             complement(1173715..1174128)
                     /gene="S24E-2"
                     /locus_tag="LMJF_36_2870"
                     /codon_start=1
                     /product="40S ribosomal protein S24e"
                     /protein_id="XP_001686866.1"
                     /db_xref="GeneID:5655577"
                     /db_xref="GOA:Q4Q1D2"
                     /db_xref="InterPro:IPR001976"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR012678"
                     /db_xref="InterPro:IPR018098"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1D2"
                     /translation="MVFQKKKAEVCIRTSQFKVNKLLNRKQFIVEVNHPHWCGTVPTQ
                     LIRKKLATLYKVPDASQVSLFGFKTKFGGGKTTGFGLIYDDLASLKRFEPNYRKTRMG
                     FGKARLPARKSVKERRNRNKKLRGKAKGKQVAKKK"
     gene            complement(<1175100..>1180253)
                     /locus_tag="LMJF_36_2880"
                     /db_xref="GeneID:5655578"
     mRNA            complement(<1175100..>1180253)
                     /locus_tag="LMJF_36_2880"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686815.1"
                     /db_xref="GeneID:5655578"
     CDS             complement(1175100..1180253)
                     /locus_tag="LMJF_36_2880"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686867.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655578"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1D1"
                     /translation="MTEVSARKERREQRQRALGVDCVDRLTWKEWEPGKEYKRKILVK
                     NIDRASQTIQLSLPVNRKTFITPFPEPITLSSGVSHEIVISFRPTELVELHDAVTVTV
                     EGRGSFQVRLDCLTPYAKLTLPPSHDFGYCAVGATAHAQVQLQNSGTAPVEFSWEVST
                     PFCILPSHAVLDEGEIMHITLLFTPTEGCTMVAQAVCRLTGTNDVIAALKISGIGKYP
                     YICFQEPTAEERTLVVQMEAQQNSGSGSSKLIHVYNPSPVPVSVRIRRVDESLMCAFH
                     FAVEGKVAVEQDDPNGEGTFLVSRGAVQPVRIHYTPGSPGVIDFNTFQFDCAHGNSLQ
                     VELSGTTLGPRVTASISSLDYEAVDLEHMPPEKQLTRHLTLRNASATDASFTWMNTLP
                     GAAFSVVPHSGVVAAQSSLQVAITFRPTHPILYYRRLYLLIEGAKDVVGVDVLGGAYT
                     SAMRPPTLTLADVEAARLRTERGLGLLTPEQLATVAAAAAAAEDELMGSKQENGQRGG
                     RRCSVPASTLEIWRRIEEDVRSPGVVMRGAKRKVRVPLSNLETANGSVSIDTPFGVDA
                     KPLYTFGGGGKSGSDLRGNLVTVMNTSDATAVATWSLPASQACPYTVVPTQQVVPPNG
                     SAVFQLQCSSTVSDELPAACTLECYVNYESMSAFYLAPDACVVPPQCFTVTCTSAIIS
                     VFTSAKQKSQYQQQSASSHISYARQVCLPACRVGGSSYQVIALRNKAATPVRYEVADI
                     ILKQVSAVVVPPNMKPVAPERKASAAAVEARAAPQEAGEVSEAVFSVYPTAGVVPALG
                     RQLLVVKFSPRDTAQYAASARILWDANAMHSTASPAASAALSAAADTTHLNLFGEVCL
                     PQLQWRQVDEDVTVPLSMITLPPSCVSGESQQRAWVRNPTALPVAFRFDTSAELLGVL
                     RMEPEQGMVPGGARLPVTLFFSPQQPRVFDGFLQLYVQEGAEEAAAPGATQLQYCQQL
                     RVLGEGAYGGVEVEPRIMDIGDTADTREQQAALTLYNSGYCDVQYDVRAMLVHAGKSE
                     AAAAVVPRLHNSRGVLPARTHTAVLVAAQPAPGLTEFLVYAIVSGLSTNVANVPNAST
                     AEEAERHPHCRWRLRAAHPAVQVVDVDLPGVARPLAWQQLSLNAINAQLATAAAEPED
                     SSNSVHASFQHYVSGLDPISMDLGVAHEGDSTVCLKVSLKNTGDCPAPFDVMLPTQHE
                     ANREHWCLENTELASLYYIIDRGLVTVAPQQGSIDVGQTVQLEVRYVHSEVGVHRLPM
                     VLRVGRGGRRVAVVLEGRTLPAEVRALNFHHQKVYELMPVALGDMEPPLQFITATNPF
                     DEPVEYSVDLVALQEHTREHYGFPVFQCVDPRGTVSPRGTVYIGFYFRPLEAREYRVS
                     VLLQTVQGEGYYVDLVGSGYHPRQVAATSVMQWIDHALMQVPAVPPTLPARAHAAFLS
                     DDICKLGAVPYFTLCRRTCTLQLAAGCPTAMRYTWHVYRPQRGDAQAVVRPSEGVVQP
                     GKEQTFKILFYAGSTSQVLERLMTCVVVPCAAASDGEEKQHSDSGGRRGRRTRATPLP
                     SLNSSRDGSSSAASLSLLLQARVMPRDDYEALYGSEKLSTAFAPPLYNSHADPVSPTL
                     LPVASQNTTSPATTAEVCFVKEVMDELIRSLVATPAVQSSFTALCAPHHVTYANMRVL
                     HAAKATNAEAVSTAAAAALSRGNASSAMATEELLEELLCSALAEAVAVV"
     gene            complement(<1181703..>1183709)
                     /gene="ABCG6"
                     /locus_tag="LMJF_36_2890"
                     /db_xref="GeneID:5655579"
     mRNA            complement(<1181703..>1183709)
                     /gene="ABCG6"
                     /locus_tag="LMJF_36_2890"
                     /product="putative ATP-binding cassette protein subfamily
                     G,member 6"
                     /transcript_id="XM_001686816.1"
                     /db_xref="GeneID:5655579"
     CDS             complement(1181703..1183709)
                     /gene="ABCG6"
                     /locus_tag="LMJF_36_2890"
                     /codon_start=1
                     /product="putative ATP-binding cassette protein subfamily
                     G,member 6"
                     /protein_id="XP_001686868.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655579"
                     /db_xref="GOA:Q4Q1D0"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1D0"
                     /translation="MSSPAPPTDRADAGLLHHLPHSPPESPESSAPPPASSHRTAVLT
                     WEDVSYTVSGADEGDTRILVRHVSGYVQSGEMLAVLGPSGAGKTTLLDILAQRKVKSK
                     GDITGRIMLNGEPVEPAAFQLCSGYVQQEDIMHSYVTVEEVVRFSATLRTSPTISEEV
                     LESRVSQVLRQLGIYHVRHSCIGSALVRGISGGERKRCAVAAEMVTLPSLLFLDEPTT
                     GLDTFTALHLLTLLRSLSRSGVAVVFSIHQPRSRIYEAFDRVLLLNGFGEEAYFGPAA
                     DAVQFLAEIGLSSGCSSNPADYLIDAVSVSPVEEAWLSEEAQQSAAVEAATDGNQLRL
                     PSPAPTQGRDIAAAFASLRLADVMRQIDELQRSSRAATAALAETGSPVRAYPRSWTTQ
                     VRCIAMRCLRNRRRDPVATYVSVTSAIVFAFLTGTIYYQVGNSQDSIRSRMGVLFFIM
                     MISTFSSLGSLEMFLTDRAIYAREHRNGMYSTSAYYVGKFIQDAPIVVAINFLFNLIV
                     YLLVGLQGTVAKFLIFDSVGALVTLNSYALCLLMSNLSKDYATGNIITSLLLVLYLLP
                     TGGMLVSLNSIPFMWRWIKHISFARFAFSVMVANEFDGLTFVCDPVPSDIAPCITSGT
                     TYAASQGMYAKDIRSHMLVVALSMAVYLVLGYLALRGWRSTEGK"
     gene            complement(<1184927..>1187785)
                     /locus_tag="LMJF_36_2900"
                     /db_xref="GeneID:5655580"
     mRNA            complement(<1184927..>1187785)
                     /locus_tag="LMJF_36_2900"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686817.1"
                     /db_xref="GeneID:5655580"
     CDS             complement(1184927..1187785)
                     /locus_tag="LMJF_36_2900"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686869.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655580"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1C9"
                     /translation="MLGLTSSKKTTKIWLLLRWVPVTHSGLSLSSWVGLRQACIRTAP
                     PLAAPMCPFHYSPYPLLPWRSTALSHIYRHTHAFGSGRRSKHTEDTIEAASSMCTPAC
                     AASECVAASIRWLDYASATLNPDRLPEHPVHLDELLDLLRSAQAPPSTLQDEWSTQVW
                     AMAGEPYLVYLLRCLAHQSGLTQLSPHFAVPTTEIDSDDGGAVAVVTAGHSANHPSRL
                     FWERCVVVGVRVEPTTKNLLQTGWETQPCSHCVSQDGAAADAHDSPSRRSRLCVLPLL
                     YGGTQCGECGHALSLVPTWTRALYLVLQRRDRSRAAAVAYGEEVHRHLWLGVTIDALL
                     YTSATEQQQQLLVVHAAAGPAAAAPSATLPCAETTKGAFHIICQDERVNRLGLKWGDG
                     TAFSAAANLHDVARRVAPQLQGQAHVKRLLLLVVLYIVYYGSHPAAAGSHRHPLHVLL
                     VGPAKTGKSALLREVAQLIGLEAEVLDSTVVRTGGSGGAAGGSSFSAALPIRRSAVLM
                     AGSGMTASTLVLDQLPSTAGGAAAMAPLLEAMERGHGCGAASGEGDAAAGGPDVHELP
                     STIIAAAGEESAAAVQLAPYFSLLAAVAPTNSLDDTAIISQDVVAASRARSSHSRATS
                     RSMSRATQLSASSPHHSQRGPSISQSTSHRADPSSLSERLTHEDVCYLVRRAAEPVLL
                     NSVVSHAACYDAFIDKLVDCAGLLEETQPSVCHALPPPSACRGQHRVGLPSAACDSLR
                     AAPLAIDEHLRILCALSRARALLEHAEVLRDAGWTAQMRDEVWALYHGHLVAFADLMQ
                     RRSCSSGAMASRDPAEVLRTTSWSSSFFDACGGSTAAPAPAGYPSLSRFSGDAAALGR
                     AWKGRMRAMSSREGLGLWHPQKTPSKKRCRLMFVEALRQRQCLSAQVESAVPPPEVEH
                     VFGLLGGSSAFGDPLDVVISQMQEEGLLLRRPGGWRSL"
     gene            complement(<1189067..>1190107)
                     /locus_tag="LMJF_36_2910"
                     /db_xref="GeneID:5655581"
     mRNA            complement(<1189067..>1190107)
                     /locus_tag="LMJF_36_2910"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686818.1"
                     /db_xref="GeneID:5655581"
     CDS             complement(1189067..1190107)
                     /locus_tag="LMJF_36_2910"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686870.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655581"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1C8"
                     /translation="MLSSAHRAAFARPTATLWASARSFGAGPTRLLLGLEQVQDVPTS
                     TDRKPTGMHRGPGKRQTAPKEAAQYQFIKKWDLQMRETWDELEPFKGLPKPKVQFGNE
                     AAEVIWPYALLLENVIKVHPYTKSIYVYYSQRQSTPLGELAARVAKRVSQAYLIPITF
                     HNSHVYVEAEMLLEYSETPWVVVHCLDGTHKLIPVKPQAGQTVKEGAEEVLNGIVSAC
                     NEIGSAVKNPKEVMRLLSERPLQNQYVRVNYQWYGDTPEERMSHLVKWDYEPEEVVPQ
                     LRNRTQHVLDWMNYDGNLPTHNSVRVNIHREAARMRKPNVSAGPKTFFNSSGSRANAR
                     TARFDNSRSSQS"
     gene            complement(<1191066..>1191407)
                     /locus_tag="LMJF_36_2920"
                     /db_xref="GeneID:5655582"
     mRNA            complement(<1191066..>1191407)
                     /locus_tag="LMJF_36_2920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686819.1"
                     /db_xref="GeneID:5655582"
     CDS             complement(1191066..1191407)
                     /locus_tag="LMJF_36_2920"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686871.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655582"
                     /db_xref="InterPro:IPR005345"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1C7"
                     /translation="MLRHSKDLQMCRKTAGTALGYVCRLHEGRCVICDLQFSEIVDTM
                     REVHLCEDCSVVAAEGEEACIMCGSRRVTDVAYYCPYCVALEKDRDGCPRVLNQTRQQ
                     RLAALRAAVSQ"
     gene            complement(<1192873..>1194525)
                     /locus_tag="LMJF_36_2930"
                     /db_xref="GeneID:5655583"
     mRNA            complement(<1192873..>1194525)
                     /locus_tag="LMJF_36_2930"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686820.1"
                     /db_xref="GeneID:5655583"
     CDS             complement(1192873..1194525)
                     /locus_tag="LMJF_36_2930"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686872.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655583"
                     /db_xref="GOA:Q4Q1C6"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1C6"
                     /translation="MYATVPILTLGPYSLALVVGLLLYWNTSLIVSRVLAAFIVSMIA
                     MKVDLAFHLFFSCCHRAASLLCRFRTFWSPDDSLDFLQTQSQFYSIADVVSLALLVGN
                     ALQFWTAALVTRIALSALATRTELSIRWWQSQSAAEHVLFALGSLLCCTGCALQWAYY
                     TLLPTEERTQGGTVSLLMWYTSIVYIVEVGLRSACTLATTVMRMWGYRVLESLASQVD
                     HIAVRALEDSGLNPFTEVHDLYMQYLYAVACAATAWYYTSSSTPMWMQCFMLVRLYFI
                     TLASGKLHHYRQVLDRFPSVAADPTKTCGICLDDFVHGESVKCLPCGHTFHGACVRSW
                     LIRAAVCPTCRRPAAQSRHQHFAAAHHEHISQQPRVSLDMRVPAVGGGFTGSLQPLAP
                     RLPASAPLARASSRYMSRSGADALSQSPSLPVELRRLPHYEELQRVDAKRRSLALHRQ
                     QQQLFSEGTRTAASPEERHKEGTEGCVRDQSAAVDALLFTETPLLPAESTPLPPYHGT
                     SGRRKRQRPPPESTAGSVTRVRNAASSGVAATEDLPSRRRME"
     gene            complement(<1195618..>1208169)
                     /locus_tag="LMJF_36_2940"
                     /db_xref="GeneID:5655584"
     mRNA            complement(<1195618..>1208169)
                     /locus_tag="LMJF_36_2940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686821.1"
                     /db_xref="GeneID:5655584"
     CDS             complement(1195618..1208169)
                     /locus_tag="LMJF_36_2940"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686873.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655584"
                     /db_xref="GOA:Q4Q1C5"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR003152"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR012582"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1C5"
                     /translation="MDEVINVILKCITQLDLFVDGPAAHLSGTAAPTTIDTIRKCIAD
                     HAYLFTDHHTNGQRVWELVCSANFTVAEPRAPTTAATATATLLSLFRRLTDSVAASAR
                     APEADILKHLVKLLCDAVKPPLVRGASPGQLRCLFEATMRLLKLLFPLKKRADVQTEC
                     LHLLLALMQLSDLQEAHGAVVASGDEVAQVAKLCTDICGAKHDVALRPQNASMQLLGC
                     LCEQPAYAHALSRQLAERILKCFLGVARNLAQRAEVNQTLGEGLLRGLAGFLGSFPLR
                     CEEDAAALALINNIVLSALMLGETSTNYTFCLSALFLLRRRAADTLAHFTLLCAAEYS
                     AALRLLWMHRNKDVRRETHAAAAVFWSTLSSQLQQHCSSEVADANTTRNTDASHKLHS
                     IVESLLRSLDSSADREASYALEALYHLLPAVAALSGPQALQAMSTRFEERVGALLITA
                     SAQRTEASFPQVPCLLATLGQLLTLLPSVSPRQQTVVRELLDWVLLLYPHPKFYNREK
                     TVLGIVLVIRALTHHPRAPHNTLPRLLSERTLELVGEAPGAAMMRLAGECISAEERLD
                     RMATLWTRLLTTREESGAEAEAESKQRLSAAFYRACTGFCERARLEVGIVASNSEATL
                     ERILVGGVDVVQPSFPTHYSAFLSFVDFFVRLSEGLKRSGCVCRPPAEELTAWLEALV
                     RGATAAPHVSGFYTLLHRTVVGIEDMRPHSSTHQQPYTDAPLASGNSVVTSDGYHENY
                     LCVSPLLRHFLCTECLRRVHVYSDELLYQCAMCVVVGAALVGSEERDELAGSRARTCD
                     DHRRLDAYVRAFKVVMAGTPTPRKAESATGSANEVVCSFGNSPAVLESNRQYGLRVLE
                     KKSCRSPRWAAAVLPALTSALRSAEVVAAVRAPVQMLSARHGVAIAAELQHHSNEATF
                     ARLCRGERASNGRRDSMPRWLATMQPVTIPLVPVDSALHIGYLVPLVSRLSLHGKQPA
                     VRAAAAEVLYWCVVWVIGKKVSHWDSAVFPPLLSLASLACTSTGGSGGGGGNGGSMVH
                     QGLHGLLMQTARWFGRSAGTPEEAESFVSVLLRGLGEQEATQRQVATEALFAYAIPPA
                     DEPQAVTPHFRAVIRQLVRMECGVSECSRLGAAHCLHLMMRRLCKTRVPVLACTVQAV
                     AQGAVGCLRRCTEVPIWGAMETVTCNEVQESLRWLCAYCHDIRQLENEEEQREADQVA
                     ADLVHAACAVLPALARRHTACAITLLQTLPAITHTSANAHQVLLLSQELIREQQQRLC
                     SAAARSLDSVVGGCATLVALLHSGYGTENNERAIAEAVPPVICAREDDCSVETELLRL
                     LTVVLQAIVEEARVATHESRCISSHLVRWLLELVDVVPEQTHATHFSLLLTPTVIAQA
                     ARVMVAGAKATVENWAGDVGEDTTVGVPLHCCAPSSRLAPTARRCVELIEFLMRVAGQ
                     RRRGAQVIEDVLCAIQETGVFSVFTAASPARQLIDALSVGPSALATGPVALAAALCQV
                     EAPRASGTATLWMRIVDSMKLSPKTVVTMLLGLLRNAAALNATGGEEVCEGLLVLMLS
                     EPDPALLRQHLRDLLASDAVQHNISFTKPSFAVNLDDGDGAVAVSPSSRSSSVLLSRA
                     FGSVMNRCWQQASAALPTDRLVSALPSLTTVAMAEGALRSSSEAVSLFSLVGDWLAEL
                     QRRSLTSEHDKALCRVCANLVAAEREMRESAPTGAQDDGRGGARLAALLMLVQLIGPA
                     ICTDPTLSSALCDLVLFVSKPANMYSLLACIGATERVVWGFHVLAATVTPRPARRSLV
                     VFPVDMRAVEVAFDLLNEVLNNALPLRWAELKTHREQTNGADVVHSGTALFAAVLPHN
                     VQVLEVIAPLLAQESMPQRDSIVRQVHGALQALSACQQALQLDACRCASRLLRDPRTH
                     SGIDALTEHVLLPLLQASAEAVRLRLFEEEVRSWVTEAGRAPALGCFYVQTAAFSCLA
                     LMHRLCPLTDLRGSISTAFTGRNPNTTGVELTLEVLKACRAAWQLPNTGGDNNSAEEA
                     DGDVGDSARADAPRRYRQAAFRCLLATLSQTQQAEKVFCRCLFQERSVAGWNGLFLVK
                     RRGVVVTDLLDAVGEVQLWRDMNRCQVPELFAHLLRHFPSSSVTPGEPPEWVRHVVAV
                     ARQPQLRLPVRMVFYEMICRHERFFGTFARCIFDGVADSVAAMAPSERAGKVIWELIA
                     LLTRWHREGGSGALAVGSAASLKALARYAAVHLAWEHSLTAREGSCALDPTSQKRLAE
                     LLEQIRQAQGATPTSLSTSQPLTAAEVKMLLSHPAYERRAALEVIYMVTNACGCLGCT
                     GDSREVGEVYDLLGACLGASASPQLYRMTARLVGLEHRLLSEAATQKPSSAVRQPLCD
                     ALRGTVCTTLDVCKSDKKFLEVLEAMQEDRSGDLVYQLLSRTDLLRRYSIRKDSEKLL
                     TLRVLARAGTYVADNYDSIHVCLSGLLRGGHGELLLGICTVVRNALPHMSMESVRHVL
                     RDFCCLDVLQAMESAEPARVAFYNMGFAALRRWTVVREDQEKQDGGDSVSADAEAFLT
                     RRGLRDASPAVQGAVLEYLDVHAQHVPDTMWGRLTCLFTAEDGASGDGHSGSGGWVRH
                     VALLLLSLSKRSRNFASPSYLFPEALHSEGASPTLATSADTAAESSVARRQPRKASLF
                     SEAVQCGSPAEAATANAACPITAALAQIYAPPALVPQPPHHHHQPLSGARRPRATGAG
                     RLDAAPCATATAAAQSWLHLESGDSEQENAVVSAGVMASRQIFATTQLRAAHGATLRA
                     GRSVINASSAAPLLESNTAGRLSEVRLTLQSLLVPLQVLCLHEDEVAARVLIDLISNA
                     AVASPATSESPHTVSLCSALASLLPKFESGATTRQCEHAKSPFALFVALELLLHAQAA
                     CWPSLASLDCAALVRLASHVQACGGSVPTASLPVADGTAHVVERLLSSLQPSTARGVP
                     TRPSLAFPTLRWHAYHVAQRLRRHDDAACQAALQLFKGARRHGAPVIQLQGALDAMEM
                     GGAAYSMQVIAKLLEDEEEEAAAVAVATVASPATHVSGGVFALFAAREEVLRHYRSRA
                     SRLLLDWCGAASALQSATPAGAGGSGEVSVEGVRLRLRAQLQLMCDGTASAVTAEAST
                     ASRHRTGFEWGACLMANGRWLDCQLHVETSVDHLLGGTASHYDGGGSSLACGYLAANS
                     LSQLADAAQVLRFVSTSTASSAGVALQTYLDTMPASVPVSGAYGSLFIDDVLLIRRLI
                     IDYHVQSTGDLSGSLQLTDNERHKLVARIHELLGTWTVQQCSELLLLPEKTSAIETIA
                     SKADHATLSEPTRCALEFLKKRSSLFCIAVTAGEVSGASREEALAAFQATGKDVQQRA
                     AAGLLSPAAARQWAADVAQCEVEMSASIGSILSCPAGLTASVPKREMWVSTLKENLRD
                     TIPSHVALLNALEKLLPPVSRGDGTLADMRGDAKDATRASSITAATQSLWQLYANTFL
                     WCAQAAGDRSVDADSGGHLPVLARVPRLLSLFALPRVAEAAAQAQWRGTWEALVMLPT
                     QVWLPWATLLVNALLQTEHAVLARILLRLCRERGQVLYYPINCAWRSLADLGKRRNAG
                     RAVDDDLIRELAELHKWHRSHRMALVAEFAAALDELVEPQHRLEMRLSEVESLVKQHE
                     QCTRGGGGGAQAEYLMAALQLYERCKGDLMDPARWGRAQLYHRRAAQVLQELDRRNAF
                     SAEVLKSGEQFRSAKKEALRQVTQTLNTLTPNASNSATRSQELRLYSERLPRALGRSA
                     TAATTTTTQLGHASDAAEPILQPVQPTHLLHTPPDGAQQCCTLVGVADRVLVLKSKRF
                     AKKVDIYTSAGICTYIVKGGEDLRLDQRIQEVFTFANVCLLVSPRSRLSALTIRTYAV
                     IPVSPLVGLICWVPRTTPLQELMKEATPPDAHDAVARFCRARGKPQEVLSLYKTAYIT
                     GIPEQEYKGLVLRLRQSALVESLESIATDHCSWFGVRDAFLDTNAAASMASFVLGVGD
                     RHAGNLLVDLLNCELVAIGFGLAFGDATRKLPVLELMPFRHTPQLQRVQGVLGDSVTR
                     CRMRRVLHVLRAERHVVEEMVAALLMPDTDAIGDEASHIAGHQLDVVRRKLNLEHPAD
                     IILRDVARNAYVTQDKDVWSGVKACLSERERDENGEDAGLTGTELSTLHQEDVFVQRL
                     LRVASDPRLLGRAYAGWQAYM"
     gene            complement(<1211743..>1212984)
                     /locus_tag="LMJF_36_2950"
                     /db_xref="GeneID:5655585"
     mRNA            complement(<1211743..>1212984)
                     /locus_tag="LMJF_36_2950"
                     /product="putative succinyl-CoA ligase [GDP-forming]
                     beta-chain"
                     /transcript_id="XM_001686822.1"
                     /db_xref="GeneID:5655585"
     CDS             complement(1211743..1212984)
                     /locus_tag="LMJF_36_2950"
                     /EC_number="6.2.1.4"
                     /codon_start=1
                     /product="putative succinyl-CoA ligase [GDP-forming]
                     beta-chain"
                     /protein_id="XP_001686874.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655585"
                     /db_xref="GOA:Q4Q1C4"
                     /db_xref="InterPro:IPR005809"
                     /db_xref="InterPro:IPR005811"
                     /db_xref="InterPro:IPR013650"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016102"
                     /db_xref="InterPro:IPR017866"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1C4"
                     /translation="MFRFGRLCTPKAASVQRRFLNIHEYQSKQIIKDNGGRVEFGIAC
                     KTIEEVEAACAKIKTEKKVVKSQILAGGRGKGVFKDGFQGGVHVCDSAAAAVEAAKHM
                     LGNTLVTKQTGPKGQLVNTLYVTEAVAGIKRELYLSLILDRKSASPMFIGSAEGGMSI
                     EELAKTHPEKIKTMKVNVAEGVDHDAAVAYAKELGFAGETTERAAEQIKALYNIGKSK
                     DCTMVEINPFVELENGDVMEIDAKLSFDDNAAFRQRGIFALEDQTQIDSKEVLAKKHD
                     LNYIALDGNVGCLVNGAGLAMATMDTISLHGGSAANFLDAGGSASEEQIVAAFKIITG
                     DSNVKSILVNIFGGIMHCDVIAQGVVNASKALNTTIPIVVRLCGTNEQRGKEIIRNSG
                     LVIHPVEDFDSAARKAVELAK"
     gene            complement(<1213721..>1214119)
                     /locus_tag="LMJF_36_2960"
                     /db_xref="GeneID:5655586"
     mRNA            complement(<1213721..>1214119)
                     /locus_tag="LMJF_36_2960"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686823.1"
                     /db_xref="GeneID:5655586"
     CDS             complement(1213721..1214119)
                     /locus_tag="LMJF_36_2960"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686875.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655586"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1C3"
                     /translation="MFAIQWYTAALILADAYELLQLRQANPKDLAHGTWWFDSRANAP
                     LAAALYGGLLVFLMLSRLFVFLEPLNRWLLMLNTIHEGIRLVLYSLLFTQHSGATQLN
                     TILLTFTLWNTLLYGRQYYITMCMLREHSK"
     gene            complement(<1214958..>1215473)
                     /locus_tag="LMJF_36_2970"
                     /db_xref="GeneID:5655587"
     mRNA            complement(<1214958..>1215473)
                     /locus_tag="LMJF_36_2970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686824.1"
                     /db_xref="GeneID:5655587"
     CDS             complement(1214958..1215473)
                     /locus_tag="LMJF_36_2970"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686876.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655587"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1C2"
                     /translation="MLGLSITRVFQAYCAGAVLFEVPGIVRLLRGDMPLPKAGAWVDD
                     KDYYTNNKPLVYVFVAILACLVVSRGMACALPKSRIIIVYLVAVHTFEAGLYLYCCSR
                     KKDAPNSEVYIMGTLMVVNISLFAARLVQLKVQHTRAEIADLKRRQEQLAIIRKKRAD
                     YAKNREEKKNK"
     gene            complement(<1219490..>1220191)
                     /locus_tag="LMJF_36_2980"
                     /db_xref="GeneID:5655588"
     mRNA            complement(<1219490..>1220191)
                     /locus_tag="LMJF_36_2980"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686825.1"
                     /db_xref="GeneID:5655588"
     CDS             complement(1219490..1220191)
                     /locus_tag="LMJF_36_2980"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686877.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655588"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1C1"
                     /translation="MDVSKRPREELHKEQCLSFVKKLWAADTLAMFHYPVSATEVPGY
                     YDVVETPMDLSTIRKNIEQGTYRTDAEVENDVVLMLSNALDFNEKGSQWHDLAKQFKK
                     QYLTLARESGLSFDADQAFIPTKKVRDDESTLRKAEKKGEEKLEDVLQAMEKDKEIPL
                     EQLRAMYARRTTRGKADQQSSDFSSGRGNDDSDEVVSSDEEDTSDSGSGSYDTEEDED
                     SLDSESASKDDDDDK"
     gene            complement(<1221050..>1222513)
                     /locus_tag="LMJF_36_2990"
                     /db_xref="GeneID:5655589"
     mRNA            complement(<1221050..>1222513)
                     /locus_tag="LMJF_36_2990"
                     /product="putative GTP-binding protein"
                     /transcript_id="XM_001686826.1"
                     /db_xref="GeneID:5655589"
     CDS             complement(1221050..1222513)
                     /locus_tag="LMJF_36_2990"
                     /codon_start=1
                     /product="putative GTP-binding protein"
                     /protein_id="XP_001686878.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.2990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.2990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655589"
                     /db_xref="GOA:Q4Q1C0"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR006169"
                     /db_xref="InterPro:IPR014100"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1C0"
                     /translation="MLRRRWGAHRARHRFVDRVKVLLCSGAGGDGASIMAHEHGNEFA
                     GPGGGNGGNGGNVMLQCVKQHTDLSHIEDLGSQISAGAGCCGFSREAHGKRGQDLWLQ
                     LPLGTQVVDMDTNEVQYDMDEEGMQIVLLEGGQGGKGNAAFANKWHHSPIESTKGLPG
                     NTMLAQIELKTIADCGLIGYPNAGKSSLLSAISASKPTIAPYAFTTLRPYVGVLHDLY
                     GNVCRVADIPGLIEGAYENRGLGHQFLRHVERTKCLALVVDMCNTYVPDTGLRNSSEV
                     LQPWDVVELLLQELEYYLPGMSQRVIMTFANKMDIEKDSTGTATQVKLSELKRRVSMP
                     VFPISAALGIHLGPQHEQTGLAPALQFMCGEVFARQSQEREMRQFRFSHERAQLERAF
                     RAKHNGVFLPQVHALGAHGAEASQDLDDEAADRGGSLVDQQLDFLGNSGLGVKFDAYE
                     NSAARGQLHRYRDLTMKGKYWNLTRQDGEVMKGEKWS"
     gene            complement(<1223367..>1226273)
                     /locus_tag="LMJF_36_3000"
                     /db_xref="GeneID:5655590"
     mRNA            complement(<1223367..>1226273)
                     /locus_tag="LMJF_36_3000"
                     /product="putative ATP-dependent RNA helicase"
                     /transcript_id="XM_001686827.1"
                     /db_xref="GeneID:5655590"
     CDS             complement(1223367..1226273)
                     /locus_tag="LMJF_36_3000"
                     /EC_number="3.6.1.-"
                     /codon_start=1
                     /product="putative ATP-dependent RNA helicase"
                     /protein_id="XP_001686879.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655590"
                     /db_xref="GOA:Q4Q1B9"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR012961"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR016438"
                     /db_xref="InterPro:IPR025696"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1B9"
                     /translation="MHISRSQGTHTVLRMSDGREDEPAAKRTRREVDPAITFPYELDT
                     FQKTSIDALEEGDSVLVSAHTSAGKTTVALYAIAKALREKKRVIYTSPIKALSNQKFR
                     EFSEKFDSVGLMTGDTTIKADADCLVMTTEILRSMLYRGTEMLREVGCVVFDEVHYMR
                     DKSRGVVWEETISLLPEGCQYVFLSATIPNAREFADWVESIHPTTKVHVIHTDYRPVP
                     LQHYLYPAGADGIFLIVDEKGKFRDDNFGKAIASMGAEGGANGVGAAGPGNGSSKDPR
                     GNHKGGGGRSHGGSSQSMMEIVKLVMDRNMYPVIVFSFAKAECERNALALSRLNFNNA
                     EEDALVMEVFNNAMESLAEEDRKLPAIEHLHPLLKRGVGIHHSGLLPILKEIVEILFQ
                     AGLVKVLFSTETFSMGLNMPARTVVFTSVKKFDGEKNRYLTGGEYIQMSGRAGRRGLD
                     RVGVVIAMVDEAVEPNTLKQLTGGGADVLLSSFHLTYNMVLNLLRVEDVDPEFMMKRS
                     FSQFQRLRDKPALEEKGAALRRSIEEINVAHESAFRQYTICEDMIAKKKNEVSHILRQ
                     PKLLKNWVQAGRFVHIIRASDQRDFGWGICRSFAAKSTNPNFSDPSTFSIQAAVICMK
                     ADASNPSALTPCPVSEYTSEKADLYTVTFDFSDVQCLSTLKTNLPENPDSERGRAEVV
                     QILSKLQRQFGHDIPVLTSAQMGAEDVQLSKLQTQLSNLQKQLEGNILATSPTPELQE
                     EFEQYKRKADLEAQLEQVKGELAGMGKAVFSEELKQMMRVLRRLDYIDKDNIILRKAR
                     VACEITTTDENEILLTELLFKGVLNSMETEMIVALLSCLVNVHRTPDGFSLPQEFEQP
                     LKDLNEIVTRIATVSAESGLLQENSSVEKVMPSLMEVTYLWAKGAKFVDLVSKTTAYE
                     GDIVRMMRRLEEMLRQLASAARSPAIGSIELHEKFLKGIQLIKRDIVFASSLYL"
     gene            complement(<1226716..>1227174)
                     /locus_tag="LMJF_36_3010"
                     /db_xref="GeneID:5655591"
     mRNA            complement(<1226716..>1227174)
                     /locus_tag="LMJF_36_3010"
                     /product="putative glutathione peroxidase"
                     /transcript_id="XM_001686828.1"
                     /db_xref="GeneID:5655591"
     CDS             complement(1226716..1227174)
                     /locus_tag="LMJF_36_3010"
                     /EC_number="1.11.1.9"
                     /codon_start=1
                     /product="putative glutathione peroxidase"
                     /protein_id="XP_001686880.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655591"
                     /db_xref="GOA:Q4Q1B8"
                     /db_xref="InterPro:IPR000889"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1B8"
                     /translation="MASVFTYSAVQNGKTVVLQKYSGYATLIVNVASRCSLASTNIEM
                     LNEVQQAYGSRRFTVLAFPCAQFANQEPLNNTEIAQWCEDLGLLFPVFDRVNVKGSSA
                     DPLFQMLRAQQGAPLWNYTKYLCDRSGVPRRKLEPGCSMDALRQSIECVL"
     gene            complement(<1228020..>1228760)
                     /locus_tag="LMJF_36_3020"
                     /db_xref="GeneID:5655592"
     mRNA            complement(<1228020..>1228760)
                     /locus_tag="LMJF_36_3020"
                     /product="putative exosome complex exonuclease rrp41"
                     /transcript_id="XM_001686829.1"
                     /db_xref="GeneID:5655592"
     CDS             complement(1228020..1228760)
                     /locus_tag="LMJF_36_3020"
                     /codon_start=1
                     /product="putative exosome complex exonuclease rrp41"
                     /protein_id="XP_001686881.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655592"
                     /db_xref="GOA:Q4Q1B7"
                     /db_xref="InterPro:IPR001247"
                     /db_xref="InterPro:IPR015847"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027408"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1B7"
                     /translation="MSRQKEYVSPAGLRLDGRRPLEARRMDIAFGTLSACDGSCDITL
                     GQSKVCACVFGPRESLHKQEAKHDKGLVTCEVAVAAFAGENRRNPQRRSKLSEDIGAA
                     VVQVARSVILLSQYPNSQIHIYIEVLQQDGNEKIACVNAACLALIDANVAMRDAVCCI
                     DAGILDEHMLIDLTSNELRSQCPVIAAAFTGHDTRNIIWLETASRLPPDSVTRLLKCA
                     EEGATKLFEATMRKALEEHAKKILTLQN"
     gene            complement(<1230555..>1231871)
                     /locus_tag="LMJF_36_3030"
                     /db_xref="GeneID:5655593"
     mRNA            complement(<1230555..>1231871)
                     /locus_tag="LMJF_36_3030"
                     /product="clathrin coat assembly protein-like protein"
                     /transcript_id="XM_001686830.1"
                     /db_xref="GeneID:5655593"
     CDS             complement(1230555..1231871)
                     /locus_tag="LMJF_36_3030"
                     /codon_start=1
                     /product="clathrin coat assembly protein-like protein"
                     /protein_id="XP_001686882.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655593"
                     /db_xref="GOA:Q4Q1B6"
                     /db_xref="InterPro:IPR001392"
                     /db_xref="InterPro:IPR008968"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1B6"
                     /translation="MLSVLMFLNSRGDVVLSRTFRAGNSVRSLAETFCSEIISTKQVD
                     RCPVNIVKHICFIHLKLTELYVVMVSDSNVNCLMCLQYGARLLQHIQNDYEGLDEKRI
                     KENFVALQGIIDESMDFGYPILTDAEAIKEFITKDGVDAAVLKNTRESERIADRMTGE
                     TPWRVEGLAYRVNEVFVDVFEDVNLLLSQTGETLQSSVLGRVVMNNFLSGMPECQLHW
                     NAKVMSHGIGEAAESHGAGGIEEVVPLASISFHNCVRLKVSGEERRLTFVPPDGKFTL
                     MTYRSSVNVHPPMKVLSAKAREISKTRTEVEFTLRSDTPAGRVAKDVQVSVACPDNTA
                     TAEVKVGHGKAKYDPVSHAIVWKLPEVKSGEEIAFFAEIRQITPTENTELLWTKPPIR
                     IAFQCVSLSLTGLRINELVVKEPTLMYTASKWIRYTVMAGDYQCRI"
     gene            complement(<1232362..>1232913)
                     /locus_tag="LMJF_36_3040"
                     /db_xref="GeneID:5655594"
     mRNA            complement(<1232362..>1232913)
                     /locus_tag="LMJF_36_3040"
                     /product="putative pre-mRNA branch site protein p14"
                     /transcript_id="XM_001686831.1"
                     /db_xref="GeneID:5655594"
     CDS             complement(1232362..1232913)
                     /locus_tag="LMJF_36_3040"
                     /codon_start=1
                     /product="putative pre-mRNA branch site protein p14"
                     /protein_id="XP_001686883.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655594"
                     /db_xref="GOA:Q4Q1B5"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1B5"
                     /translation="MRVARFRLSVCQRAHTRRSCLQCLLLGLTILLKQPPPPLLAFFL
                     YSASVVCSHVSPSNASVHAAAMPDERILLVTGIPSKQCTSEYLYSLFGAYGGIQQIRI
                     GSSSITKGCAIVVYEQCEAANNAVGALNEYALSKDRVLRVSVYEEERDKKALERRKRK
                     REMQAEYKKHIADVAHAANEPKE"
     gene            complement(<1233301..>1233729)
                     /locus_tag="LMJF_36_3050"
                     /db_xref="GeneID:5655595"
     mRNA            complement(<1233301..>1233729)
                     /locus_tag="LMJF_36_3050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686832.1"
                     /db_xref="GeneID:5655595"
     CDS             complement(1233301..1233729)
                     /locus_tag="LMJF_36_3050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686884.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655595"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1B4"
                     /translation="MMRIKQKAFVGKKICIAWEVLHDGKGWKAQGKALQILRFYAFSS
                     EVYLMCRIRDADDKKQICNLVKAVDGIERHRVLFCTTEKGYEAFTRQIDPSLLITNNA
                     AQVAFLKRVIQTLVLVGGDGVVASNVACVPSVEAIAVDLE"
     gene            complement(<1234408..>1236528)
                     /locus_tag="LMJF_36_3060"
                     /db_xref="GeneID:5655596"
     mRNA            complement(<1234408..>1236528)
                     /locus_tag="LMJF_36_3060"
                     /product="cullin-like protein"
                     /transcript_id="XM_001686833.1"
                     /db_xref="GeneID:5655596"
     CDS             complement(1234408..1236528)
                     /locus_tag="LMJF_36_3060"
                     /codon_start=1
                     /product="cullin-like protein"
                     /protein_id="XP_001686885.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655596"
                     /db_xref="GOA:Q4Q1B3"
                     /db_xref="InterPro:IPR001373"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="InterPro:IPR016159"
                     /db_xref="InterPro:IPR019559"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1B3"
                     /translation="MSSLVSSRKRMAEYSTFSDKWSIIEETIRCIFKKEVSKNSFQRI
                     HHSVFQLCQAHYGSLVLVQLEEQFFAQVSIIVNRIDGSSTYVADFLREWQDYNDSVSH
                     ISNILLYFNKNYMYACHHSSIEHLGERIFCSSTLGNPEVSTCLIASIKQLIHVPAAES
                     TIRDIGQELYTAEGSKYFARCMETPFVDAMVDKYVVQGEQQKQALTTSGYLQWVQNVV
                     CTESHKYADTFFYILLDKLTSALYSSLVLSDPSSVNEMLMGPTGLVHMLEEWDVASIS
                     TFVQVFCAMKREKDVTDIIAHVLKEKCEDIINDRDTSVFPFPGVQKMLQLIERAKALD
                     SLFPSEEGHSQSPFLRVIRNVLGNDTRFMETLSVYYDNGIRQGKDDIVSTVGNNVLTI
                     LQLTPDLEAFEVAFRSHLAVRLIYAKPHAVNMECLFIDRLFNIYGSSVVNRFQKMVED
                     IRSATAAQEKLIADMKTKRISPPLEFNVLVLTSGLWPQYTNIPLSIPQSMEACKRVFQ
                     EYYRRRHNGRKLVFQMSLGSIAFQLCHGDRTYHVSAHTHFVNSIMALNSDENLSVAVV
                     AQQGALSCDEVLTQFNTLCHVGLAERNGTEFRFNRNFYSSKPKVKVSAGVQKSAHDGG
                     SASAATRKGMDGARTMSLDATIVKLLKEHNSMDYQTLCGAIESELRDVCSPTRTDVKL
                     RIDALIEKGLMTRGESAHCYFYCS"
     gene            complement(<1237402..>1238106)
                     /locus_tag="LMJF_36_3070"
                     /db_xref="GeneID:5655597"
     mRNA            complement(<1237402..>1238106)
                     /locus_tag="LMJF_36_3070"
                     /product="fibrillarin"
                     /transcript_id="XM_001686834.1"
                     /db_xref="GeneID:5655597"
     CDS             complement(1237402..1238106)
                     /locus_tag="LMJF_36_3070"
                     /codon_start=1
                     /product="fibrillarin"
                     /protein_id="XP_001686886.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655597"
                     /db_xref="GOA:Q4Q1B2"
                     /db_xref="InterPro:IPR000692"
                     /db_xref="InterPro:IPR020813"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1B2"
                     /translation="MLHPGVFISKAKTDSLCTLNMVPGISVYGEKRIELGATQGGDDK
                     KEYRLWNPYRSKLASAIYAGVSSIHMGPGSKVLYLGGATGTTVSHVSDLVGPEGMVYA
                     VEFSHRVGRDLVEMSKRRPNIVPIVEDARYPMKYRMLVPMVDCIFMDVAQPDQARILA
                     LNAQAFLQNGGHYVISIKANCIDSTLEAPVVIASELNKLKKDKLKPLEQVSLEPFERD
                     HAVVVGVYRPVKKSKQ"
     gene            complement(<1239201..>1239998)
                     /locus_tag="LMJF_36_3080"
                     /db_xref="GeneID:5655598"
     mRNA            complement(<1239201..>1239998)
                     /locus_tag="LMJF_36_3080"
                     /product="putative lipoate protein ligase"
                     /transcript_id="XM_001686835.1"
                     /db_xref="GeneID:5655598"
     CDS             complement(1239201..1239998)
                     /locus_tag="LMJF_36_3080"
                     /codon_start=1
                     /product="putative lipoate protein ligase"
                     /protein_id="XP_001686887.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655598"
                     /db_xref="GOA:Q4Q1B1"
                     /db_xref="InterPro:IPR000544"
                     /db_xref="InterPro:IPR004143"
                     /db_xref="InterPro:IPR020605"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1B1"
                     /translation="MKAFFIGKREYRRVLSLQETIFNAKIARQVSVRRGASKLPLLPD
                     VVILVEHSTPVYTIGRRDTTHGLPPHCSIDVVKTRRGGGITYHGPGQLTMYPIANIQL
                     LWKDCTAEKPRSPIEWFSWALEEAMIQTAAMYHIPTHRFKTGVWADQYKDIPAQKLGA
                     VGLQLGSWVSMHGAGLNVASDLHFFDDIIMCELPDRRATSLSNEMQHRGVAESPPLVQ
                     ATAPVLLQKFIESLHQQPSCAAPQLVDLSADADWHERVIDTAGISTP"
     gene            complement(<1240529..>1243000)
                     /locus_tag="LMJF_36_3090"
                     /db_xref="GeneID:5655599"
     mRNA            complement(<1240529..>1243000)
                     /locus_tag="LMJF_36_3090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686836.1"
                     /db_xref="GeneID:5655599"
     CDS             complement(1240529..1243000)
                     /locus_tag="LMJF_36_3090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686888.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655599"
                     /db_xref="GOA:Q4Q1B0"
                     /db_xref="InterPro:IPR005746"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1B0"
                     /translation="MQTQAHKDVVKNITTASQLEGELQLSQAQHGVAVLDVYNAEWGH
                     CKALSDTFRRLFTDAGDLVHLRFFSVECNAVLESLKDPDEMKPHHPQQRGMVFSKDTL
                     VSFWKEMLEKRQNHSKPFFAFYKEGRMRTQLEGIDTPKICRVVRDLCNQQNTVSEYVT
                     NADVLRFWESHFSLSENEVAASEFAHAVQAVLGASAAELSEADLTDITAEVQSTSGAT
                     VSAADLQSFVGDSGRVQDAILTFLAKKREMATATAAAPPPPLEEELQPTESEEKDTDE
                     EPRASPQRPLSAESGEAVVEAAASDEEAEVGGEEVDADAALETLPAEEDTAEAASSVH
                     DAPSHNDEQNEELPETVTDGADEEPVIEPPTVDAAEADEAGADTHDLDEPAVANPVVQ
                     QAMQQPEGNEPDSAYEELPEQQSAADVESPTPSPSLPAEEHGESSVEEASGAPADEAP
                     TEDDTQALPGAAENDDDQHEELPEDACPPSSAPQPHMDTMESEDGNDEELGEAPSSVP
                     PADTVNTTGDQDESVVNQIFTNRWVTVTEEEMHVWNTVAALPLHYPQSTTMMADLTND
                     TTPAHEALSTTADLPTLAEYLTEQGVPYSDINMMCIAADQKVASESLSYGKLSLLLLS
                     CDPEEGKGLVPHCETFLKELSDGTLLKHQQPLAFTALALSASVAYPDECFCYCVPETA
                     VAAFQELVVDDIFILNALTPLKTTVPQDGQFILRIIGLPKVIELATTDESEDTMVLSQ
                     WYARLRVAEQDASALTAHFVENVCDDEFQDFLSGYIERLIEDENRLDKKHGDEEKTAE
                     GEFNDEELDDGRSAEAATPEPEDVL"
     gene            complement(<1246490..>1247140)
                     /locus_tag="LMJF_36_3100"
                     /db_xref="GeneID:5655600"
     mRNA            complement(<1246490..>1247140)
                     /locus_tag="LMJF_36_3100"
                     /product="putative ATP synthase"
                     /transcript_id="XM_001686837.1"
                     /db_xref="GeneID:5655600"
     CDS             complement(1246490..1247140)
                     /locus_tag="LMJF_36_3100"
                     /EC_number="3.6.3.14"
                     /codon_start=1
                     /product="putative ATP synthase"
                     /protein_id="XP_001686889.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655600"
                     /db_xref="GOA:Q4Q1A9"
                     /db_xref="InterPro:IPR002842"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1A9"
                     /translation="MSEARQIQSMIDFIEREAQEKAEELEAAAQEEYDVEKMRLVEAE
                     KAKIRAMAEKKLKQVDVDRRVARANYSKVQRMRVMEERARTMEKLHEQTRQKIVAMVN
                     NPPQYKPMLVRLIHQSLMSIRTDAVVQCRKEDEAEVVRSIPELERWYKEKTGATISIQ
                     TSKTYLDTAEAWGGVVVKSTDGRVVCNNTLSYRTKTCFDEQLPTVRFHLFNPDAPL"
     gene            complement(<1248790..>1249920)
                     /locus_tag="LMJF_36_3110"
                     /db_xref="GeneID:5655601"
     mRNA            complement(<1248790..>1249920)
                     /locus_tag="LMJF_36_3110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686838.1"
                     /db_xref="GeneID:5655601"
     CDS             complement(1248790..1249920)
                     /locus_tag="LMJF_36_3110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686890.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655601"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1A8"
                     /translation="MTRVLVNREDCSVQVKGDLITFLYATVAKDPLVVASRNVTQLLR
                     SRKDDTAAKLVADGESYVLKFESLRDREGFIESIVRAQEAEQALSNDEWVASTICHAA
                     VDVGVLDQEELRAIMSAAGQRGVEQAFDALETLVDRETFQLLPITEQMENDVLRQTPV
                     LAAIFQERVVDKETKKSFWEAVVRKYFCFSRTFLEEDIQRLEGARSVATAASPPLSGS
                     AATSSLSVINASSMCALPKGAATAMLDTDINEEDLLHLDENVEPLQQSFHGLFAAHRH
                     LPVGSASVLPVNGAALPFPQETAEPSPVYRPRFVGFRVLHQLPSETIEKAALETLRTF
                     WRSSVKQRRSILAKYTRISKKGGGGFIQRMCLEQADRAVQNT"
     gene            complement(<1250853..>1252559)
                     /locus_tag="LMJF_36_3120"
                     /db_xref="GeneID:5655602"
     mRNA            complement(<1250853..>1252559)
                     /locus_tag="LMJF_36_3120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686839.1"
                     /db_xref="GeneID:5655602"
     CDS             complement(1250853..1252559)
                     /locus_tag="LMJF_36_3120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686891.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655602"
                     /db_xref="GOA:Q4Q1A7"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1A7"
                     /translation="MAGFGMAYSNVPQYSPGVLVGNWLEDIALREDQLKLYKAQRHAA
                     VEHPEKAATNAVARSMLASQLEEPTTVDAFKGDDVRIGQPYLLVNDKTQAALALDLMT
                     GGGASSQSQQYTLSGSLAPGPQVRSTWTLLRCKDEHNHSYNRNNSGVLHYGQRVRIAN
                     EKVSAEGFLYVQSSLSSGLRSSEVQYAVAALNACADNVFVVSRAGTVREDVHFGFPVK
                     VGDGVVLLHSLTNLPLACNGERVATSYGMEYAVTCGYTTDYCSRSRGAVVVKPENVFY
                     FSGGDGTDAVLMRPRASSRHQSRSSAVLTMTAGTGVMTLLEHIRQGALEIGGRIGFRS
                     LSIALGVACNEQRQRRFLDRNELRKAIARLGVLLSPIETDVLMRHFDTTGNNVLCAQD
                     FLAELRGTMPLARMQAVIYAYQQLSIEGRGSVEFKDMRSLFCLNAATIPDVVDGVLQR
                     EEAVLDFESCWPGRLGYKVGTVTLDEFVEYYADVSPAEESDERFCKLLQQSWAIPVTS
                     AYLSGEPHRLLTVTYDDKPTETVRLPDSLVLDTQDRKAVKRLLIQRGLRGVKDFTVST
                     DM"
     gene            complement(<1253498..>1254298)
                     /gene="CYP10"
                     /locus_tag="LMJF_36_3130"
                     /db_xref="GeneID:5655603"
     mRNA            complement(<1253498..>1254298)
                     /gene="CYP10"
                     /locus_tag="LMJF_36_3130"
                     /product="putative cyclophilin 10"
                     /transcript_id="XM_001686840.1"
                     /db_xref="GeneID:5655603"
     CDS             complement(1253498..1254298)
                     /gene="CYP10"
                     /locus_tag="LMJF_36_3130"
                     /EC_number="5.2.1.8"
                     /codon_start=1
                     /product="putative cyclophilin 10"
                     /protein_id="XP_001686892.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655603"
                     /db_xref="GOA:Q4Q1A6"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1A6"
                     /translation="MRVWVLAPHSLPPASFRPIFEARPPSSPTHSFHLLPTPIYLYIT
                     CTDAVDLYVCAVTSLLAEWTTTMFARSTIRWAAGAGHAFMDIAIGSQPPHRVTFELFT
                     KRCPIASENFLKLCTGENVLPQVSSIDGIGEPSFRDQFLPQLTYRNTTVHRVCKGYLV
                     QGGDIVSGQGTGQLSIYGESFDAPEEVKASKFDRMGLLGTAVSAPHLNGSQFFILTAD
                     KAPHLNGTCICFGRVVDGWTVVKAIEAIPLTAAGEPAERVVVVECGKL"
     gene            complement(<1255263..>1256012)
                     /locus_tag="LMJF_36_3140"
                     /db_xref="GeneID:5655604"
     mRNA            complement(<1255263..>1256012)
                     /locus_tag="LMJF_36_3140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686841.1"
                     /db_xref="GeneID:5655604"
     CDS             complement(1255263..1256012)
                     /locus_tag="LMJF_36_3140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686893.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655604"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1A5"
                     /translation="MASVDTQWAIKSILQLGHHHLRHGAETTSSSSSCLVRPTSPPFR
                     SASKAVQVTAMPRLMRASCDPSYVILLAKRPSGIAGVSLRPGNRVPWTGLPAAASSLV
                     SAPCSKKTRLLASYLQRRGFATIRPVATDTHSSPSQFRPVQRSMPLLLHTSHLIGWKL
                     NDASPAFPVYAHTLAELQQLRSSDVAALKPQHCLIANEYCEWDNWREVLGEPGWDLFS
                     ADEDAVERLLQDGLAISALEEEAGLYPVEVL"
     gene            complement(<1256968..>1258224)
                     /locus_tag="LMJF_36_3150"
                     /db_xref="GeneID:5655605"
     mRNA            complement(<1256968..>1258224)
                     /locus_tag="LMJF_36_3150"
                     /product="putative ADP-ribosylation factor GTPase
                     activating protein"
                     /transcript_id="XM_001686842.1"
                     /db_xref="GeneID:5655605"
     CDS             complement(1256968..1258224)
                     /locus_tag="LMJF_36_3150"
                     /codon_start=1
                     /product="putative ADP-ribosylation factor GTPase
                     activating protein"
                     /protein_id="XP_001686894.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655605"
                     /db_xref="GOA:Q4Q1A4"
                     /db_xref="InterPro:IPR001164"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1A4"
                     /translation="MNIRQRKSERHKEVLRKLSQNGGNKNCFDCGMRGPLYVVSDFGI
                     LVCSGCSAVHRSFQHKVKGITMSEFTDDEIARFSVSGNDRARKVWLSTFHDQLPRSGN
                     VMALKDHVHVVFEERRFWSAQELSALQDSWEHAQGQPSHAPPSLSVTRPAESPLASVP
                     EAPTAQPGPAAAPTSPVRPPQEDAFDNLFSAPVQPSSTPQPTAHAAAPPLPPMTTSHA
                     PTPPAPQQPATVTSIVADLFAGVPPPVVQPAGGYSAPHPQQQQQKQSMGYPTDGGMYN
                     FTQDPQSSMMAPTQLQSSQLPSQQQQPQPFTWGQPVPAQLQQQQQQQHMIGLLGSSGT
                     VAPYATPAQSQSYNFKNGAPGAAAYPSANGAPAQAYQPSPFASNPPPPQEGGGASFIP
                     NHNRIVVLSVTKQQNDGPQNPQPQWQ"
     gene            complement(<1259183..>1260190)
                     /locus_tag="LMJF_36_3160"
                     /db_xref="GeneID:5655606"
     mRNA            complement(<1259183..>1260190)
                     /locus_tag="LMJF_36_3160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686843.1"
                     /db_xref="GeneID:5655606"
     CDS             complement(1259183..1260190)
                     /locus_tag="LMJF_36_3160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686895.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655606"
                     /db_xref="GOA:Q4Q1A3"
                     /db_xref="InterPro:IPR006599"
                     /db_xref="InterPro:IPR012945"
                     /db_xref="InterPro:IPR016098"
                     /db_xref="InterPro:IPR017901"
                     /db_xref="InterPro:IPR027684"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1A3"
                     /translation="MEAKFLKLRQEREEQRRHRSKKTGAITLQRQQYEAEAELLEAEV
                     MQLLQEGNVTESQQRIDALRTLVQDTSNSISLTAHEMAKANVILARLQQRVDEKCSGA
                     APKKFKFSSRLKAKPTSDAEPATPSFSPTGTSDTNEATATATVPIAGTVSSTNGFGNV
                     YGPSTGTDLFISHSKGVFINGCADCAIYCLPIAGSAFLSNCTNCRVYVACHQLRLKGC
                     TNLDLYVWCASTPIIEECDAMRFGPYRCWVGLLSSCTEDGKTYATHAEWVSRVGEIED
                     TARTEQNYVKVDDFQWVKKRASPHWCVLAREEERASTTVFGPATLPSSSTAHSTVAAD
                     H"
     gene            complement(<1260926..>1261960)
                     /locus_tag="LMJF_36_3170"
                     /db_xref="GeneID:5655607"
     mRNA            complement(<1260926..>1261960)
                     /locus_tag="LMJF_36_3170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686844.1"
                     /db_xref="GeneID:5655607"
     CDS             complement(1260926..1261960)
                     /locus_tag="LMJF_36_3170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686896.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655607"
                     /db_xref="InterPro:IPR003495"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1A2"
                     /translation="MSSDDECPELISARVPVTVLTGFLGSGKTTLLHYILSADHDMRI
                     AVIVNEFEFGKTIEKGLTLKSSEKPDDEWLELNNGCMCCTAQTQTVKALESLMEHRGT
                     FDLILVETSGLADPGPIAAMFWQDLPLCGHLYLSGIVTLVDAVNICRYLDDEDVMREA
                     ERQILMADKVVLNKCDIATEAQQKAALAAVREINPVATVIPSDHSRVPNLRDILFIDT
                     TRAATELVHLHEHHHSSISAVSLEFFEAERAFAVSSYRDVHAIGSDLLYRCGDYGFEV
                     VRCKAAIWCCEDGQYRLLQLQSIGDLFDVTPMVGQSVPFGCTRALVLGKQLDEVKLRD
                     IFAKYLKATK"
     gene            complement(<1265533..>1269738)
                     /locus_tag="LMJF_36_3180"
                     /db_xref="GeneID:5655608"
     mRNA            complement(<1265533..>1269738)
                     /locus_tag="LMJF_36_3180"
                     /product="receptor-type adenylate cyclase a-like protein"
                     /transcript_id="XM_001686845.1"
                     /db_xref="GeneID:5655608"
     CDS             complement(1265533..1269738)
                     /locus_tag="LMJF_36_3180"
                     /EC_number="4.6.1.1"
                     /codon_start=1
                     /product="receptor-type adenylate cyclase a-like protein"
                     /protein_id="XP_001686897.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655608"
                     /db_xref="GOA:Q4Q1A1"
                     /db_xref="InterPro:IPR001054"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR015232"
                     /db_xref="InterPro:IPR028082"
                     /db_xref="InterPro:IPR029787"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1A1"
                     /translation="MWQPPRLVMNRCKGSSTRPSVTPVLLLLLLVLCAPASAQGGSLR
                     NSLDVECVLLQTTESSTVALNALDVTAQKASITCARKSLSSPLAWAPTDGSGSTLNVY
                     MSALSDTLLSSVVAASSSTSCTLVTSISEGVLDTRRMSKNVYFTNADPATEMLALLSY
                     VMINGAPPKIGFVYTRTDDEETSAGAAVYKEFVRRMDELAYTGTLVTYEAAEDYDSAT
                     FAAFSKKFESGVSVVFFFPSAGKGTNDMFAELLKSSREVKVLMPSWLIRTATSRYLVA
                     TKPKVPASSIIVSSTNPHPEDKNFEKSMGQFKKDYGNTKPTLASSSVDGIEAVAGWIT
                     ARATVATLQYHTLWTESPTQKLYFDMLHKQHVYTIGGDIVLGAYGSSCNVGGRMVLLY
                     SLRAMSSGETGAYYGLASVPGANLMLKSWECHAVDVTLSISKMVRAAYVKYHGIGENS
                     NYMTTQMDNIVPAAMVSATFTEATIGPLDSLADTTWKAALDNSPTIAVFGAASVGVDK
                     SPVEKVLVEPVFLQPTLYQNASNVVYLTATNEQQLGAVATWVAQSAVAPDVHAVLLNS
                     GASATAMQSTLQRIMTHAGVTVESVKTLGVGEKLSSKDLPKSGLVLLTGIMQNDIYTL
                     QKHIQNNQNARVILLFDEVTQWYRQIKQAFAASPSSGKRLVFVTNLPPWTPKKQDISR
                     ISAEFLATAIGPDYHSPASMRGFLAVRALSMLSYNAANPSTSALLDALYTQQVLQIKD
                     LTLGPFKRTGCAYSTGSNQVECTGVLNGGAGGIYIWSYSDMEGGTNGPIAGPYVVNLF
                     GYVDANDEGSSSSGKAHSSSSKSTIIASVVVCVIVMGVVVAAVIICVLCTRDSRDNRN
                     APKDENEHVTLIFTDIESSTALWATAPQAMSSAVALHHKLIRQLVIKYKCYEVKTIGD
                     SFMIACKQPFAAVQLARDIQVALHQADWGSTAIDDAYELIGKPSGGTDPGECGSRPWS
                     GLRVRAGVHYGLVEVRFDNVTKGYDYYGNVVNTAARTESVSCGGQVICTSSVVKALTE
                     EEQGMVQFVALGPHQLRGVAEPIEMYELRTVPGRVFPSKGSDVSANPLASLTAGAEAD
                     AAPNGEEVDPMLTQEDTFAEVATGVEPVAEVLDVYFSAYTNNQKIKFLQKTCKCFCLP
                     SPPRRMFASNDAYLNSLMLTVATRTSAVINFRHRKLENDTLRPAAESQANAPALELVA
                     HRDAAAELRRHSSVFFSGVDSPVAGESKRRRSVVIDRPGASLSKHGNSDSTMMLVLDN
                     GELLTLCSSAGQSCTEKLPEVREATKVYQNGAPSISGDEVTPCFEGGNGLLFRIIDKA
                     TKRWAFYNDTVDFVMHVYFSVGRTSAVKWGPSVAGKVTQAEETSRYEGELIVPPLSTE
                     VLMTGRVNGYTMRYCAMPSSGGE"
     gene            complement(<1273598..>1275298)
                     /locus_tag="LMJF_36_3190"
                     /db_xref="GeneID:5655609"
     mRNA            complement(<1273598..>1275298)
                     /locus_tag="LMJF_36_3190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686846.1"
                     /db_xref="GeneID:5655609"
     CDS             complement(1273598..1275298)
                     /locus_tag="LMJF_36_3190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686898.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655609"
                     /db_xref="GOA:Q4Q1A0"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:Q4Q1A0"
                     /translation="MPPAPPPALLPIEEPPIGTQPAAHLASGTTSQNTSSNATGGAVV
                     CDNCKTRGHLRRNCPKIKCNLCKRLGHYRRDCPQDASKRVRSVGGAPHEEVNLDEEYR
                     WSVCRNCGSSRHIQANCPVRYQALECYQCHQLGHMMTTCPQTRCYNCGTFGHSSQICH
                     SKPHCFHCSHSGHRSSECPMRSKGRVCYQCNEPGHEAANCPQGQLCRMCHRPGHFVAH
                     CPEVVCNLCHLKGHTAGVCDNVHCDNCGRNHETVHCHQPYLAPVTHDRVSEERSASLP
                     SEHDPSSADQSNNSATPCDSDDGGSNRGGEPRPRTGVSCAPVVPPYIPLDGPKRDGRV
                     AIVVDGSYFERCVAVRRNRSDPTYYRHITDALLYTIDYIGDIFQCEPFAYWFDTDTAA
                     FREFVETSMPLAHRENAFREASMRKRYLTDEMNSGRSLPNVVAKLVGGMKRQRGFTED
                     GPGHVWVQTGVDVATATCVIELFQDRRQFRQVVLLCGDADVYPAVQYCNTLRRSSHQH
                     ADSNPVRVCGTSDSMSKIYGQQQDLTDFLPRLLLDCPLHTEGGRTIEFPTSKVFMSVR
                     "
     gene            complement(<1276549..>1279392)
                     /locus_tag="LMJF_36_3200"
                     /db_xref="GeneID:5655610"
     mRNA            complement(<1276549..>1279392)
                     /locus_tag="LMJF_36_3200"
                     /product="putative DNA topoisomerase III"
                     /transcript_id="XM_001686847.1"
                     /db_xref="GeneID:5655610"
     CDS             complement(1276549..1279392)
                     /locus_tag="LMJF_36_3200"
                     /EC_number="5.99.1.2"
                     /codon_start=1
                     /product="putative DNA topoisomerase III"
                     /protein_id="XP_001686899.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655610"
                     /db_xref="GOA:Q4Q199"
                     /db_xref="InterPro:IPR000380"
                     /db_xref="InterPro:IPR003601"
                     /db_xref="InterPro:IPR003602"
                     /db_xref="InterPro:IPR006171"
                     /db_xref="InterPro:IPR010666"
                     /db_xref="InterPro:IPR013497"
                     /db_xref="InterPro:IPR013498"
                     /db_xref="InterPro:IPR013824"
                     /db_xref="InterPro:IPR013825"
                     /db_xref="InterPro:IPR023405"
                     /db_xref="InterPro:IPR023406"
                     /db_xref="UniProtKB/TrEMBL:Q4Q199"
                     /translation="MPTWLNVAEKPSVAKEMAQSLSGGNCRTVPSQSRFNPVYEFKFE
                     GKTMLVTSVAGHLMEDQFPPNTKNWSTYPFQGLFSAPITKYVRADLEPVKKNLEALAG
                     RADTLVLWLDCDREGENICFEVMQVVQSKRPQVQVKRAHFSALTARDLLNAVHNLKLP
                     DKRLSDAVEARQEMDLRIGAAFTRYQTVKFRHLFAAIPGVLSFGPCQFPTLGFVVRRY
                     WQQQGFVPEDFFTLQLQHGDTKFHSSRGSMYDQVAATLIYEDMLLAAAAEGHKGRITN
                     VQQRPSHRRPPVPLATVVMQKLAATHLRIPSERCMALAESLYQEGLISYPRTETDSYT
                     FQESELLELVRVQISNADVAEYATAMLADIATRVRPPLRGGRDDKAHPPIHPTKAWNA
                     TQDERGRLYNLIVRHFLASLSPDAVAATTQVSAEFGGELFSTGGTTILQRGWLDIFPY
                     ERWNSTCIPNYQIGDAFQPTAVPLKKGCTSAPPHLTETHLISLMDSNGIGTDATIAQH
                     IKTVLDREYVKREGQSLVPTTLGIALASAYESLGLASLLQPQLRAQMELAMGDIANGA
                     ATKEQVVAAAVQLYEEIFSRLMANTNAFYEELKRYLQPEVETDACAVQATVVKANFIP
                     CGTCGRLMDLVERAGERDREVWSVRCHACNKMHRVPNGRLNTLEPVSPPHTCPLCGFL
                     ALRVANREKQTSYHVCPHCFGSPPKAWSVTTYGCVGVAASLPDVEAAAEFRCFQCTAD
                     CPLAKGLEAIGITTCIACRQHELRLRSGANGFFLSCRGYPSCQLRVSLPAAASVKPSP
                     SQRCPACSAVLLTFDFSGRQGVPGLNMLDTICVRCDARIKDYIAVKGMPTSGANSSAV
                     PSAAASVASTASGTYTLPSVKPSARRSVRGGGQRGGRGGDAAAANTPSGGVDPVCGCG
                     TPAKQLVSRKEASRGKRFLTCANRQCSFFQWLD"
     gene            complement(<1283014..>1283790)
                     /locus_tag="LMJF_36_3210"
                     /db_xref="GeneID:5655611"
     mRNA            complement(<1283014..>1283790)
                     /locus_tag="LMJF_36_3210"
                     /product="14-3-3 protein-like protein"
                     /transcript_id="XM_001686848.1"
                     /db_xref="GeneID:5655611"
     CDS             complement(1283014..1283790)
                     /locus_tag="LMJF_36_3210"
                     /codon_start=1
                     /product="14-3-3 protein-like protein"
                     /protein_id="XP_001686900.1"
                     /db_xref="GeneID:5655611"
                     /db_xref="GOA:Q4Q198"
                     /db_xref="InterPro:IPR000308"
                     /db_xref="InterPro:IPR023409"
                     /db_xref="InterPro:IPR023410"
                     /db_xref="UniProtKB/TrEMBL:Q4Q198"
                     /translation="MTETIKWKNVAIQDEVVPRPSDIKLPDDLAELIYMAKLAEEAER
                     FDEMLLCIRKYVRLNSELDTEERNLLSVAYKNVITPRRNAWRVITSIESRENAKENSA
                     TLPFVVNMRRELEAELSPLCDDLLSLLDTYLIPAAQGGEAKVFYLKMKGDYHRYYAEI
                     DSGDGQRQAALSAYQKATDVANSSLAPTHPIRLGLALNFSVFYYEIMKEHEKGFQLAR
                     QAYDEAVTELETLDDEAYHESNTIVRLLRENLNLWTDDQL"
     gene            complement(<1284554..>1286206)
                     /locus_tag="LMJF_36_3220"
                     /db_xref="GeneID:5655612"
     mRNA            complement(<1284554..>1286206)
                     /locus_tag="LMJF_36_3220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686849.1"
                     /db_xref="GeneID:5655612"
     CDS             complement(1284554..1286206)
                     /locus_tag="LMJF_36_3220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686901.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655612"
                     /db_xref="UniProtKB/TrEMBL:Q4Q197"
                     /translation="MASYSELLQTCAEFQENFSALTGKYNALSLELKNTKAVCERKQW
                     QLDEAAAREEQQRKELLKLKKEVDDAAGLRERFHAAAVATEHLKSQLACAHQSAVDAS
                     LEHDQEVQQLKQQLEDMIKRVETAADGQRLREAQRQTLELEERCATMHAQLLEDRERH
                     SQQLLTAHNALREQQSRNLELEQRCRAMEADLAEMRAAVRRSTELQNEAALLKERFST
                     AATVAQHQVEELRAEAEEARRRLAQLKADHQAQMAQVAQDAAEAREELHERVASLTAD
                     LATAQSNLEEERSLYRKMQASAEEKVTQARNASVVEASALRCAQAALKEENTRLQWRL
                     EKMDGELREGQQALQALQSRHDSLAAKLQQSQGQLDTAAQQEAWLTCEKQNIADQLAV
                     ARQQLDVLNKALMNHEEVTLQVQQLTMRLANSTEEAQSHRCAALLCESQLRDVEEASA
                     LKVRELRRELKAYKKQCANEAARADRLRRKLMTALIEKEAELYRVSRATGRALTLEGE
                     PATIPASGTVLHDSAYSDVIGMLRNQSQQAEDLHTRLVQLAR"
     gene            complement(<1287880..>1289490)
                     /locus_tag="LMJF_36_3230"
                     /db_xref="GeneID:5655613"
     mRNA            complement(<1287880..>1289490)
                     /locus_tag="LMJF_36_3230"
                     /product="putative oxidoreductase"
                     /transcript_id="XM_001686850.1"
                     /db_xref="GeneID:5655613"
     CDS             complement(1287880..1289490)
                     /locus_tag="LMJF_36_3230"
                     /codon_start=1
                     /product="putative oxidoreductase"
                     /protein_id="XP_001686902.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655613"
                     /db_xref="GOA:Q4Q196"
                     /db_xref="InterPro:IPR000172"
                     /db_xref="InterPro:IPR007867"
                     /db_xref="InterPro:IPR012132"
                     /db_xref="UniProtKB/TrEMBL:Q4Q196"
                     /translation="MSKAYDIIVIGSGAAGCAAARACALRHPAASIALIEQGSRAAVP
                     QVMRIPLMQPYIASVRKARPFLQTLTCVAEANLAGRSLPFTLGRGLGGSWLCNDMKYM
                     RGTRKDYEGWADASWTYDTLLPVFKILEANSRGRSRDHGEDGPLRVTDAQRSNIDSGM
                     NVLFFEACEAAGVPATNDFNAGEADGFSAMQSYIDGGARVQAFHALIGGTRPRTPNLD
                     LLDETCAERIHCTAGRVRAVEVSHRGDKRLLEARHVVVCAGTLRSPLLLQRSGIGAKG
                     SVLDAPAVGQNLITTSAADLVFRIRNSSNVYSKSISWRNSSYLYRQWREYKENRSGVF
                     SAFVEGAAYVRSQLQQDAPDLSILFFRTPQMGMVHWPMDGFTMRVTHHYPSSRGEVLY
                     DGSKGTTLIRSGMLSTREDVLAMDEGVQWVGLLTTRDGTLRSVNHVDEKGRHVSPFWS
                     YGAALHHPRDGLITQCGTAAFLAEHVKSGGDLYGTCAMGTVVDSQLRVKGIAGLFVAD
                     SSVVPVPTVASSSTLGSAIGARVASFIH"
     gene            complement(<1290129..>1291055)
                     /locus_tag="LMJF_36_3235"
                     /db_xref="GeneID:5655614"
     mRNA            complement(<1290129..>1291055)
                     /locus_tag="LMJF_36_3235"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686851.1"
                     /db_xref="GeneID:5655614"
     CDS             complement(1290129..1291055)
                     /locus_tag="LMJF_36_3235"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686903.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3235"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3235"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655614"
                     /db_xref="UniProtKB/TrEMBL:Q4Q195"
                     /translation="MDSLYFIGKAQFHQLATHISLYHEDMSDGYKHLSTDAVMAVGLK
                     PHKFTYWNVPMMSGYLGKTVPLDIHGGYVMIDEEKVMPMATSYGMLRYALLTSAVRAK
                     EGGRWRYDFMTMNSTLAIGTAAGLGLLSFGRQRIGWIRRHPIGSVMASFVACLTTTVI
                     ARQGIKALGIGIVQAQNSHKRALNCLHCVDCLEDVNTYTLKQIEELKAQQIPQQAGMP
                     PPPEEYVRRFKKGVEMQCRLLETDMEEVRLIRKWAGASLCDVHQHLRDDPMGYKEPHG
                     LVLLASDRARAAERPPLATMPDDKKGIRPAKS"
     gene            complement(<1293798..>1294673)
                     /locus_tag="LMJF_36_3240"
                     /db_xref="GeneID:5655615"
     mRNA            complement(<1293798..>1294673)
                     /locus_tag="LMJF_36_3240"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686852.1"
                     /db_xref="GeneID:5655615"
     CDS             complement(1293798..1294673)
                     /locus_tag="LMJF_36_3240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686904.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655615"
                     /db_xref="UniProtKB/TrEMBL:Q4Q194"
                     /translation="MDDVHASPLERDNEQVAAAAKATNSTGVRRRRMNEVYPVMKNTI
                     YSDGECEVVVVLTSWDCGMRFIRYISDLFQYFVRNPKAMGLIFTTVIILLFFKYAQQV
                     VVKAVNAAVRAHSGLEPTDTIRSAFTSFTEELHALERAAQTIGWAYMRDSVEGYDMGT
                     AVVTAFSSLVRNVQLSLMANMRTCVVRAFPAAASTVFTSRHWGQIGGTPNETNRSVCF
                     CVSKDSTVRQWDTVSNTGDGGPLMSRAYVEQCMPDLLSVATTATKGSALAASGGVDAG
                     LHDMQYLPAKGLAHD"
     gene            complement(<1296223..>1297770)
                     /locus_tag="LMJF_36_3250"
                     /db_xref="GeneID:5655616"
     mRNA            complement(<1296223..>1297770)
                     /locus_tag="LMJF_36_3250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686853.1"
                     /db_xref="GeneID:5655616"
     CDS             complement(1296223..1297770)
                     /locus_tag="LMJF_36_3250"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686905.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655616"
                     /db_xref="InterPro:IPR013176"
                     /db_xref="UniProtKB/TrEMBL:Q4Q193"
                     /translation="MALTTSSDVAAPLISLAVYCPLLCADKEKHGADNILFYFPSDTH
                     LNLQMNQVGFCIAISSLAPLFGVHCSRRQTIRKQRSSVCLMSPAEDLWVSAHVRGGNE
                     AALTTHHLLQLSCALFELLYSADTVLRLTLPDMEKGRKEGPPAGTGSSTPSTPTTDKA
                     VSSDTAARPALRSFFTRCATFISSVLAAQCKARDGATERMGRSGAAMSAQDWAHHLSA
                     EAAFGFPLRFVSDRELPSLQLGRVEEVVRHILWRPVDGCTAGPDGDAPSSLGRDSVHC
                     CVFDLPSLHVVMADSRLPRVVVQSLKYYLVLYAPIACTSFRCHVPPGGLCEAAVWLDG
                     NVVVVLVDMHEDETASVGVRAVSPSLMEHARIISSAVRQLLSKPAAGAISVEAKDAYW
                     LSTRDVPTHQLYYKLTLKPPIAASSGLVAHWRLRGTVVEGTPFRQVVPGLVEYLRVLV
                     HSTKLCLPSSTSTSVLEYWTRWNSFWVYLRFAGPTVTALAWQHQQHATSVRQLAYEAQ
                     HLLLVAP"
     gene            complement(<1298489..>1299073)
                     /locus_tag="LMJF_36_3260"
                     /db_xref="GeneID:5655617"
     mRNA            complement(<1298489..>1299073)
                     /locus_tag="LMJF_36_3260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686854.1"
                     /db_xref="GeneID:5655617"
     CDS             complement(1298489..1299073)
                     /locus_tag="LMJF_36_3260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686906.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655617"
                     /db_xref="UniProtKB/TrEMBL:Q4Q192"
                     /translation="MLRSTGVSLYYRATAELDRLRGMLRGRARLERKVGLKRITFLMR
                     TQTRYRVEQKAHWERAIVRKNVDSAAHEHGSGWQHLRNDLARQNLMLLPRTQQQLAQY
                     EPLAFRAVMELCASRVAPPPPPMTAQVPEEAYATRPEDPKVAHPAARRQLEECVERML
                     CTGRSDVLQREGPRTTQAWMDAWKEYDLGSAAQK"
     gene            complement(<1299978..>1300367)
                     /locus_tag="LMJF_36_3270"
                     /db_xref="GeneID:5655618"
     mRNA            complement(<1299978..>1300367)
                     /locus_tag="LMJF_36_3270"
                     /product="putative 60S ribosomal protein L22"
                     /transcript_id="XM_001686855.1"
                     /db_xref="GeneID:5655618"
     CDS             complement(1299978..1300367)
                     /locus_tag="LMJF_36_3270"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L22"
                     /protein_id="XP_001686907.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3270"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655618"
                     /db_xref="GOA:Q4Q0X2"
                     /db_xref="InterPro:IPR002671"
                     /db_xref="UniProtKB/TrEMBL:Q4Q0X2"
                     /translation="MVAVRAKVGSRSYVRQKQLAKGKKVFKIDCSIPAADGIFSEDVL
                     GNFEQFFQDNTKLNGRKGKLSDKVRLSMNDNVLTISTTMAYRKKYFKYLTKKFLKKKD
                     LRDWIRILATGKGTYQLKYFNIQDQEE"
     gene            complement(<1302242..>1305754)
                     /locus_tag="LMJF_36_3280"
                     /db_xref="GeneID:5655619"
     mRNA            complement(<1302242..>1305754)
                     /locus_tag="LMJF_36_3280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686856.1"
                     /db_xref="GeneID:5655619"
     CDS             complement(1302242..1305754)
                     /locus_tag="LMJF_36_3280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686908.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655619"
                     /db_xref="GOA:Q4Q190"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:Q4Q190"
                     /translation="MLRRRVSATPSLAVSPAGPSSLSLTPSPADSQQRRSLKTLDVRE
                     YRPLGTPIEFRFYQRYANHPNRQSGVQFLTHYNTHQRFRVNKDFIDYMHWGKEQGQAR
                     LPHRHQRVAFDFDDSLQPTRAEGAVGAWFAGQDPTMRSHPDISASFDPNKKLFSHPEH
                     WNKMFSKRRPGEGDIKLNVIPSNSLLGPMVTQTDTQDMAYFKTETCGPTHGRVPGINA
                     PFKGEMDRKMMQAMSRPLNRSCTLTGNNGRFSNTIFINDPKRHQTLSATLAKELNREV
                     DRATNGLYSKLTVLTSAQSGLTDFFCGGTDLQCIGFDLTMAQLLRKEADALTKSAASG
                     SKKVEAKVHELLRDAERYEERADSVLRENAAVIWRAYTSPRALMTLVNGKCRGTGCGL
                     ALAAKYAGLQDASEFIVDGPNVGLTPYSGMTRLLARPETSLKYPGLAEFVMLTGASLF
                     AGDALRLGWSDLFTSLPDMPYHIKDWFDSTEHMHNDAVAWQLGHLLEKCFQMKDRWHT
                     SAMERCAMTPIRARWVEDAFADQSSIEEILKTLSAMEKLPLTDRHNTYDPSYATPYTL
                     ASVAEGVEKLGASRLRYTLSPWDATPPEEAVEVRQAAEIFTSYVLERRGKVNIVAHRD
                     RHKVQAWQKQREREYVAYSNMKNAPHRRHVYVRLEGCEGTLVDFDFTIDPAGDAAAAA
                     AEKGAGVDDRNELVHTASVERLKRAVLQAMGMPADRDVDLCWYLPTLDTCPIRNDEEL
                     VDVLHSDPGFEDPSAQLRYPPIYFLVKRNTLHLSEWAYAVKHQLLLQSPYALKATLQL
                     LQEVRGDGSAKAVRSLADTLATEYRYAARLLKRPDFYQVGQHVDKSPEEWDVVKEERM
                     RYVHKAHLPTRPLPDYEVVFERNVQLDGHTFQLRPRWSPRTVQEVTAESLAPLATPLD
                     FEKDGAVEFNVVVHASKADRLAGMIEDAGGFEVVAHLGEVDKEGNAKVPPLHGDAHVP
                     TNVNFYEMARHPWEDTPSSTRRDGFTAGSKEYFEQQYKKAEKAVYDEAGRGQRNYWPS
                     KAAVDGVTGEESNALLEERFFAKLRDAERGVESWARQLRKKAVEGKLDNKPEIATQQE
                     KIYDDDYYRWFIQPGHNPNPSGLLRGRKVADSGSSSVDKDLEVFLNQLLSGAAERGAD
                     GTTGDEGEALSLPEEDTDEAADST"
     gene            complement(<1306700..>1307530)
                     /locus_tag="LMJF_36_3290"
                     /db_xref="GeneID:5655620"
     mRNA            complement(<1306700..>1307530)
                     /locus_tag="LMJF_36_3290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686857.1"
                     /db_xref="GeneID:5655620"
     CDS             complement(1306700..1307530)
                     /locus_tag="LMJF_36_3290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686909.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655620"
                     /db_xref="InterPro:IPR002589"
                     /db_xref="UniProtKB/TrEMBL:Q4Q189"
                     /translation="MVSYLEGQVTRDGRKRAPRHLFGTNYRKPFPWIRVGLGLAAMAA
                     AADIVYRRMSYVSPQEQFVRKIKIRPYGVMGTQMTLQGSLRQEGPKPDDTMVITDPCD
                     LMHIFTSAAGATGTSGAIYKWVGLTKAFPHDVVMAMSKVGDAKHHQYGLKDSEAGEQH
                     VIHVSAPDFREGIWSEREAAIELSRAYRNVLHEYVVSECDTLRMVPLSDGLQAGPLYN
                     QLPAITHSALLMGFEQLHLFDKEYVLRDEKNIELCVFMNREWDMFNNAFENLPVGPTG
                     "
     gene            complement(<1309800..>1312259)
                     /locus_tag="LMJF_36_3300"
                     /db_xref="GeneID:5655621"
     mRNA            complement(<1309800..>1312259)
                     /locus_tag="LMJF_36_3300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686858.1"
                     /db_xref="GeneID:5655621"
     CDS             complement(1309800..1312259)
                     /locus_tag="LMJF_36_3300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686910.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655621"
                     /db_xref="UniProtKB/TrEMBL:Q4Q188"
                     /translation="MSRAREVSQKLTYYGGITLPNIPRIAPDEKSRQKYLSEYEKYEP
                     ELRRHHLGDAETTNTIGLKDVPPDFDRTMPSLLDPTAAEVEYERAREGRKARALRKGH
                     RGASARVAQAAGMVNPTPPARKSVSPQPSQIALTDEEPAQKGTPSPSSPSSAAGTPTT
                     AATAAPAASEEAARLTPVEADGTRTWDAVVVEAAPAHVPQPPSERSHPMTATATTPMS
                     QPRARTAPSLKPQQDGTRLGKRTGTSPAASARAAKPKSRPRAQPERATTPATAPTTPR
                     RLRTPFAAHEPPTAESTARVLRVLLDPPQQYASSLHLDLSSFDLGWLRNGQAAPRHLT
                     TIANHFNDNGASPQLRINSPRSVIAFLENGASPKDWDPRSSATSASAAALGGATQDMA
                     AVQAEVHEHRRAYVQAQRDAVRRTLQDSYSVLCARVPFNELVGWYRRLCEADMLADAA
                     LAQQHSLATAVQQLQERQRQVFETNKIRMMRQMQQAKELQERQEASVQRKLQVEAEAG
                     ELRRQKALEEQERRRLQQARLEEHRAERQRREEAYKQLLQARLNRAETCNAERMAARE
                     RQLQAMQQRREAQEAERLRRLERSTAALEEKFAAEEQKRREKAAKLEQLRAAREARLA
                     EERRALAEKQQRAAYLREEAKRRSEEAEEAVRREALQRQQHAEERLREFQSRRHEEAA
                     QRAVAVAARHERCNEIRSQALAKEELLKATVEDKHRQSEEHHRERQSRQLTEFMWRRE
                     ANWEEEEAKTYAVLQLQRIAEFNKLHTVVDLLEKRKAANAVVRQRELICEKVMRARDE
                     LREGRAVLKQEVERSSQETWR"
     gene            complement(<1313675..>1314898)
                     /locus_tag="LMJF_36_3310"
                     /db_xref="GeneID:5655622"
     mRNA            complement(<1313675..>1314898)
                     /locus_tag="LMJF_36_3310"
                     /product="putative actin-like protein"
                     /transcript_id="XM_001686859.1"
                     /db_xref="GeneID:5655622"
     CDS             complement(1313675..1314898)
                     /locus_tag="LMJF_36_3310"
                     /codon_start=1
                     /product="putative actin-like protein"
                     /protein_id="XP_001686911.1"
                     /db_xref="GeneID:5655622"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="UniProtKB/TrEMBL:Q4Q187"
                     /translation="MTGVSASIQSVVVDVGTRNTRVGFSGEEAPRTMLRSCVGLPGTR
                     RPRPTLLQHPFDIATGDAAYNDGGLLSLTYPVRAGHVCDYDALEKLLFYALVEEARVT
                     PDTSPFLFLVPADQTRLDRERLCELLFESFNIPLAGLLTNTAATLYSSGRTRGLALDS
                     GAGRTCVAAVEEGYTLAHSVRSSSLAGEALTDELFAALRAGGYPLSTAADRGVVEAAK
                     EALCRVSADAKDEEARQVGTHSHPDPADGFILPDQERIFLLEHAYKVPEALFDSTYLT
                     YTTALSAERPTTPTGYSQSNPIVKKTLSGWVGMLRDAADAAPRILEQALYENVVLGGG
                     STLFPGTEQRVQREIAGIAPKGVRATCVAFPERGAAAWMGASIWGCSSVFPDTCLAKA
                     TYDEQGSSVVHLYTQ"
     gene            complement(<1316163..>1316627)
                     /locus_tag="LMJF_36_3320"
                     /db_xref="GeneID:5655623"
     mRNA            complement(<1316163..>1316627)
                     /locus_tag="LMJF_36_3320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686860.1"
                     /db_xref="GeneID:5655623"
     CDS             complement(1316163..1316627)
                     /locus_tag="LMJF_36_3320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686912.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655623"
                     /db_xref="UniProtKB/TrEMBL:Q4Q186"
                     /translation="MLRRSAGRYMKPFLHAFSPGARASEKGMLYRNSYMNAHAQVASI
                     QSTHRTRRERTIFLLLLLPDQVFMCIIVFATGCVAVAVLFRQQPFSTNLNKDRWLSGG
                     MNPHEQYERNATMSQIFEMHKEAIDNTRAELTRPQVFSAPSGYHSPSGVYTP"
     gene            complement(<1317913..>1319139)
                     /locus_tag="LMJF_36_3330"
                     /db_xref="GeneID:5655624"
     mRNA            complement(<1317913..>1319139)
                     /locus_tag="LMJF_36_3330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686861.1"
                     /db_xref="GeneID:5655624"
     CDS             complement(1317913..1319139)
                     /locus_tag="LMJF_36_3330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686913.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655624"
                     /db_xref="UniProtKB/TrEMBL:Q4Q185"
                     /translation="MSTYANSQARLNRVAPQLRPAGVHGDWTEATMAELLSSYNPNGI
                     ITPDHIRSFHHRGCDVGEQRRHWGLAKDAPVDPNMRHGVKGKETGGADACLRPEMYAD
                     KMTALLDAQLESQYLSNRRKPLGHAPVPRDPVPVPFGGFGITQKKGDSTQSVLAGYRS
                     VDVLHPAGEQLTRNYDWEKAGIDPTQHRFGKPSARSDGTTAAALFNDSATQLTSKLAK
                     DYETTVAKELGKSKRYGFDDPAEWDEEKRGSVTKFGATGTAASYFQTEQPTVRELLSS
                     WAQTASGPRADKAASGKAGQQGLTGSADSAVTAKADASAAAPVASGPSLTEPLKDEAR
                     AHQLLYPCHYVSLGVESKYFAGGRPLEDIRRLCHKCSFGLSDADIDAVFVLVAKGGST
                     CSIEEFKNAARARGYM"
     gene            complement(<1320420..>1327997)
                     /locus_tag="LMJF_36_3340"
                     /db_xref="GeneID:5655625"
     mRNA            complement(<1320420..>1327997)
                     /locus_tag="LMJF_36_3340"
                     /transcript_id="XM_001686862.1"
                     /db_xref="GeneID:5655625"
     CDS             complement(1320420..1327997)
                     /locus_tag="LMJF_36_3340"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_001686914.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655625"
                     /db_xref="GOA:Q4Q184"
                     /db_xref="InterPro:IPR027272"
                     /db_xref="UniProtKB/TrEMBL:Q4Q184"
                     /translation="MSSSREFITTGGGPAPISRRCVATLHVLFFVLATISAVSLRAPI
                     WLIGGLVYCSKHRNALTGQHLFPLRLWQVLLASLVTSAVCSLVANLVTTLQRNTAWVQ
                     KAVWRTLYPLWALLGVQQWDAADYVNTIVWPGATAVVLGAYLLILKRTLAGRVLSRND
                     AMRAVQDRPVPSSLLPRWAGMALAAHRPAAKPLLSLFSWAAAWTAEPSLVGLCLEIFT
                     FVFVAAFLYVEHRIRKPPRRAVQSGKGAQRRIPHAFGTAVAVVLVGVCVTQNSAFFFF
                     TNARGDWCRLLGMGPAALDTVAGLRYAMQMVGMAGVFLGAAFMHHGTESSESTLPDSG
                     ADAAVPASGEATPLLAAMDQRVLATPAPDASLPSTSARGEGLPNRHRRTPQVVAIVCI
                     TALLAYAVYYPSLVSTAVWLLHLCCCAEGLVQNPMAPPSAHRIAIACVLAVLCCTILV
                     QYVFQALAGNPRTAAWGQWSPARPAYPDDGCAVGAQVVAEHLIALLFGVYVSIAGVSD
                     TGGGGNSAREGAEPAAPPRSSLVSRVGFSTEANAHFSDSVQVTWLRAQLSDAAGDQKQ
                     MRYLFQVAVGRSPRTIELDAICLAAAQQSGGSSPIASRGGLTVEEVTQLLVSGPFYTY
                     AVILCMFVLGTSSVSMDLLHATCLVVSLGVSVIGGSAMLYRRVRSVPPMCVAVVVGVQ
                     LCYTVFAAGDEKQRQQPHQLIPRGAQPSFLKAALGNYVSLTALTWEDCAPYLCAQLVL
                     MWCSRYTPKWLTNWTHIAQCLAFRCSWARFIRTVYQVAGAVVLAWIVLLLPRSASVTG
                     LILLLFTVALLQHLRLHRLAYVWRRFFVVGYCGVVLMCMLTAEFQPVQPRLWRLLRAL
                     GCPPGSEGRCAQDIGLPADSAMWLTPLSIPWWLIIVLATATARLHPLPSSLPSSLAAA
                     PATGVPEASTPWFWRALVWWPKVLSDVLSIAILAGMVHAALQRPSILAALYLVGPGLG
                     VFPCWTLGVAAVHAALQCVYQLWFSPGWLDAQTRLGVSPAQLLGLWRPLSAMGSTPNL
                     PSTLVVAAAPLLVGVAQSLQLQCALLARRRERDTVAACPGRVSMWCRLQRTCATHLYM
                     LLLWVLLYLTQKIALGWGVGVLIMMVWISAEVRSCGVLQRRRWLFAACGSATSVLMVL
                     AYLLHWLHTVFPWWSALAMYPYLFGGSINEDKTMTALQSVCCAAAAACVVLRVSSGAP
                     RGNESEHLLCHSHTPSFLDWLRRHSGQLRENHEDISASLSEMPPDEIRYFFRDVAGVF
                     HCDEEVAEEADTSPLSRGPAPRRNGGVVVSVVRLMPLVACGSVAVGSATASPPCVLRA
                     ALLLAGLCLAVRHPRLHWSCWRWWRLTVALYALLPLIALVAACPCVRDAIPKLPPWVG
                     LLIGWSVDASHVDGNALVFSHWHVMLFLCLWLQSCVYNCPQSGTALLRQQGEERLLSE
                     TRHAALQRQLLSHMANATEKTVRVDQEVCSYLNALRAGDDMVFTCQVCQRRSSEHVEE
                     NGDEHDSDAERVRVSMPSPPSMTPVLEPEEVNKVLDDAVELPRPPLTFPAAAGRNNVP
                     TPSYDQAQPPLLRCWQQRCVLWLRWICDKLAACTYHPSEYRLSAVVADSSTSTLWLLS
                     QYALRAAAQVVLRHTSFALLGCSVVNSLLTGCLWELIGLCYVVQVALAYHPHPPRVVY
                     KALGVYLGTGMLLKEAASMWTFFGNANPSLITALSWILLPLKGQGRSSRNSNQMWANV
                     PYSRGALRYDMLWMDLVTIGVIVLYDRVCIIHGVHVERDQQQSMERDRSDVMVMLEGP
                     ASSAGSASLSNSITAATTLLPSPSFLLLTPISHGTSIIGAFRALVADYCQNLLTVPGV
                     GEDWYIFYTSVDSLALLMVAVYYSRIAGSNNGTLQDHVQNNLLPGPMALLICVSVLQL
                     VMDRMLYVQRSMRLKALANGVCAISYTVFYWWWRNAVTVSEHATGNVYFALKVVALVL
                     SVTQVCRGFPVHRRRHIFTTHLGSLLSYSFTVYRSLPFLWELRTLVDWTVLRTSLSLQ
                     EYLTVEDIYVYIYQCRDRYLEKHRNNEKLGDAVAPLSKWSFGVSRLALVLLALLGPLL
                     YYSTYNPSTVANSATQLNFQLSFFGTYDFFATTVRDNVTTPEGWWTWIERTRPTLGSY
                     GFMAEGKTVQLMEFTSCSSSLWMASPQAVRQVLAGLRAAASNASSAYMLQTLEVSRSV
                     SSTDAAMAASLVNHWPIPQDTAQDLVAILERETSGARGAAVVDSENSSSSVVVGSASL
                     PFFYSPFVFNRASRIDKLTTSLHFPHRNQHNCTLELNHGTDITLNSRVRYWCLRCAPL
                     FPEGNIPSENSSSAAEWRCLTTGEGCDDFNYEDAAGGSGSRTVQASLAAQMNSGVTAK
                     QVSVYMVIISDTVVMGISLLKGIGIVALYTTFVLALGRLLRSVLTNQTSTLLYSNMAN
                     PAALQNMVRCMEMAREYGDLRLEHTIYLELVDLLRSAERLFRVTGPLRCMYGDAGHED
                     LFGLGQVRRRNIHRNPSVEAREGEAGEGHGDSGVPAAVPHLAHGG"
     gene            complement(<1329201..>1329788)
                     /locus_tag="LMJF_36_3350"
                     /db_xref="GeneID:5655626"
     mRNA            complement(<1329201..>1329788)
                     /locus_tag="LMJF_36_3350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686863.1"
                     /db_xref="GeneID:5655626"
     CDS             complement(1329201..1329788)
                     /locus_tag="LMJF_36_3350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686915.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655626"
                     /db_xref="UniProtKB/TrEMBL:Q4Q183"
                     /translation="MLRLTQAVLRVQSHQKKRAQHPNAGTRFGRVYNRGFVRYGFGGF
                     GMSVYSSKKDRTFKVMPVPPPPPATTAVEQRDDFADNRGLSATTRTLSPTFRMFALED
                     GGVLVSHPSHAQIMRWNQRVHTEEGKAANSTVMDEYVNSRIQAIIADNTIENTSLSQW
                     RKAHMWNVIKSHGKLQRRWGTPDFVMGARSTLYNN"
     gene            complement(<1331543..>1332214)
                     /locus_tag="LMJF_36_3360"
                     /db_xref="GeneID:5655627"
     mRNA            complement(<1331543..>1332214)
                     /locus_tag="LMJF_36_3360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686864.1"
                     /db_xref="GeneID:5655627"
     CDS             complement(1331543..1332214)
                     /locus_tag="LMJF_36_3360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686916.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655627"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR018359"
                     /db_xref="UniProtKB/TrEMBL:Q4Q182"
                     /translation="MASQPGDALGKIEYWVQYIDCALKHPRPLPAGKHAHRQSLETIP
                     EVAELYHCIYKLYNEEESSVWFREPVNALAQEIFTYYDVVKSPMSLRHILDNIVKGDT
                     YSTALQVMEDVELIWKNCITFNGANSLLATEAGKCRSALDRIRRAYQDDQRITVEEAE
                     RLFRVISSMQEQQLIDNIAEYLRRDDPTSIDETGAVNFDMLKRKHFRNLERIVDNYSK
                     SRTRS"
     gene            complement(<1333310..>1333618)
                     /locus_tag="LMJF_36_3370"
                     /db_xref="GeneID:5655628"
     mRNA            complement(<1333310..>1333618)
                     /locus_tag="LMJF_36_3370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686865.1"
                     /db_xref="GeneID:5655628"
     CDS             complement(1333310..1333618)
                     /locus_tag="LMJF_36_3370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686917.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655628"
                     /db_xref="UniProtKB/TrEMBL:Q4Q181"
                     /translation="MGLKRLAKAAKITSKHMLLLNRREPYKPVTSDRVMIENRRRLED
                     FEAKNAEGIVFVPDTALPPWQKSIATNLKQQATQMNFRGFRVRVADKQDEPGFPTHFR
                     "
     gene            complement(<1334685..>1335101)
                     /locus_tag="LMJF_36_3380"
                     /db_xref="GeneID:5655629"
     mRNA            complement(<1334685..>1335101)
                     /locus_tag="LMJF_36_3380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686866.1"
                     /db_xref="GeneID:5655629"
     CDS             complement(1334685..1335101)
                     /locus_tag="LMJF_36_3380"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686918.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655629"
                     /db_xref="UniProtKB/TrEMBL:Q4Q180"
                     /translation="MFRRSSSVMRRAVSAFLKEPGQAKTFQETLAVCEAESRDLASML
                     SSDFLLLQSKLFKYRIARLGEETRYVMKHPLGCLPSADMVLVHFVALPLVFFAAVCIG
                     RGSSRPLVQPPAAKMEVAAAAAATADAAAVAPEEQT"
     gene            complement(<1335968..>1336180)
                     /locus_tag="LMJF_36_3390"
                     /db_xref="GeneID:5655630"
     mRNA            complement(<1335968..>1336180)
                     /locus_tag="LMJF_36_3390"
                     /product="putative ribosomal protein L29"
                     /transcript_id="XM_001686867.1"
                     /db_xref="GeneID:5655630"
     CDS             complement(1335968..1336180)
                     /locus_tag="LMJF_36_3390"
                     /codon_start=1
                     /product="putative ribosomal protein L29"
                     /protein_id="XP_001686919.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3390"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655630"
                     /db_xref="GOA:Q4Q178"
                     /db_xref="InterPro:IPR002673"
                     /db_xref="UniProtKB/TrEMBL:Q4Q178"
                     /translation="MAKSKNHTNHNQSSKNHRNGIKGPVPLHLHNSKRGSWLPALVNA
                     RRVRKHNQKAALKKRRERIAAFAAKN"
     gene            complement(<1337345..>1337557)
                     /locus_tag="LMJF_36_3400"
                     /db_xref="GeneID:5655631"
     mRNA            complement(<1337345..>1337557)
                     /locus_tag="LMJF_36_3400"
                     /product="putative ribosomal protein L29"
                     /transcript_id="XM_001686868.1"
                     /db_xref="GeneID:5655631"
     CDS             complement(1337345..1337557)
                     /locus_tag="LMJF_36_3400"
                     /codon_start=1
                     /product="putative ribosomal protein L29"
                     /protein_id="XP_001686920.1"
                     /db_xref="GeneID:5655631"
                     /db_xref="GOA:Q4Q178"
                     /db_xref="InterPro:IPR002673"
                     /db_xref="UniProtKB/TrEMBL:Q4Q178"
                     /translation="MAKSKNHTNHNQSSKNHRNGIKGPVPLHLHNSKRGSWLPALVNA
                     RRVRKHNQKAALKKRRERIAAFAAKN"
     gene            complement(<1338385..>1339515)
                     /locus_tag="LMJF_36_3410"
                     /db_xref="GeneID:5655632"
     mRNA            complement(<1338385..>1339515)
                     /locus_tag="LMJF_36_3410"
                     /product="short chain dehydrogenase-like protein"
                     /transcript_id="XM_001686869.1"
                     /db_xref="GeneID:5655632"
     CDS             complement(1338385..1339515)
                     /locus_tag="LMJF_36_3410"
                     /codon_start=1
                     /product="short chain dehydrogenase-like protein"
                     /protein_id="XP_001686921.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655632"
                     /db_xref="GOA:Q4Q177"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:Q4Q177"
                     /translation="MRSPRLLPPLPFPFCQLSLSPLPCTSNTRPHPHAHMCARVALRP
                     SLSFFFFTDAEAAKHNKSTSSLSRLGMSRVAFAALLSLAVALLSRHVYRRVNRQRLQA
                     GAVALITGGGSGLGMELAKIFAVSHCEIVLVGRNEAALKAAAQVCREAGAPRVEYIQA
                     DISKAEGTDRVRSEYARLYKGTGRSLAPPLKYLVLNAGAGAIAPFTTEPAFEQICHAM
                     MDINYFANVRLLQAFLPQLTQNHSSSSPSRIVIMSSLAGVLPSILRSAYTASKHAIQG
                     FMNALRGETAVHITLCCPGYVDTDFHSRVLTNDGKLLGGNQRRGVSPAVCARQCMDGV
                     LCDDAEIIMTTGGKLAYRLRPFLTGIIDVLVKRKSLKSLEHH"
     gene            complement(<1340104..>1341189)
                     /locus_tag="LMJF_36_3420"
                     /db_xref="GeneID:5655633"
     mRNA            complement(<1340104..>1341189)
                     /locus_tag="LMJF_36_3420"
                     /product="vacuolar protein sorting-associated protein-like
                     protein"
                     /transcript_id="XM_001686870.1"
                     /db_xref="GeneID:5655633"
     CDS             complement(1340104..1341189)
                     /locus_tag="LMJF_36_3420"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein-like
                     protein"
                     /protein_id="XP_001686922.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655633"
                     /db_xref="InterPro:IPR028934"
                     /db_xref="UniProtKB/TrEMBL:Q4Q176"
                     /translation="MLRDELPPEKGQQSFSLWSRILRSIDGCKLEIVLDDQTEADKIK
                     VVDIYDKVSERFPLYSWKEPVKGRVVVTPTGSSYSHQGVVVELIGVASTFREVESRVV
                     FLRQERQFEPDTLNQSTPFEFTFSAPKEHESYHGIYARVRYFVQATVKQRIKSPSVKE
                     EVWVHRVDTALSESQTDASAHMNYFRETCFGPESIAMNVGVDNVLHIEFRYDKKIFHL
                     AERVLGKVEYKVADMDIAYGEVGLVRKEFLAPGQTDETMESETLQKFEIMDGTPIVEE
                     VVPIRLYLKSVPRLTPSYMDVENLFSVRYFLNLVLVNQEGKRYFKQQEIQLYRRTGQE
                     RSATSFNSGLPVTPASGDVDAKGGWSA"
     gene            complement(<1342557..>1344935)
                     /locus_tag="LMJF_36_3430"
                     /db_xref="GeneID:5655634"
     mRNA            complement(<1342557..>1344935)
                     /locus_tag="LMJF_36_3430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686871.1"
                     /db_xref="GeneID:5655634"
     CDS             complement(1342557..1344935)
                     /locus_tag="LMJF_36_3430"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686923.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655634"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR011074"
                     /db_xref="UniProtKB/TrEMBL:Q4Q175"
                     /translation="MPAKASGGVVAITSTDWEAQYERDFTAQKGSGPIIFSEEERRKN
                     RELCSRLRDILPFDDAYKVSDCDLMYRFLIGKHWNVASTEKGMREYARLRKSDDLNNI
                     IGEQLHPTICSVLSPMYKGEPYPIYGLDKEGLPVLWLSPDANKLMAAMKDFTSEQLLR
                     FQLRSMEVSRYVCLQRRVDRCTYVIDLGGITISSVNKATLALLKGVMNLLQVAYPEIM
                     RRLLIFNAGWAVSAAWKVLRPLVDVRVQDKIKFESGPPSLAALEQYIAADQVHPSFGG
                     TGSANVLGPIIDAEVRRIRRGVEGRVSPDPAAAAASVIHRPSLESRQSTSLLSRDALT
                     LYSVESTTPLSTACPSPNCNPSLAGSGHAEEREQVAIGVPSAVTAWLVKTSTASGPLN
                     VRDMSLSVASSSGEYACCREQASPTPAADDTTKCSYRGVASPPSRDTSADDTATSSRE
                     SVPIHATTSIEPTAQQQAELPIVTISLTYGADGSISGYCGRQWVGCFQHGLLYAPATD
                     DDDSAFPRRSPSLLPSSQPYVAGGCAGRSVGVPAGELLAEAGHPLHTFLIVCDAQRRA
                     RYLVRESRLRKRLTIYNVFGDAEVHTDKNNRHYVEGERAKLGVVVPHSNATSCGGKED
                     WMLYGKDVTKRSSRNPTLPLQQFLSKTKRAVLTAKKSRSGDSLDKSQNSRWAASIFAA
                     LRFRAYSPAKRKSKSISFKASGSANVPPPSLPDQSEKHCDAVTDDSTQLLAECKGQTV
                     RFYKLLTKNSLPDLFALAFAITQSWSNEMDSCKGEAAAPKETHYSSDDDVMP"
     gene            complement(<1347834..>1348484)
                     /locus_tag="LMJF_36_3440"
                     /db_xref="GeneID:5655635"
     mRNA            complement(<1347834..>1348484)
                     /locus_tag="LMJF_36_3440"
                     /product="SNF7-like protein"
                     /transcript_id="XM_001686872.1"
                     /db_xref="GeneID:5655635"
     CDS             complement(1347834..1348484)
                     /locus_tag="LMJF_36_3440"
                     /codon_start=1
                     /product="SNF7-like protein"
                     /protein_id="XP_001686924.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655635"
                     /db_xref="GOA:Q4Q174"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q174"
                     /translation="MPVFGNMFHRTTPEEEVRKWTRSLRSEQRKIELQITKIRREEAK
                     VKLSMKQAAKQNDQVVMRMLAKEMIRSRKAVNRMYASKAQMNSVSMQLQNQASQMKMS
                     GSLKKSGEIMKEMNSLVKVKEVQQSMMAMSKEMVKAGLIDEIMNDTIDEALDDDISDT
                     ELEDEVNKVVMDVVQGQMDGARVGASRIPAQQQQQQETAEEEEDELMEKLNALRNS"
     gene            complement(<1349576..>1350433)
                     /locus_tag="LMJF_36_3450"
                     /db_xref="GeneID:5655636"
     mRNA            complement(<1349576..>1350433)
                     /locus_tag="LMJF_36_3450"
                     /product="glycosyl transferase-like protein"
                     /transcript_id="XM_001686873.1"
                     /db_xref="GeneID:5655636"
     CDS             complement(1349576..1350433)
                     /locus_tag="LMJF_36_3450"
                     /codon_start=1
                     /product="glycosyl transferase-like protein"
                     /protein_id="XP_001686925.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655636"
                     /db_xref="GOA:Q4Q173"
                     /db_xref="InterPro:IPR002654"
                     /db_xref="UniProtKB/TrEMBL:Q4Q173"
                     /translation="MRTSPLWRLRMTSRPLSLERVFVINLDRRPDRWAAIQAVCARAG
                     LPAERTERVPAVEGSRLDVNAVHHCGFVSALGLRRLKEPPEHHIWGMDLNKAALGCAL
                     SHIHLWARIAALGKVSNISAEAPAATLPKQCFLVLEDDSTFADSDDNGSDSPAASPSL
                     PFLDQLQRRMNSVPPDWELVYVSGLDTAKQCLHMQVAKGVARVPQYHRTTNAYLVTPQ
                     GARRLLATCVPLTFQLDTAMTMNVGYPPGVVGVAGAQTLPHVLDPVCYTLQPPLMQQA
                     AQLDTDIQH"
     gene            complement(<1351438..>1352040)
                     /locus_tag="LMJF_36_3460"
                     /db_xref="GeneID:5655637"
     mRNA            complement(<1351438..>1352040)
                     /locus_tag="LMJF_36_3460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686874.1"
                     /db_xref="GeneID:5655637"
     CDS             complement(1351438..1352040)
                     /locus_tag="LMJF_36_3460"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686926.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655637"
                     /db_xref="InterPro:IPR011008"
                     /db_xref="InterPro:IPR012577"
                     /db_xref="UniProtKB/TrEMBL:Q4Q172"
                     /translation="MLRLCARHLGDAKSASHVYELRTYVVAPEKYDSFHQLSMKYMPQ
                     RPCIGICQGCWTVQLGGVNQYIQIWRYENLKHRYDCRKQVEQDQEWLRTYVKPADDMM
                     ISKSNTLLRLVYREGNASTQSYKYLMQVSPHKEVELSGPSATLAATFQVIVGEEEGKY
                     IHLVKGHKLDDVIPVTPTLGCSSKIMGPVRWSSTMNCLWR"
     gene            complement(<1354417..>1357356)
                     /locus_tag="LMJF_36_3470"
                     /db_xref="GeneID:5655638"
     mRNA            complement(<1354417..>1357356)
                     /locus_tag="LMJF_36_3470"
                     /product="putative 2-oxoglutarate dehydrogenase E1
                     component"
                     /transcript_id="XM_001686875.1"
                     /db_xref="GeneID:5655638"
     CDS             complement(1354417..1357356)
                     /locus_tag="LMJF_36_3470"
                     /EC_number="1.2.4.2"
                     /codon_start=1
                     /product="putative 2-oxoglutarate dehydrogenase E1
                     component"
                     /protein_id="XP_001686927.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655638"
                     /db_xref="GOA:Q4Q171"
                     /db_xref="InterPro:IPR001017"
                     /db_xref="InterPro:IPR005475"
                     /db_xref="InterPro:IPR011603"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:Q4Q171"
                     /translation="MGRRRAAEAVPERQLLFDNDSFLSGSSAMYMDGLYQQWKKDPAS
                     VDASWAELFSRSDLGNYNHALLDTPICVLPAKSSDEAVVKQSLADCGRLIRMIHTFED
                     RGHLMAQTDPLNYVDTDVTERTPSRRYKEMVRLDLAYFGFSDKDLDRVVRVGFQNQMG
                     GIYDTSSPQLTIRQLHELLTERYCGRIGFELVHLTDGDAKRFVRSQIELKDGCSALHR
                     PMSREERLRIWDTVASAVFFEDFFKRKYSTQKRFGCDGAESMVAGLRALLEKSSELGV
                     QAINLGMAHRGRLNVLCHVIGKPFEVILKEFVGVTGQELHPFQIQSDVKYHLGYRGQL
                     KLNSGKVMETEMLFNPSHLEAVNPFVQGYTRAMQVSLGEKGREKVLPIEIHGDAAFAG
                     QGVAFETMCISEVGEQDTGGTVHVVCNNQIGFTTDPKSSRSSAYCSDLGRVYNCPILH
                     VNGDYPEEVIRVFEFAAEYRARFHKSVVIDLVCYRRFGHNENDDPSITQPLMYERVRA
                     MPDVFRRYTDALITQGILTPQQSTQKAIDEKARYGSYQEAAAQVNYAEYLKKSIPDKW
                     KCMKYSDELGNVTQHPTAITQETVDKVLKALKTYPEGFQLHPKLKAVLDRRNETIETG
                     EGIEWGTAEALAFGSLLLEGHQVRVTGEDVERGTFAQRHAVIHDQSQERTYVPLAHIS
                     DTQGRMIINNSPLSEYGMLGYAAGYSLYDPTSLVIWEAQYGDFANGATIVFDQFLSAG
                     ESKWNQQQSCIVTLPHGYDGKGAEHSSGRLERFLQMSSEDVTTPAYSKEERAHRINWE
                     ITYPSTPAQYFHLLRRHQKRNFRKALVIFFSKKYLRAPNVSTLEELTSGEFQPVIPDL
                     SVPASQARRLVMCTGQIYHYLNKYRETKGVKDVALVRVEELSPFPVAEVQQLLAEYEK
                     AELMWAQEEPKNMGSWAHVEPRIEDYTKGERELRYAGRSITAAPSTGYKSKHEKEQEI
                     ICEMVFH"
     gene            complement(<1359006..>1359632)
                     /locus_tag="LMJF_36_3480"
                     /db_xref="GeneID:5655639"
     mRNA            complement(<1359006..>1359632)
                     /locus_tag="LMJF_36_3480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686876.1"
                     /db_xref="GeneID:5655639"
     CDS             complement(1359006..1359632)
                     /locus_tag="LMJF_36_3480"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686928.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655639"
                     /db_xref="InterPro:IPR026714"
                     /db_xref="InterPro:IPR028124"
                     /db_xref="UniProtKB/TrEMBL:Q4Q170"
                     /translation="MTSFKDCLREVREAATEHLEGYRGGDTEKALQHIPREEALTTIS
                     LVAIRLLEQELPKRGAGNDASQHELHAQLRACRKALKSHSARSAAGDEGTSDKKRRRT
                     EESTEAPTSSSYRGSATADRSGTSNSIELGQYASSDAFDQNEQKRMKFARLMGGAKVA
                     AQGTGGAGGHSRHNTFAASNAELKRMNANLESQFESAMSHKGKKGLGA"
     gene            complement(<1360552..>1361571)
                     /locus_tag="LMJF_36_3490"
                     /db_xref="GeneID:5655640"
     mRNA            complement(<1360552..>1361571)
                     /locus_tag="LMJF_36_3490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686877.1"
                     /db_xref="GeneID:5655640"
     CDS             complement(1360552..1361571)
                     /locus_tag="LMJF_36_3490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686929.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655640"
                     /db_xref="InterPro:IPR021298"
                     /db_xref="UniProtKB/TrEMBL:Q4Q169"
                     /translation="MVFVVVKGTNYPDEFTVERALTDALSSPEETSRGAADVNSPPHA
                     CSSLLSTDTIVPGIAHILNKRHHVRLMLMSAQELAMLWPQHQHRSDGAASTEARESRE
                     SEGVLERYQALIDSLYTRLRDAKTPVLADEFDNAERELRALTATLYSSLCTHADGPEA
                     AVQQLYTKYEDPDLDEDTRLVVYHCRALLDPEWKANERVKEDDAALWFCGKPMEATLA
                     KYCGRNEKSKVIVKVAPRKGPSPSCEPRMRYEDQRALYRAMCQRREAYKQLEDSELRD
                     RVVQQSRSTGRILLGAAAAFGSRTEGAPTLTSLASGTSSPVTLCTDGLRPIFPRKEER
                     ELPIS"
     gene            complement(<1362351..>1364813)
                     /locus_tag="LMJF_36_3500"
                     /db_xref="GeneID:5655641"
     mRNA            complement(<1362351..>1364813)
                     /locus_tag="LMJF_36_3500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686878.1"
                     /db_xref="GeneID:5655641"
     CDS             complement(1362351..1364813)
                     /locus_tag="LMJF_36_3500"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686930.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655641"
                     /db_xref="UniProtKB/TrEMBL:Q4Q168"
                     /translation="MADPFLDAGNPLELEVTRLTQENRELRQENARLRARISLTATPS
                     ATASNAVSERSSLRRAADTAAVHVGTSPGAKPIDKPGGALSHRSTRAAEASTPKQHQQ
                     QAVSTARIEEAVQRVKKELRGEVEKYQKAAETKASQMEQLKQQFELFVTTTCEREAAY
                     ELVHMQVFRELEEQRALARAAQAQLEEQRLEAVEMRTALQAAAAAAAAPSKCGTLASL
                     SPSPPSKSEDVAVASSSSAARPAKKCRTGKTAKHADDGDKSNATEAQTTQEDVVEVQQ
                     EVAMPAPNVTPEPRQLRIVQGGAALRADSKASRLKRPRASSAMSVSSATRSTRMRQSA
                     VALAQLHMPASPVFAAASASSADGAVEVAVTSSSGTVATAFPAAASASSPARQAASDA
                     LGDLWALLARHTEATHGFLPLWQHLARLRGSDRLAALRAMISLLLHLLGPADATMPLV
                     LPVPLSTSVAAPPTSITVLATAIRLLKVQLESEEQQQRGAAVSRADATAQQCSALFHS
                     LFYRICVATLRRWQMAEAEADAVDNWATALVHLYGFQPALSKLVQYTNSTIAYERTHL
                     AHSWVTYTAQAIFAQCFTSSSTSSAEVAVARWRELCDSIGWSPHSLPLERLETAAARC
                     VARTRVSLGFFTAACAEEALLSLRLVVLYRGFDHMERIAALLEMPGVLPMVITKEIYA
                     ELVSLAVMDRSPFRTADAIQHALHLLREYVQEVSPERCTSAEHFVSVPRLSHLLAALA
                     LLRVESTNTAATARSTETDSAICEAVQAGRQTALRWLQAQKVALNMVRQSAALARDRQ
                     LLLRDTVLGQRLLRDASATVHS"
     gene            complement(<1365798..>1366358)
                     /locus_tag="LMJF_36_3510"
                     /db_xref="GeneID:5655642"
     mRNA            complement(<1365798..>1366358)
                     /locus_tag="LMJF_36_3510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686879.1"
                     /db_xref="GeneID:5655642"
     CDS             complement(1365798..1366358)
                     /locus_tag="LMJF_36_3510"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686931.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655642"
                     /db_xref="UniProtKB/TrEMBL:Q4Q167"
                     /translation="MFSSSTGAGAAAAAKPSAGPPSVALATVTVNEDPNIEVLLASKR
                     IQKLTRATDALIARDFVLREEEAILDDLEAYIISLESEVRKAEFQTEELRSRSSLLRP
                     GKRCAIAGENVELSALWNAYGSDMGYLVKRHSLRLAVLEKALATVSTRNPELPVPKPL
                     PPPPVTKTSKTMSAMRDMSQRQKAPS"
     gene            complement(<1367512..>1368291)
                     /locus_tag="LMJF_36_3520"
                     /db_xref="GeneID:5655643"
     mRNA            complement(<1367512..>1368291)
                     /locus_tag="LMJF_36_3520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686880.1"
                     /db_xref="GeneID:5655643"
     CDS             complement(1367512..1368291)
                     /locus_tag="LMJF_36_3520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686932.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655643"
                     /db_xref="UniProtKB/TrEMBL:Q4Q166"
                     /translation="MTAAAGAHGDDSHAHDDHRGHHGAATAPYERIKAPSMASEDYLD
                     NLPAFDTKKPMPKPRTAVERFTRVLQMQFGQDPDMPTLGYNTERKYHSLLDYLASPIT
                     PLRPRTYVDSHTRPNPCPEEYWWASWRWPRTKYVNAKVPPPVDGKYTDYYHYLAFKNW
                     LERERDVYVAHANLVHEMTSRCLVKEGQYNAAKNCRHLYHKGFAMSRMEELNQAMLYM
                     AMTGNAAIRETPYPENFVEEKRKIYDDWLYRTRMRKPGDAA"
     gene            complement(<1370931..>1373444)
                     /locus_tag="LMJF_36_3530"
                     /db_xref="GeneID:5655644"
     mRNA            complement(<1370931..>1373444)
                     /locus_tag="LMJF_36_3530"
                     /product="putative polyubiquitin"
                     /transcript_id="XM_001686881.1"
                     /db_xref="GeneID:5655644"
     CDS             complement(1370931..1373444)
                     /locus_tag="LMJF_36_3530"
                     /codon_start=1
                     /product="putative polyubiquitin"
                     /protein_id="XP_001686933.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655644"
                     /db_xref="GOA:Q4Q165"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR019954"
                     /db_xref="InterPro:IPR019956"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4Q165"
                     /translation="MQIFVKTLTGKTIALEVEPSDTIENVKAKIQDKEGIPPDQQRLI
                     FAGKQLEEGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIALEVEPSDTIENV
                     KAKIQDKEGIPPDQQRLIFAGKQLEEGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTL
                     TGKTIALEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLSDYNIQKEST
                     LHLVLRLRGGMQIFVKTLTGKTIALEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGK
                     QLEEGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIALEVEPSDTIENVKAKI
                     QDKEGIPPDQQRLIFAGKQLEEGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
                     IVLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLSDYNIQKESTLHLV
                     LRLRGGMQIFVKTLTGKTIALEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEE
                     GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIALEVEPSDTIENVKAKIQDKE
                     GIPPDQQRLIFAGKQLEEGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIALE
                     VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLSDYNIQKESTLHLVLRLR
                     GGMQIFVKTLTGKTIALEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTL
                     SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIALEVEPSDTIENVKAKIQDKEGIPP
                     DQQRLIFAGKQLEEGRTLSDYNIQKESTLHLVLRLRGGC"
     gene            complement(<1374746..>1375861)
                     /locus_tag="LMJF_36_3540"
                     /db_xref="GeneID:5655645"
     mRNA            complement(<1374746..>1375861)
                     /locus_tag="LMJF_36_3540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686882.1"
                     /db_xref="GeneID:5655645"
     CDS             complement(1374746..1375861)
                     /locus_tag="LMJF_36_3540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686934.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655645"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR024559"
                     /db_xref="UniProtKB/TrEMBL:Q4Q164"
                     /translation="MSTSQPIVKPFIYLRIPSEDARPVEELHFNGHNEAELRHTLTRC
                     FRQSLLSDDQKKDMARHLADKASESAKKHAVKGNGDASAAGSGAEPPVDVEQQQAAMI
                     DQYLEQASYEIIPVTMPMRSTQYIGTSLYIDDSGAFKDLPLNYRASKLAQREIRGDAF
                     LLSNHDDPALDEWGRVDCPLQRYEELYANPPQIAYDPSNQAQMTQAAMLRETETKKIS
                     LEDYEKAQKAKEDGNRLFAANDLPAAVQAYSMTVDLTDGRRDLLPNEEAATQLRLSAL
                     LNRCLCFTRLKKFPEAVRDAQAAAYLDPKSMKAYYRLTYALCGAQEYEAAAQACEKYA
                     QLGGAEEDVTAMRTAVAAGETEVKKAQKQIFSKMFRS"
     gene            complement(<1377099..>1380590)
                     /locus_tag="LMJF_36_3550"
                     /db_xref="GeneID:5655646"
     mRNA            complement(<1377099..>1380590)
                     /locus_tag="LMJF_36_3550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686883.1"
                     /db_xref="GeneID:5655646"
     CDS             complement(1377099..1380590)
                     /locus_tag="LMJF_36_3550"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686935.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655646"
                     /db_xref="UniProtKB/TrEMBL:Q4Q163"
                     /translation="MQLQSRAPEHFSTPFFSSPSSSVAYESGCSLDALERLVHFTGAG
                     ADACLYAVHPPQAKGTDSAALTPTTEGLRYWLNPSVRARPTTATCEITNLGPPFFAST
                     STAVLRISATPLFVDGRCFPTRCVVSLATSAQRLDGVSLRPVVVTEWNLTASGAAGVC
                     TTTVPLRTLYHLAVLISSSAPATGVEEVRLYLHLRFMGCSDGSDTHRIAAVRLRYEQL
                     GTAAEVLPQLLQRRQRAAAHVMLPSPYDVKYHSEGRFTRAGAPLEEVEVGVIAGSSTA
                     TSSGRKDMGDDAGKSLFVGAKERRTHTSPPSSTRMRSDGCEDAAAESAAAVAASPPRR
                     SATRPRAERLLSADRDSSSRIEAVGVTEGRDGPKLVCVDRALRIPPPPPKLSAAAGSA
                     PSLLSGPWPPRKVRTIVLAPSISPSLCSSSAGTSPRGSPSPLPSPPPTTNADSSAKAH
                     SNTSLAGTARCREAESCDREGFEDAVDALMPLTQQNVQGRFLEPTKPDERTSSPVSDA
                     GTSSQRRHCHESSSVPRHIPSAEAQEVSQAVAESCPDPHLHPFAPQQLYAHSDPAVLW
                     AATSLLGTLPWTLASQHQSRISTPAVSVASSRAPSCDGSAQAMSTDSAKGAPCWQMRQ
                     LTPSKSFLDSGSCAHRRDTRETQQRSWKRTPLGALDPNTSFHRPERTTVTAKADLAAM
                     TRTFSTESTTAFLQHWRRNESAHASPQLHPPHPFATASPSTSHPKPFSRPSFPQPATT
                     YAPLQRPTSAFVPRLLLRSRQRSNETRAASSTQRGGGVITTNRSRSIGSSSATTATAA
                     SAPPPSQNRSLWSKAAAPSGASSSLDARPRRSATADVHERRRLSTAASPMSSSAVLSV
                     MSSSWLQSNATVTPKTPSESAAEMKSQSSTASQRSFRSSTAPPSSHRPQHVPSPTGAA
                     ATERMEDAVSVASGSSAPLPPSPLPPPEGCALFHSPAPTHSSRSSSPSSSSSRACAAP
                     VLPLQEAHDGNRNRNRPRQRSITQSGSGHGSNNSSAFRQFVVQTFAVWKHHASRRGVG
                     RRWLRIERLPPSPSTSAAARFRITLDKAHPPVLARASMLLGRSSSSSGNNSDHAANPS
                     CEVCIRRTDTVEVWCGLRAYHSGVIHQRKVHRAECCLVIRCNAQLVTAVELESTEAVD
                     TVRRLLSDRRCTPHAKM"
     gene            complement(<1381572..>1382750)
                     /locus_tag="LMJF_36_3560"
                     /db_xref="GeneID:5655647"
     mRNA            complement(<1381572..>1382750)
                     /locus_tag="LMJF_36_3560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686884.1"
                     /db_xref="GeneID:5655647"
     CDS             complement(1381572..1382750)
                     /locus_tag="LMJF_36_3560"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686936.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655647"
                     /db_xref="GOA:Q4Q162"
                     /db_xref="InterPro:IPR002060"
                     /db_xref="InterPro:IPR008949"
                     /db_xref="UniProtKB/TrEMBL:Q4Q162"
                     /translation="MRNKEATDYYRALPQNELSKEDMWRRINEASADRAEATGTAIGS
                     AEVDYIKLEDELRDFDLFHYRIGEMAYPDQAMRRDYYALWNLAMSLNKARWSMLEVHS
                     QRGMKTTGAGMKLIFWKESVGAVMEKRKMCTGEFTDSHPVLRPFAAAVERNPHMTKAF
                     VRGFTDARLRVIQQPGNVQQLFDHFDKFYGYFFNSLLEVTHIKDEATEHLMTHVGRAT
                     GLTNHCVMFWKKYARLGFTMLPADLCADNHVNLGLLKNIPLASRDRAVRKVLFDVMCI
                     VKDEMLHAQKCAKDVPPKAWPIVMECLYANYYLGFLQRRDFNVSAMFADHNIENAGFT
                     WYRLKKRWEWERYQSIERLVDEAAPLPYINTCFTHRGSHYKMASGVGSGAPQAQRKRS
                     "
     gene            complement(<1387119..>1388936)
                     /locus_tag="LMJF_36_3570"
                     /db_xref="GeneID:5655648"
     mRNA            complement(<1387119..>1388936)
                     /locus_tag="LMJF_36_3570"
                     /product="putative signal recognition particle receptor
                     like protein"
                     /transcript_id="XM_001686885.1"
                     /db_xref="GeneID:5655648"
     CDS             complement(1387119..1388936)
                     /locus_tag="LMJF_36_3570"
                     /codon_start=1
                     /product="putative signal recognition particle receptor
                     like protein"
                     /protein_id="XP_001686937.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655648"
                     /db_xref="GOA:Q4Q161"
                     /db_xref="InterPro:IPR000897"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR007222"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR013822"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q161"
                     /translation="MIDTLSIVSDSGVVLWQCTTHETGRRVMVNKLIQEVLLEDRAGL
                     AQYSVDDYQLRWALENDARFFVVAVYPKFFKPHYMHVFLRDIATTFAKKYGKQTAQQD
                     FFSSIQGSSNQVPAENLMEFSAEYAALLAKFNTSEEAASRHGVESEDRDEAACSGSSG
                     AAGEASDSGSAQGDGADDDFYRDNPQQPAAQNAGKVIVTKDGRRLTIGGGPGKGNASG
                     ASKVAPSSGAAKKRGKKPTRCDNPWAAHDPMVEKQLHQKKATEAELQAQASIHRETYI
                     KRLPNGGIAPVKEREWEGQSRGCLATWLRSYVGTREVDAEDLKKIIPDLREKLIVKNV
                     AVEVAEHVCKSVEASLAGKRLGTFDSLYKTVEDAMMASLRRILQPKCEVNLLRNVAAA
                     KAAGKPYSIVLCGVNGVGKSTSLAKIAYWLQQNGNSVLLAAGDTFRHGAVEQLGVHGR
                     CLGVPIFQLGYGTDPSTVAAAAMAQASKQHIDVVMVDTAGRMQDHESRMRALAKLIHD
                     NQPDLVLFVGEALVGNNGIDQLRKFNQCLVDFAPVGSQLRGIDGIVLTKFDTIDDKVG
                     AALSMVYELGQPIVFVGVGQTYQDLKVIEPEVVVSALMK"
     gene            complement(<1389910..>1391313)
                     /locus_tag="LMJF_36_3580"
                     /db_xref="GeneID:5655649"
     mRNA            complement(<1389910..>1391313)
                     /locus_tag="LMJF_36_3580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686886.1"
                     /db_xref="GeneID:5655649"
     CDS             complement(1389910..1391313)
                     /locus_tag="LMJF_36_3580"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686938.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655649"
                     /db_xref="InterPro:IPR018553"
                     /db_xref="UniProtKB/TrEMBL:Q4Q160"
                     /translation="MHFSQYPLRLTDLERQKLQLIVAALKVSEYTDDVDDFMRPYGKE
                     GRMEAAMREFIDIVVGLAIASDAIPRSVKNSFLAGEVKVATVVPLLEDLFEIMRRHKR
                     LNPFSHRGEFGKLMMMLQDVQKRSLQRALEIQSTLVIPVRTVEAALSSIYCETLVDDE
                     AVRTDYLKRTGAEKQAGMQSLIERYGKGDEHKKEVIEHCLRSIDDVYSFIQSNTRPLR
                     TLRRWLSRDFEPLPSDDVYSISIRHGRSGACFTHSHATHCQYVTESLLLWENVQKNIL
                     NLWEAAEDDMLVEGQGQYVVANTGQGFHRMCSAPKSYGVMSRLVRDTEQRMGGWVGIK
                     VIHLGDRDVPNPLVFIDKYTVIPRLVKPVVQTLHALRYVLHEEDEEEEGQPQVAHEYD
                     NYPGLRNLLRSKYHSYSELMMMILSDFFKHAFDGSGDDGGSCIDGRLTSAWNWCHQLH
                     KKKYYDAFVLTGFAGFD"
     gene            complement(<1393412..>1394413)
                     /locus_tag="LMJF_36_3590"
                     /db_xref="GeneID:5655650"
     mRNA            complement(<1393412..>1394413)
                     /locus_tag="LMJF_36_3590"
                     /product="cysteine synthase"
                     /transcript_id="XM_001686887.1"
                     /db_xref="GeneID:5655650"
     CDS             complement(1393412..1394413)
                     /locus_tag="LMJF_36_3590"
                     /EC_number="2.5.1.47"
                     /codon_start=1
                     /product="cysteine synthase"
                     /protein_id="XP_001686939.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655650"
                     /db_xref="GOA:Q4Q159"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="InterPro:IPR005856"
                     /db_xref="InterPro:IPR005859"
                     /db_xref="PDB:4AIR"
                     /db_xref="UniProtKB/TrEMBL:Q4Q159"
                     /translation="MAAPFDKSRNVAQSIDQLIGQTPALYLNKLNNTKAKVVLKMECE
                     NPMASVKDRLGFAIYDKAEKEGKLIPGKSVVVESSSGNTGVSLAHLGAIRGYKVIITM
                     PESMSLERRCLLRIFGAEVILTPAALGMKGAVTMAKKIVTANPNAVLADQFATKYNAL
                     IHEETTGPEIWEQTNHNVDCFIAGVGTGGTLTGVARALKKMGSHARIVAVEPMESPVL
                     SGGKPGAHKIQGIGPGFVPDVLDRSLIDEVFCVAGDDAIETALKLTRSDGVFCGFSGG
                     ANVYAALKIAERPEMEGKTIVTIIPSFGERYLSTALYRSVRDEVSSLPVVDASELQD"
     gene            complement(<1395092..>1396834)
                     /locus_tag="LMJF_36_3600"
                     /db_xref="GeneID:5655651"
     mRNA            complement(<1395092..>1396834)
                     /locus_tag="LMJF_36_3600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686888.1"
                     /db_xref="GeneID:5655651"
     CDS             complement(1395092..1396834)
                     /locus_tag="LMJF_36_3600"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686940.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655651"
                     /db_xref="UniProtKB/TrEMBL:Q4Q158"
                     /translation="MLHCVLCVCVCACMYGPYSEDHYAGPAKRHLCTPLTSSPCCVTH
                     LHMLFAHATPTRSDGAFFFFTAVVGAAHRLPPQTTDKRNSIARIPPPSHTGTHTHRKR
                     EQAAMSVDKTFGTFCAMSALQQRRDGLPVPSETSNSFSYYQWLEVAKAKYVESQPPAS
                     SSPGQQRPPAKRAKTEDGVSDSGSALADGLAQQLVASLKSQTESGNSPAALHHAAQEE
                     FPMPQASADMPAFLALAEAALRLTLWTPEDERLAQLAARLRPNLRTLEERGIIRFYYG
                     CFPSLQVLMDLLSWRIIVHRWGRLASEMRQVAVDGVLTLCGCLDSVATAALRAAVQAL
                     PVSAASSSSADTLELKTLDTLVGHVSAAVPFQFATCRDLAPLYPEPAGLLHVPGAPAA
                     SSESVLRDEQQSRPADEKRVDYDAEVQVGELLGVRCTPTLTVHASVEEESPTRRTQAA
                     PVAALPSRPLLKATRRTSGGIRPSAGVTQTRHGIPTRTASGHIACMSQFHARYVDPAK
                     HASPECPYCATCHLMEIIFRGNKRSCLWGHWPTPRKIRLHLKQFPTVMKLAQERFAAI
                     QRGVQLAATDEVPL"
     gene            complement(<1398879..>1400483)
                     /locus_tag="LMJF_36_3610"
                     /db_xref="GeneID:5655652"
     mRNA            complement(<1398879..>1400483)
                     /locus_tag="LMJF_36_3610"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686889.1"
                     /db_xref="GeneID:5655652"
     CDS             complement(1398879..1400483)
                     /locus_tag="LMJF_36_3610"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686941.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655652"
                     /db_xref="UniProtKB/TrEMBL:Q4Q157"
                     /translation="MECADTVLLIASYLTKKELMALSGVSHLCRKIVSDSFISYEEKK
                     YLVWPCLKDDYVELAPPSQILALGVLEKEQRLLVLVRSGTDTSRIDEMECYLYTQLVD
                     DDGCVVEHQKELPACFAFPSSLVHFSGNRYLLCKTREGDLHVFDCLIEAMVEVPVGTD
                     GFYASPDGDHFLLDYNRHVFFCTASVHIACWWEMTPVDLKRHGGTYNAASNLPPSALV
                     ATHLRAQIVPLPDPFSSCANSTSGNAPAHVDTTHPAPPLHFYLGTSSAAWRTFWMGSS
                     SALCANEDGVSLLKTGNYPEMVAERLTSLSPSCSDFVDRSCGDVYGTPCKDRDEYAVM
                     NCREVRLHTVSYWPNRRPTTEVRAIDLNAIVPSRATIKSVRIAVSRVTYLVYMQHQGL
                     DRVLLLSSDLTLTRWISIGHSSCYVLWRQQVSLVTASLSDGAGDNFHPLVEAVEGGLG
                     CVYTFGMRLPEVSSTAAADPFVTTVKVTSAVDGGVGPAGAGRFLILPHSITGVEALSW
                     MAFGVVSSSLLWTVSALCYNGWWLHL"
     gene            complement(<1402403..>1402714)
                     /locus_tag="LMJF_36_3620"
                     /db_xref="GeneID:5655653"
     mRNA            complement(<1402403..>1402714)
                     /locus_tag="LMJF_36_3620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686890.1"
                     /db_xref="GeneID:5655653"
     CDS             complement(1402403..1402714)
                     /locus_tag="LMJF_36_3620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686942.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655653"
                     /db_xref="GOA:Q4Q156"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:Q4Q156"
                     /translation="MQQSLIPGHNNNRHLTYDEVENNIGGLPVTDNRIQDLFDSLDVD
                     HSGTVSVEVVKKFYMGLEHYGVDLSDKELDEMVRKYAATHDESLSYEEFACFVLSLAQ
                     W"
     gene            complement(<1405224..>1406096)
                     /locus_tag="LMJF_36_3630"
                     /db_xref="GeneID:5655654"
     mRNA            complement(<1405224..>1406096)
                     /locus_tag="LMJF_36_3630"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686891.1"
                     /db_xref="GeneID:5655654"
     CDS             complement(1405224..1406096)
                     /locus_tag="LMJF_36_3630"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686943.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655654"
                     /db_xref="UniProtKB/TrEMBL:Q4Q155"
                     /translation="MHRVFLVRSSDAMATTTSTDSDVDCNHGVWNATTLTCDCDAGWN
                     TDWLNQDVLGGNYVYCNSQASTPPPSNSSAATTSFLADKSILIMIVALAVVLAALCGI
                     VVFYCYWKRLRRAKEEAKGAQIVAAANEEAGRQEALQLQQMQEAALQQQLWAAQLEAQ
                     RQNQALLNHLVSMSTMPAASSSQLSASSRHRRHWHEMLPRHQGEVAYACDANYEGGNS
                     LAETFDGWGSQEPLVQCPSSYRRGAPLSTTDGYNNYSDILPSYYTTTTTEAPRREAHS
                     PPPYAQLASRHPPF"
     gene            complement(<1406576..>1406941)
                     /locus_tag="LMJF_36_3640"
                     /db_xref="GeneID:5655655"
     mRNA            complement(<1406576..>1406941)
                     /locus_tag="LMJF_36_3640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686892.1"
                     /db_xref="GeneID:5655655"
     CDS             complement(1406576..1406941)
                     /locus_tag="LMJF_36_3640"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686944.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655655"
                     /db_xref="UniProtKB/TrEMBL:Q4Q154"
                     /translation="MALVISDEATREAERILACSNSFEVLELSPSNCTKEMVLEQYET
                     KASLFKGLFRNKLAMQAKAKLGNAKVRLADAQLREKEAAALKVLQSDVHKDYAELQAL
                     EVRTRVLEMRAATIQGEAA"
     gene            complement(<1407462..>1408640)
                     /locus_tag="LMJF_36_3650"
                     /db_xref="GeneID:5655656"
     mRNA            complement(<1407462..>1408640)
                     /locus_tag="LMJF_36_3650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686893.1"
                     /db_xref="GeneID:5655656"
     CDS             complement(1407462..1408640)
                     /locus_tag="LMJF_36_3650"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686945.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655656"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4Q153"
                     /translation="MQEIIDTVNRYTLRSAAFRDKPTPGLAARQFLCSLLLHRKLDSI
                     RLSSIARYMFSTEALIAVSRDGIQTISCEGNTLWPICTIPNGLTSEISGVAVTPEGTL
                     VCSSNGICYLEGENLRVAEDCASSSYAQNVLCISCTPDGRYIATGGGTATVTVWTSDL
                     KPLHHFAGHTDWVRFVKFARGRSPALQLFSTGDDGVICQWDVLAGSLISRVDYSLGES
                     IQLFEVSYYSGLMAISSGTSLIALYCPQSDNTTRAVGEDVLRLQPMALITGAHEYTPT
                     AGKFTDDSQWLASASEDETIALTYVLDPQTCFVCKKFVTRRRCFSFMNIFNSICILAA
                     PPVSSVIVIAACSSDGTVVQWVVDPRTNRASYTKKLQLHLGSFLGMDLIPGDDLNHLL
                     "
     gene            complement(<1409103..>1409696)
                     /locus_tag="LMJF_36_3653"
                     /db_xref="GeneID:5655657"
     mRNA            complement(<1409103..>1409696)
                     /locus_tag="LMJF_36_3653"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686894.1"
                     /db_xref="GeneID:5655657"
     CDS             complement(1409103..1409696)
                     /locus_tag="LMJF_36_3653"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686946.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3653"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3653"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655657"
                     /db_xref="UniProtKB/TrEMBL:Q4Q152"
                     /translation="MLWCTGPRRIVFHNAPSVYPFTKPFHDTPYDQDRGRFDKTKNIL
                     RENKWPAWMDHGADGTGFGIGLNRTHPLSKLRGNLRRNPSEIPRVLNMMIQGVWHKSG
                     NKLYFRGGKPPNPSTHPYLTGEPCPVYGWKVTDPGVIREFNLPQPEDKTRYKPYVALQ
                     ERKIMGMQAPTKEHSAASTSAASTDSKPLMKRLFFWK"
     gene            complement(<1410604..>1412361)
                     /locus_tag="LMJF_36_3657"
                     /db_xref="GeneID:5655658"
     mRNA            complement(<1410604..>1412361)
                     /locus_tag="LMJF_36_3657"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686895.1"
                     /db_xref="GeneID:5655658"
     CDS             complement(1410604..1412361)
                     /locus_tag="LMJF_36_3657"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686947.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3657"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3657"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655658"
                     /db_xref="InterPro:IPR011677"
                     /db_xref="UniProtKB/TrEMBL:Q4Q151"
                     /translation="MLQGLLCLLLLTTSAFAYPIVVVPVDWANVPNSTPEARNLNSPY
                     LGECVCDVTRGICDPFCCCDEDCDASARAAFSYCLPEKYSSPYLDYCYPKDRATSLKR
                     INRKDATFIEKKLQGYNAVCVIRTNHPSELYRYFRVPTDVRQPLLPTAPIQPVTVSQP
                     YAVGDPLTTAKYVVVSGSPSYRRVAPLQLPTTMSDGSCSALGRNVGFLDSIKGTSCTL
                     NGAQICLLFPLAKYQNLFLQATLGYNSSAPEFVPVTLNLHDSSGALLNSLGPTVVPAS
                     STYATISDGKTCNNAIVDLHAHFSYSSNKSGKLIEAALNVTLRNVGLTQYVALSFEAA
                     FTSENVALPNNIFAATPGYLPGDKIRSGTLITHGGKSTILERKSGFAVPAGGRLCGSN
                     QWRRASFLHSIISSGCLVLMSESDLQDVCSAGTGRLLAGLINVTVDGEPTILDQIGVT
                     NDALTNDTTSWIAISGLSNALTSPSGTYNAYTRQCSNITVGLHYQFVVARAGAEYNPQ
                     DIIVGAFASPIIGTLQIWNETNFDENALSYQQFTFKVSFSRYDPNSQATIMRRVVAPP
                     ILPPLDDSIFYPFRRSHPV"
     gene            complement(<1412672..>1413340)
                     /locus_tag="LMJF_36_3660"
                     /db_xref="GeneID:5655659"
     mRNA            complement(<1412672..>1413340)
                     /locus_tag="LMJF_36_3660"
                     /product="nudix hydrolase-like protein"
                     /transcript_id="XM_001686896.1"
                     /db_xref="GeneID:5655659"
     CDS             complement(1412672..1413340)
                     /locus_tag="LMJF_36_3660"
                     /EC_number="3.6.1.13"
                     /codon_start=1
                     /product="nudix hydrolase-like protein"
                     /protein_id="XP_001686948.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655659"
                     /db_xref="GOA:Q4Q150"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="InterPro:IPR020084"
                     /db_xref="UniProtKB/TrEMBL:Q4Q150"
                     /translation="MKHTYVRTGLEVVSGLKFTRLCSLLYTATDDGAQPGNKWEMVQR
                     TTRSTALSAFERSPAPIPVDAVEICAVVRRSSKRFIVVVAQYRPPVDSVCLEFPAGLV
                     DDNENAGQAAIREMHEETGFVVDETDIVSISPPLSTEPGLTDSCCVLVRLDVDGERAE
                     NQKPKQHLDDGEDIEVLLIPISQPKNALNALSDVVKRYAEKGQRAIVDAKLYTFMEAL
                     AWGV"
     gene            <1414163..>1415185
                     /locus_tag="LMJF_36_3670"
                     /db_xref="GeneID:5655660"
     mRNA            <1414163..>1415185
                     /locus_tag="LMJF_36_3670"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686897.1"
                     /db_xref="GeneID:5655660"
     CDS             1414163..1415185
                     /locus_tag="LMJF_36_3670"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686949.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655660"
                     /db_xref="UniProtKB/TrEMBL:Q4Q149"
                     /translation="MITSATRSFSFCSSTYHQKQSGTVVCLMKATSGRSPLLRMLDDC
                     RVLSCQRRWHLIKGDRKQNEELKKVEFAPTFERDQIIKSVESGPSAGSSTTGNEPMEP
                     LSKGLMNTMEETPYRVSWYDFQTVSPAKRFTYWVYRRLRDLPPEWQEYYRSMVYQEIS
                     ASRYVNQTWDCFMMVVDGYRKAKWVLRKYGVKVDESLIPRPYNNFWEETTHEERVWAH
                     RRSHQMKELQALQRDDDEAVFGASIMNRNEVSYTSIKNLQTGMQGGTPLHAHDLPAPK
                     ESELRMSRQDEEMSSALMSSIEDDKLWNPVLRSRLHTQRQRAEAELYGFEDEYDDEAP
                     AEIQRK"
     gene            <1415556..>1416023
                     /locus_tag="LMJF_36_3675"
                     /db_xref="GeneID:5655661"
     mRNA            <1415556..>1416023
                     /locus_tag="LMJF_36_3675"
                     /product="putative calmodulin"
                     /transcript_id="XM_001686898.1"
                     /db_xref="GeneID:5655661"
     CDS             1415556..1416023
                     /locus_tag="LMJF_36_3675"
                     /codon_start=1
                     /product="putative calmodulin"
                     /protein_id="XP_001686950.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3675"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3675"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655661"
                     /db_xref="GOA:Q4Q148"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:Q4Q148"
                     /translation="MADLLSLQQITELKEAFSAFDADCDGSITVDDLEQVFSSIGHKV
                     SRKKLQSILCEADLDSNGVIDFPEFLTLVATKLNDPEEKELEMRRAFRMYDLGNTGFI
                     TVPNLRFVMGRLGCFLTTEQAFDMISEADADGDGKLSFDDFRRVMTEGWGATP"
     gene            <1416592..>1419525
                     /locus_tag="LMJF_36_3680"
                     /db_xref="GeneID:5655662"
     mRNA            <1416592..>1419525
                     /locus_tag="LMJF_36_3680"
                     /product="mitogen activated kinase-like protein"
                     /transcript_id="XM_001686899.1"
                     /db_xref="GeneID:5655662"
     CDS             1416592..1419525
                     /locus_tag="LMJF_36_3680"
                     /codon_start=1
                     /product="mitogen activated kinase-like protein"
                     /protein_id="XP_001686951.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655662"
                     /db_xref="GOA:Q4Q147"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q147"
                     /translation="MSGASVRIPIEKYDIYDVFLALSVLRKLPEYTRELEEGSSETLY
                     RIIDSSICTARWYYRRYSRCGAFVHLLNTYAECIAAKSSNPALRAAELLAAHTSQLNT
                     PQLWQRLPLPIVASLLLAVICCIATVILIGIGDDCCRKVDVAALILSCVSVLCLCALF
                     PLIHASLKWRGYKGQERLVDRIVRMACDNAQNQNSYYNPLSGQIELTERVVVEDADAF
                     LVDADTAHRNRRAIAKLLAEATEDEGSVILRSRGFPPAMIGLNAIYRHAIIIMTDFDG
                     KVVMWSDGAATCFGFSARDVEGNNIISLLYGERSVELYTTMTEAAVKKLDLSEKVLTM
                     AHMGLGTVSISATVVVSREAKSNQPVGFTLIGSVRSDELSQTQAVLHSFFVKELSQLS
                     VKDSQFRQIVDCLRWKNLRDLSALAMHWRSAHIRQLLSEVIKSRQRYVSVEVDPKVTE
                     LPPILCDTVGVTAVLNRAFELFCEKIRVRVEQKHTTSAVYQLIVAYRHDMSGLNRNTL
                     IDITRSANDLGGIVVDCPGTLKLLLPFMVKDEAIQALKPQDAAAQKPIGHDPLIVLLL
                     EKNAVHRHNISASIWSCGHSLRLIENVRKALQAIEELTDIGCAIVDVDVKGSDRVIEA
                     LLAKHIYIIETSEALDGGAKRGDALLKKPISNEALRKELERATYKREEAKRAGEELLK
                     RREVFGKVRNSPWTQGRLLGRGGYAAVYEATSTLTGGKMAVKIIRVSGNFEERIDEFM
                     NEIGILCQLTHPNIIHYFYCERTETTLNLFMAMADQGTVADLIKRCPRLPENHVATIT
                     KQLLQAVNYLHECGIIHRDIKPGNMLISQGQLKLSDFGTATTNIREGIVGTISYMAPE
                     VVDGKPSGKESDIWSIGCVVCECLQIKRSGDGLLGYGAPEEYPSDVSAQAIDFIKACM
                     QRNPSERATTGTLLLHDFIVHLDQEVSQLAEVLAEATPNEEGAKSPKARSSLSDSTVI
                     SWSFD"
     gene            <1420244..>1423462
                     /locus_tag="LMJF_36_3690"
                     /db_xref="GeneID:5655663"
     mRNA            <1420244..>1423462
                     /locus_tag="LMJF_36_3690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686900.1"
                     /db_xref="GeneID:5655663"
     CDS             1420244..1423462
                     /locus_tag="LMJF_36_3690"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686952.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655663"
                     /db_xref="UniProtKB/TrEMBL:Q4Q146"
                     /translation="MVAGQSGSTAQGSSPSLSTSLQEVFLRYDPKECRHSANGPAVEE
                     VRPMLGNRYFNMDHLALWKPSLLASLGETCRRAVYVNEYHALLCSRRLVLVNNKGRYI
                     VFPPFCDTLNDAYVERVSKTCTLVLAAVASGVHVALVRDSDSRKADTLQSAFCSTASA
                     VACIHHLGKNFYGLCCENCSVEGLAITFDNTHSLHPELHANLLPSRHSWAQAAYGYLS
                     PKRYVHSLFDRHRGYLLMLSSRNVSLWLYSDETHLQLECSAALPQEAVAAIVPPLQDE
                     YGETQVAALITSSGGRVPVHLCTTAGKRGNLRSLSVGELRGLPGGVTNTVVSLACACG
                     SSLLLADQLTSSLLLVTRCEPFCEAPGSSTTHVVTQHFLGKPICGVGVEKSVRDGGSF
                     LTFVVYCGDSTIVRLGRMPRGQLLQRQFAASVTSGIDALSKLQPQARVVLLLDAVLSG
                     LPISYLSQSLEPLLQPWAATVRGVRLSDGARGIIQHAMQGLSELSRLCLSFHYWRLTE
                     ELAQSRSRLEKSCTVLTEVLNRGGWLDCPTRQRLEWDDDVLVRADGKLTDISAVDAQA
                     EVLQLLLSSVKNATTIAWLYDLLLQTGTTYRFPGRLEDLLWKSDPVTVQVSLCKDLLA
                     RHDKDITEKLLQKEHVLPQRCRLAATLLSLVLDRALEPVMTYTRRHILDIVQYDLLSY
                     TTDLLESSFPTSQPRIRLLVYRYPYDHSVSSDILSMVEAISSTGDLYNTLVTILGDAA
                     CDSELSSVLLDWMECHTLADHRILTFAKVVVDMGLCVDPAHTLTGRFFSSVKQQANGN
                     TQQAALRFAELARSNLSVPLDGRLLAIEHAITAVPSDDNRLVQFLLLLQQQLASLIAE
                     HLAVGKDLVFARGTVEADLRALREHYVDENSLFELAGRYKVLGGCSIQLDLLKIHSDS
                     PEVLIANALTGVLTFLKAVGLSAPQAVQRVLREYLGTFQAPLPLFPFVEFLAFDGQSP
                     ALAIDELEKVGVPLPTIFDTFMSLLDGHRNPLFPIGDTVLALGQLVPKISPAVQHICA
                     AHLLECSRSMLAGEQRAIALTEEDVHTVKRIGDDMRKLSQRS"
     gene            <1424866..>1425450
                     /locus_tag="LMJF_36_3700"
                     /db_xref="GeneID:5655664"
     mRNA            <1424866..>1425450
                     /locus_tag="LMJF_36_3700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686901.1"
                     /db_xref="GeneID:5655664"
     CDS             1424866..1425450
                     /locus_tag="LMJF_36_3700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686953.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655664"
                     /db_xref="UniProtKB/TrEMBL:Q4Q145"
                     /translation="MLRLCLALRSASVQRKPHLFRIDLTSKHTPGHLYLADRAVKSTA
                     ADPCFVCLDNAMTCQTVDSNAAVVLRSCMTKGRELFQYGRMRFQGMSAALVFRHNHLV
                     FQGIGDASVQALEMSLQHKDVFALLGGISPHENIPEWARAVEKAIAEGDVEYVAEEML
                     LQLRCPTEGCTSVVAKISKFSAGLPEPPNYSHAM"
     gene            <1433430..>1434788
                     /locus_tag="LMJF_36_3710"
                     /db_xref="GeneID:5655665"
     mRNA            <1433430..>1434788
                     /locus_tag="LMJF_36_3710"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686902.1"
                     /db_xref="GeneID:5655665"
     CDS             1433430..1434788
                     /locus_tag="LMJF_36_3710"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686954.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655665"
                     /db_xref="UniProtKB/TrEMBL:Q4Q144"
                     /translation="MPPKKRSSRRLTLNAGEEYTLVGDGAVQITLQSGLLDVAGVMLD
                     ANRPYTFYLHTDRQTITLFTLEGAACMLSSDNRVDTHRGVARAGKLVQMTRRTILSAK
                     RTKVLVIGRPRSGKTLAAHTLCNLLMRYGTDKKSVFLMDLNAESNCLFAPGCVSCIQV
                     SEAPLWPGLTASPKLLPISLYAGAAVRPSASNVNSLLHYYDQLHETVMGYIQELSGAA
                     AAAAQQQSPSPYAPSLNETHSHVVVDAPAPLADLQEGVWYKKLIEILRPSHVVIVSSR
                     EDDEERWSTFLQEDVQRVLPDCEFLFTDPVAHPCERSSSRELLREYFTGTPFYSLGCS
                     KVVVPLKSLTFVEEASEGLVPGSADGVLMRVVHPDASFQALVCALSHAELLEEAPLAP
                     IAGLVTIVYVDEKNEEVAMLIPAAEEPLLRRLIIVPQSRYRDTLRMSSVQVTTMEEYV
                     AV"
     gene            <1435844..>1437727
                     /locus_tag="LMJF_36_3720"
                     /db_xref="GeneID:5655666"
     mRNA            <1435844..>1437727
                     /locus_tag="LMJF_36_3720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686903.1"
                     /db_xref="GeneID:5655666"
     CDS             1435844..1437727
                     /locus_tag="LMJF_36_3720"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686955.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655666"
                     /db_xref="InterPro:IPR007523"
                     /db_xref="UniProtKB/TrEMBL:Q4Q143"
                     /translation="MRASVRVRDTHTIGWRTRAKRAVERAIHKYVSDPRDNPLTELPM
                     NSEAYSKTHQQQEGSVRIGIRPGQSIEDYMAERDRKWLDQQRLIFEQRVKDDHLPTTK
                     DGLPFIGAGSREHYMDVDSANKLVHTPEPKDYEIDEETALLRRQLQVEKEAEYRKFVA
                     EAKRSDIAAKETCKRRLPHPSDPNYDPFKLTPGYRPQDSTALAQWLKRQRESGKSASG
                     LSMQTKEGQERFYNEEKMATQYNANPFANRIETPRGMSTMRITAYSPDSVFINDREVI
                     GSCIVTEKGYYHWNVGSFEEVNERTLAVLLHMYPVPDVVFLGTGRNLHFIDEDLRIAF
                     QKRGTVIHCLTTPQACGHFGVQLSVSRRSALAIINPIPTNGYGVECFGDFVENDMFSL
                     SDTQLGISPMRQFSPSLFRQNKVAEKYRATQGTGIGPQYHQLSDGRLVRPGTSHTKLL
                     PMLEPGETVDWEKLPSYYHWYPKEELHDYIENTTWREIKGRPTGEPLEKRLRKAITGG
                     TFEKDEAPAPDLMPWNSATIPITKFPHERNDEEIIVVDPKTGRIIGMERETYERWKRM
                     MEERRAGLPESDPVEYDQERYVTNKDGVVFDLSKMKYRPIFEGRWNPRRQQSTGRTNP
                     IMT"
     gene            <1438844..>1439389
                     /locus_tag="LMJF_36_3730"
                     /db_xref="GeneID:5655667"
     mRNA            <1438844..>1439389
                     /locus_tag="LMJF_36_3730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686904.1"
                     /db_xref="GeneID:5655667"
     CDS             1438844..1439389
                     /locus_tag="LMJF_36_3730"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686956.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655667"
                     /db_xref="GOA:Q4Q142"
                     /db_xref="InterPro:IPR006677"
                     /db_xref="InterPro:IPR011856"
                     /db_xref="UniProtKB/TrEMBL:Q4Q142"
                     /translation="MLVIEGTNGPLFSVAESAAAIAYLSTHYPQCKKRGSGWQLSVEE
                     VSLLQAQLRRTGGVHFASADTKEQFEVLRKRYARDCVVYAALTTDHGYRLRHGSQFGA
                     NYIGYQDVGTHGECLLFTGPLAELEQVRAVRIARSVGKRAMLVTVQEGDSGCSSTVTV
                     TDLMADSFADLRRPQKSCRKE"
     gene            <1440236..>1440742
                     /locus_tag="LMJF_36_3740"
                     /db_xref="GeneID:5655668"
     mRNA            <1440236..>1440742
                     /locus_tag="LMJF_36_3740"
                     /product="putative 60S ribosomal protein L34"
                     /transcript_id="XM_001686905.1"
                     /db_xref="GeneID:5655668"
     CDS             1440236..1440742
                     /locus_tag="LMJF_36_3740"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L34"
                     /protein_id="XP_001686957.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655668"
                     /db_xref="GOA:Q4Q141"
                     /db_xref="InterPro:IPR008195"
                     /db_xref="UniProtKB/TrEMBL:Q4Q141"
                     /translation="MSCPRVQYRRRMHYATRGNRMKMVRTPGNKLVMQKRAKRSQGIH
                     TPWVLGHKRLGGTKALRHIDARLASRHEKSVSRAYGGVLSHDQVRDRVVRAFLVEEQR
                     IVKQALKEHSKMKLSHKRTANKKKSKQSKKEAIAKKISTKTVSKKKALAKKATTTRQP
                     VGSKLVKK"
     gene            <1441482..>1441742
                     /locus_tag="LMJF_36_3750"
                     /db_xref="GeneID:5655669"
     mRNA            <1441482..>1441742
                     /locus_tag="LMJF_36_3750"
                     /product="putative 40S ribosomal protein S27-1"
                     /transcript_id="XM_001686906.1"
                     /db_xref="GeneID:5655669"
     CDS             1441482..1441742
                     /locus_tag="LMJF_36_3750"
                     /codon_start=1
                     /product="putative 40S ribosomal protein S27-1"
                     /protein_id="XP_001686958.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655669"
                     /db_xref="GOA:Q4Q140"
                     /db_xref="InterPro:IPR000592"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="InterPro:IPR023407"
                     /db_xref="UniProtKB/TrEMBL:Q4Q140"
                     /translation="MGFFDADLSYPTVRTERMKHKRRRLVQGPNSYFMDVSCPRCRQV
                     TVVYSHATTSVECKGCSKKLCRPTGGKALLVEGCGYRRKPDH"
     gene            <1442435..>1443079
                     /gene="RPL10a"
                     /locus_tag="LMJF_36_3760"
                     /db_xref="GeneID:5655670"
     mRNA            <1442435..>1443079
                     /gene="RPL10a"
                     /locus_tag="LMJF_36_3760"
                     /product="putative 60S ribosomal protein L10a"
                     /transcript_id="XM_001686907.1"
                     /db_xref="GeneID:5655670"
     CDS             1442435..1443079
                     /gene="RPL10a"
                     /locus_tag="LMJF_36_3760"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L10a"
                     /protein_id="XP_001686959.1"
                     /db_xref="GeneID:5655670"
                     /db_xref="GOA:Q4QDX9"
                     /db_xref="InterPro:IPR002143"
                     /db_xref="InterPro:IPR016094"
                     /db_xref="InterPro:IPR016095"
                     /db_xref="InterPro:IPR023674"
                     /db_xref="InterPro:IPR028364"
                     /db_xref="UniProtKB/TrEMBL:Q4QDX9"
                     /translation="MSKIAPQTLMEAIQAVLKVDKERKFKESVDLQVNLKNYDPQKDK
                     RFSGSLKLPNVCRPRMTVCLLCDLVHEDIAKKEGVPTMNQEELKKLNKNKKLVKKMCN
                     QYDAFLCSESIIKTVPRLVGPHMHRMGKFPTVCSPSESLADKIVELRSTVKFQLKKVL
                     CLGTCVGHMEMSEEQLRQNVTMAINFLVSLLKKNWQNLKSAYIKSTMGKPQRIY"
     gene            <1444056..>1444367
                     /locus_tag="LMJF_36_3770"
                     /db_xref="GeneID:5655671"
     mRNA            <1444056..>1444367
                     /locus_tag="LMJF_36_3770"
                     /product="putative basic transcription factor 3a"
                     /transcript_id="XM_001686908.1"
                     /db_xref="GeneID:5655671"
     CDS             1444056..1444367
                     /locus_tag="LMJF_36_3770"
                     /codon_start=1
                     /product="putative basic transcription factor 3a"
                     /protein_id="XP_001686960.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655671"
                     /db_xref="InterPro:IPR002715"
                     /db_xref="UniProtKB/TrEMBL:Q4Q138"
                     /translation="MPITQEQLKRRAEMVRTGGKGSMRRTTKAHHKSTGDDKKVQVTL
                     RRLGVTPFSDIDEAVFYRQDGSTYYFSKPKVQASMQTQCFVVSGDYDVKSADEVDAKK
                     D"
     gene            <1446160..>1447110
                     /locus_tag="LMJF_36_3780"
                     /db_xref="GeneID:5655672"
     mRNA            <1446160..>1447110
                     /locus_tag="LMJF_36_3780"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686909.1"
                     /db_xref="GeneID:5655672"
     CDS             1446160..1447110
                     /locus_tag="LMJF_36_3780"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686961.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655672"
                     /db_xref="InterPro:IPR003409"
                     /db_xref="UniProtKB/TrEMBL:Q4Q137"
                     /translation="MDAIKTYTYKSGAVYEGTFNGNMRSGRGHWTHPQGERYEGEYKD
                     NKQNGLGIYIFSETGKKYLGNWEAGQMNGEGLYFFNRDCTAYYFGNYTKDKKDGDGHY
                     MYETGVMTTQKWNMGALLQEEETPPSEIVECAVKIKELMDAVRAVAPKELGEMPPPSE
                     VRTFQFPSGATYTGQYFGTKKHGRGYWLHPEGDSYEGQFDNNHHSGWGVYVIGRSGKK
                     YVGHWRNGKMNGIGVYFFNPQETEYYVGLYRDDVKNGRGMYHFAESGASMVQMWENGV
                     LRQETEADKATGKAYEEAIRKIVEVVKPYAPNYEPVTFGS"
     gene            <1449509..>1452340
                     /locus_tag="LMJF_36_3790"
                     /db_xref="GeneID:5655673"
     mRNA            <1449509..>1452340
                     /locus_tag="LMJF_36_3790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686910.1"
                     /db_xref="GeneID:5655673"
     CDS             1449509..1452340
                     /locus_tag="LMJF_36_3790"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686962.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655673"
                     /db_xref="InterPro:IPR001715"
                     /db_xref="UniProtKB/TrEMBL:Q4Q136"
                     /translation="MRVISESILLGKAELLAWAASVTGISPCDKYGDLKDGLIYLALT
                     RQLFPDEIDNAIVRLQRRGTRDAAKNWSLLISCLRRHGIPTHLCSQQAVERGHTRYCF
                     NLLVLFYFLVRLARGHQFAVDFAQPVDPQLAAFLQSPESVLAVERRTDMGFSECSSSN
                     TGVFAIDEEESRGQADSGAPRSVTRLSSPPSVATAPTTATPAAPLRLPLRSTALSADT
                     SSNHLAPPPRWMRTHEQSSARAFQDAGAWCAPSRCSNRGTEASKHSPRGAFDSTLVHG
                     AARAPATSGGELVMATLPPPSTLLRPFPSTACTPHLYTQNQLLREELQHVKAVSQLLL
                     TQQRGSEAAVEMRASATLHSQLAKAELDHLHAIRQLEVTLTAASVHDGGANAAPSPQQ
                     WAALAQRAEAAEATAVQLYREYHESQQVYDSTLQQLRQVFCSIADIAAAALASVPTNS
                     DSADAAAYEETVTAAMMAQLTGVPAMRKDAFCAQMRALLLTLSSLRSSNARLQMDAAS
                     VPPYCGTGDASRDCASSFSVLHASSSLPFEQESLKTACAEARSACHGANPVVQRALNR
                     LTRLVDILSSALDAAHQDRDRWEQRCRRAETATAEADEASQGARAEGEAQRQQDLAAQ
                     AHQEVSQSLCNRVQEVLAMAFSTAGTHEVQWASDELVALLGAYVRERASNPAMEAALA
                     EQAETIAALRADLRQQREAWERAEAQLSDGERRRQVLEHKSDALQAQLRSATEKLGTQ
                     RNDSQVHTATLHRTLLEQTFTPSSAALASAPLAEPSAAPTRGTQEHIAASGAAPLTDA
                     SRHAESTPYRSTAHSLYSSLHLPGALRSPATSDDEMDDAEERRLIDHHRFHSGLHNQH
                     VSPSPSPSTSASLPSSRATTAEADVPRGVTTERVVARAGLAAPTVSPARSLRSSTDHP
                     SAASGPSLLLSAAELERRKQAILRKYDVA"
     gene            <1453421..>1454605
                     /gene="GCVT1"
                     /locus_tag="LMJF_36_3800"
                     /db_xref="GeneID:5655674"
     mRNA            <1453421..>1454605
                     /gene="GCVT1"
                     /locus_tag="LMJF_36_3800"
                     /product="putative glycine synthase"
                     /transcript_id="XM_001686911.1"
                     /db_xref="GeneID:5655674"
     CDS             1453421..1454605
                     /gene="GCVT1"
                     /locus_tag="LMJF_36_3800"
                     /EC_number="2.1.2.10"
                     /codon_start=1
                     /product="putative glycine synthase"
                     /protein_id="XP_001686963.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655674"
                     /db_xref="GOA:Q4Q135"
                     /db_xref="InterPro:IPR006222"
                     /db_xref="InterPro:IPR006223"
                     /db_xref="InterPro:IPR013977"
                     /db_xref="InterPro:IPR027266"
                     /db_xref="InterPro:IPR028896"
                     /db_xref="InterPro:IPR029043"
                     /db_xref="UniProtKB/TrEMBL:Q4Q135"
                     /translation="MSASLKKTALHLFHLAQQAKMDAFAGYHMPISYGRLGVLKEHLY
                     TREVAGIFDVSHVGQYEVRGADRERFLEHVTPVDLQRIRAGHGALTMLTNAQGGIKDD
                     CIVTKMADHLFLVLNAGCKEKDVAHMESVLRESAMKGADVQLVPLDRSLIALQGPQAA
                     AILSEFMDDVPGMGFMQCRQRVNIKGMEVQVTRCGYTGEDGFELSVSNTDIVALVELL
                     MSRKAEMIGLGARDSLRLEAGLNLYGHELTEDINPVAARFMWVISKRRMAEGGFIGYE
                     PIKYLRDNASKGAVPRLRVGLVSTGPVAREKTVIEVGGKPVGEVTSGCPSPCLKKNIA
                     IGYLDRELAKDGVKVDLVVRGRRVAAVVVTPPFVPARYYRKPPVKGTEERRTPTIKNI
                     AS"
     gene            <1458907..>1460040
                     /gene="GCVT-2"
                     /locus_tag="LMJF_36_3810"
                     /db_xref="GeneID:5655675"
     mRNA            <1458907..>1460040
                     /gene="GCVT-2"
                     /locus_tag="LMJF_36_3810"
                     /product="putative glycine synthase"
                     /transcript_id="XM_001686912.1"
                     /db_xref="GeneID:5655675"
     CDS             1458907..1460040
                     /gene="GCVT-2"
                     /locus_tag="LMJF_36_3810"
                     /EC_number="2.1.2.10"
                     /codon_start=1
                     /product="putative glycine synthase"
                     /protein_id="XP_001686964.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655675"
                     /db_xref="GOA:Q4Q134"
                     /db_xref="InterPro:IPR006222"
                     /db_xref="InterPro:IPR006223"
                     /db_xref="InterPro:IPR013977"
                     /db_xref="InterPro:IPR027266"
                     /db_xref="InterPro:IPR028896"
                     /db_xref="InterPro:IPR029043"
                     /db_xref="UniProtKB/TrEMBL:Q4Q134"
                     /translation="MSASLKKTALHLFHLAQQAKMDAFAGYHMPISYGRLGVLKEHLY
                     TREVAGIFDVSHVGQYEVRGADRERFLEHVTPVDLQRIRAGHGALTMLTNAQGGIKDD
                     CIVTKMADHLFLVLNAGCKEKDVAHMESVLRESAMKGADVQLVPLDRSLIALQGPQAA
                     AILSEFMDDVPGMGFMQCRQRVNIKGMEVQVTRCGYTGEDGFELSVSNTDIVALVELL
                     MSRKAEMIGLGARDSLRLEAGLNLYGHELTEDINPVAARFMWVISKRRMAEGGFIGYE
                     PIKYLRDNASKGAVPRLRVGLVSTGPVAREKTVIEVGGKPVGEVTSGCPSPCLKKNIA
                     IGYLDRELAKDGVKVDLVVRGRRVAAVVVTPPFVPARYYRKPK"
     gene            <1462413..>1462808
                     /locus_tag="LMJF_36_3820"
                     /db_xref="GeneID:5655676"
     mRNA            <1462413..>1462808
                     /locus_tag="LMJF_36_3820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686913.1"
                     /db_xref="GeneID:5655676"
     CDS             1462413..1462808
                     /locus_tag="LMJF_36_3820"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686965.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655676"
                     /db_xref="UniProtKB/TrEMBL:Q4Q133"
                     /translation="MLAKAPSQNRGLSPPSPSPAALHQLRCENAMLKKEKQFLTQAVA
                     SGPSTSARVNGARYNAGAVEAKLMMAYRMASEMRDAEGCKTVELQMQQRVAEMLAKVD
                     KLHQLLKMVQKDVEEVLAASGGWDRQAAA"
     gene            <1464482..>1465420
                     /locus_tag="LMJF_36_3830"
                     /db_xref="GeneID:5655677"
     mRNA            <1464482..>1465420
                     /locus_tag="LMJF_36_3830"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686914.1"
                     /db_xref="GeneID:5655677"
     CDS             1464482..1465420
                     /locus_tag="LMJF_36_3830"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686966.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655677"
                     /db_xref="GOA:Q4Q132"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q4Q132"
                     /translation="MGCCCCYPSGFRAARQASSPLQRRPSSVEHRSFEQNVFHPAKQP
                     AKTRYICDLCGVEVDPTLLDGHQEVCRTNHLRTILAKNAALLSHASIRPSSSVKFHDD
                     AASGDKELCLVCMDRPRSYAFLPCGHISCCQECTKSFDQCPLCRQPREGLCHVSPNVT
                     AQYECKHCHELIAPTLFDGHREVCSLRQRQTQREAGEAAAAAGAAAVAVGVPVEAAEN
                     SAAWQNSTKSMPSRSPPQAAVATPPNPMLSTATAPARNPTRSLSHVCLECGKTYGQLV
                     VCAPCGHRVLCYTCSQKRTTCPVCLSEIRDIIVAFD"
     gene            <1469348..>1471234
                     /locus_tag="LMJF_36_3840"
                     /db_xref="GeneID:5655678"
     mRNA            <1469348..>1471234
                     /locus_tag="LMJF_36_3840"
                     /product="putative glycyl tRNA synthetase"
                     /transcript_id="XM_001686915.1"
                     /db_xref="GeneID:5655678"
     CDS             1469348..1471234
                     /locus_tag="LMJF_36_3840"
                     /EC_number="6.1.1.14"
                     /codon_start=1
                     /product="putative glycyl tRNA synthetase"
                     /protein_id="XP_001686967.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655678"
                     /db_xref="GOA:Q4Q131"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002315"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR027031"
                     /db_xref="UniProtKB/TrEMBL:Q4Q131"
                     /translation="MPAASSLPAKLEGFVRTEFEDTCRRRFFYGLAFDPYGGTAGLYD
                     LGPTMCAMKSNMLHFWRQHFVIEESMCEVDTTCLTPEEVFKASGHVTRFNDVMVRDTV
                     TGECIRADKFLEEWSEAQLEKDGITAEQKDEFLHLLHDAAGMNPPQIKAVLEKHAIKS
                     PKGNPFSDPFPFNLMFATHIGPEGDRLGYMRPELAQGIILNFKRLMDSGNAQRMPFAG
                     ACVGTAFRNEIAPRSALIRVREFTLAEIEHFVNPSNKNHEKFDRVRDVEIWAWPRHFQ
                     ASNEDPIRMTIGEAVEAKVIDNQTLGYFMGRVALFLTSIGVRFYRFRQHQSTEMAHYA
                     QDCWDAELLTSYGWIECVGIADRSAYDLTQHSNASKKDLCAREEYDEPCMERQLLRQL
                     TKGLIGKTFGKKAGEVMAYLNSAPVEACEAIRAAHAAGHPATVALPSGEEVSITAQMV
                     SFEEKDVKVTGYSYTPSVIEPSFGIGRILYCLLEQSYWVRRDDGGKNDKRAVFSFSPL
                     LAPQKVALLPLMVKPELLATISEIRQELVMRGISVRVDDSSVTIGKKYARVDELGIPF
                     AITCDFEGDGSVTLRERDTASQVRVPKLEVASVVVDLCNPLQPLTWDSVKAKYPAQAA
                     AAEK"
     gene            <1473727..>1474404
                     /locus_tag="LMJF_36_3850"
                     /db_xref="GeneID:5655679"
     mRNA            <1473727..>1474404
                     /locus_tag="LMJF_36_3850"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686916.1"
                     /db_xref="GeneID:5655679"
     CDS             1473727..1474404
                     /locus_tag="LMJF_36_3850"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686968.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655679"
                     /db_xref="GOA:Q4Q130"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:Q4Q130"
                     /translation="MFNRLFGREKQVQPSRSSGGGSTTTAKTMEDMDAAIELLEKREA
                     ALEKRMEGELAKARQLYAKKNTQGALQCMKRKKMYEEQLVNIGAQKQNLETLKFTVQN
                     QSMNHEVLRAQIRAKDELKRSNKQMKAEKIEDNMDDLMEEMDKANQVSDALRQPLDNN
                     FVDEEELMNELEMELDGMNLEETQVADAKLPEMPAVPSQKLPAQPVKTTTQEDEDALA
                     ALEAELA"
     gene            <1477852..>1479582
                     /locus_tag="LMJF_36_3860"
                     /db_xref="GeneID:5655680"
     mRNA            <1477852..>1479582
                     /locus_tag="LMJF_36_3860"
                     /product="similar to leishmania major. l411.4-like
                     protein"
                     /transcript_id="XM_001686917.1"
                     /db_xref="GeneID:5655680"
     CDS             1477852..1479582
                     /locus_tag="LMJF_36_3860"
                     /codon_start=1
                     /product="similar to leishmania major. l411.4-like
                     protein"
                     /protein_id="XP_001686969.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655680"
                     /db_xref="InterPro:IPR018928"
                     /db_xref="UniProtKB/TrEMBL:Q4Q129"
                     /translation="MGGTATATAYVRSCDGASPPTPPGCGLKLVVDLTLDDSILTGSV
                     LETEVMVTHALHESLFPRDAASDAAGTAATSLQVSLPPITVAMRRGAVQMRYGLTYLR
                     TFPAALRDSVRVLKTAMSCDDGVTRCPSYMSMTGTLVSAPLGLCCLCTSVECALTSDL
                     CNASMRAHFCFRTGAAGITCVQSEGITYHGWAVGSSSPYYMMHLSASGRGIAPTTLQL
                     TTDAPEVQKGASALQILRASGVLPGESNPTVDISGRVLFVPSAEHSSASRSISTGPVR
                     DDDPAEWLLLPAPLVSVSGNDCDKVGISPDYFYSLSSTKQCNAQKGTCVRHQLADYRA
                     ADLEQIAQGVGGRYIAASLGTFTRQAMREQEFLLDAVERTGGAMLRWTVNADGLVFQP
                     LPVHGVLDAIKFDSSTGILYVTVRNNNTYGGLYYVAVGQCRGARASNCDSDGVTHECG
                     RTALVAGANTSSLLQFSMVSDLPEEVGSTASCTVVFRDAAAALLASANISWTVEHTTT
                     TPAPNAPKAEQCRRCAFRDLRCLFSTVCEWQMLLWTAVAVAVTWTPYAILAYWRMAWH
                     VGAKLLACLN"
     gene            <1480817..>1483342
                     /locus_tag="LMJF_36_3870"
                     /db_xref="GeneID:5655681"
     mRNA            <1480817..>1483342
                     /locus_tag="LMJF_36_3870"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686918.1"
                     /db_xref="GeneID:5655681"
     CDS             1480817..1483342
                     /locus_tag="LMJF_36_3870"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686970.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655681"
                     /db_xref="UniProtKB/TrEMBL:Q4Q128"
                     /translation="MERPSLMERYFAQCQAHRTSPHPAFVAGLREGVMDINFAEIPLA
                     DIRLFACALLDVSPAARAARSPAAPSRNSSGQLSRRGAASDTSPSSRPRTIGAFSRTQ
                     FAKLHFAYKDTVPAAQLPRGAASPPASRTWFTQNEPMLRRLAQAVAQAVKESATTLSS
                     FSWCGMPLTSMAVQGRAPLQQQRGIGQVPPSLTRVLPLCHRLTSLRLDGVPLTHAQFM
                     QLTTPSPKSSEASADGGVTWPALEEASFVGCGLTDACKTGLVHLIRAAVPTASASTWQ
                     RSLRGGYASLDDRPLPRPAGGTMSLGHSATRGLKGLDASQNPLGDETARAVANAVPGS
                     ALRYLNVSSTSITWMGGSLLASRPVLEGTAMELLDMSNTGVSEVFAHAGSAAEAKMLA
                     ESSAVAGFRVLARGMGQLLILRESDRSPQHSWLIQTTTAIAPQPSPAPASAPEPPHVE
                     SPTNPTNPPASVMEMERVAPPAPPATPLPSSESGDQHSAPQSVHNSAAAPGPAVSPYG
                     PWWPMFASWYAARDITIPTSSADAAAAGSSAAGLVKGYVPVPVPFPMLAPMPIPYTAP
                     HGADLPFAGAATAATAAATSPHTAGAVAEDSTPSPERRVSTPPADDPIDAAAETSEPL
                     PSPTSSGERHDEEGVGSLTGGVANPPDAASTASQAAAVTASASEDLVHRVSEAAGDRK
                     FLLALISRLEAHESDVTERLEAQYQRTTAQLTSLEKDMRFRLQQLADADRKERAAAAD
                     RQTALLESLAALRGEPAAVSAEGMTETMLRQLIHLIEAGMGKVQAALGAEGAVGTKST
                     RAGEGRVSPQLRSSEAATHVGEATITDRDLVKTASQRLKELGW"
     gene            <1483808..>1485067
                     /locus_tag="LMJF_36_3880"
                     /db_xref="GeneID:5655682"
     mRNA            <1483808..>1485067
                     /locus_tag="LMJF_36_3880"
                     /product="putative eukaryotic translation initiation
                     factor 3 subunit"
                     /transcript_id="XM_001686919.1"
                     /db_xref="GeneID:5655682"
     CDS             1483808..1485067
                     /locus_tag="LMJF_36_3880"
                     /codon_start=1
                     /product="putative eukaryotic translation initiation
                     factor 3 subunit"
                     /protein_id="XP_001686971.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655682"
                     /db_xref="GOA:Q4Q127"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR027525"
                     /db_xref="UniProtKB/TrEMBL:Q4Q127"
                     /translation="MMGPRSRLQPGPSAAVSPLLNTPSPFFFWCLLLSHLASLLAAFL
                     TETKKSKTQLIFVSRTSATMTAAVDLEGVALHGHMKGVTMLKFNRDGDLLFSSAKDTN
                     CSACCWQVKTGKLFGSYTTVGQVEGRTYDAAMVALDVNRESTLLATASAGEEVLLWSV
                     ESGALLGSVSRSLSSGASVGFSHDDTLMMVATKGRSSTNSAIQVYNVPFTVPKAGEDI
                     APVKTPFTTFSTFETPDTITWAAWGPTNETIYYSEGGYMNILDVEANKVIRSRQIHED
                     ENEVINRFSWDPNYLALATASTDKTSHLIDFRDLATIQVYRSDVPVNDVSISPNADHV
                     ILGGGMDAASVTTQGGQSIFEVKFFHKVHGHQLGQLRCHFGTINAMSFHPDGRGFASA
                     SYDGLIKMYRFGDSYDSTPGAQPLWTL"
     gene            <1486527..>1487711
                     /locus_tag="LMJF_36_3890"
                     /db_xref="GeneID:5655683"
     mRNA            <1486527..>1487711
                     /locus_tag="LMJF_36_3890"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686920.1"
                     /db_xref="GeneID:5655683"
     CDS             1486527..1487711
                     /locus_tag="LMJF_36_3890"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686972.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655683"
                     /db_xref="GOA:Q4Q126"
                     /db_xref="InterPro:IPR003428"
                     /db_xref="UniProtKB/TrEMBL:Q4Q126"
                     /translation="MWCLKRVPRGPSLARGSAAMVGMLRRFGAVQEASALCSVAVVAY
                     GRRSLSTEELVDEETQWTRAMGSKYGSGNYQLFRALYKDLCDEIRREYYTKPPPPPPA
                     TRTTGASPSLVAAEAALEVHGSAGSGANDTSSGAAKQRSMAGGAGATSSSTQGGGMTA
                     GSEREGSTVEAAHAARETAATPPSQPEETYGDGSWSVQHRPEDNVAVFHRGAVKRGRL
                     AAVHAWARIELKDPPRLNAVLTFADWIPIEVCVERNGIVIHFSMAANEGGMHMRNVRV
                     YEPKSAEERAALLDPSDDGEYARKNFYYDGPCLWHLELDMLNELYDVMQDHGVTLDWI
                     RWAASWVFYLEHVNYVRWNLGMLEELIPSSLRGPEEDFLLPVEKALLAEPVEDWLRAH
                     SI"
     gene            <1488618..>1489445
                     /locus_tag="LMJF_36_3900"
                     /db_xref="GeneID:5655684"
     mRNA            <1488618..>1489445
                     /locus_tag="LMJF_36_3900"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686921.1"
                     /db_xref="GeneID:5655684"
     CDS             1488618..1489445
                     /locus_tag="LMJF_36_3900"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686973.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655684"
                     /db_xref="UniProtKB/TrEMBL:Q4Q125"
                     /translation="MLGEGLDIGFYAEDAYAAYVTDLATSLHLVPHCRNARGATLEVV
                     FTGPFHDLSAYEEAVKQGKLVPYAELPWPVAEERGVQGVSGATLSVTLHGWIEKLNAA
                     RKVQLMEPLFPAAELGATIAEICVMGDAGNSAPCAFASTSPPCVAESAGTSNEKGTHP
                     SLKPSRFRILGSLDFLLHLSSRDWLMGESSVPADSPSADGRDEANPNFAVGADDATRA
                     AHACRDALEQRDDVALARNAVNTVIKMAQMAEEHPGEVGSVFVDAKERVEYIQFSAQ"
     gene            <1490398..>1491711
                     /locus_tag="LMJF_36_3910"
                     /db_xref="GeneID:5655685"
     mRNA            <1490398..>1491711
                     /locus_tag="LMJF_36_3910"
                     /product="S-adenosylhomocysteine hydrolase"
                     /transcript_id="XM_001686922.1"
                     /db_xref="GeneID:5655685"
     CDS             1490398..1491711
                     /locus_tag="LMJF_36_3910"
                     /EC_number="3.3.1.1"
                     /codon_start=1
                     /product="S-adenosylhomocysteine hydrolase"
                     /protein_id="XP_001686974.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655685"
                     /db_xref="GOA:Q4Q124"
                     /db_xref="InterPro:IPR000043"
                     /db_xref="InterPro:IPR015878"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020082"
                     /db_xref="PDB:3G1U"
                     /db_xref="UniProtKB/TrEMBL:Q4Q124"
                     /translation="MADYKVKDISLAEWGRKAIELAENEMPGLMELRREYGPSQPLKG
                     AKIAGCLHMTVQTAVLIETLKALGAELRWSSCNIFSTQDNAAAAIAKTGVPVFAWKGE
                     TDEEYEWCIAQTVKGFSGDGLPNMILDDGGDLTNLVIDRYPELVPKIFGISEETTTGV
                     KNLYKRLSKGNLPISAINVNDSVTKSKFDNLYGCRESLVDGIKRATDVMIAGKTCCVC
                     GYGDVGKGCAAALRAFGARVVVTEVDPINALQASMEGYQVALVEDVMADAHIFVTTTG
                     NDDIITSDHFPHMRDDAIVCNIGHFDTEIQVGWLEANAKEHVEIKPQVDRYTMENGRH
                     IILLAKGRLVNLGCASGHPSFVMSNSFTNQVLAQIELWSNRDNGKYPRGDKAGVFFLP
                     KALDEKVAALHLAHVGAKLTKLTPKQAEYINCPVNGPFKPDHYRY"
     gene            <1494528..>1494929
                     /locus_tag="LMJF_36_3920"
                     /db_xref="GeneID:5655686"
     mRNA            <1494528..>1494929
                     /locus_tag="LMJF_36_3920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686923.1"
                     /db_xref="GeneID:5655686"
     CDS             1494528..1494929
                     /locus_tag="LMJF_36_3920"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686975.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655686"
                     /db_xref="UniProtKB/TrEMBL:Q4Q123"
                     /translation="MLFFIAAAAAIFVLAACAVLLYGATSILAGGFIRLALGALLVGM
                     SLSVVFSATANLLLVTFSRYDLEPRPPIIFLRSFLAAMGQPTLTGIIGLSLVALISLA
                     ASKVRVMVEEMDILIRSHAAYAARSDRTAAP"
     gene            <1495874..>1500229
                     /locus_tag="LMJF_36_3930"
                     /db_xref="GeneID:5655687"
     mRNA            <1495874..>1500229
                     /locus_tag="LMJF_36_3930"
                     /product="putative telomerase reverse transcriptase"
                     /transcript_id="XM_001686924.1"
                     /db_xref="GeneID:5655687"
     CDS             1495874..1500229
                     /locus_tag="LMJF_36_3930"
                     /codon_start=1
                     /product="putative telomerase reverse transcriptase"
                     /protein_id="XP_001686976.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655687"
                     /db_xref="GOA:Q4Q122"
                     /db_xref="InterPro:IPR000477"
                     /db_xref="InterPro:IPR021891"
                     /db_xref="UniProtKB/TrEMBL:Q4Q122"
                     /translation="MSASFPSIPGFAGPLSLKAFLEEYFGLHLTFAVETASPSPRAAA
                     TAATPSAAEFRALRDVVLPPNQSFLVVVYVALHASSSPPPTTAHASPTPPTPALGRAA
                     SATGFERLRQPLTHQTVASSAHDTCMTRCNPADRQNSSWSSSSFAGKHGSTRDPWRAS
                     AFRLLYTNTSHRPLTDALLRHPWWASFAACLGPAAMGFIEMYCPIVLQLEAMAGGVQV
                     LGPALKHTAFERSFSAAAPSSEMKGPLPQGSGCISSRGVKRALDTRECSAPLPLQKQR
                     RVEAPPKAKAGRRLQRGVAPDSRPCRDDPFSSSVNRAAMAATWAAALTRTDVPRTRLY
                     SARISDGDGAGDGSGSALPLPAGFLEAQWLRRHPHSLHRALQAALPKRAAYGASTRRY
                     SVGASERGTGCTSVEDIPMWHVTHVFRWLVLQPPQSSADASPTTPPKFDLPSHLRRLL
                     STVVDQCSRLDLRGAALKHTGYLEEAFRRQQQGVEPWDVQRLSTPVDVVVSYLRTLLS
                     TLRWAPLKETDNGSFWGRDAAGSERVLDALMRAVRGWLIAGRHAVFPVSRFLDGVPVA
                     QVPWLNGFYTTAPSLPFPAATSSAARHARRERSHVQQRVWLQFALFLTQDILPFLLRA
                     SFTITWSSKNTHKLLFFPAVVWRRLVRREVRRTRSCGAPRSQMPLAGESARRIGAEPA
                     ALSSAPSACGGVVTAALLTPHSAVSKASAAIAAPRDVWRAVRTGGALTHRGARATLAT
                     RGGGASCLYAGVRFRPDRRKLRPIAVVRSASLRSLKEMARGSPSPYSHASAIARLLRR
                     LGCSDTDGQLPAATATLLRRVQARSRHNRRAGVHRFPHPLPPHLPHKAALRDALRCLV
                     SGVEEQRVRDGLPRLSNLSHQDEYAELRSFCEEVRGRHALLCEGPAGTAPAVSSAPPP
                     GSAACCFAPYVTLVRSDASRCYDNLPQERVLAAVASLVKHDAYRVLRFTAIHALDGEG
                     ACRGGCLLRRTFTTRTIPCAEAECGVLARIPRGHIYWEEEEEGHTQGGLHTTAAVSRT
                     TDANRRCGANLISGAAVRALLSEHIRHHLVVVSGGSLFEQRVGILQGSPVAMLLCDRL
                     FSDVVDTALSGILSEHAERSLLLRRVDDVLVATTSPAAAERCLRAMQCGWPSVGYVSN
                     PSKLTLSTACGRLVPWCGLLLHDTTLEVSVEWRRIGVLLASLRVGDPHYVHRGDHDPL
                     YLTQRFLAVLQLRVAPTALCGRMNSKTRQLQTFYEVGLLWSRVVLEKVQEALPVARNR
                     CVAVLLLRPLAVCVGRLCRLLSGHQRFLAARQSACDVSAAEVRACVLTALHRTMQAKL
                     RVLQARTVCVVTAQRGRTPRGTSLKGRRNHFCSHEALSAGRKCCERRRKGRNRRRNTR
                     VCLRSFWWLAAAEVESQWRRSLSALHRAAPRLGEARGPTALSPSPGASASLLMDDGPL
                     SMHARALSATRLSQT"
     gene            <1501448..>1504726
                     /locus_tag="LMJF_36_3940"
                     /db_xref="GeneID:5655688"
     mRNA            <1501448..>1504726
                     /locus_tag="LMJF_36_3940"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686925.1"
                     /db_xref="GeneID:5655688"
     CDS             1501448..1504726
                     /locus_tag="LMJF_36_3940"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686977.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655688"
                     /db_xref="UniProtKB/TrEMBL:Q4Q121"
                     /translation="MSEAGGYSTLLELCTHMNAAAPAPSRHASHSDAPSTECLSSSPL
                     AEASTIMAGASAVNSKPSGSVAAAAASVASLPHFHFPPAKRAPQFTSLVFDSEVEQGR
                     GDEKFDLHAKKGVTVSSAPFNPMSRRATLPFTAAATCHGVGGATTSEGALRLALPTLG
                     CSSKAICGQNPTRSVNHTRVGLAPAMVADDAHQQWRLDRLAFPGRAVAGEDAAEDAAV
                     AEQGRPSLIDNLMSPVGAVCGDGEDGQSIDVASTPDSFISEADTFLGAVEMSDEEDYL
                     SNLGATRRPRASSSADSVATAAADVCALGNGIDSSPPSCECAYMRGCPDPNCVSHMLG
                     ITVSPKAAQTGVPPKASAPAASAQFTHQRLSLSTPGRGTSATTILITAAATPSAAHAG
                     DDVHPPESFPDAGQGAAPFPHSDREDTRMGGEGVLDVSGDPTAAACMQAKLPSTAHDA
                     LTVQHDASGSDEQSAPCPGVSAVGVGMCTEHDARLSFTIPINLLQPNTLLLTDTISEV
                     CTSSFATVTTSKSTQESSSSTQLLGSREGSSIAASVSAPRSLQQHNSFDRSITGPKLG
                     SPLQLTEELQGQKQEPRHPSSSPRDAFGIDKHSASQVSGGAPAAAVTGPLSSPSPFYR
                     LSPGSPSSPPFALAQRRGTVAAFAEMELLPKEVVVKRREIPGKQKTTTINAVRPPRLL
                     CRGPDRAAEDCRDLSDAVPTAPAMDSSSDARAHAESPGDDADLVDSVGAFFSAFQSKL
                     GKWMTWVGRKYHGVVRRTSDAAGEEQSLPPPPPQQPLESPPRRSCAPQRESNDGSSGH
                     RVSFSPGDSAEAVDSGSASFYDARSLKRKSSHLSFAPSLSTSQVNSSYDGERSRHPVV
                     EEALCGLATPWNGGGNSTWYSVGWQVEPRGTGRVTNGFMQLRRSITASPQSPSTRDSP
                     FPTPSGERLCGSTTPPNLSLSAESLTSTFDALTTQIFSGGALQRLSRSLGDALNSSAS
                     GTSMSGDHYSLSFPSSNDRHSRMSDFNTSAIADDRYRDTLYRLFRHPPSSLIGDLTEC
                     YEAYKAMSTSSNGHHVLNWGELGLLLQPEDYIDYRALFPPYHFVTFDDFVEFVEVLSL
                     RYHR"
     gene            <1508462..>1509214
                     /locus_tag="LMJF_36_3950"
                     /db_xref="GeneID:5655689"
     mRNA            <1508462..>1509214
                     /locus_tag="LMJF_36_3950"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686926.1"
                     /db_xref="GeneID:5655689"
     CDS             1508462..1509214
                     /locus_tag="LMJF_36_3950"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686978.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655689"
                     /db_xref="UniProtKB/TrEMBL:Q4Q120"
                     /translation="MEIVRGQVEQVNRRQRKLNEMLEAFKEEGLLGGGGIGLHDERQI
                     DALVKRLRARLHTDDASELETLKINNSNLKHSLDEITLAMEKKNSEMEVLRANYARKL
                     ARTDVENDAVRAKVEAALHASILDVERMKRELSHRIDIACASIRTPRYNTSMGALREL
                     VQQAQEEVQRHHDELTRLVVSIGAKDTFLKHESETMHSNLPSAYRTELRKMEKDQLLN
                     LLDVLSFQEGVVDTIGKAIYIITEAQHKTAVV"
     gene            <1510736..>1513789
                     /locus_tag="LMJF_36_3960"
                     /db_xref="GeneID:5655690"
     mRNA            <1510736..>1513789
                     /locus_tag="LMJF_36_3960"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686927.1"
                     /db_xref="GeneID:5655690"
     CDS             1510736..1513789
                     /locus_tag="LMJF_36_3960"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686979.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655690"
                     /db_xref="UniProtKB/TrEMBL:Q4Q119"
                     /translation="MPRNHCRVTLKQQSNVSAASQTTPAPANDAHENTREVAPMPSIS
                     ALAARAKHRGRGRPRIYPRKTSSAHSLHPHLAPAEPGSGDLDDALTVAAVPPAVSDQT
                     SITAAIVNSGTAVSQHEVAQSAETFGAGAAVSAELPLPQRLSPLGVPFSSSRITSASP
                     LVKANPAGAAQGGEETATFSSRPPLHSSTRIKAAVTAGIAVDEADRATLGAQPFLPSM
                     AACMAACFGWRLKRCSVGEGAQITFVLQHRAIPVVRVTIESTGGAFTQACGASSETDA
                     GAVRVNGTPMSFLQCTAHLQELTHALFSLSDTTRSAPLTDRAPAAEEGDSEGEEDGRS
                     VSSPTVPAPPLLSPSEQAKAAERRANKRARSRSPMRRTDSTASVSRATELLSCATVPS
                     LTEGSAGAEADGEEASKKGSQPYSTPLNSSDVTLSPAPPTRPPPVSLAAAGVKVDAEL
                     SLLATTPPRTSEQENGADTRSLSALSTLVAAMEGGESSTLLPRAPPAPRTNTGKPSVA
                     SRRAVASADKGAVKRESPTSSTVFASPTMRQRRTLAPATAAAAAGPASAITGEHHAPL
                     ASLTPPHAALRTATFTMPLAFHHTSASPLAAGAAPEEFDVASCNTDSNGGHQSVWCDS
                     AGWSTDSSRLWLAHTHAVSRAFQCMSVPRCRVSATAKATQPLGDEGADGHGTSTATSA
                     SSTVPLTDSAAAAALVRMTQLWRWRERSSMWTAMEDSLRMAVGSGHLRGDALEAGVQA
                     LQASEEEQRQYDGRGADAGEDGSDLGPSCGRTALDVGQVGHGAERQQTRSFPACPPRA
                     LLPVSGRAVVEAQHRITDSEEGRGGEEGAHGPRYVTCAGGIPSAERIVIDHTYSTRGS
                     YVMASPVTAQGTTATPCRLLALQRNPQEDLHYHVYKRFMPTDMRLAMEAEGTLRVGPG
                     DMGPLHGASAELSPAYKLPREQSGGEGDDNEDDEERDDGADDADEKKACNSSTASQAA
                     PRAPAATTVADASGGGPFTDMDYVLRHRPSIRRIPMPDVESRYGP"
     gene            <1515078..>1519142
                     /locus_tag="LMJF_36_3970"
                     /db_xref="GeneID:5655691"
     mRNA            <1515078..>1519142
                     /locus_tag="LMJF_36_3970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686928.1"
                     /db_xref="GeneID:5655691"
     CDS             1515078..1519142
                     /locus_tag="LMJF_36_3970"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686980.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655691"
                     /db_xref="UniProtKB/TrEMBL:Q4Q118"
                     /translation="MTSRERVTQARHVMLLSNDAPVLNRCAKEDAHLKHRLAQSTAAC
                     ALMVQKSHAAAAREERSRESRLQAQFRALLSGTPGVVMPPFVTSSPTEGFTDASERAS
                     GYAATAANDRSVPDPTTRTDAALLSSLGLKSSSTVTADGSAASAASLPCALGFPEAYE
                     SSGFKSEIHWASVAHDETFLTAYGPRRIREEAQARAIAGAGGSPAAREAKPHRLMTAV
                     ACYLLNQVLCADAAVSELWREKLRQPIFDAVFSSQSIAMGHERSGAQRSGSLGDAAVT
                     NAIVHRTLGHASSLLSGTATHSDPTTSFPPRTNEYASRRDFASLRLWTEEVTLEHLEK
                     ASVCQRVRNLQNAMARRQLAVHLFQRRAHQAELQAVFTVWRTYTRQRRASRSVLERYL
                     VKRNHRHVEETIFLRWRRFALRSKVEAVQRRLLNVAADRDYAARKHATALQGLQDQLA
                     SERRKHVQEVFERDTLHAQVLESHAVEIEALQLMLQMERLKTAQSGKWAMRWERVAKT
                     FRPAKPCPAVPRPIWTLARALLSAEEELAATILTRSRDQRALLQIPYSMILQARRRLE
                     QLLLTWVNVIMEASPQASTWVTVEAFTHSRSSHPRGILLSQKQSSSRKAAARRSGTTA
                     GAVATGKDDSTCEFSIYTLMCLVRELRRFYAKAGLIEKAEDWGTPDGASVADCYQELT
                     HLFAVQSCGGLYPPLLVHCPTSPLWFTPEGVFSGPVSHLEGSKRQKRQQHTTFTWLLA
                     SLLVGHIQTMWMLPLGDIGVPPGRRPMKGTATLRCKHEAEMTKLARISFPRRCGAPPA
                     GLTAAPRGTSVVAPNTLLPKKRSVAVSAASFSGRAAAKTSMASASVAEDVEGAGVVTT
                     EMTLEALLRARSKSTHDSTSSDSKRTLAGKDLMAAAEDSLSDIEAFLGMAPSQLQSLK
                     GGAGANGTDDDDSDDDDGDRWVNGLLRRLFEAQDAEAHQRRTKRLQCSEFLKDGAEDG
                     HARSAATIPASALGDDEEGEGGSGDNDAAAAGDAASTIYGDLPKSTVALTGDQLRLLR
                     SLPGRSHAFDTLRPIAIARPEAASVVVGLSKDDSSTASYASAAPLYSFLLNTLDDTVA
                     RQQWSGLARVVTSLVVRFHVLDESEDAAQRAAVLTPEGEESEELKSGSVSRQSPVERA
                     GSSALPSTTRLPPVSVGCAPSVAAAGKGGDGAAGVESPRSGGRIAARLVPAAPPQRPQ
                     PPPCPTTHGAQRRLPRARSPPCVSTALDTEATSAQRATEPGVPIFSRPKPRDVQGATA
                     TAAPPSATAVTSMMLGEELRRRGTYQTNSARNSFSFSSPTDLSGQGAQSPEPSSSAVP
                     PISSEASEPMVPPPTEEVHTPMIPTAVLFPSQGD"
     gene            <1523278..>1524369
                     /locus_tag="LMJF_36_3980"
                     /db_xref="GeneID:5655692"
     mRNA            <1523278..>1524369
                     /locus_tag="LMJF_36_3980"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686929.1"
                     /db_xref="GeneID:5655692"
     CDS             1523278..1524369
                     /locus_tag="LMJF_36_3980"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686981.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655692"
                     /db_xref="InterPro:IPR007852"
                     /db_xref="UniProtKB/TrEMBL:Q4Q117"
                     /translation="MATTSSPAASETAVRTVWFDAIDATAAMISTDPLQPAAEYTADS
                     YLPPLSLAGDQADFFAQLRELDRGFIEAAPSLFLPQMTLEEACHAKPSFYQTFLGERE
                     ITETTFQPLLLKQRDEAEQEADGSAMNGRHGARRRRQEAPVLPRGTAPLYGGFLGQEA
                     MSPSTAVQRKPDFMPIILVPSAATAPLQLMNIKQFLEHGAYVDPATLYVDRETGVVNI
                     RDSKPRSVIVKPGSFHDPHKYHVAFRQFRVVDDQDEVDDWSHVCGCIVEGKLWQLKGW
                     YPHEQPQSRDPSRLFSRIRAFLAYFEEDKVPPQCREWNVQSLALTRNLLKDQVHIALA
                     SKFWEQLYTFLDEHPMFSRYTIPLTDERL"
     gene            <1526757..>1527401
                     /locus_tag="LMJF_36_3990"
                     /db_xref="GeneID:5655693"
     mRNA            <1526757..>1527401
                     /locus_tag="LMJF_36_3990"
                     /product="hs1vu complex proteolytic subunit-like"
                     /transcript_id="XM_001686930.1"
                     /db_xref="GeneID:5655693"
     CDS             1526757..1527401
                     /locus_tag="LMJF_36_3990"
                     /EC_number="3.4.25.-"
                     /codon_start=1
                     /product="hs1vu complex proteolytic subunit-like"
                     /protein_id="XP_001686982.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.3990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.3990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655693"
                     /db_xref="GOA:Q4Q116"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR022281"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q4Q116"
                     /translation="MFRRLATRSTSLVTGAAVQARHTTILSVRKGSKVILIGDRQVTL
                     GERIVAKSSACKLRKLNDNVVIGFAGSTADAFALMEKLENKLNDFPEQLSRAAVELAK
                     DWRTDRALRRLEASLIVCSKEETLEIDGQGNVITPEADGIIAIGSGGTYAKAAARALI
                     DVDGYDAERIARKAMRIATDIDVFSNSNWDVEILTRDEEAVKKDEAENEAQGKE"
     gene            1528894..1529631
                     /locus_tag="LMJF_36_ncRNA1"
                     /db_xref="GeneID:12982077"
     ncRNA           1528894..1529631
                     /ncRNA_class="other"
                     /locus_tag="LMJF_36_ncRNA1"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002461157.1"
                     /db_xref="GeneID:12982077"
     gene            <1531053..>1531637
                     /locus_tag="LMJF_36_4000"
                     /db_xref="GeneID:5655694"
     mRNA            <1531053..>1531637
                     /locus_tag="LMJF_36_4000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686931.1"
                     /db_xref="GeneID:5655694"
     CDS             1531053..1531637
                     /locus_tag="LMJF_36_4000"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686983.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655694"
                     /db_xref="GOA:Q4Q115"
                     /db_xref="InterPro:IPR017941"
                     /db_xref="UniProtKB/TrEMBL:Q4Q115"
                     /translation="MPIHQYEGWSYERLRQQRNRAHFLLEDPYRYVTVLLISKPGRPE
                     ELKCIDSPCYHAAGPLGEGDIVEIEDLLCLRCPWHRYLVNIENGEEILLRVDPASAQG
                     AGIVGRQAALPTYPMHFTDPSAEGVTVVHGEKVQRVHRAWLEEATGILSIEVAEEAVM
                     RQHPVKSDKPAGNVKNGGICMQIFDIKLRGLDKL"
     gene            <1533128..>1534708
                     /locus_tag="LMJF_36_4010"
                     /db_xref="GeneID:5655695"
     mRNA            <1533128..>1534708
                     /locus_tag="LMJF_36_4010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686932.1"
                     /db_xref="GeneID:5655695"
     CDS             1533128..1534708
                     /locus_tag="LMJF_36_4010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686984.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655695"
                     /db_xref="UniProtKB/TrEMBL:Q4Q114"
                     /translation="MDSLPNQLMSRITEISLSDAQIQSYGRWLAAAMGAYYVVNAWQK
                     DTPADVQAAITGHMVQGYDRSTITTRLEQRHTRQLLQQIIGLNELRQQLRSETDREAK
                     LRGWQRVFRLTLISIAATTYTHSLTISLLSIKNMVRVLVFLLSRRESAALSKSRSGPI
                     STLRAWWTGGRRAGLTGIMMESMMAKMAEQVSQQASPFVNAELEEEVVTEEVRQLPVP
                     PPPLDGRTAFAQAQQQHEMLEAAHGESQSQVEQAFSVRAVLEVAVPRIVACAAAAVDS
                     AIAARPAHLFSVSGIVRAVDLCSLLRDIALGMERRACVSEWVHRSHPSLVPMPRARSG
                     ASISPLASLPKQLETSKGRLPPDEGEELLDEPDQSATSSEDIIEFPHGSTTLLRPDGR
                     PVRRRAGDRSEDKILDGLLNRRLTAEEEALQEETIRRDHLLKRQMAGFFTELSHSASF
                     GELCITYAAELLAAQFKEACDIKRVKTYDSATDTAKMAMVIAALDSCRLAALEEECEV
                     KSYMRLFCEETIRSTCAR"
     gene            <1535612..>1536442
                     /locus_tag="LMJF_36_4020"
                     /db_xref="GeneID:5655696"
     mRNA            <1535612..>1536442
                     /locus_tag="LMJF_36_4020"
                     /product="putative Qb-SNARE protein"
                     /transcript_id="XM_001686933.1"
                     /db_xref="GeneID:5655696"
     CDS             1535612..1536442
                     /locus_tag="LMJF_36_4020"
                     /codon_start=1
                     /product="putative Qb-SNARE protein"
                     /protein_id="XP_001686985.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655696"
                     /db_xref="GOA:Q4Q113"
                     /db_xref="InterPro:IPR023601"
                     /db_xref="UniProtKB/TrEMBL:Q4Q113"
                     /translation="MNPEARQVAVWERLRNEARQTDQLIDQQLRRLEVLALFDEERMI
                     ASAAASSSMKGVGTSSSVTPAVPDSSSSLLHGSGAYPPPASTMSFEDVESQYRGADRD
                     IDEFLRRLEQTVLSMEDACRELGPTSAAARHTERFRGMLTEKQQARRRLATEFRQRKD
                     RYELAASRLAGDARRRGGPVDDDARGGVRILMDEQVAIQHTLNRVNGLLEQAEGTRDR
                     LRMQRERFSQIGDKVLHIAEHIPFVQNLVRRIDVRRRREVVVLGTVISSLMFMFFFFL
                     "
     STS             1536859..1537309
                     /standard_name="fb22g09.x1"
                     /db_xref="UniSTS:203070"
     gene            <1538739..>1542575
                     /locus_tag="LMJF_36_4030"
                     /db_xref="GeneID:5655697"
     mRNA            <1538739..>1542575
                     /locus_tag="LMJF_36_4030"
                     /product="putative zinc carboxypeptidase"
                     /transcript_id="XM_001686934.1"
                     /db_xref="GeneID:5655697"
     CDS             1538739..1542575
                     /locus_tag="LMJF_36_4030"
                     /codon_start=1
                     /product="putative zinc carboxypeptidase"
                     /protein_id="XP_001686986.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655697"
                     /db_xref="GOA:Q4Q112"
                     /db_xref="InterPro:IPR000834"
                     /db_xref="UniProtKB/TrEMBL:Q4Q112"
                     /translation="MSTAVDPQRPNMAAVLLPTQQLLEDGYYVASDESANSSFSDTPR
                     SARRISLGSSSSLRTTAQRLDLNSSGAVGGGRSATVVTGASPSGINSLRDSRDPNGFS
                     RGNGGDDNSDIILEEENDAGNFDEEDEEQAVLTYMDSGVEGNLPGRPSSSNLAPLPLS
                     TRQGPLSASGAGDGPSIDPGALSVSVEVGDTDYDIGEDPPSCTSASSPPQLHRRGAPA
                     LRTAACSVRSSAAADWRAQTTARRPISVSKAGGAPSFQAAVTPAKLTAVTAVPRMLSR
                     QHSTVNAATSSRPTPLTTAAAHTSLTATSSSPRFASFSPHLQLSSINEEELRERECKQ
                     LSLYEAFFFNPTRSMWLVDDHVLAKVLEYVRIMGYEHPALKRDRLKGQPSLWSSSSAI
                     ASPIAPVKTKKKAAGVRNANSRVPQSTHTSSSSAVAEAAVEALAQPISADASPALPTA
                     AGDSADSATFATKQFCLKAVKPRCARQCVNKSPATAASHLFLTFSEAMRWIAEQEYVI
                     GTVLLCCARFVGDPNADGAAVLGDGVADTALWHPRRAMLQRRKPCIPLRFHPIHFAAS
                     LVCSRFPQWGGMSAFTRAWETQIRLVLGSASPSHQCLFKLPDGALLLSSDCEAGNLHR
                     VERAGEPYSFLIWLEPDFGSDKRIWFRFSVAGAKEGRRLRFRLMNAAPHVKLYRQNGM
                     VPVWRDGLSQPNWGPVDSCSFRTTNRDLDGEVSFSINPRNSTETIQIAFCVPYTYADL
                     LCHVCHWHALVKTSGCDMRFEERVLCRSPDGRKLHLLIVTSRVGGAPALAATEDKSTA
                     DAAILGGRGHTGVSADGVAAAGASSFSGWTSPGVASPTMTIPPGKGKGGAAKEAVRGP
                     YANFASGKKVVLVSGRVHPGEVTASHGVHGLISFLLSSDVRAIQLREHFIFFIVPMLN
                     PDGVSRGHSRMDQFGNNLNRCYNDPDAETQPTVLALRRVFEHLQHTYRERFIMYLDFH
                     SHASQSSGFMFGNNLPVSVQHWNLFFPRVVELHARHVFSFALCRFGRVHMTSKDGASR
                     VLFGSSLIHSYTVELPHFTDRRLYADEYTAMNNGSSVLFEVTWPPLHQTSGQAGSVDV
                     NEDGAQDAEKGSEEKWRDLDPSHGRAVHPAAGARGLDKRSNMSLAGRGRACRPNRESS
                     SAQSRDDSSPKKSPGAAPRSQGHANSTGVGEHCRGQSSATQIGGTRAASFLQPISTPS
                     ILCQSAEVGQACLLALRDYCSIGACPSPELTMFGGMDGVLRDSKRQVKLDSSRKCKKS
                     QSVATYAGINPIYKQY"
     gene            <1543743..>1545035
                     /locus_tag="LMJF_36_4040"
                     /db_xref="GeneID:5655698"
     mRNA            <1543743..>1545035
                     /locus_tag="LMJF_36_4040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686935.1"
                     /db_xref="GeneID:5655698"
     CDS             1543743..1545035
                     /locus_tag="LMJF_36_4040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686987.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655698"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:Q4Q111"
                     /translation="MSTSLDSSLAHMTEAAQQQDEAQHLMLEEEENQVPQAEEGASEQ
                     SSQEEASSTSSDEDEEAEEAEDGVGDDEDATFQFATDEEAEAQRQAGLAAYNEGRYED
                     ALDVQYRVVRHFSNKYGSTSAKCGKYFLDYGLSQLRLLQGQTTVDDVLQPRDEDALMT
                     CYVNLEVARVCFQKLEDEVGDEDVEVELALAEVHNALAQLSLEKEDYDAALREYEAEL
                     LQYRCLQDAAPEEGKLTVVPAGRVIGVLYGIADCFLKESDFEGAEERLRATLDEIKLY
                     PAGTIAASLVAELEDLLADAVEMKGGKFQEIQNAIKQQFAAEAEQIPTPQEFFSVDKD
                     GKHPFLSAVPGGAGDEVAENSYLSMPMSANGQVLATNEHSNSLSVSLFPPQGSRSGTP
                     TGPLQHATVRKKQKRTGDDSLSNAQPENKRLRAESASA"
     gene            <1546339..>1547643
                     /locus_tag="LMJF_36_4050"
                     /db_xref="GeneID:5655699"
     mRNA            <1546339..>1547643
                     /locus_tag="LMJF_36_4050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686936.1"
                     /db_xref="GeneID:5655699"
     CDS             1546339..1547643
                     /locus_tag="LMJF_36_4050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686988.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655699"
                     /db_xref="GOA:Q4Q110"
                     /db_xref="InterPro:IPR001130"
                     /db_xref="UniProtKB/TrEMBL:Q4Q110"
                     /translation="MSSDTAAASEEEGDMLRSTGCRLVYGFLYDSHCHLRRVSPVVSG
                     VSVSTPIASVDCAGRKCDDARCSVTGLVLCGTHPSIDWDDVAQASAMRAATLIGFGVH
                     PWFVPNRVGDENPASSLSPEYSSGEACCCLSRNSAEANASLAACSAAAQSLSGILRLL
                     EERLQQHPLAIVAEIGLDKLRGPPESVQVEAFAAQLRLAAAYRRPVSVHCVRHYGLLL
                     RVLQDLPAEHTPPAIILHAFTGSLEVAKSLLSLKRKKRRPALDGSATPAQDAAATAGS
                     GLPVQRTTKRGGTTSDTVRIKDRIFFGVGVSTSFTVKNFSTQTLPFLLDAQRVLLETD
                     EHYSGIEALDTASSGEFPAEAEARSSVRGGGRACVSVDPQEHVTKLAGVMERIHASML
                     QNHEFVQKAEASSMPVESVLQDTLMHAYAAAFCSVSEKTGAS"
     gene            <1548381..>1550453
                     /locus_tag="LMJF_36_4060"
                     /db_xref="GeneID:5655700"
     mRNA            <1548381..>1550453
                     /locus_tag="LMJF_36_4060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686937.1"
                     /db_xref="GeneID:5655700"
     CDS             1548381..1550453
                     /locus_tag="LMJF_36_4060"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686989.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655700"
                     /db_xref="GOA:Q4Q109"
                     /db_xref="InterPro:IPR000408"
                     /db_xref="InterPro:IPR009091"
                     /db_xref="InterPro:IPR028641"
                     /db_xref="UniProtKB/TrEMBL:Q4Q109"
                     /translation="MFFWGSYNFQEPQLSENPDRPPLRFPGYLPPSPAMLRCSAPASQ
                     NATSSSSSLQSDAASVQDALRSIRALRMQAHHIACGAKHLVAAVSLVPAAEAAPAGNS
                     EAVIALYGMGNNEYGQLGHHVANYATTLTHLRLEDLMEGTVVSVACGARHTIVCTSTG
                     CVYVTGDNSFQQLGLPRQMVKPLPRGGTYAPSFTQLKSLVHVKAVYASGNASFALDRR
                     GQVYSWGEAKYGHLGHNDNGERLDTQTLKTVSTNVATPQLVRWLERHRVTIVEVAVGR
                     SHMVCRSEEDVYTCGEPFFGKLGHGDIDPRLEPTRVTFPPRKQVERLLNIAAGDDHTL
                     VLKENPLIGTVVYFFGKLNNGDGQLQPTIVQLPTTAVRSVMAGRGTFCAAITQEGQLY
                     VWGKHAYTKVYNGTNAAASRMQPSKVQLLEPYSIGGAVSGGTFMVAYAATGTVVRPVS
                     DPAAAGDGKGEVKVEGDTASEETVAATTAARSWDVVVPHNARVGRDGLGDPKEEYEEG
                     LRALLRQYLGPALGNAYVAQLPAAPPRTAAPVYQFDHIAVKDLRCGQKVRLWMTNIYA
                     LGTIVDELADQRRGASSSHVGEASTSSGAAATVDPSEPFQRDKRSQRGAAAPSGAAAE
                     EDADGHSPSSPKGKRVKVEWQRDDWDDEVVTLYSEDETLDEENANRWQPFWFEQNPDG
                     EYVVPKSK"
     gene            <1552559..>1553602
                     /locus_tag="LMJF_36_4070"
                     /db_xref="GeneID:5655701"
     mRNA            <1552559..>1553602
                     /locus_tag="LMJF_36_4070"
                     /product="putative phosphoglycerate mutase family member
                     5"
                     /transcript_id="XM_001686938.1"
                     /db_xref="GeneID:5655701"
     CDS             1552559..1553602
                     /locus_tag="LMJF_36_4070"
                     /codon_start=1
                     /product="putative phosphoglycerate mutase family member
                     5"
                     /protein_id="XP_001686990.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655701"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:Q4Q108"
                     /translation="MSFTFRRFFCSVGIGFAASPLLRGAAVALCETVKPAAPPGMSSA
                     AHISANGLVNHLFDEDPLPTKKELQYVKTWGVPWVEDWDRPGNRGIRADRSASHQRQI
                     IMIRHGQYGNEGVNDDNIHRLTPLGERQARETGVYLRRLFEESNKRKKLKAIYRQARQ
                     AYKQAKSDGASEEQLTQLERKMDEARLVLCGAGGIFVDTMPMAVHVSDMTRAKQTADL
                     ILEAFPEDVRLRKDVDPQLRERIPCAVQPVRPFTPSAEDMHIAEAVFERYFHRPVESG
                     TSTEIIVGHANMIRYLTMRALQLPPEAWLRTSLPHCSVTTITIRGTGHVSLVGMGSYG
                     HLPPDMVTVSNVK"
     gene            1554776..1554845
                     /gene="LM36Cs3H1.1"
                     /locus_tag="LMJF_36_snoRNA0074"
                     /db_xref="GeneID:12982078"
     ncRNA           1554776..1554845
                     /ncRNA_class="snoRNA"
                     /gene="LM36Cs3H1.1"
                     /locus_tag="LMJF_36_snoRNA0074"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461176.1"
                     /db_xref="GeneID:12982078"
     gene            1554881..1554937
                     /gene="LM36Cs3H2.1"
                     /locus_tag="LMJF_36_snoRNA0076"
                     /db_xref="GeneID:12983066"
     ncRNA           1554881..1554937
                     /ncRNA_class="snoRNA"
                     /gene="LM36Cs3H2.1"
                     /locus_tag="LMJF_36_snoRNA0076"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461178.1"
                     /db_xref="GeneID:12983066"
     gene            1555105..1555195
                     /gene="LM36Cs3C1.1"
                     /locus_tag="LMJF_36_snoRNA0060"
                     /db_xref="GeneID:12983068"
     ncRNA           1555105..1555195
                     /ncRNA_class="snoRNA"
                     /gene="LM36Cs3C1.1"
                     /locus_tag="LMJF_36_snoRNA0060"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461162.1"
                     /db_xref="GeneID:12983068"
     gene            1555516..1555585
                     /gene="LM36Cs3H1.2"
                     /locus_tag="LMJF_36_snoRNA0075"
                     /db_xref="GeneID:12983065"
     ncRNA           1555516..1555585
                     /ncRNA_class="snoRNA"
                     /gene="LM36Cs3H1.2"
                     /locus_tag="LMJF_36_snoRNA0075"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461177.1"
                     /db_xref="GeneID:12983065"
     gene            1555621..1555677
                     /gene="LM36Cs3H2.2"
                     /locus_tag="LMJF_36_snoRNA0077"
                     /db_xref="GeneID:12983067"
     ncRNA           1555621..1555677
                     /ncRNA_class="snoRNA"
                     /gene="LM36Cs3H2.2"
                     /locus_tag="LMJF_36_snoRNA0077"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002461179.1"
                     /db_xref="GeneID:12983067"
     gene            1555845..1555935
                     /gene="LM36Cs3C1.2"
                     /locus_tag="LMJF_36_snoRNA0061"
                     /db_xref="GeneID:12983069"
     ncRNA           1555845..1555935
                     /ncRNA_class="snoRNA"
                     /gene="LM36Cs3C1.2"
                     /locus_tag="LMJF_36_snoRNA0061"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002461163.1"
                     /db_xref="GeneID:12983069"
     gene            <1556743..>1558341
                     /locus_tag="LMJF_36_4080"
                     /db_xref="GeneID:5655706"
     mRNA            <1556743..>1558341
                     /locus_tag="LMJF_36_4080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686939.1"
                     /db_xref="GeneID:5655706"
     CDS             1556743..1558341
                     /locus_tag="LMJF_36_4080"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686991.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655706"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q107"
                     /translation="MQAVARMEAGSHFIFQYSTREGHSCLERDVMSRKYSLITPAYGC
                     SLVNAVLSALEDAAAHASVELDAAVKIQATFRMYQQQKAFLMLRHHACLIQRVYRGYA
                     TRKRLDVERATVRQMAYLQTVFDMFATRIQACYRGYQSRKTRSNYYAQQAYLNVVTAR
                     SSEVLVQALRTQIEQDALRNAEAKRVHDLSYARRTAHMHYMVSTCSVPSVYQPCAAPS
                     TAKQPTPNTSHTCREVRCHGEECGSVSPVPPAVKSAGEGSDGCAANDKLMAQAAAYAS
                     GQKLEDDIRRHARAARLERNTVKAKASHGLVVLTVPATASSPSPDKTIAEGPEAEGAP
                     VSAPPQVSGMRLPALTPSQPAQRSRPVNSTAPTAIAAVPWEVSSARPPQKPLTPRAPS
                     LTGPSFSQTAPPATFRTTQAGRKPRKAQQAAEDDSCHAAGTAAAPTAGPAPSAASIDP
                     SMSRAAVSSFHRRFAVKRHDCLEHQLSITNGVVSDGNDSHALRSALLSAKEDAAVQRS
                     VDHKVMQALHGDAIFKVSARRGVQ"
     gene            <1559627..>1560925
                     /locus_tag="LMJF_36_4090"
                     /db_xref="GeneID:5655707"
     mRNA            <1559627..>1560925
                     /locus_tag="LMJF_36_4090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686940.1"
                     /db_xref="GeneID:5655707"
     CDS             1559627..1560925
                     /locus_tag="LMJF_36_4090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686992.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655707"
                     /db_xref="UniProtKB/TrEMBL:Q4Q106"
                     /translation="MRCISPRSYESTDLLTDGTAAVQQLTGSRSLLPPSPTADELLQL
                     LHESGHPCTSSTAPDSDMGVFGWPPTSFSAACIKCKCPTSRRVASSFAAAGAHSMLGE
                     MLQFFAESVTRLFTTGVADPSVRAFPSEWDRRLHAPAAASLRQHHLYELQGFSTLFTY
                     IWGQVAASLPLLREQHGEEKALRESTERGMASSTSVAMRPTRGSSAKSPAAQQPPSRL
                     PLSASAATAHQPQPFHRTARKGGSGGLESGNASAHARPLLSLSPAALHLPNAEMAPTY
                     CRGKRQKDGPIAAVSSRFAAQPPTLAVLQHALTAQARAQRPFLPSIPLEGLVPSSGAR
                     MVEGPHPENSGAANDYAKRLLASASSNSNATASYPASARTLSLEQAMQLDRQRELQKK
                     LGVRRVRNYAAEDDMRNYLDNYQANMRSVLDGDDVTEDGT"
     gene            <1562821..>1567230
                     /locus_tag="LMJF_36_4100"
                     /db_xref="GeneID:5655708"
     mRNA            <1562821..>1567230
                     /locus_tag="LMJF_36_4100"
                     /product="glycosyl hydrolase-like protein"
                     /transcript_id="XM_001686941.1"
                     /db_xref="GeneID:5655708"
     CDS             1562821..1567230
                     /locus_tag="LMJF_36_4100"
                     /codon_start=1
                     /product="glycosyl hydrolase-like protein"
                     /protein_id="XP_001686993.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655708"
                     /db_xref="GOA:Q4Q105"
                     /db_xref="InterPro:IPR000322"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:Q4Q105"
                     /translation="MAKRPFGFHRVRCWRTRRLLRTPLALAVLVAVSLVAVLWFSVYE
                     NTGVTEISSDRRFFLPAKYDEGEEVDANGKIEFRRLSSASTTALAPVEETRNGVDTVW
                     FSPNTSNFLDRNTSSLHSVFTSAGKVRVALPFGVHADTGAFVAQKPRLFAFLASWSTY
                     ERALTARGAQSADAAAVADINEELQVFARRKVVPVKHVEVRLLRQRASRSTWATETEA
                     ALPIVGILPRESTTLVSAEELLVESAVDQEGLAPLVAAVQPGSDNKESTVVGIDTHLR
                     VSPAKGLGGGANQGAGGSTSPLPFPLLELSSVPRRRATSPESATPASPDTSPATALLK
                     WRTSRMTASSSGEALEITLDIAHPSRSSSAAPLRAEEDERTRPGARDDTYTAALEATV
                     CSARLVRLYGFSSSFSPADTHGGSADVSAAVEAGGLNLIPLNMSEEVELMVGGEMQLP
                     SGGARLSGVVPLLYLELSNNSAAGVQQGAGTARRQTVGLLWLHPASFFVSTMTLPSPT
                     GGHEPPRTCVRLRSTAGATGLYLLPGPTPVEVLRQYYTLTGFPTLPPRFLLGYHHGLR
                     GAVATTQQAAEDLSEAFRSAGAPLDSVWITDPAVAASDTPFTWSHSRFPDPLALQSNL
                     WYRGRRYVVLRSVPTIPMTTRSPLLLEGRRGGFFVSLSAADTAGWPVLSVDGVPSHVV
                     DFYNPAARKWYGDMLKYRRYVGSSNHTFINLQHSGPTVLSSAAPPKGKEALLCRPPGL
                     RARGEQLPMDVGHYGGVHHRQVHQLLTVHFVRATHDGMLRRTRYHRRALTFTESYFVG
                     TQRYAVVRVETRPRCASAVRPSSAAILTEAWRALQTAVHQCAQLGVLGIPFSGANLAD
                     GLVSRLLLLQLAKSASTTTTLTAPLAGVAGEGGGDAGAVGANGELTVPPALSRGAMEE
                     MEQLLVRWYQAGVFFGAMYADESAAAVDATDPGVVVSLQPSATGPWWMRLPVTAATRQ
                     AIHANLHARYALLPYLYTAAYHASEEGAIFLAPLAFTSSEASLLSQETTMPTCYAAGS
                     ALIVCPVTQPVHPPRDISRSHSTRSADCKGFFDLWTGAWHSTASSVARHPSWWEGVAQ
                     YSAQNRALASEELGWLAADDAVRLQDLPVAASLAPVLLRSGHIVATQNVVAPRASGRH
                     VEDSEIVGDAHALHSTHVGANWTLTVALPPLPAAQGVAAPSPVLLAEGDVFWDEGSHN
                     SQHRPPNMKPCSSVLPDMPHIPANVHHCALHMKCLYEEAEASEATARLTVEVTQTSES
                     CAEALAELVSHWNEEPQGFAERLANAKAHRDARLHELQVAQNEQEDKGLRGGRGGAND
                     SPDASTFTGEDLRGLHLPNAHDKAARNDIWASYLLQRLRFLFQREEDAARLSPRSSTS
                     RATTVIVERRSSTGGTPGAQADEDSAVRASVRASHDMPDAHVVLVHLMSDAQDEGVAG
                     SVFGARKVVLEDGSVGVRVPPRHTWRFTFSLMN"
     gene            <1568533..>1571598
                     /locus_tag="LMJF_36_4110"
                     /db_xref="GeneID:5655709"
     mRNA            <1568533..>1571598
                     /locus_tag="LMJF_36_4110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686942.1"
                     /db_xref="GeneID:5655709"
     CDS             1568533..1571598
                     /locus_tag="LMJF_36_4110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686994.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655709"
                     /db_xref="UniProtKB/TrEMBL:Q4Q104"
                     /translation="MSLRAIPRRLAGPAIHGRAQATALSSSPKKDQQQVAPLLQFPQF
                     HPTPFPQDKFLSIKSRSLETYTKVRGDVLQRCADLCAQLQRRHKQSGQSGRGTAALAR
                     PVGEETSSSPAAGVSPELPAHPLTPHQAEELLLLTKKVEDLVHYQGFVLTDELVWRML
                     HLCIQCGAPQLAVDGWLQKHVIAEKRGPPFPLFILEDLAATLRASLLPRLPESGASLA
                     CSSAVIATSAGSTDANLSIAFEDGLAAAQRFLRRHLPHSGWPISDAVTTEFLGAAQTY
                     TTHLLAEHVWPVWQALEAMNLTFADLRAKNIEDEEEQDATNDEGGSGRIPDRGSSRMS
                     RGEHGRYPTWLPDAAAQTVAVRAALMSVTPLYSFHAPPSSAPPPSVAEGRRDSSKSAN
                     TASTRAHALLCSDPPFFPSETAAIVAPLRALLDTWLVLAQCAAETKDVSLLKALLRTV
                     CLGFFTHPATTTGDEHDAAEPEDGVQLPPVCVNEAAWCQYVTPGSEQTKDAVHQRAAE
                     QQARAMVREFINGSLSVLQYGLLCAEQEAALWQLHDTFALISAVAASLRNLHGPQKKR
                     GSRSVITNDARLHRMSAVALAQPASAEEADGLLRLALPCALVSSFARGQQAAGDGEHA
                     SATAAMHTFVCDALAHPAEMTAHPYAEAGLYVALATGDEALLAQAATVGMAMNNSGAT
                     LLLPHARALHAYRRAATRLVTAHEGHKEEAPEDDAWDAWTATLRQSVSQATSGSGDAD
                     ITQAQLVETCLTILTLGVARRQAQRAAAYVQCVQQLTTISAAEEGDDTQDDSHNSYDK
                     AEAEKQRREAIEVGWAQLYDGAAACAQDMLTAVEQLLDASNSADATASCLSPLSLSTL
                     AVLTRVGVYAEEEAQARRASASTTSEDFSKPAGAAPPPLPLSISLDRVLTRVVRDTCI
                     RLRCASAASPTGVAPAATSSAVGNWVQWVLLTLMARRAWTDVLAVLRALDGEASGESA
                     ANVAGTSSTLLCSTTVDPSVFAALYARAVEDGAARVCAFLRPRRERLFF"
     gene            <1572171..>1572725
                     /locus_tag="LMJF_36_4120"
                     /db_xref="GeneID:5655710"
     mRNA            <1572171..>1572725
                     /locus_tag="LMJF_36_4120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686943.1"
                     /db_xref="GeneID:5655710"
     CDS             1572171..1572725
                     /locus_tag="LMJF_36_4120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686995.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655710"
                     /db_xref="UniProtKB/TrEMBL:Q4Q103"
                     /translation="MRRTRLVCTATPEKFSILGTTHPKPKRNGMGRNNKMRSKPSDNV
                     AWYDKGPVEWLPRPVRLTYDQLDQLRDWMMRETIAGRTEEFNKIRHLHREWSQHPLMP
                     VLGDVEPKFPLNLYKQNHRAKRRFLVRWHKANSPTYWMWMPRGPAVATPLHRSSPSQF
                     PEHWKSLARTSSSSSSSGSSSAAP"
     gene            <1573477..>1574190
                     /locus_tag="LMJF_36_4130"
                     /db_xref="GeneID:5655711"
     mRNA            <1573477..>1574190
                     /locus_tag="LMJF_36_4130"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686944.1"
                     /db_xref="GeneID:5655711"
     CDS             1573477..1574190
                     /locus_tag="LMJF_36_4130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686996.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655711"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4Q102"
                     /translation="MGRLDHRREDKRSCGGRVVDALCGVFSLRIALSIIYFILVVLLC
                     VMQDLSLFSTPTIRIMNIEASRIVGAKTFIAATWFKVDQSIYGANVTGRIDVKLWVTK
                     MNMHVEIPYGFLPQNISQVYHVQDLPCAEFRNFFRCMQIFSLLSIFTGFIVWVFTVSN
                     FFTRMFLPLLWLFLWVTIAFTATTVAMMFRVLCDGACDGEVGEIPPFTTLATPMGGFA
                     LAFISLQTYLVTSLMTVFL"
     gene            <1577185..>1577784
                     /locus_tag="LMJF_36_4140"
                     /db_xref="GeneID:5655712"
     mRNA            <1577185..>1577784
                     /locus_tag="LMJF_36_4140"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686945.1"
                     /db_xref="GeneID:5655712"
     CDS             1577185..1577784
                     /locus_tag="LMJF_36_4140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001686997.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655712"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:Q4Q101"
                     /translation="MLIIRFVLLVLIFVFFVIALVGTVSLPLYSNRITSYNQDGKVEV
                     SLWKIVVGKVTVTGENSTNVPASTPVRINYAGCEEFRATFRAMQAFAIGGTVFGFYAL
                     LVSCLQCFCRLKVKLPLFLFLFLAMLCELCVVFIGGAAYSKEFCKNLEKNGNLTTIIF
                     KGAGYKLDTAFILQVVALVGYAICTIITPFTQQLWCGKC"
     gene            <1581430..>1582194
                     /locus_tag="LMJF_36_4145"
                     /db_xref="GeneID:5655713"
     mRNA            <1581430..>1582194
                     /locus_tag="LMJF_36_4145"
                     /product="transcription factor S-II-like protein"
                     /transcript_id="XM_001686946.1"
                     /db_xref="GeneID:5655713"
     CDS             1581430..1582194
                     /locus_tag="LMJF_36_4145"
                     /codon_start=1
                     /product="transcription factor S-II-like protein"
                     /protein_id="XP_001686998.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4145"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4145"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655713"
                     /db_xref="GOA:Q4Q100"
                     /db_xref="InterPro:IPR001222"
                     /db_xref="UniProtKB/TrEMBL:Q4Q100"
                     /translation="MVGQFVVGPTPPPPARCRFAQPPLPSFSPSFTRCPLIAVHYFVC
                     RHIEARLLNNAAAVITHATNAMSASSRAAKLQTPPQQQQVHYISDNVYSLGTLSCAVC
                     GQTFPIHTNACQRSTCGWCGTLHEPGTHSALQQHHRAMRRTGDSVKMSSKVCSLDTSA
                     ALFFTEKEVTAAVEYIRQTLGDTSPFGTAPGAAGGAKRAGITEVDNRIIEEAFCEMCG
                     VHRPCKTFARQTRSADEGQTIFFQCTKCSSEWQQNS"
     gene            <1583088..>1584935
                     /locus_tag="LMJF_36_4150"
                     /db_xref="GeneID:5655714"
     mRNA            <1583088..>1584935
                     /locus_tag="LMJF_36_4150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686947.1"
                     /db_xref="GeneID:5655714"
     CDS             1583088..1584935
                     /locus_tag="LMJF_36_4150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001686999.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655714"
                     /db_xref="UniProtKB/TrEMBL:Q4Q0Z9"
                     /translation="MTKSATRGSSTASPAAANAASAKEVSSTIGDLAATTAPVECVLQ
                     IGQPSFSTQLDFIKVNRAVASLERAVERLELLSLLDAAGPTPGREGSHHNANGTRTAS
                     SAIALAAASTASFYPHNSPRGPAVMAGIAHDASVATAQKVAEVLAVTQQQRDCGHASV
                     LELLAELRVLERRYGELLTQAQPTVLLHPGEPQLHPKCFAHVCDPSKAALQRELALVS
                     NRLRDTNRLLCTQLQDNPQDADNWAKVCNGRRELTALLREAIKELTVGYKEALQTQQL
                     RQQQHQANAVLDGGLRRSTAQTGVGADAHFSHMAFNGTGASGPARSDSRPSSTIGGGA
                     VSTESESRASVFLKCFGSSLQRPRASRVVQQGPRIPLSSSYQQFAVKILQEEASQRWA
                     DDVLAKERALNQNVKQLQVDLVRERELKDKEVGERLSRISTLKVELRKLKTALQQRSE
                     AAKACGEAATENLQREGAAEVRDVRKAIQQDEQLLSIGATTHEVFSAYLRERTAAMDS
                     LAGEWEAKTLHELKKKEAAKIDAEGSRQACAQRLTDLEHERDAQQELKVQRDSVQKAE
                     EDARRRAEEQRDAEYAAASVLEAALKAMMTRQTISKLQKSSKKKKKAAS"
     gene            <1586076..>1587065
                     /locus_tag="LMJF_36_4160"
                     /db_xref="GeneID:5655715"
     mRNA            <1586076..>1587065
                     /locus_tag="LMJF_36_4160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686948.1"
                     /db_xref="GeneID:5655715"
     CDS             1586076..1587065
                     /locus_tag="LMJF_36_4160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687000.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655715"
                     /db_xref="UniProtKB/TrEMBL:Q4Q0Z8"
                     /translation="MSKNKRPRLAKKAGKASHGKRKRATSLPAVAPDHRTPRVQHAES
                     TPAAPKSIEDVARLFIGVGRSSDNGDKAYASTESISLQMKKAKGSMKRLREGAENGTG
                     GRNSSMKRQKGSTTGALSFAITNNTVTLERKARRQPKVAERCEDDDDEEDVELSKAVQ
                     AQTLSFLQHLNSKSSKTFWELRDVAQGKLSAASATTATSSSSQLPSSSRTKAAKGNAK
                     GAKKLADDGEELWRVGGPYISGDQADDTDESERECGRTSDSELQSSTSSSEPSWVTDS
                     SEEEDGGGSDDEAESAPVAAGATSRRSAAEPPKRGGGGGRLFQGGGDGVWDED"
     gene            <1587909..>1588931
                     /locus_tag="LMJF_36_4170"
                     /db_xref="GeneID:5655716"
     mRNA            <1587909..>1588931
                     /locus_tag="LMJF_36_4170"
                     /product="putative oxidoreductase"
                     /transcript_id="XM_001686949.1"
                     /db_xref="GeneID:5655716"
     CDS             1587909..1588931
                     /locus_tag="LMJF_36_4170"
                     /EC_number="1.6.5.5"
                     /codon_start=1
                     /product="putative oxidoreductase"
                     /protein_id="XP_001687001.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655716"
                     /db_xref="GOA:Q4Q0Z7"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002364"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q4Q0Z7"
                     /translation="MSSPSNFKKLQVVSLSKDFRNSTSVVEAQLPEEVPEGMVRVSVK
                     YAGVNASDLNFTNGSYFKNARPPFDCGFEAAGTVVKIGAGVANVQEGDPVVLMQYGCF
                     AEFLDAPAEMCIPVPELKPEYIVLPVSALTAAVALGEVGHVKKGDVALVTAAAGGTGQ
                     IAVQLLKHVYGCTVIGTCSSEEKAQFLKSIGCDHVINYKTENLDSRLHVLCPKGLDVI
                     YECVGGQTFNDAVRHVAVQGRVVIIGSVSSYKSGEAVPFSHPSGTSLTMLLLAKSASL
                     NGFFLPQFHGVMPKHMASLLKYLKAGQVKLFVDKKVFHGLSSVADAVDHLYSGTSYGK
                     VLVEIQ"
     gene            <1591299..>1592699
                     /locus_tag="LMJF_36_4180"
                     /db_xref="GeneID:5655717"
     mRNA            <1591299..>1592699
                     /locus_tag="LMJF_36_4180"
                     /product="putative
                     UDP-N-acetylglucosamine-dolichyl-phosphate
                     N-acetylglucosaminephosphotransferase"
                     /transcript_id="XM_001686950.1"
                     /db_xref="GeneID:5655717"
     CDS             1591299..1592699
                     /locus_tag="LMJF_36_4180"
                     /EC_number="2.7.8.15"
                     /codon_start=1
                     /product="putative
                     UDP-N-acetylglucosamine-dolichyl-phosphate
                     N-acetylglucosaminephosphotransferase"
                     /protein_id="XP_001687002.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655717"
                     /db_xref="GOA:Q4Q0Z6"
                     /db_xref="InterPro:IPR000715"
                     /db_xref="UniProtKB/TrEMBL:Q4Q0Z6"
                     /translation="MTLGLVESSCNAAFAVAVHAPVLGLILLGSIVAYVGTMRYIPNV
                     ARTLLERNIFGIDINKNTEEQRQKFAVKRRAGQTEEKEFQKQAIPESLGILVGAVYLS
                     VVMVLTVCLRFLGTAGEGLDNPYASLPGPLMTITLMLLLGFTDDVLDVKWRHKIILTT
                     LGSLPLIMTYDGSLSVLMPCVFGRFGLPTMNVTKTWLLGLAAAQGEPTTTFRVTAPST
                     WFSYVVSHRSYVKVSESGTVLIYLGPIYLVYLSMLCIFCTNSINILAGVNGVEVGQSI
                     VIAVASVVYNLFQMRLERQATPALSSVDAVAADARDMRSDHRLRALLLLGPFIGVSLA
                     LWRYNRYPARVFVGDSYTYFAGTVLAVSSITGVYSKTLLLFFAPQVFNFIISLPQLFN
                     IVPCPRHRVPTWNPRTNLLSNSHNYTILNVVLYLFGDMHEEKLTWAILKCQVIACVLG
                     FVVRYVLSSFLYDEVR"
     gene            <1593747..>1594778
                     /locus_tag="LMJF_36_4190"
                     /db_xref="GeneID:5655718"
     mRNA            <1593747..>1594778
                     /locus_tag="LMJF_36_4190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686951.1"
                     /db_xref="GeneID:5655718"
     CDS             1593747..1594778
                     /locus_tag="LMJF_36_4190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687003.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655718"
                     /db_xref="GOA:Q4Q0Z5"
                     /db_xref="InterPro:IPR007257"
                     /db_xref="InterPro:IPR021151"
                     /db_xref="UniProtKB/TrEMBL:Q4Q0Z5"
                     /translation="MSSSTRDGAGGGGGSSSNGGVGLAVGSLADEWAFSNYHVSSFMA
                     MEVLATIVPRFVMDGVDCLGGRYGPFAPNYPIDVPLWLALYFRQTNTCAIQPPDYLRV
                     EYLRDVIERERTNDQGFESLPFYFYEIAKKLTERGGGSSSGGGGSDDGDTIPHVVEVI
                     RLVNEIHAMRQQKLKNLMTVFETEGSPMFIPGVLLTNIVCHELHFLRASFGIVLQQAA
                     SMERQRQQLIRLPPVSAATPGRLSSTMGRTTLTSGFSTARTTTTLSSTGTPDGATAAT
                     DLTSKMGSDSFLNDGVANSQVSALTATTSMTTAMAVTSDGETQPIAAADVTPLAQPAV
                     KKRRTLRQT"
     gene            <1596509..>1598938
                     /locus_tag="LMJF_36_4200"
                     /db_xref="GeneID:5655719"
     mRNA            <1596509..>1598938
                     /locus_tag="LMJF_36_4200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686952.1"
                     /db_xref="GeneID:5655719"
     CDS             1596509..1598938
                     /locus_tag="LMJF_36_4200"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687004.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655719"
                     /db_xref="InterPro:IPR011021"
                     /db_xref="UniProtKB/TrEMBL:Q4Q0Z4"
                     /translation="MFRKRDSSKEMEPEVVLLLRHQSRYPGDLLQGVVIVDIPFPSDI
                     LALEVRVCGNERSILGGLFVTDKNPEARKTTYYEQFITLRGVDHDLLDSKRSLRNCRR
                     IAEAQGLRTGLNSAPRRQSVPAGDVVPELSASVIQSASEAAVHLIPGTYSYPFSLVLP
                     DNLPASCELYRGRDGHCVLRYHAAASLIMTSGKIHTSEARLRINPLPVQVQRWYQLHE
                     DEQQLCEAAVGGGDASHNETESRAGVLSRLMSSAGTMRVDKAEWDAEIAPQRRIRHYR
                     QFPEDQLIREAAVYAETAGERAERKKRRACERNARERGSLLVAAEATAMTDGRARILQ
                     NRREQEGAENRSLDTRDGAADAMNESNDDAAAKVYDFGLEVPSSTGAASITGEQEYRN
                     GRFHSNSGGTNAGRRRALENRDKKKRHHHSHEKDAMDSPAHTAMVEKNVDKLIFTPPG
                     GELPAPMAVQRVNQTEAVSHKTAHGSSEEEREGKQPRGAHPHRRRSRFQPPPWNQEFS
                     ISLRSGFLRTGKVRVLLSLRSPLVTVGIGKVGATVLIDNSDGSGAISRVKYSLVTQCY
                     IRTKTEVYNFPVDTVETSSDVSVEKGKVVKLPEVELPVPKSTPLTMLTEGMGTLTFLS
                     VRFYVNTALKTFSRSVSTEVVLVSGQDVLNCSRRLLRWTCFFRRRNGEDARDFTLRPP
                     TINLSEKNSKLRVIDGGIRGAAKEQRGPSLQSNDADTSITAASAVSRSMRILRTSQRI
                     SKAAPPIDVRLLAKTLNYEEALFVPRDEDDGSSFPRHVDPLAGLNPFAAPVSDVISNL
                     AEGDNYETLCH"
     gene            <1601293..>1604223
                     /locus_tag="LMJF_36_4210"
                     /db_xref="GeneID:5655720"
     mRNA            <1601293..>1604223
                     /locus_tag="LMJF_36_4210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686953.1"
                     /db_xref="GeneID:5655720"
     CDS             1601293..1604223
                     /locus_tag="LMJF_36_4210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687005.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655720"
                     /db_xref="GOA:Q4Q0Z3"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR007319"
                     /db_xref="InterPro:IPR011041"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q4Q0Z3"
                     /translation="MESFDPFRVVGSICGPLPISPTLLYGTPVLMVATGRTFQLYKGK
                     ELAMMRGGPTFQDSVRAVAQAGKYRAVAEGPRLHVYVHHKPLWSSHHEAATKPSITLL
                     LAQDDLLFSVGNDKRIVVWELKTGTVLQAMSVENTETVTCLALLTGYTNKMLLATAEG
                     TLQLWNFRSGACLWYSLRGNGSSSGQASRATADGAAAITALACSRYKDIVAYGTTEGK
                     VVACNVATDEVITTFDHSESCAVTSLLFRTDKDGLLVSGTSRGEVVIWDLENRCMDGT
                     LTRSKQVRSELEALERPHVDVVHSLVMFDLPEYTSLLITGGADNALMQFRFDTVDGLG
                     VLVRERRGHMGSCTNAIFYNTDLLVTAGNDRALRVTHVFSDRASWELSQGKLGKRGRE
                     KNLGREAVKLPPATALAAAITRNYQWPSLVSLHAASALACGWRMDTRVMEFKLSGIQT
                     SAHTARALALSDCGNYAVVGYSSGNVAVLSLQNRSVRHLFDADLGADRAHDSSVECVE
                     VACGNTVVVTAGLDGVIKMWDLWTGKLKAAIPTGQPMTKSCMHEASSLFIVAQHFTIR
                     VYHANPDVGLTVEELSTPVRALEGHNSPITALALAPDTYRYVASTSGDGALLVWDLAA
                     AACVGQYRFASPALSLSFHPDALFLVTTHAGERGAYLWVNNIRYGYVPEVVRSPKANA
                     VETLPWLHFPTAHGAAEETAEESANGSVPRTSAAAALTEAEEEAREAAAAEANLFDAS
                     QDIALARRRQTEAQQAALDAITTEGMQLAGVPQRLWFNLTVLDQIKEKNQPLLPPKKK
                     DVPFFLPTTQELRPTFLVMVSDNRKNDTENAKRRLMHADMEELTPVQEMLVNEKHDAL
                     MDYFLSLKTAQAIDLELKRAVDYVSGSSYTAAELARMQACVKGLLSFITAWLRRNKNV
                     DFVQGLLADVVRSHGALLTRFGDALVPALEELAEVQNTLRHSVDHLVSYPACLAGTFS
                     GSIF"
     gene            <1605302..>1607311
                     /locus_tag="LMJF_36_4220"
                     /db_xref="GeneID:5655721"
     mRNA            <1605302..>1607311
                     /locus_tag="LMJF_36_4220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686954.1"
                     /db_xref="GeneID:5655721"
     CDS             1605302..1607311
                     /locus_tag="LMJF_36_4220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687006.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655721"
                     /db_xref="UniProtKB/TrEMBL:Q4Q0Z2"
                     /translation="MAASPFARHWVPQDWANCTTPTSASLLVPPRPSERAMLVMLQFS
                     PIPSQPTAIQTHAMEDACLFQPQINPRSRRLARHAPTLRERQEQDAQRRSAGREDHGE
                     QPQRGAPMPSPGPEAFAGDTESDIVESVWGLWRSVAIREARETEAALVRRVPSVNDDD
                     RLLQRRPRVVYVTAVLGMLNALGITSPRHDALIAKFLKAMAVEGGASEATKRDEAVDA
                     ARFVYVFSTVWRAAVTHRTPRSPVSTRVSAPPRSPPAAQQHGNSPDGATMRHAYSREV
                     SCRGAPPSHMKAAPATEVGSSGGSGSAVSARSSSSPSAVWSSSEGGEGAAHSHTESAS
                     PLTSCGGGDERRSDAAESDADFLRTNISDASSSIPDSSEKPQAGVRSEELSPMSVEPS
                     AGLDPSPEPCNPGEPVIITSARSSVTPRTHHCSPFAAASRLGSASVSRSRRMSSSLRV
                     IPSDSHLLSSTTSRELKRATKRVPGGLMRECTFKPVINSVYEQSPVSFSSTAIVQKRK
                     PASTAPPTFQPNTQQFHQARDSLARWTRQPIKDNSDYRGEAAANPLATGVETAVRRMI
                     AARQQRQRSQSPRPSLQKGSHHSAPAPQSTVRAPVAHPRKPLLYVDVDLPQGQRDRLA
                     LYTGDDVQDVAQRFSILHGLSESLCQRLETALTAELCALSVGKAA"
     gene            complement(1607643..1607714)
                     /locus_tag="LMJF_36_TRNAGLN_01"
                     /db_xref="GeneID:12982079"
     tRNA            complement(1607643..1607714)
                     /locus_tag="LMJF_36_TRNAGLN_01"
                     /product="tRNA-Gln"
                     /db_xref="GeneID:12982079"
     gene            <1608348..>1611719
                     /locus_tag="LMJF_36_4230"
                     /db_xref="GeneID:5655723"
     mRNA            <1608348..>1611719
                     /locus_tag="LMJF_36_4230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686955.1"
                     /db_xref="GeneID:5655723"
     CDS             1608348..1611719
                     /locus_tag="LMJF_36_4230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687007.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655723"
                     /db_xref="UniProtKB/TrEMBL:Q4Q0Z1"
                     /translation="MFALWRGHKLVHLVFFYKAHHTLFQHFSRASCITLYSAAKNKRT
                     RMSEDLFKEALQSLSKKGVARINCSGLDLNDHQLQLLITAMQNSPSNPEIIDVSNNSI
                     TSAGVAYLMRYLATASVEAVDLRNNHIDEDGALALFPLFEKKTSVKLLDVRNNPCSAA
                     TASRLYHLSKTEKCTADVRSALLTGKAQHISFAGMTYGELEKELLRFLLHMENLQSVD
                     FTGMDLGTAGMITVGTCVRDTQVSALSFCRCNLTNDAVLSFFQAADLANQRYPNSFDF
                     SSNIGLSNDLVRKLISTTFDQSHCITNFVLTKTSVTPTYARLVQKECELNQENLAIKR
                     AVVALRNDSSDAQEINLQWDAPLPMCMNYLADYIAASSVIQHLNISNSLIDDTGLELL
                     AEALEKNTSLKVIELANCRITATGIQKLFAVLQKGICLVQEVNIANNNLDEGSVQFIT
                     AALSANPRLKTVNINVNPAISPASLQEIAGLTMVNRAPPRIRSVLPLIENNSKDVVVL
                     DFSGKDVILNDDSVWLLAQALRLNLTVRRLNLSHNSFGDTGASYLAGYLADNRTILEL
                     NLSSCMIGNRGAQHLCEALATNQALQSLDLSNNMMDTDSLSALPLVLRDNTVLREFKL
                     ERTRVAPEFVEQVKMACSLNRECAAVKRVYYRLHDGDASLTKIELSSPDEERVVDDQT
                     VSTICTVLRSNTSVEVIDLSGNRIGKNGCSALAVTLSECTCKVRKIILSKNPIDDDAA
                     AELAACFPQTKTLREVILYNTNITKIGMEALAKGLEENTSIVWIGITDDDTGDENVSL
                     LMRNLALNNGPAALKRITLSIDAGVVVDDVDLSRPVDCSMDDSLCKFLCASLVCCPTL
                     RSLNLSHNEISSSAVPYILEVVETCPSLVSLDLSDNQIDESGAQQIIACLERVSNIRS
                     VNFAGNLFSAESLERVSQLVALNMGSEVLKKLYLITTRGEQLPNNIDLNGTTNSYRLT
                     DEEVVFLAGLLQNSSTVKSLDLGSNSFCDAGCIAIAEVLRFNHTLEALNLAGNAIGSK
                     GGEALYFALKINPQLHHLDLEKTAIPRDVLESISSLLHVNQTPYRAVIDMRGVKVHEV
                     NDETQFRSTDYYVAQTVTLDAAIEGCRQSEVKLIE"
     gene            <1612533..>1614656
                     /locus_tag="LMJF_36_4240"
                     /db_xref="GeneID:5655724"
     mRNA            <1612533..>1614656
                     /locus_tag="LMJF_36_4240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686956.1"
                     /db_xref="GeneID:5655724"
     CDS             1612533..1614656
                     /locus_tag="LMJF_36_4240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687008.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655724"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4Q0Z0"
                     /translation="MPSTAEQSLTPLFVLQEHTDPVLSCSFYPSEVYQRDESSWFLSG
                     DAGGLVVLWDLSTRRKMISFSAVTEAHRQLCGISQHGRNRGTSTTGDLIPENEVLLER
                     TGTLAFGPHSQSVLSVGFIPLSLSSPQPTAVTANSRGVADALVRGSDAEVSNSAVCSA
                     VVDHATRGTSEWAHPGRPRFRLSRRAPTRSVSSEQASSLSTGDVPDSGAQGFAFTPSS
                     TICFYTHCRDQRVYIWCLKRQCTDAPASSPPTRVPQLVVVLTAPQHGFCPVESISKAA
                     NPFTRTYLAVPHESGGEVTVWELSWRQPNSARLTSSRELEEKGASDGPRSSSGNASVY
                     EEEEEEVNTSGMNPMDALIARAAAEERQQAKMKQKSTRVSGESDLDHPSPSAAFPDSV
                     ISRGERASILCYVDPAATTTSSNFSVRRLRTFSACPTFKGGMIMRLTMCHDAQHLTVA
                     FESGHIVLARYRDADVIDMADEPGEVCHAGGSMSVARVRNVTRAFADSALACWWSGRR
                     MLACSSEGGMHCYDVSATAEGLLEAHLVWSVTLRKGIGSVFLQRNLVVAGCWDSTLRL
                     YDARDGRLVSILSYQRETINEVRAAPPSIARVAAFGFDVRQPRLYAGQPGALSTKIPA
                     CIASNSKAVTQGNLPQFSESPLRETYVAGTPTPHSSSGSLAAEEQLVYLFASASKACT
                     VALWRVDLGLVVEQTAREAIAAQTV"
     gene            <1619114..>1621537
                     /locus_tag="LMJF_36_4250"
                     /db_xref="GeneID:5655725"
     mRNA            <1619114..>1621537
                     /locus_tag="LMJF_36_4250"
                     /product="protein kinase-like protein"
                     /transcript_id="XM_001686957.1"
                     /db_xref="GeneID:5655725"
     CDS             1619114..1621537
                     /locus_tag="LMJF_36_4250"
                     /EC_number="2.7.1.-"
                     /codon_start=1
                     /product="protein kinase-like protein"
                     /protein_id="XP_001687009.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655725"
                     /db_xref="GOA:Q4Q0Y9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4Q0Y9"
                     /translation="MMKSYRPPASFQQGRYIPNKVLGTGTYGQVIRCYDNVTGKDVAV
                     KVAQSDAAYRRSALNEISALLCLKENEDSVNILDSFEDAGHVCIVSELLDRNLFEVLR
                     HRGFGPLSLREVRQVALRVLSALASLHNSGYIHCDIKPENIMLRRSTPVSSDSSSFML
                     GPFTSENASSGSSNKSGEQNNFPNALAPGQAALKLDSNANAHNQLWRNTNSIDSLVGN
                     THSAAFQDSDLNMGFSPRTGNRLGGYSKQQHGQRGSGDATAAISGAGMRYSSSLDALF
                     SMPAAAVGASGTGNSTRNDLRVNCNALGNKGIESQERTQFNPDANPYRRTCLIDFGAV
                     RRFNENTYYDVQSLWYRAPEVLCGLPYTTAIDSWSVGCVLFELFTGKPFFPGESLQHQ
                     LSLIVQHVGHPSQAALTLGCLATQFQLPMVYVSHDARREHVRQWILSSREAGLQRWRK
                     HQIQKLQEAHIAGNQQLWLHRTADVPNTKSEEDALLTATPYGESDVDGASEELELLVD
                     LVCDLLNPDESQRLSCTQALRHPFLSNVSKCCSAAPCPCTATPAACFPAVSAAPAPIP
                     CIMATTTAGQPVMMTASPLSVPMGCSPASPFVMHPVHSAPAATVPFTVASVESMVGVE
                     MEVSTLGVSSQHQPAQAFSTYPAVAASTVYTTNSTGQVMQCTVPVFTQVAHQVAPNVG
                     HAFLPLGMTAQNPTGGTYCSPTTTASQQQYPPSGMSISPTFSPGGALVHARVPLGFTP
                     TTGSNPAAVAAPAASVQPLGASSYVLASAGTVPCMHDYHSEMASAGMSPYVLCHFQPQ
                     HACATVMSP"
     gene            <1637045..>1638340
                     /locus_tag="LMJF_36_4260"
                     /db_xref="GeneID:5655726"
     mRNA            <1637045..>1638340
                     /locus_tag="LMJF_36_4260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686958.1"
                     /db_xref="GeneID:5655726"
     CDS             1637045..1638340
                     /locus_tag="LMJF_36_4260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687010.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655726"
                     /db_xref="UniProtKB/TrEMBL:Q4Q0Y8"
                     /translation="MNSTTTISADPDGSSLCAASRISTPGTMSVLVPYKRRGQKSSMA
                     RGGASPQRRSPQPPYAGKSISTSASTLSSSVQPHGAGAASRGDQSRRGDAAPDGTLNA
                     YSSHPAAPLDRPRDEEFDAVEQRARMALESIATRDEDLEPSMGDHIGVLQSYRTACEA
                     RAMYREAYLVQQVLRNLRLEEESRHVRGITEQQMEERRILEEAHRQEFREFHHSWNAR
                     IDAFEEEQLEAELALLERQNEELIRFQEEMRNFQPRLLRYSRSLLESRLKQQTLAKQR
                     DYVGAQAQKAHAEAIEVEDIERFEAARMSLFERREYAARHRHQQELYALRTKVESRRL
                     YLERYRKQELDVLLQRYINARRSMESQQNIVRNKTGTLLLKHACNMKTDSSGTAVLVE
                     SAGSGAFGTMVQRRQAYELRALQGSPDGASASVRDGSAM"
     gene            <1640076..>1644854
                     /locus_tag="LMJF_36_4270"
                     /db_xref="GeneID:5655727"
     mRNA            <1640076..>1644854
                     /locus_tag="LMJF_36_4270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686959.1"
                     /db_xref="GeneID:5655727"
     CDS             1640076..1644854
                     /locus_tag="LMJF_36_4270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687011.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655727"
                     /db_xref="UniProtKB/TrEMBL:Q4Q0Y7"
                     /translation="MQLLVMNNTQSSKAARSCQSRLLTVELPVTSPSDLVTCGVTRSY
                     MGDNGVAVVWVQRGVSGEGEEEVLSPGFAHVTVQREADNTGHSNLLLYPDERVVQCAP
                     LSRVPSSFFQSALAGSGSAACVVAALPDDATQRTISIVVLTDGSRVWRAELFADGTTA
                     VSGFRDEYRRNMLRSFCDGNEEVRLLDTRSVVADLQRLASPAASSAPSFADSGAEEER
                     ASPRGSTWIRRLLGSGGRTGANAADDSDGAASGVLDVALPAVVRKRLYAAVTAVQQSR
                     FVALTRWNGQLEVYDTASGTLKLTRAYPIGILPQEILRPIDDNFSGLGAKAPGGKSAL
                     CALPPGPLAQWAKQCSTTQLLHVVSCCSGGGGRACFWSALPPLAPSSRIVGLEEASNA
                     GEVLAQHCTLSVAPPTQSSFPLACAVTSDGRKMILVSDVGAEEDGHLLCTRTLGALTL
                     RCDQAYEDGVATVVQVMEAANGAAFGDLLRTGRMHGYLCQGARMQSVVAQDNAVLMVE
                     RGPQTCRLYTLEEAAPDAMRLANERVVVSVDEEDVYAMAHDMDGDDAIATYVGGALLR
                     SHRVHYVPLFEASLLLLGAAVPSTTHDTDGLALYWEGISVLQACPHGSRLMSDLLQDV
                     ILATTPIARLSSLPRFLSEAHLSGYAAALQRDAAATKASVRAAIRMALLPPSTAAAGE
                     TAHAFYRFSRLYATHATLGELLSRITFLTTTYLGWQSTYSVSHALSSTGEDDAALSTA
                     DWVSHRLITALEVLVAAYHAVPAAGADLVQLDLVDDSVSQPFSSAIVAALLPTLTDTA
                     GCDDDSVACGWGFSTLSMIQVANRLLRCGTPSTARACAVWVKQLAHRFPLLQHYQLLS
                     LLETTAISTQSERAVALCERVCQALAREAPGDVTTALLLEGLLLTDISGPGSAFLQLS
                     LDEVAAFLAADPTLGPKLYAVGVLRRTITVRSLQTPMSHCVTHRYLYTTLAMCVEAVE
                     RMHRCTSVTAPTPTQAPFSQLRRALEELQVDALLASAFARVSGGDVACGFHDIQTALD
                     LITRHKCLPSYAELLQVILGHVVEVACASQANMNALLRATTIGAAQLEESLILQWYNY
                     IARLPTKSATEVTEALRYRAIMGLHRYLMNRHDYAQCARLMSSLATLIRCSPLRRSAS
                     AGISVSELAGLALHAAEMIAPSAPVPETAAGEQGETGQAAPQGTLHDPALMVGSPLSL
                     GYSWQPSTSASPAPFDLHSSTLGATARGPRWLTRADIPCLRRRLYQAHCERQLWRRGC
                     TLDCTDLWVEGAPADAYQAGVEKLVAALMQARLWPQAFRFACLSAVYDPCAVLVEWAV
                     DLLRAPRECGSDEVAAAEAAHADLTAAWAELIGYCGEISNLENQFYAYVHTITAALTC
                     AYSQVPTALLAAHRAADAYTAMTTLFHVALMLRRQAEAVELGQQRNEEDGGDKEDADE
                     LSSSSSNREAGVTAADRDTEKRGEMSLEDIRCNVWRAWCAAARIGIDMVAERQPRCAA
                     APDLYQRTAGAMTGAGEVMAEEDAAQMNVGVVVAGTVSAASSAARRTFSAFTAGALDP
                     MAVWASELLRIPAYRAALNLVARGEETVRQFQDLMGRPCS"
     gene            <1646578..>1649052
                     /locus_tag="LMJF_36_4280"
                     /db_xref="GeneID:5655728"
     mRNA            <1646578..>1649052
                     /locus_tag="LMJF_36_4280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686960.1"
                     /db_xref="GeneID:5655728"
     CDS             1646578..1649052
                     /locus_tag="LMJF_36_4280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687012.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655728"
                     /db_xref="GOA:Q4Q0Y6"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:Q4Q0Y6"
                     /translation="MKRSRQDNRRLGPAAAAMRRRDVYRDGRQAEEQVSIQKLFRDAV
                     AMQKFHSPNQSGAGARVMIHSREELALYRQKRRAELEESVRRGFKAIGNWIRYARWEA
                     QQRDFDRMRAVMERAVPVHGENANLWRDYAELEESNGFAEHARQVWSRGVTALPSSVD
                     LWVKYLAMEQAAGQDQRVRDIFHRWLAGDAVPPCAYALAALYEAQQRRQAGCRDILRR
                     CVERFNTPASWLLYGATEQQVFGDHERAVRVLETAMHALPDEDLWGLEECRVPLALAE
                     AHVAAGNAVQARNVFHNALEHVADHPVLLEKVLASYSRFERLYGDGAHSEQVARLLTI
                     QLYEERLRTNTSDFDAYLTLYSLYRDQERESRLRASGSSNKMPEPVVGGNAAPASAAL
                     ATSTAAGASPSRQVLERALQIPARDPYGAQQRAVLIMEYARACEADGELDAARRTLAQ
                     EIKNFPFDVALCPRLWVEAAAMEERHGATAQARRLLRAGSQVTKDACLFEEAIQFEER
                     QRDSVMEAMHAAAHETTPPSAREVEEACAPYVAELRADYQNAIQAFPFDVQWWLRYAK
                     LEEQQHEILRADALYGACIRTFNDEAERVRSFAQRYDLLSHVDAAWAHRIHLHTRRAR
                     ALQRQASRRKGNAAGAETARAEVAALQEELLHLYPTFLQDVWNAYRHEAVAWFSRYFE
                     AGEGSGSGVLAGAAPKTLPASLTPATARWSEAVEAVAGYMERMSAIKAGQGASTGATA
                     ALRAILKSMVEAERHAIRRSLGWTEQTTQFDAVQRAREWGELLLSPLLEEWSKFELTH
                     GGSLEAVAAAMEKPVKRRTRLFKARS"
     gene            <1650408..>1654100
                     /locus_tag="LMJF_36_4290"
                     /db_xref="GeneID:5655729"
     mRNA            <1650408..>1654100
                     /locus_tag="LMJF_36_4290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686961.1"
                     /db_xref="GeneID:5655729"
     CDS             1650408..1654100
                     /locus_tag="LMJF_36_4290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687013.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655729"
                     /db_xref="GOA:Q4Q0Y5"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q0Y5"
                     /translation="MERTVSELVSQHGPTPHMGLLRCQMERRGRHSLKGYKKRFWVVD
                     ERNGWLEVYKNDQEHVPIEIFRAADIRNVMYSDDKQNRFFMMLVQTRGPRDIKFRMGS
                     FEERESWSKAITHIMDVYSAINKHKNVLGMVLRRAKTVSEALGVNISIDSGRLLAEVP
                     EDLLQYVAEAVDIALVSVTAIVRSFKEEGADMPRSYILYVHAITEDQSPHQRKETKYS
                     PEGRTMTMNVCLLRVKSVRVSFVVTQPEEVFRLVQSSVFRNPVIEGWIESEPNCARAC
                     AAIQDYLELPAERSSWITFQWGQHVSDSAKVEAFLQRFVTATFFERALQSVRDAVVRV
                     ERLIADTNAQTTAKSFTGGSLVAPARDGGCSSPFSERRQMTTLGVTVQPDSIVFSNNS
                     LAATSTTGGFGGAAGGGFHTHQPANPPLANNAVGGGSDAALAIRLIRENVAGLCIQLD
                     KRVVEKGTAPPPIVTLHASEYEQHCRPAFLLVAKCHRVLPRKHHVTNDVLSEELYEVA
                     YNAFLQQQLSLLRTELNGIFHKQVKVVIMWDLFFRAAAGLKTPVSAEELPHLLRYVKD
                     VCLSRLHHVAQVLRHTRSDVPGHVEDHSYLYNAFCSCVGTVVVNFLPYTVSSDANVFE
                     PNVQAGVLTDTLYCAKEESMPSLMAALGHAHRGSAGKTTRVSLMGTGFHGVLLYAAEA
                     KLGAWCESYFSDPENATPDPRRQLVEDEFDSDTDDTSVGMLQDPDFGEAVAYERSAEI
                     RPLTMQRVVNAIYDSQRHAPVDLKIGSEDIMRAIHAFVSAFGDDKRPSKHDVARVLII
                     NLQRLRQMYVRAVDDETTSLLTFEQARQLLRDFCEYETNEQYIDVALREVPRLGTEPA
                     SPQEEQERSHRESHEPVRTGEEEMDVDASDSGRLLEGNNVYPCSPRPRAMNEASLSVV
                     SNGTTNIAEATRRGNRRWSLSRRRLRSNSKRASTISASRTAKSPSARPALVTPGAMPN
                     RSETHIHVLSITSDAFDFASVTDVALTVLLPREARLARLAWRVGFVFGLENTGKSLII
                     NSMRGIARPTVATVGLSQQVVAFDEWVWALNELGGRESFRKNWRYYALRIDTVHFLMF
                     VLDVLNGQALDEARQYLKEVTSHYHEVPLLVVFNNFREGHRRFDISEFEALIHLDKLR
                     RRHGADVLSCVCDISVVHSKNRQLPRTLSSTLRTLSSLLKARSKSENGGDGGAPPVPK
                     ATTSFSASVVGGAAGAAAAGAGVVHS"
     gene            <1657674..>1659923
                     /locus_tag="LMJF_36_4300"
                     /db_xref="GeneID:5655730"
     mRNA            <1657674..>1659923
                     /locus_tag="LMJF_36_4300"
                     /product="trypanothione synthetase-like protein"
                     /transcript_id="XM_001686962.1"
                     /db_xref="GeneID:5655730"
     CDS             1657674..1659923
                     /locus_tag="LMJF_36_4300"
                     /EC_number="6.3.1.9"
                     /codon_start=1
                     /product="trypanothione synthetase-like protein"
                     /protein_id="XP_001687014.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655730"
                     /db_xref="GOA:Q4Q0Y4"
                     /db_xref="InterPro:IPR003615"
                     /db_xref="InterPro:IPR007921"
                     /db_xref="UniProtKB/TrEMBL:Q4Q0Y4"
                     /translation="MTVKVASEVSLLPYGEHQGSFRGVVACSNRDDGYFSGENNYVDT
                     SIYTGFRYQCVEYARRFLLLTTGCVFANCGRASEIYAMDHITHVETGAQYTLHRHHND
                     GTATQKPAPGDIIIYPYHPELTPWGHVGVISFVDDNRVGIAEQNHYFGPFTSPSESYL
                     DGERCVARYAMLTLDEATKTWRIDEPGAMPSAVGWLSYPDAPTREQIHAPFTPLPCAI
                     KVRSTPFDQDDHPFLTHYHLHKIFDIPSGCVRHAYGMRNGTAETLVGATSAAARVLRF
                     TLHLLFHRGRLGPAFRALPTNPLNATLPEGAGASTEACREVDALFKVLAEEDVVNATE
                     TTPDRLRQAVATYFDIPVEWVMAMERDFAKGETHMAAVVSFYPNIATDSAALEAFRAA
                     RKRSGTWAAPAVGTVPLTTAKASTPVAEEPLTLSYPATVEELPLKNPHDEAWHLATVN
                     FGNARVMTELSQLNKVKQDLTETIALMTPSMRPFISTQYRMDFAGYLKVVEAVYGPRT
                     GFTIVVSDDQPMDGLLRELVSTVQNLCEHVEYPVRIVNEKDLTFVNGKLHATPSAISP
                     EAGSHMTNIAPSGAYDVNFVYALCEWPRILACREATHAALYRAAVDPASDVVFAKPLW
                     SYLCSGAVNVSDDAERAHYSHSPRSPSVRFFDVCRRLYLLASPTQQPKTWDLEVSEYK
                     DSCRRIHVDAETVPMHSPAHLNADSLMINLAGSCYMGHAGGTLSVESENTGIHVGHPA
                     FLMFMFPAD"
     gene            <1660662..>1662290
                     /locus_tag="LMJF_36_4310"
                     /db_xref="GeneID:5655731"
     mRNA            <1660662..>1662290
                     /locus_tag="LMJF_36_4310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686963.1"
                     /db_xref="GeneID:5655731"
     CDS             1660662..1662290
                     /locus_tag="LMJF_36_4310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687015.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655731"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:Q4Q0Y3"
                     /translation="MSATADSAAASSSFYLGTNPSPQAFAKYAKKHNIFLHPDVAFLV
                     PTKTMGMGVFAARPLHAGTVVISCPETSGVSPYMKEVATSPCVAALHASPAAMKDAAL
                     FDVLVLMAELSRENSPWRPWLEVCPRMAHHFFDLSSAQAAVLGTESVMGGWTGADLGA
                     PRAVGDSAVVASPTLGLAGVTGVAQALGELRVMQRWATAQAIMAAFPDVWSANKVSFG
                     LFSEALSQVLSRNFHREELPGREGPYLLPGLDILNHSFAANTAFEVRGGGRKHATAFT
                     VVTTRAVQKGEQVYGCYGRIGAARFAVEFQFVTKAILRNDLVRCSAASLATVATILQY
                     WKAARETPGCTVDSSAITAYLQCCSDGAALAAGTGAMAWKPAFFGGDSAADIEIHRKE
                     MEQRVERLQRRGILYDEGLYLVRPYATWEAEEAAEPASTFRWSTPAAHEEEIAQSRRV
                     LAATVYLLTATKSVYNDVYHRVTADWEPPESAQISAAVRDFLHIRMVAAQLQHDAVCG
                     VFVDSSRDVVRCQLVQDVLVSEMETLRYYANSFV"
     gene            <1663914..>1670495
                     /locus_tag="LMJF_36_4320"
                     /db_xref="GeneID:5655732"
     mRNA            <1663914..>1670495
                     /locus_tag="LMJF_36_4320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686964.1"
                     /db_xref="GeneID:5655732"
     CDS             1663914..1670495
                     /locus_tag="LMJF_36_4320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687016.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655732"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="UniProtKB/TrEMBL:Q4Q0Y2"
                     /translation="MGKLTIKVRKCELYRPVSGGNCAVNPRVTVVVDGTYRFQTNIKK
                     NTFNPEFRDSFVVGNTHRLAVIEVSVHDVQEPSGLVLPGIGVLTAKRGLVRGLSGVGM
                     DEGEGAGASTAGPTGGGGSSGISSGTSSSFKARLPVLLGRCYISIERLVHHERKRRKY
                     YLATPLPPSSATVTAGSNGCATAASVAANAIAAGTSPTTMVSDVGSSFLQQALPTGIA
                     GTITISLESDSLGEPPSELSLNEQLEAAYVRRLRRFLMSYDQPKVAMLDVMMAHVRDT
                     TELGPHSNSSRRYSNSNGTGTVALAANSAPASRSHKQDRSSAASATSGTTSLLRSGVD
                     NVTSPACGASSLLMSSHDQVDSLMWNPSNNCPNRDLQLDPKRSPPSSNDAPPFVPTLR
                     THSVCLGGRAELKADLPDERETFEEMMNRLCAEYHASEPGDFRVVLRVEGCTNIDKEA
                     WNQSLIGSDDVFIIFRSESEEFETNMVTLQDTVVWSEANTVVMDVVNPHRFYVTVILM
                     GRCGSKTYEIGRCNVSAAPLSNGYISRRNMFLCMAESVTRVAMNGVVHLLMRPVNFSL
                     TPPDMAESVDDFYYRLGRFFKRYDPLQLPLVDMLARARLRDHDTYMKDLVVQYGREPG
                     TVRMLVAVESLISLRETADRDLSGQDVRVLLTMGSCGVRTKTFAVRQFAPTNVRENYV
                     FDVVRETDLIRIEVVNARDDNLVYGRVDFSCLNTQRSVMNKRDLYLVGAAATRDAYFS
                     GIVRVSLYSDEVGHNYEVDMKLEDAFTGRLRRYVYRRIPESLHRVNLAVATVFDIESF
                     MAQLAVEYGDEDPTYALYFTVVGCRQLRSGFGGINPYVVVRVDIDAYQTKTARANEEP
                     DYFEFCEFYYDRPEGMAITLVVMDQADIGKDEEVGRAVIPLANVQPSRQYNDWLPLLS
                     EKKSGKVREVGTIGFKYTVVDLNLVDRTRARIIKEQYRDRSARRPSLAKGGSESRPTS
                     LAPSGIGGADFLNTTWSTNANASSGLTHRWNTFKRYLLQAPIMTYSSRTLSMGNSAGD
                     ESDRFEQSMNESATLVMAGRDASLFKSGRSVTSCLPTMNLMDLGISTVEEFCTAEVNE
                     LHSAGYSETDADLSASLEMTYRPPTHERDTLTGSCFPINGEGGVQSGNAARMQLRVRL
                     LSCTNLFKPGHSMPNPYVLLATISESHRSRVQFCTTEPRFDETFLFTVEDPKIDYLTV
                     TVLTDTPYGLRKLGHCTLSMRNVQCGTMRTRWTSLVIHPFEPTAMECGFVYLSLGAIN
                     FGINYLPSVEAENRLREQIREYLTLHARRQLHRLEWYVGEFSQLESILLGGWFRDSGN
                     DAGADDTGTRVADLEVTVLGVSNLYSGGFLAEGSCVVKAKVDGQTRAKTRPITGAQGS
                     FVVPEGQDPLRFTVPEPMTTLVRLSVVLNGKTGAGECYVSLADLHRGVAKERTLMLVM
                     DSRSSHAEAVGFIRISVFCSNYGSSAPAPTEEELALHSRLTRFFYYYIPTELAMVDVK
                     YATTLNVAAYLNRMVEMYGPEPGEYHLRFTVDRCRNLVFKNDNTPLHVFSIVRVGLQE
                     FQSSIVEGHSECVFGESFDLIIGLPQQEKVELIVMRYYPSKQVELGRTQLELRALRRA
                     EENIMELALVSNAGTKAAGVSGVLKVSSFPIDFGCDGGVHVRTLSMLAYGLDGHSALA
                     QTLCLFSSPTRTGAANTVSGPRSSAPSDQDTVKAPLDTERRTPPLSASRMISSSLHDS
                     LRERGGTAPPTVCSSTSASVTIVGFAGLTMRDAQIYIRVSEHDKTLLKTKPIPAEQLV
                     ALEASTATFTIDNVAANYDKQYTLKLGFRKLLGAEALCHADFCVLRCPAGKTVEKRLR
                     LYDVNSQYLGICRLSITLPPVHLPVLQWQHLSPAVFEPLMDDVASLVSTYMPKDLRRL
                     DLILCHAPDIRRLHCALRLQLAPSVVATVYVAIHSVDLHSVTVRHSCVVTASVGNFTS
                     EAVRRQPGSLQVYPYGMSKEGIFNLDFPLLRIDISATGPAAILTLCVCDRSSKAKSEE
                     VGRTVVSLRALLTPAVFAMSEKVQVPLVSVSHAANRVHASLAGTVTFSLMPPAFESYG
                     ASVRFASSVVEGFDRAYVRYYTDRICRLLSHYDANSLVDIHSRLYESYVSCQCWETGL
                     PACLSELVVRWGPELDSFDPPPALKSRDGAQHSRMAAMVRSKNKESGPYELTPNGERQ
                     PAR"
     gene            <1673922..>1678799
                     /locus_tag="LMJF_36_4330"
                     /db_xref="GeneID:5655733"
     mRNA            <1673922..>1678799
                     /locus_tag="LMJF_36_4330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686965.1"
                     /db_xref="GeneID:5655733"
     CDS             1673922..1678799
                     /locus_tag="LMJF_36_4330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687017.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655733"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="UniProtKB/TrEMBL:Q4Q0Y1"
                     /translation="MPSTRRSISSQPRRTGTVTADPASRSPTRSTCRTRQEKGKPCYE
                     VVETREEVTTYIVTANHVPAAAERSPSHQEHVPKGSGGRTQSCSGGARQEYPRLAYDG
                     IDRAPRTNQSALEITGDSARRRPQFGALAADPDSHYVSAANRGGLTLSGNATSNSATR
                     RHAAGAHPSRSSRIVKAPVDISTLEDYQTPTRRRRSGGRYECDHGVGHTEAPPAGRGG
                     SHGRQRFSADVHAHENIDVEETETNCAAAAAAAEPYHFRVRLHKCRGVFADLKASCRP
                     PPAVYFAVHTVTERVHSGIADKGSYNPVFYDEFMFSSADPEHDALVCTLVAASSVNTS
                     RGSGTQRDKKVAECVLALHNLAWQVERKVWVPLVRHPGTSQAYEQGEVLVSIYSADFG
                     YDDVATEEEEAACSAAIHDTLTQYAPQELHRLDWMTSAYVNKGPEALSQLRAFYRART
                     IEPVPVRVTVRRVEGLTDEAGGPTRASDIYVVVGDGRVERRSKTVPYRRCATINQEFN
                     LVFVNPGVDTLSVTVFGNGRKLGEAVAGLTNVQAGKAKEVTLMLVRAAETGDASNGGQ
                     VTLTLQTEKYSSPYRMSAKQEARLRERVLAHLWCYLRDDLHRLDAIMGSIDNEEVYMQ
                     AWARTVGPEQKPRRLQVSVREARHIIADGGLQPRCYARITAGPTTVRTGLVTVRNGVA
                     TFKDSFRVQVYDPAHDAVEVMIVAEDDGGEREISRVCLGVANLPRQGRVVRTLHLVSA
                     ATKRAAHVQGELTVELLAEDFGLTGALAVAAEECTSFASSVHMQRLEAIMQRSSPEKL
                     HRVPYMLDTAPPGKAERVVEDEAKQHSSDVAVAPMTVKILGVKAFKPAVDFYVKVYLN
                     NEPILRTGDVRGSTVVTIGIKDNNEATVRLKDAPQAVMTFKIAQHRALRKTAVLGEAE
                     VALANLVRGEKNVLWVPFFQPAKASASGSGGESRRCSASCTSDTRGNIVKLKGNRMPN
                     SNDTVAARQEQLPGASLARHDTAAASPVGILGLELQSNAFPETTVTEYKLDDESGRTG
                     VSAQEAVTEDVTSLIAKMRPSELPRVQPMIAQCTSLKSAHDELRTELSPRPILGTVYV
                     NIESVDLATETGKAQEAQGGVAVEAAYGSERQESRKRTGFANDALHQRQLYTQIRLDI
                     PAKLDSAISGRNGAMSRSAAYAKGAPALELRLIGVHGNEGASGAVLVPTGSVASGGAF
                     GEGRKGAYHYDAADTDSDATADSYYVGGENNLHSYIRFPQNRGRLRSTTQPEEEHMGR
                     PSKMRIMQQGQRQSDPHRNGGSTVSLYSNHYQNIPEAQHSSHREEDGKRCLGGANNSY
                     SYVGSPGQSFRHSVHGSERAPSRHQVGLANASGSNRQPGSTSWSLTTASVPYKWSTPY
                     RGEIGVVRLSLRALLTRPLYKIGDTLRVPIVAPAIPAKLSNRARCSPAVNQRCIVGHV
                     TLRLTLPAFEHVPESLRLGGHNSMSKVVPDYVHYYERRIGAYLRSHNARDLVSFHYDL
                     CERDVVSGCWPVSLPQWMQTLIKRFGPETEYVGPVPSLPFVPEEWELVRQRADALRRE
                     REAALAPWKQSSKVGDDHTDDHINVYSSRGASPSVRSRGNSPGRSAWADRKKGSSANG
                     RLDAGEASAEAVHRL"
     gene            <1681077..>1682687
                     /locus_tag="LMJF_36_4340"
                     /db_xref="GeneID:5655734"
     mRNA            <1681077..>1682687
                     /locus_tag="LMJF_36_4340"
                     /product="hypothetical protein"
                     /transcript_id="XM_001686966.1"
                     /db_xref="GeneID:5655734"
     CDS             1681077..1682687
                     /locus_tag="LMJF_36_4340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001687018.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655734"
                     /db_xref="UniProtKB/TrEMBL:Q4Q0Y0"
                     /translation="MSSYDAMSAVSSNGAVMPEINLHPRLMTHRPESDSYTGSARHSS
                     RSTRAVPTNAELAYAGVTAQDGVVQQLSSRSEERGSLAGPREVSAQSNSGHRALRAIT
                     ACGSIDEPLQLSEPHQGRAIRDTPREQKPQQHQSQPTRSISHGVVARNAAGAGSSREP
                     IRPGRSSCSSTPRIPSKHNDPYAHVTSVVQEYRQSRINALEAQYRVAHTHSNTSVSQG
                     YDTRQSQSASPRSLEARRNASAHSRASARPRDGSWRMSSVSSRTRQNSPLPRAVEEEY
                     LRGGVPRAALDAPHIRYAEALYNMYNSSSSSARRLACMSSMSSNMTTEYVPDVAKRIP
                     DRFKYVPPTEEERRLHREATLRALEEWRRRQCARENAHCKGSEDMAAGGAAVELRNRN
                     PPKNQSGTRSQQPQQAGHEEAAAWALQKGFDNTSDSFSGQARDSFTPSKKCSARKAKK
                     IRSAAEQRDDYPTNEGAGEWERPQSSVGKRSGTLISRRQNGAGLRASSRKGRKSPTES
                     ARVEDGMKLNSFREKLLFDIAPPTVSIA"
     gene            <1684158..>1686827
                     /locus_tag="LMJF_36_4350"
                     /db_xref="GeneID:5655735"
     mRNA            <1684158..>1686827
                     /locus_tag="LMJF_36_4350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686967.1"
                     /db_xref="GeneID:5655735"
     CDS             1684158..1686827
                     /locus_tag="LMJF_36_4350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687019.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655735"
                     /db_xref="UniProtKB/TrEMBL:Q4Q0X9"
                     /translation="MGPVAASACSHMDDSRGSARFPQPRTPEPQRFQFRSLRWCPEAQ
                     TPTAQHDGGAPYAAEEVAYMYADEEGVRHAPRTDVGHLTRPGAQDDGASPCTPRTVCQ
                     SRMRQCAELANAHPFSASLRTAHASAAPLQQSPCSFTPSIADAPVVRRTRSLSCPSAY
                     RSVAPARCSVGYGISSGGAGQSIGRPTTVLSGVSPAGVNVCGSPSAVSAARPTVPLHS
                     ALSTTALSTADEQGRTLPERRDGVDDLPACESNDVFLMHTYTTQPCATSTSVPQLTRL
                     SVSSSGHSPAVPTNWSIGRPTTLRCRDTDSDVHCNWGAIQGEDEEDKESLIGCATQVW
                     RISAEVQMPLQCSHGTRATEEETLLGAPTSHCGDHLTNGRGVFASSPPIVWQPAPLPA
                     SFSASQIDLSGGGQDNAVLLSGAPVGSAEEETHNDNREVTRSNVIPATGDIAATESND
                     SFVGLEAAPRKGYARSNSGTPPRSDLGSPNNAANLQAHGRAANGVSAGVELVYRAAAS
                     ETNSHHFGASLCANIGSGCRARLGIPAEWRDHMCAATPQGRGVWVQVPGQLRESEYPA
                     STTTAEAVAARLAHISIHTSPTPKRLAFEEEELVERVSGGGSPTLIPAVRFVADGAAR
                     RGACNEASVAQGAGGSTEVGLLGRGAGGLSSSGMRWASVFGDSGHLELCSSRIPSGLQ
                     LLRSRKRCLDEMQATDTQERHADTLVTGGISDARDASYLVPDRVARMSLATPFENLEE
                     DGDGDEEAVKRQRREEQRRMRLQHLLPASPNTMDDLIPAPARALGTAVAPCSSVSSSH
                     VRSTVHGIQSTQDQQHQQDRTRNDDPASWSQVSSISYVTPASQSTSMGLWGVPGTLSQ
                     GHHGGAVVCSVGSGSQLLTPLPTNVMPQPSHKP"
     gene            <1689262..>1690494
                     /gene="RPT6"
                     /locus_tag="LMJF_36_4360"
                     /db_xref="GeneID:5655736"
     mRNA            <1689262..>1690494
                     /gene="RPT6"
                     /locus_tag="LMJF_36_4360"
                     /product="proteasome regulatory ATPase subunit"
                     /transcript_id="XM_001686968.1"
                     /db_xref="GeneID:5655736"
     CDS             1689262..1690494
                     /gene="RPT6"
                     /locus_tag="LMJF_36_4360"
                     /codon_start=1
                     /product="proteasome regulatory ATPase subunit"
                     /protein_id="XP_001687020.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655736"
                     /db_xref="GOA:Q4Q0X8"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005937"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q0X8"
                     /translation="MLAAVAVPSSSSSTAPGTNTAVSDYFLQKIHELRATQKRTLDNF
                     ERLEAQRNDLNRRVRHLKEEVQMLQESGSLVVDVVRVMGKNKVLVKAGSGQGKMVVDV
                     DKSVDFKDLTPNARVALRSGTSAIHYILPTKVDPLVSLMKVEKAGKESTYDEIGGLSR
                     QVKEIKEVIELPVKHPKLFEALGIEQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRV
                     SGAELVQKYIGEGARMVRELFVMAREHSPSIIFMDEIDSIGSSRLESGENGDSEVQRT
                     MLELLNQLDGFEASKNIKVIMATNRMDILDEALLRPGRIDRKIEFPAPDEAARFEILK
                     IHSRKMNLTRGIDLKDIAKKTSNCSGAELKAVCTEAGMFALRERRVHITHEDFVLAVA
                     KVMHKDQDKNVSLKKMWK"
     gene            <1695323..>1702984
                     /locus_tag="LMJF_36_4370"
                     /db_xref="GeneID:5655737"
     mRNA            <1695323..>1702984
                     /locus_tag="LMJF_36_4370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686969.1"
                     /db_xref="GeneID:5655737"
     CDS             1695323..1702984
                     /locus_tag="LMJF_36_4370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687021.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655737"
                     /db_xref="GOA:Q4Q0X7"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="UniProtKB/TrEMBL:Q4Q0X7"
                     /translation="MRMGSLALLSDIRTAYLAGYDAAQRSGETILSSSRGAIDRAKVT
                     AGTKDARQRLEEHLRLLCTTICISGEEYVRAFPANLYVPLLTEILTAAHVAQRSDGCV
                     MNPLSSDVCDSDVPSSFSVVKQPSHKVVLKSRSNKLLSSYMPALGMQAASPVAVFALR
                     ALALIADMVPSGSFAFCPSRSKDTIATLALYISEPDFLVVNEDLAEELLKCFRYVSMV
                     TYDACIDARVPARTVEMLLVLEPHHLRVLCVQVVSNLLARARESDLEGVWAPVMAKLL
                     ESFDSFLLESSLRLSAPETTTQVATDGSSRPTAATAAATTAFVTPTAVRSLTGKETTL
                     LQHYMEAIAHAVDRLFVSVASMKAHMKLLDHMIRVCVQVLQLSLNIIPATCGEWLRSV
                     ALSPILAFYLTNPPFAVPVLLQLRVWEAVCGCMLTLVDRRAVGTRASGAAAGVTALES
                     EVAGGAPDDRAAMQINSSAHTASSAAASSASLASNAQRGRGEGPALTTGPVLTTDVTT
                     IPFIADELRLLPLLEFLLVLLPCACRGHSHTDFRHVTLPYFGWTWEDDFHNETECNEA
                     ISRRLERIYQQTRSCRKHELFAITHGKQRVFYIDFLSKSYVSERRERHCLHRKPLLTG
                     YMHGTQDALLRGCTCCASEPAPRFSTWVNRNYMQLRTADTEAGGRRGESLSSSSSCAS
                     SGDAADEEDGSQAPGSTPQSSAMVRASSSLSLRSSSARDRGRGHVSSSSSSHLRHQIN
                     TLQMPDVHASDPDDGDGNRDTATSPSASRRSRGSGTTREGSGGAANVHHGNRLPHTAY
                     SEGDEVNADDEDCYSSMNGHQGESQQLNPRRRGGGLGFLLCRCDSDTTASSQGRSRQI
                     RMRAYLPETPPFPHHRHDSLAITVLPMEAVLESPGERLQADLSTRKSFLGKGVLSSLL
                     VTVVPALLSVLDNCVNPVVARHSVTLLLRCLSLSANLRTQVTGESIELFTGSCSGEKA
                     AAAAAASEVSDKSGWRRMSFRKWITGGSGSKPRGWQRAEWEATQAALQRLAPSLCEVL
                     VSLYVADSVNIVAERQETFGYVRDDLLMADELARVGLSKDFFSFQLALPSELHVCTAD
                     AITLLLHLFPSVKPSASAASAPKLKALKKSRKTSNLHRPPRHSISGDKDAGVLASLTQ
                     SMSSSGSSTKTSTAGQPTTPAAQAALQRQHSQDLRDTVASLALSETPVLQYRTPVSQG
                     GQGHVTKPLSPTQRPAPVPQQGSADANATNSQPPPLLSPTTLSRPSTMSLSLSASESY
                     SASVDTVQDCLSKASPADSRGVGGAGVFTLHQSTLLVSYASQIVRRSTKACAAAQQIH
                     ESMNHKTFYTRVVIGSPEPCDGGALQLQSRELTLRLFPDSRCPYHSTFLACTEAFFHA
                     SQALLMALLAAGASPPARSGATAAPSRDLMAQPGTAVFSPAVVSEVPSAAVARLQGPQ
                     PGRQRPSACLTVRPAESAHTSAPVQSQAPSHFKGGEEFAVGVELPVIPATVNAGAMQE
                     AIDRAMEDTTGLYRRLPPALRGLLGFYDYCKQCNIELRAAVVETPEILGEMATHLEKW
                     LASRARQREDVECSNASFALSLYMSNNSLDSSTSRIVDALLASQQQLHLDSTARGKLL
                     CLTADFATTIGRDLGLATLDVAPSVVMKQPCSFQKRAKRVKTFDAIRLLLWRPLSIFL
                     DPRTPTTAKQLLSGSLSTADAASVAWGEAAGAEKSVVMVGCTELRVVTGVKLRDPMMS
                     VLPIITMGLLAEAVAAQVQLPPVSAFSRSFTLKSSQLSPSPRPLHASQERQSLSESDS
                     GRGGAESSCLKSENGFEERRPDSTATATTASATEPPISADRILFFLNDTPLFSPMTTL
                     LDALTAFAGSGASLRDLVERQRRSSVSVDAHSSDISATLPTLPFWTVTHVLKFVVLAE
                     PLPSSLILGLTTTASASSATNCCCCCGCDGLRPAFLCSPKHLFDAAPSSGPLALYSAL
                     STVMREEVGNSLAVLESNQQRLSSAVVHELYHQLKMFMLPPLLWCCGIGAAAQGRTRG
                     RVVGTAATLSAGAFPLPSYVLWRYPFIFSAEMRLSIFRFFISAQRSLSYEEAKHLLQH
                     YRHLLVRHAAAEEARATASGADGDTEETLNIVGLQWLSEEVVRRRRVTLTVQRRNILC
                     CAEELIRLATCNVTIDVAFEGEAGIGNGPAMEFYEMVAEELLDPKHGLWRTEPIPIDE
                     PADSSSLRAAPPPTRSANPSPRTAATGVPQRRRPCTPLFPAAKQTPTSLHYWKLLGVL
                     LGRLLVIGTTSSLNFHPLLLRRLRGESLTSTATEASQNMSQVDAALEFTLHRLETMNA
                     GSLAACELFFTIPVSEADGYAPGTVKELPLIPGGADRQVTVDNVREYTHSLRAYYLHT
                     VPDLALLYLRQGLQLTVNPLYLQLFTVDELGRLLGSPLDSKVWETREQFARDVEAAHG
                     YHIKSDVVQYLLDIVPTWSAQMQHAFLKFVTGSSAVPYGGLTQRIKVVRRDVDVSAAD
                     LSVTPTTHSFGISAAGLFTTSSFAGGGVNYDNSLPTVSTCFLYLKLPRYSSRAVLQDR
                     LLFAVCEGQRFFSLT"
     gene            <1704508..>1705989
                     /locus_tag="LMJF_36_4380"
                     /db_xref="GeneID:5655738"
     mRNA            <1704508..>1705989
                     /locus_tag="LMJF_36_4380"
                     /product="putative alternative oxidase"
                     /transcript_id="XM_001686970.1"
                     /db_xref="GeneID:5655738"
     CDS             1704508..1705989
                     /locus_tag="LMJF_36_4380"
                     /codon_start=1
                     /product="putative alternative oxidase"
                     /protein_id="XP_001687022.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655738"
                     /db_xref="GOA:Q4Q0X6"
                     /db_xref="InterPro:IPR002680"
                     /db_xref="UniProtKB/TrEMBL:Q4Q0X6"
                     /translation="MHKTPLFMQMMMRLHIRVALTSLSSSRRYVSKGGGHLGTSRSAS
                     QAASSASCSASVSAPSSNAFGSSSVRIKPPSYLYRAFMGHSTPFAAIAPPLTRAGITQ
                     LEREPLAHSTPGRINDHICIGMVKTLRWLADRAFRERYIHRATMLVTVAAAAPAAGSV
                     AAYLRMFFRRSNSSNACTGDSQMPTTAEASSPFLAFGSSPSPGAAPPIPDACRAFAMA
                     RPSLYMSTSSATMEGTGPRPEHSYVDELRGLLAQCESHAVHYQVLSCMAEITLLERSL
                     VLLLQAVHFTIYLALFLFYPRMGFRLMAYAAEESSVVWTQMVNDVDLGKIAEPRVPQL
                     ALHYWGLEGVFTAQAAPPPKTVTLQEQEAVLYKTSEGLVAEQIPVADAPISGASPYGS
                     YNGHRSATPPSRSADHVSVPFAAAASCDGSAVDRKESEERVVNTSDPGAGPGLSVLTL
                     RDVALLIRSDEMIFRDLNHELANKLDMQPSWTQRLLASLGGEK"
     gene            <1706956..>1709550
                     /locus_tag="LMJF_36_4390"
                     /db_xref="GeneID:5655739"
     mRNA            <1706956..>1709550
                     /locus_tag="LMJF_36_4390"
                     /product="putative gamma-tubulin complex subunit"
                     /transcript_id="XM_001686971.1"
                     /db_xref="GeneID:5655739"
     CDS             1706956..1709550
                     /locus_tag="LMJF_36_4390"
                     /codon_start=1
                     /product="putative gamma-tubulin complex subunit"
                     /protein_id="XP_001687023.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655739"
                     /db_xref="GOA:Q4Q0X5"
                     /db_xref="InterPro:IPR007259"
                     /db_xref="UniProtKB/TrEMBL:Q4Q0X5"
                     /translation="MSSTTDWTRFLAALEKRGVRFDQVQYATDRQEVIRATGITDALS
                     IAVVETEWQRHCNGGRATSGAIPPDHQGVSASNPAPARTLAPLLSQPAPDERGPVTSA
                     RASNDGVAGLPTLHELSQLTRLPEELQDTVLATEVLAAAVGLGGLFLQYTPAAPGTSS
                     GISPKEGFQVSPLVPASMRSLCETVLPVADAFMALRCIEKAEYSSCSLVLMALGEVVS
                     EINTSYAHQVSKLQLWSEGRPMPLMGVVSEILRVGHHVVRLRQVLPMDLICSALAEAA
                     AAAADPTSSTFASPSTGLVGPRILNHLCDQVNKYSGSCEDHELLTLLLRRSLVPYLRM
                     LQRWMHSGVLDDPYGEFFISEVYHPAQPSGTAASHHQQRHVGQLFLDALAPSATSAGR
                     DGELGASGASTASQGRFGLKRRAAAQQDVVAFDRRFSLNKSLVPVFLNTPSRIAKMAF
                     FAGKYCCILREYGAALPAFRPASVPGGAGAAVGSRPDGPGDALLTWSGANQLQRQVQE
                     SFEISSGAVIQLLFSPSVDLLGHLKSLKLYFLQERGDWVVDFLDSAESLLAEHPDRIK
                     QHSMQVLLQAAVARSCSSDPYHDLIGCSFANCTLEELLQEQNRQRDSGGDTTAAAVGE
                     GATTALPSRRSMGGSGGEVDARRSLELLQLETDLQWPLTLVLDGKVTHRLNIIFRLLM
                     WVKTCERHLFELWYTNEILGEFSAAYGLKHQFVQFLRQFQFYAAHFVLEPLWSRLVAR
                     IGQADSVFAISQALTDFFDGAETGLVLSSTQRFRSLAHILELTERFCAVGMHSSTATM
                     PLIEATLHSVEDQFLRALSELASPIGPDYPQLVPLLTWIDFSRFYDQNNVYHVQHGAA
                     SSAAGRSM"
     gene            <1712602..>1715496
                     /locus_tag="LMJF_36_4400"
                     /db_xref="GeneID:5655740"
     mRNA            <1712602..>1715496
                     /locus_tag="LMJF_36_4400"
                     /product="ATP-dependent RNA helicase-like protein"
                     /transcript_id="XM_001686972.1"
                     /db_xref="GeneID:5655740"
     CDS             1712602..1715496
                     /locus_tag="LMJF_36_4400"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase-like protein"
                     /protein_id="XP_001687024.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655740"
                     /db_xref="GOA:Q4Q0X4"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4Q0X4"
                     /translation="MSLKKKTFKQRIRKNDMKQRHQIGFGLRKRMGAARRIRNRYDSV
                     DDGTRPMEMIVSEIAEGTAVPSQEAVLDPRSLTDLLLRPAESPVSNNSASASANVATT
                     SCAVASKSNGCSSALWKRGSSKSSALLTSVPLASEKVLPSLPLAPDDPLALPDTRVFE
                     EEERQQRLAREAAARQNENKNLYRHSGQPYLFWERVGLHPALLQALRDLHFTHPTPVQ
                     EEVLPNVLASGDEGLARQRSSEADKKSKKHKRAGGAADSAGHDVVVSAETGSGKTLVF
                     ALPILQDLLTTLDTERVSAVTPTSSAEAVHEKATGQASSDAAVARAELKAKRQKRIMH
                     SLIISPTRELALQIDAAIRQLTKFAPQVVVGCVVGGMAQERQQRVLNRHPHILICTPG
                     RLWDLVQKNEGCYLGHSASRRLHYVVLDEADKMLQSGRFAELQTLLERIHCEVLPAGF
                     AQDREEGAEPGEIAVESGRWDPDTESFIPFDKEEAGATKPKVKKLVAETVTEAGGAPV
                     ETMKGKKRAREAMEAAAEDVSSTSKTKKAKKVTADVTPAKSRKTAKTSAKQAAGLKEE
                     EDEEAADEEETASKYGNINTETEHGGARHRKDEPQPIPMPPEPAAGHRVITYVTSATL
                     SLQTNYERRDFSARKSIIRTSNADVLTKVLQQLEIKLSNARVFSLAESANVAARINET
                     YLRCPDNSKDLYLYYFLKTYHDDRAIVFVNAISMLRRLVKLLEVLGIAVVGLHASMQQ
                     RQRLKFIDKFKEGKIHVLVATDVASRGLDIDGLKYVVHYQVPRTTEAYIHRCGRTARC
                     GGTGLSVLLVNAQEHMSFRKLMESLGRKESEVETFAMQATIVHQLHSHLRIAWQIDKL
                     QKEIGKSRANNQWVNRMTKEADLETDDMFDDTADAENREKQKAIRILQRELQLLGRKF
                     TGQYGGKGAFRTSAYALGAKQAEQHLKERADRQTIRVASKKKKFAADGKK"
     gene            <1716678..>1717262
                     /locus_tag="LMJF_36_4410"
                     /db_xref="GeneID:5655741"
     mRNA            <1716678..>1717262
                     /locus_tag="LMJF_36_4410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686973.1"
                     /db_xref="GeneID:5655741"
     CDS             1716678..1717262
                     /locus_tag="LMJF_36_4410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687025.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655741"
                     /db_xref="UniProtKB/TrEMBL:Q4Q0X3"
                     /translation="MRRAGWCAVALTAAVVVGTRVSQALASPSSASSWSLCDCSHVSA
                     PCRFHHAVGLLGRTRFTRFDLRKHEMEKRRLRELEKAGIDPVDDDDAPWIAPEEQQRL
                     DEEEERRRAEMEEQRQAFMKKRAEEDAVKRQKFKEFRAKQIAMSRHRKVAAAEKKEEA
                     RQHRQQTSRVEGAEEANAAEDGADAEGASHHGTQ"
     gene            <1717982..>1718371
                     /locus_tag="LMJF_36_4420"
                     /db_xref="GeneID:5655742"
     mRNA            <1717982..>1718371
                     /locus_tag="LMJF_36_4420"
                     /product="putative 60S ribosomal protein L22"
                     /transcript_id="XM_001686974.1"
                     /db_xref="GeneID:5655742"
     CDS             1717982..1718371
                     /locus_tag="LMJF_36_4420"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L22"
                     /protein_id="XP_001687026.1"
                     /db_xref="GeneID:5655742"
                     /db_xref="GOA:Q4Q0X2"
                     /db_xref="InterPro:IPR002671"
                     /db_xref="UniProtKB/TrEMBL:Q4Q0X2"
                     /translation="MVAVRAKVGSRSYVRQKQLAKGKKVFKIDCSIPAADGIFSEDVL
                     GNFEQFFQDNTKLNGRKGKLSDKVRLSMNDNVLTISTTMAYRKKYFKYLTKKFLKKKD
                     LRDWIRILATGKGTYQLKYFNIQDQEE"
     gene            <1719757..>1720866
                     /locus_tag="LMJF_36_4430"
                     /db_xref="GeneID:5655743"
     mRNA            <1719757..>1720866
                     /locus_tag="LMJF_36_4430"
                     /product="asparaginase-like protein"
                     /transcript_id="XM_001686975.1"
                     /db_xref="GeneID:5655743"
     CDS             1719757..1720866
                     /locus_tag="LMJF_36_4430"
                     /EC_number="3.5.1.1"
                     /codon_start=1
                     /product="asparaginase-like protein"
                     /protein_id="XP_001687027.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655743"
                     /db_xref="GOA:Q4Q0X1"
                     /db_xref="InterPro:IPR006034"
                     /db_xref="InterPro:IPR027473"
                     /db_xref="InterPro:IPR027474"
                     /db_xref="UniProtKB/TrEMBL:Q4Q0X1"
                     /translation="MLYISSGLVGRKAMSGELSPEEDTSGAKVLLINMRSYQSDLLDQ
                     TQRSNVDHRRFFLDILQCNEDLHRPGVPSFDVIQLEKLKLSADHTHEDWLELAHLIKK
                     EYHRYRGFVVESGSDNMVTTSTAVSFLLENLGKPVIFTGSLIPGHRIYTDMTRNIILA
                     LAFASCSQICEVCILFDEMLYRANRAIKMSLCSLRPFDSPHFPPIASMRGGVLIIHKV
                     LLRPHPTGRLCIKAELSTKVLTLELGPGAPFEFFRAAIEYTSAPALILRCYGSGNGPT
                     RRDFMKRLLAIAKDRDLVVVICTHNRYGVVALSEYEAGRQLMGAGAISAGDMTQEAAM
                     VKLKYLLGLGMSPEQVRKYFAVDMRGEVSTPSAKL"
     gene            <1722016..>1722864
                     /locus_tag="LMJF_36_4440"
                     /db_xref="GeneID:5655744"
     mRNA            <1722016..>1722864
                     /locus_tag="LMJF_36_4440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686976.1"
                     /db_xref="GeneID:5655744"
     CDS             1722016..1722864
                     /locus_tag="LMJF_36_4440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687028.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655744"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:Q4Q0X0"
                     /translation="MGSSSSRQTPLPAGSADTAASAEVTASTTDYQEYIKFRDQLLDF
                     ALGESAFDYTERLFAQKPDSPEVMALLAETAFLYDKTKNKVSREHWCDRLDLLQRGVD
                     VSRKCINENKDYGPCYRTYVMCATREAEALYYMKSFTGLGLVENYQAIMRKGVKGMEL
                     LPTDAEIPNTLGALCARCCFRWYDPSRVYAWFYGLPPTRRLRELSVDFHKKACANDPK
                     NLEYACRLAQAYFQLGDLANARRWYVKVRDEMPPQELKDEKWQGVAHTQLSTAFVKPK
                     WNVPFA"
     gene            <1723999..>1726029
                     /locus_tag="LMJF_36_4450"
                     /db_xref="GeneID:5655745"
     mRNA            <1723999..>1726029
                     /locus_tag="LMJF_36_4450"
                     /product="putative mitochondrial intermediate peptidase"
                     /transcript_id="XM_001686977.1"
                     /db_xref="GeneID:5655745"
     CDS             1723999..1726029
                     /locus_tag="LMJF_36_4450"
                     /EC_number="3.4.24.59"
                     /codon_start=1
                     /product="putative mitochondrial intermediate peptidase"
                     /protein_id="XP_001687029.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655745"
                     /db_xref="GOA:Q4Q0W9"
                     /db_xref="InterPro:IPR001567"
                     /db_xref="InterPro:IPR024077"
                     /db_xref="InterPro:IPR024079"
                     /db_xref="InterPro:IPR024080"
                     /db_xref="UniProtKB/TrEMBL:Q4Q0W9"
                     /translation="MLRRLVSCASPLRLRGCGAAVVLGNGRFASTANASAAPPITTTK
                     APTYGTVPDIPNLNFLSSPDNLLNTVDGTVDVCEALLKEIPKAKTPQAKHDLIDSTSN
                     VLCLLLDPCEFVRQIHPDENYKRGASLAFQKGYEYMCEVNSRRDLYDVIKELDSQEGR
                     KGLTPESVKNVVQLRRDMENNGIHLPDAQRAKVTEMNIEKEELAMRFLTEQGSANPFG
                     TLRYLLQCRYELAQLLGFESYAEQQLRGTMLENQENVWHFLCSIASKYRQQAEAEMNL
                     IRKHVGEVRNRVNITDEYRARVASSMRRDAEPENALEYFSVANCVRGIQCLCSEVFGV
                     KLEEVPLNPEEVINNSVKKFHVYDEHKRFLGVIVLDMYTNEMKYCQAGHLTLQLGCVP
                     HQEALATVGLRLPKRQYPVVVLTANVGALKPAQRRPDGTYDDESTLMQPNEVTTVFHE
                     FGHAMHTIFGQTQVQNLAGTRASIDYVETFSQLFEQFLSSHEFLKLWAHRINTREPIS
                     FDIVQKRNSAANMFKHLDMLDQVVLSAVDQALHGPQPLTVYFPHGDQGHVGKRTLGDL
                     GDYGRGGFNMARALIQVAKPVSVAEPTETGVLSTLSFEHLSGYPGGYYGYLYSLSVAR
                     RIWTKKFERDPLNRDAGRELVEKVMCHGAACDPRETIEKYLGDNLTDIDIWA"
     gene            <1727428..>1727910
                     /locus_tag="LMJF_36_4460"
                     /db_xref="GeneID:5655746"
     mRNA            <1727428..>1727910
                     /locus_tag="LMJF_36_4460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686978.1"
                     /db_xref="GeneID:5655746"
     CDS             1727428..1727910
                     /locus_tag="LMJF_36_4460"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687030.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655746"
                     /db_xref="UniProtKB/TrEMBL:Q4Q0W8"
                     /translation="MMRSSFVHKAAAAAAGGGMTATSSDHKMASLHKLLTGEVQFRNN
                     ALLKTCNIEHNFGATWKSDIEAYAKCLPADERSCLERQVARVMLTRYTTRELAEYCGE
                     GPEHVDAVAREANIAQAKAHAQQYGADKLEAYVKAESKNAGWSEAETKSFLDAVKAAK
                     "
     gene            <1729428..>1730255
                     /locus_tag="LMJF_36_4470"
                     /db_xref="GeneID:5655747"
     mRNA            <1729428..>1730255
                     /locus_tag="LMJF_36_4470"
                     /product="putative chaperone protein DNAj"
                     /transcript_id="XM_001686979.1"
                     /db_xref="GeneID:5655747"
     CDS             1729428..1730255
                     /locus_tag="LMJF_36_4470"
                     /codon_start=1
                     /product="putative chaperone protein DNAj"
                     /protein_id="XP_001687031.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655747"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:Q4Q0W7"
                     /translation="MGAVKFQLYKTLGVPMKSSIKDITRAYRHLALKYHPDRNPEGVE
                     KFKSISNAYAVLSDPERRAAYDLTGFLSDSADSSHAMSDEAARQQRSAELADQVRTFF
                     ATYAGSAEERLDVVRGYEKCRGDFKKMVREYLLFDNGVEAEVQRLHRLVSTLIELGNL
                     SPTPAWKSTSTPEALLRLEKAMHRERQEAENVLKDMAGSGTGAAGAADGDLSSLQVMI
                     RQRQQSSYESMLNHLESKYVTKKSNARESSKRTREAAPTARKDECASKKHRKASHHR"
     gene            <1732070..>1734418
                     /gene="AAT14"
                     /locus_tag="LMJF_36_4480"
                     /db_xref="GeneID:5655748"
     mRNA            <1732070..>1734418
                     /gene="AAT14"
                     /locus_tag="LMJF_36_4480"
                     /product="putative amino acid transporter"
                     /transcript_id="XM_001686980.1"
                     /db_xref="GeneID:5655748"
     CDS             1732070..1734418
                     /gene="AAT14"
                     /locus_tag="LMJF_36_4480"
                     /codon_start=1
                     /product="putative amino acid transporter"
                     /protein_id="XP_001687032.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655748"
                     /db_xref="GOA:Q4Q0W6"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:Q4Q0W6"
                     /translation="MQSLATRSSLLVHDVRASQRQSFAGRISHRVASRLSLAGPPVEA
                     RTGTVAGTIINTLCSVIGAGVLSLPLALYFSSVIVGLVVLLLFSSFAAFSVYCLVVGC
                     DATGRYSITEVIAFALYPPQLWEEYLRKQGAAKETAREEEQHAARPQHMPAPAPSGVR
                     SSSRNSESAVATPPPTEAAPTSADARLHSGRGEGVASGEEGSEDTLPYLRRHGSHRYD
                     RRRDDGQSCAEAARTKGCTTRDPDAFFLVPSTSTYARLRDAYAREEWRRRRYRRIITA
                     LMELILFCSNYGALVIYSKVIADSMPPVVSYVTHTDGFLVSKYFWLITGGAVFFVLSC
                     SRNMEELKWSSLLGFLTILYIVVLILYRYHTQKRYDYPHVDPRRHGKVHWLRFSVGVL
                     QTISTFGLALSYHYNVPYFYKELQDRRPYRMMQSLAVAFPIVVVCYAVTGVVGYVTFG
                     NEVAAPKVGGNIVLNYPKNDLLMNIGRLGLFVHFACVFPVLSICTRRGLHRLTMIALT
                     WADQSALMMEAARASGAQLTEAERGAEASTATAVLTNGAGIEDGAHVCGHIPGETSPL
                     LQRRGGPTPGYEVFANSSPPHLAILGQQYNAESPVSGRRTSDAADRPRDTLSADASGT
                     EQVCGSQPGSEQVSTVDVDRDVGSPDQTTMLAIVIEAAFLVITSVLIAGTVSGIDFVI
                     HLIGTLFSIFIVMVAPGIVGWCVFSPSGPFGSASAAVAAYSGGDRELSGAPVSGLSSR
                     FRLIRVKQLMCLLNAVLGVCVTGVGIATLVYETFWGKPIPAL"
     gene            <1735616..>1737160
                     /locus_tag="LMJF_36_4490"
                     /db_xref="GeneID:5655749"
     mRNA            <1735616..>1737160
                     /locus_tag="LMJF_36_4490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686981.1"
                     /db_xref="GeneID:5655749"
     CDS             1735616..1737160
                     /locus_tag="LMJF_36_4490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687033.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655749"
                     /db_xref="GOA:Q4Q0W5"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4Q0W5"
                     /translation="MTILLTCSSEQRVAPLSLACMRCRMAALRRAAPQPNALFLGAPL
                     FRPTSSLMMSVRCRSDSGFAKSRPVKYVSTEAPELRCGSSSAEAGSYETVNDALSADY
                     VGGLSNVTAEKFRGMQPVGTWERGDGDGESDKSVNSSAEFMEVDFTSDEKLRKLEKLY
                     RGAHQGDKILSTRERQLFSRMIYEKFYKVGVQSVVDPAILYQASLEVHWVEEWAAGRA
                     RAERWSEDEARRQVKRSLLERVDLHKPLSYIIGSQPFFGCDIHCEAPLLCPRPETEMW
                     THWMVYRHLARAERSTPATGFSPAVSPIRILDVCCGTGCIGVALAKHLPSAVVTALDI
                     LPEAVRVSRENAMRNGISPERYSARESDMFGCFLEGRVSGPPGKSANLSEDRPLGTVK
                     DAYAGTYDVIVSNPPYVLPQQYVDLPCTITHWESKTALVGDDYRESRQYLYFKELCVH
                     GAKLLKPRARRNDMLRDAPNIAIEVGLQAHMVADLMDESKLWRDVEVHLDYAQQERWI
                     TANSVH"
     gene            <1738214..>1739017
                     /locus_tag="LMJF_36_4500"
                     /db_xref="GeneID:5655750"
     mRNA            <1738214..>1739017
                     /locus_tag="LMJF_36_4500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686982.1"
                     /db_xref="GeneID:5655750"
     CDS             1738214..1739017
                     /locus_tag="LMJF_36_4500"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687034.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655750"
                     /db_xref="InterPro:IPR021298"
                     /db_xref="UniProtKB/TrEMBL:Q4Q0W4"
                     /translation="MVLLECKRLPKEEYSRDYDAFIASVPATTNIGEATDAIQKMQNT
                     RVRLTWMMAAAKQMIKDCMVDAEQQHYLTGPIGDTERYLSLERTERRQLCVQSELDAL
                     VEAFKGGAMILFPAECSGSDACQRLAAILDSDTASDVEKSKAHRILSMIDDGATNENT
                     LSGRAVMWWSAKPLARDSDFVKYIGKNDKTKITVKLAAEGSVAPPREPAVDVKAQAEL
                     MQHFYRKQEEMKKLVEDEDISFGNSAWANPHGLKNQLQGLDSIHYKGAF"
     gene            <1739978..>1740574
                     /gene="RPL18"
                     /locus_tag="LMJF_36_4510"
                     /db_xref="GeneID:5655751"
     mRNA            <1739978..>1740574
                     /gene="RPL18"
                     /locus_tag="LMJF_36_4510"
                     /product="putative 60S ribosomal protein L18"
                     /transcript_id="XM_001686983.1"
                     /db_xref="GeneID:5655751"
     CDS             1739978..1740574
                     /gene="RPL18"
                     /locus_tag="LMJF_36_4510"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L18"
                     /protein_id="XP_001687035.1"
                     /db_xref="GeneID:5655751"
                     /db_xref="GOA:Q4QG98"
                     /db_xref="InterPro:IPR000039"
                     /db_xref="InterPro:IPR021131"
                     /translation="MGVDLTGISKKSRVIRHHTYSTNPYIKLLIKLYKFLAKRTSSGF
                     NKVVYQRLIKSRSNRAPISLSRIAVVMKRKAVFTAKSKAAPIAVVVGDVLDDVRMARI
                     PAMRVCALRFSKSARQSIVAAGGECLTFDQLAMIAPTGKNTYLLRGRKSGRESVRHFG
                     ASGVPGSHSKPYATNRGKETKRGRRTGRSYKRKAFRHV"
     gene            <1742192..>1745356
                     /locus_tag="LMJF_36_4520"
                     /db_xref="GeneID:5655752"
     mRNA            <1742192..>1745356
                     /locus_tag="LMJF_36_4520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001686984.1"
                     /db_xref="GeneID:5655752"
     CDS             1742192..1745356
                     /locus_tag="LMJF_36_4520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687036.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655752"
                     /db_xref="UniProtKB/TrEMBL:Q4Q0W2"
                     /translation="MSSAQSSVFQGGAPAGPQRLSAIDLQRITTILEACGVSKVHGSA
                     HIYAHPESIHLISPRDLSFLVLHADVLATHTDLLYDARAFTGILWGMMQHADRGIERV
                     LCAIEGNGAAAAESARGGNVGGTPSSSTTAPAPAHTFVYTNVSKVYSAMFPHLVQVFR
                     VATLLRAYESADARAEVRDTRRIAQVDIDVAARLAGRLNHLFLCEAGERSTGALSGAG
                     ALNVTATYTNVGHHLFRTTESALSSVLLLLSSLAARPGSDAGPILRYFHDVGAWEASA
                     LGSLITESYSMSVQTVLFSLFQRSCEFDNVEEVAAKLLLQRLALRPPYQWRAFRLLYF
                     SVQDIGASDTQAAEDRQGSSAFGQLFVFSRIQHALQRCLTTSGRDNAGELAIVKSMRK
                     AVSAQVQRAWPEQGSADNAGSPSRKSRTDAPPRLLSYYELLVLAALQGMPEADLTKDA
                     ELLRRAEQTNLSAEPEVLTPSFLRMLMAFCYTVPAPTDPALSHAMLSTPSTLALYESL
                     AKHIFQIPLCASAAVADEVNQLFATAALRTETLVDLCVRSAIHNTREDELELAGGVTA
                     RENSAAAATDPVVVSPAPHARAKAGPAKTAGPPLPPIPSPRTAEVSTTAAMPSLPLPP
                     TPTTALFHLVRRDVSLLFAGNEDVLQHTPEAARARAKNFPYGFRAVTLATVHLLFAAL
                     RTAEFYHHIRPTDMLPVIAQLFALRAYYPLLPSETEAQRKAARRMLALMQNTLALLPQ
                     EMKAATVNQLLCRTLVPMSTTTGHTDQLQLALFEAYLRSMATASAANAVTDELMLQHW
                     VDIAVPAITNRHSVTLSIAGHDFLIAAFRAEKYVSPLFVPTYIALYVPSVELFSTGGR
                     VGQRSTYSPLPVSVIQHFARMVRVACHGIERCDSTALARLFEEDAGREGEATMPGSMN
                     AAAAYMASLSPAQRAALRKLTPTSAVLLVVSALFDCLCLLWNNTPGYVKVAQDLFVAY
                     FSGLCNLLQCTSTPVLQRVCASIEAMEVEHLRGSGSVQLQFLKYVSSVVDSVQGPSKV
                     GIAEWFLKMNKRIQEQNYGKHSKL"
     gene            <1746520..>1748121
                     /locus_tag="LMJF_36_4530"
                     /db_xref="GeneID:5655753"
     mRNA            <1746520..>1748121
                     /locus_tag="LMJF_36_4530"
                     /product="putative ABC1 protein"
                     /transcript_id="XM_001686985.1"
                     /db_xref="GeneID:5655753"
     CDS             1746520..1748121
                     /locus_tag="LMJF_36_4530"
                     /codon_start=1
                     /product="putative ABC1 protein"
                     /protein_id="XP_001687037.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655753"
                     /db_xref="GOA:Q4Q0W1"
                     /db_xref="InterPro:IPR004147"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4Q0W1"
                     /translation="MMRASQPCRDAPLCNIARGLQRIASAMLASTRGVEAGVASGATS
                     ATSWTADSADGAVGRGVAQRYASSSLTLPVDVAEDLSQPTTPKDMRYKHVPSSRVGRA
                     AGFASLFMQLGWEKMTGSIPASGLLSERGHQHIVDTLCRMRGAVLKLGQMLSIQDEST
                     IPPHVAALFERVRDQAFAMPPAQLHHTLATEFGNAKWRTDLFDTFDDTPIAAASIGQV
                     HRATLRPGAAGTDPTEPPVEVAVKVQYPGVAQSIDSDVANLKMLMSLGVLPPGMFVDK
                     ILQELRKELSAECRYTLEASKQMRYRDLVAADPALSSLFYVPQVYQAITTDQVLVSEY
                     VRGVTIDQLGKRPGVPQELRDYIAESFMALTLKELFVWRFMQTDPNFSNFLYNAKDKR
                     VYLLDFGASREYSREFLDDYLDVVTAAATGDRESIIAKSITLGFLTGQEVQEMLDAHC
                     ASVLLLGKPFQDRAHPFDFAAQNLPSLIQANVPTMVKLRLRPPPSPVYSLHRRLSGTI
                     LLATKFRATIQSGRLFWNIHDQLRK"
     gene            <1751705..>1752814
                     /locus_tag="LMJF_36_4540"
                     /db_xref="GeneID:5655754"
     mRNA            <1751705..>1752814
                     /locus_tag="LMJF_36_4540"
                     /product="elongation factor-2 kinase-like protein"
                     /transcript_id="XM_001686986.1"
                     /db_xref="GeneID:5655754"
     CDS             1751705..1752814
                     /locus_tag="LMJF_36_4540"
                     /codon_start=1
                     /product="elongation factor-2 kinase-like protein"
                     /protein_id="XP_001687038.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.36.4540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.36.4540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5655754"
                     /db_xref="GOA:Q4Q0W0"
                     /db_xref="InterPro:IPR004166"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4Q0W0"
                     /translation="MVVVKTKPAAAPQPRPAPAPRSFPKKWTPPTHTHEIPEHLSTDE
                     PDVLVPAQKYVYDVKTCAWKEADAMIRVLHPNRGLSQGTMRVCFALEELDETGFRSQM
                     VAKMFRHDISRVVESDYFNEGEAQCICGILAEKFNRVQVPAGFQRHVVSFLQCETVRI
                     KLREAPAAYQHKRLGFFSYRTTDSADILFTMEPRLTGNFTKYTNNFGNVYDGFEKRRS
                     LEEEKKRHRVLMAVEAFSHFTLVESGGSMLVCDLQGVNDFLTDPQIHTEDGKGLGMGN
                     MGQEGIDKWVDAHVCNEVCRAMMLEPLSKGLRNFPRTAENESRVSYYQILRSKLRSQT
                     PVRPEDIIPLKKPLSMMSDDEQLEYAMRLSALLSD"
     gene            <1758107..>1761532
                     /locus_tag="LMJF_36_4550"
                     /db_xref="GeneID:5655755"
     mRNA            <1758107..>1761532
                     /locus_tag="LMJF_36_4550"
                     /product="related to elongation factor-2 kinase efk-1b