GenomeNet

Database: RefSeq
Entry: NC_008639
LinkDB: NC_008639
Original site: NC_008639 
LOCUS       NC_008639            3133902 bp    DNA     circular CON 27-JUN-2013
DEFINITION  Chlorobium phaeobacteroides DSM 266 chromosome, complete genome.
ACCESSION   NC_008639
VERSION     NC_008639.1  GI:119355857
DBLINK      Project: 58133
            BioProject: PRJNA58133
KEYWORDS    RefSeq.
SOURCE      Chlorobium phaeobacteroides DSM 266
  ORGANISM  Chlorobium phaeobacteroides DSM 266
            Bacteria; Chlorobi; Chlorobia; Chlorobiales; Chlorobiaceae;
            Chlorobium/Pelodictyon group; Chlorobium.
REFERENCE   1  (bases 1 to 3133902)
  AUTHORS   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina
            del Rio,T., Hammon,N., Israni,S., Pitluck,S., Goltsman,E.,
            Schmutz,J., Larimer,F., Land,M., Hauser,L., Mikhailova,N., Li,T.,
            Overmann,J., Bryant,D.A. and Richardson,P.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Complete sequence of Chlorobium phaeobacteroides DSM 266
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 3133902)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (11-DEC-2006) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 3133902)
  AUTHORS   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina
            del Rio,T., Hammon,N., Israni,S., Pitluck,S., Goltsman,E.,
            Schmutz,J., Larimer,F., Land,M., Hauser,L., Mikhailova,N., Li,T.,
            Overmann,J., Bryant,D.A. and Richardson,P.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (05-DEC-2006) US DOE Joint Genome Institute, 2800
            Mitchell Drive B100, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CP000492.
            URL -- http://www.jgi.doe.gov
            JGI Project ID: 3634474
            Source DNA and bacteria available from Donald A. Bryant
            (dab14@psu.edu)
            Bacteria available from DSMZ: DSM 266
            Contacts: Donald A. Bryant (dab14@psu.edu)
                      Paul Richardson (microbes@cuba.jgi-psf.org)
            Quality assurance done by JGI-Stanford
            Annotation done by JGI-ORNL and JGI-PGF
            Finishing done by JGI-PGF
            Finished microbial genomes have been curated to close all gaps with
            greater than 98% coverage of at least two independent clones. Each
            base pair has a minimum q (quality) value of 30 and the total error
            rate is less than one per 50000.
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. It is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..3133902
                     /organism="Chlorobium phaeobacteroides DSM 266"
                     /mol_type="genomic DNA"
                     /strain="DSM 266"
                     /db_xref="taxon:290317"
     gene            1..1473
                     /gene="dnaA"
                     /locus_tag="Cpha266_0001"
                     /db_xref="GeneID:4568532"
     CDS             1..1473
                     /gene="dnaA"
                     /locus_tag="Cpha266_0001"
                     /note="binds to the dnaA-box as an ATP-bound complex at
                     the origin of replication during the initiation of
                     chromosomal replication; can also affect transcription of
                     multiple genes including itself."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiation protein"
                     /protein_id="YP_910502.1"
                     /db_xref="GI:119355858"
                     /db_xref="InterPro:IPR001957"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR013159"
                     /db_xref="InterPro:IPR013317"
                     /db_xref="GeneID:4568532"
                     /translation="MSEATNRVPEVKIPSNLHKPILLEQQVWDSCLEAIREKINPLAY
                     KTWFSPIKPVNFSGSELTIQVPSQFFYEWIEENYSSFLKQALKDVIGSEAKLMYSIVM
                     DKSQGQPVTIELPHQSTPLSACSSDSSESTQIKNKEAFEKNLQRFETHLNPKYVFETL
                     IRGDCNSLAFAASKSVAQNPGLNAFNPLVIYGGVGLGKTHMMQAIGNSVRKNCLSEKV
                     LYVSSEKFAVDFVNAIQNGKIQEFSSFYRNIDVLIIDDIQFFAGKEKTQEEIFHIFNT
                     LHQTNKQIILSSDRPIKDIKGIEDRLISRFNWGLSADIQPPDYETRKAIILSKLEQSG
                     VNLDESVIEFIATNVTENVRELEGCIVKLLAAQSLDNREIDLHFTKSTLKDIIRHTTK
                     QLTLDTIEKAVCSFFAITPNDLKGKSKKKEIATGRQIAMYLAKNLTESSLKTIGLHFG
                     GRDHSTVIHAVNTVGNRMEQQSDERKKIEELKKRIEILSM"
     misc_feature    73..264
                     /gene="dnaA"
                     /locus_tag="Cpha266_0001"
                     /note="DnaA N-terminal domain; Region: DnaA_N; pfam11638"
                     /db_xref="CDD:221153"
     misc_feature    85..1362
                     /gene="dnaA"
                     /locus_tag="Cpha266_0001"
                     /note="chromosomal replication initiator protein DnaA;
                     Region: DnaA; TIGR00362"
                     /db_xref="CDD:232941"
     misc_feature    544..930
                     /gene="dnaA"
                     /locus_tag="Cpha266_0001"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    574..597
                     /gene="dnaA"
                     /locus_tag="Cpha266_0001"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(577..600,763..765,865..867)
                     /gene="dnaA"
                     /locus_tag="Cpha266_0001"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    751..768
                     /gene="dnaA"
                     /locus_tag="Cpha266_0001"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    901..903
                     /gene="dnaA"
                     /locus_tag="Cpha266_0001"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    1186..1419
                     /gene="dnaA"
                     /locus_tag="Cpha266_0001"
                     /note="C-terminal domain of bacterial DnaA proteins. The
                     DNA-binding C-terminal domain of DnaA contains a
                     helix-turn-helix motif that specifically interacts with
                     the DnaA box, a 9-mer motif that occurs repetitively in
                     the replication origin oriC. Multiple...; Region:
                     Bac_DnaA_C; cd06571"
                     /db_xref="CDD:119330"
     misc_feature    order(1255..1257,1279..1284,1303..1305,1321..1329,
                     1354..1368,1375..1377,1384..1389)
                     /gene="dnaA"
                     /locus_tag="Cpha266_0001"
                     /note="DnaA box-binding interface [nucleotide binding];
                     other site"
                     /db_xref="CDD:119330"
     gene            1895..3025
                     /locus_tag="Cpha266_0002"
                     /db_xref="GeneID:4568533"
     CDS             1895..3025
                     /locus_tag="Cpha266_0002"
                     /EC_number="2.7.7.7"
                     /note="KEGG: plt:Plut_0001 DNA-directed DNA polymerase;
                     TIGRFAM: DNA polymerase III, beta subunit;
                     PFAM: DNA polymerase III, beta chain"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="YP_910503.1"
                     /db_xref="GI:119355859"
                     /db_xref="InterPro:IPR001001"
                     /db_xref="GeneID:4568533"
                     /translation="MNMKFTAPIRLLQDAVNRVSQAIPSKAIDPRFENIHLAIEPGKL
                     TLFASDGEMSITAKSEISSEDTGNISIKARTLQDFLRSMYDTEVTFSIERQEISDHGT
                     VSISTDKGKYKIPCFFESKMEIYEKNYVINLDLPSVELQYLIQKTIFACSVDGMRPAM
                     MGVLFELESSSITAVSTDGHRLVRCRKSTVIEVEDKQKIVVSARVLSILQKLPLHETV
                     IIQIDQDKRFVRFTQNNVVIDASLIVEPYPNYEAVIPVIHDKQVSCDRSNIYDSVKRV
                     GRFSSVGDIKMVLADSIIKVMAENTNEGESAQEELPCSYTGEDITIGFNAKFIEAALA
                     HIDEKEIIIELKSPTTAVIFKPVQEKETGSLIILVMPVRINA"
     misc_feature    1901..3022
                     /locus_tag="Cpha266_0002"
                     /note="DNA polymerase III subunit beta; Provisional;
                     Region: PRK14941"
                     /db_xref="CDD:184905"
     misc_feature    1901..3013
                     /locus_tag="Cpha266_0002"
                     /note="Beta clamp domain.  The beta subunit (processivity
                     factor) of DNA polymerase III holoenzyme, refered to as
                     the beta clamp, forms a ring shaped dimer that encircles
                     dsDNA (sliding clamp) in bacteria.  The beta-clamp is
                     structurally similar to the trimeric...; Region:
                     beta_clamp; cd00140"
                     /db_xref="CDD:238082"
     misc_feature    order(1970..1972,2114..2116,2135..2137,2504..2506)
                     /locus_tag="Cpha266_0002"
                     /note="putative DNA binding surface [nucleotide binding];
                     other site"
                     /db_xref="CDD:238082"
     misc_feature    order(2117..2119,2126..2128,2219..2221,2225..2227,
                     2726..2728,2816..2821)
                     /locus_tag="Cpha266_0002"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238082"
     misc_feature    order(2423..2425,2429..2440,2867..2869,3002..3013)
                     /locus_tag="Cpha266_0002"
                     /note="beta-clamp/clamp loader binding surface; other
                     site"
                     /db_xref="CDD:238082"
     misc_feature    order(2423..2425,2429..2434,2651..2653,2750..2752,
                     2789..2794,2876..2878,3002..3013)
                     /locus_tag="Cpha266_0002"
                     /note="beta-clamp/translesion DNA polymerase binding
                     surface; other site"
                     /db_xref="CDD:238082"
     gene            3303..4400
                     /locus_tag="Cpha266_0003"
                     /db_xref="GeneID:4568891"
     CDS             3303..4400
                     /locus_tag="Cpha266_0003"
                     /note="TIGRFAM: DNA replication and repair protein RecF;
                     PFAM: SMC domain protein;
                     KEGG: plt:Plut_0002 RecF protein"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA replication and repair protein RecF"
                     /protein_id="YP_910504.1"
                     /db_xref="GI:119355860"
                     /db_xref="InterPro:IPR001238"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="GeneID:4568891"
                     /translation="MRLTRITYNNFRNYRKMTFEPNAGITLLYGSNGSGKTNILEGIH
                     YCALTKGFTSIADSDCIFDSSDYYALQSTCLGENGSDIEVRISFSREKGKTLFVNNNE
                     IKKFSNHVGTIPCITFSPPEISIVSGSPSERRKFIDNIICQSDKKYLKDLLTYRRVLL
                     QRNALLAQISEKKSSINMLPYWSENLSVLAASIVFKRLEFLDKFIDNFRDLFKKLSIN
                     EEPGIVYRSVLGRYDNIRNIDELAALYYRKYDDNLRYELLRSQTSCGPHRDDLEFYIN
                     DKEIKKYASQGQLRTFLIGLKLAVYDYLFDTTHEKPICLLDDIFSELDTQRTENILSI
                     LQTLGQSIITSTVRRDSDIISSVSVHDLIND"
     misc_feature    3303..4340
                     /locus_tag="Cpha266_0003"
                     /note="recombination protein F; Reviewed; Region: recF;
                     PRK00064"
                     /db_xref="CDD:234608"
     misc_feature    3309..>3800
                     /locus_tag="Cpha266_0003"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:247755"
     misc_feature    3390..3413
                     /locus_tag="Cpha266_0003"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(3399..3404,3408..3416,3660..3662)
                     /locus_tag="Cpha266_0003"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    3651..3662
                     /locus_tag="Cpha266_0003"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    <4017..4340
                     /locus_tag="Cpha266_0003"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:247755"
     misc_feature    4152..4181
                     /locus_tag="Cpha266_0003"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    4239..4256
                     /locus_tag="Cpha266_0003"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    4263..4274
                     /locus_tag="Cpha266_0003"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    4329..4340
                     /locus_tag="Cpha266_0003"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            4411..4704
                     /locus_tag="Cpha266_0004"
                     /db_xref="GeneID:4568892"
     CDS             4411..4704
                     /locus_tag="Cpha266_0004"
                     /note="KEGG: cte:CT2287 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910505.1"
                     /db_xref="GI:119355861"
                     /db_xref="GeneID:4568892"
                     /translation="MSRTKSPRILSSVVQDVCRTLGMNKAIDDFRTVQIWKEVVGTTI
                     AEITLVERYTDGKLFVRVKSAPWRMELNYRKTEIKNKLNVAIGKEIIEEIIFR"
     misc_feature    4438..4698
                     /locus_tag="Cpha266_0004"
                     /note="Protein of unknown function (DUF721); Region:
                     DUF721; pfam05258"
                     /db_xref="CDD:218524"
     gene            complement(4906..5004)
                     /locus_tag="Cpha266_0005"
                     /pseudo
                     /db_xref="GeneID:4568893"
     gene            5093..6328
                     /locus_tag="Cpha266_0006"
                     /db_xref="GeneID:4568894"
     CDS             5093..6328
                     /locus_tag="Cpha266_0006"
                     /note="PFAM: transposase, IS204/IS1001/IS1096/IS1165
                     family protein;
                     KEGG: cte:CT0518 transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase, IS204/IS1001/IS1096/IS1165 family
                     protein"
                     /protein_id="YP_910506.1"
                     /db_xref="GI:119355862"
                     /db_xref="InterPro:IPR002560"
                     /db_xref="GeneID:4568894"
                     /translation="MPPLPSLTSHYHQLLGLPPNWNVENVTLSITGKQIEIRLVYTDK
                     QAECPECGQLCKIYDHTSEQQWRHLDTMQFETIIVARLPRCKCKEHGVKTVRVPWAAR
                     HSRFTLMFESFAIELLMHCSSIKAASSMLNLNWHAVDEIMRRAVKRGLNRRESEAIAY
                     LGIDEKSFKAGQHYVTTLNDLDKGRVLEVVEHRTNEAAKALLESLNKKQQEQVKAVSA
                     DMWKPYANAVEELLPNADLVHDRFHISKYLSEAVDAVRRKESRELDQAGDKRLVGSKY
                     VWLRNPENMREQQKVELSNLMACEFKTSQAWALKNMFRYFWQLGDTDGASFFFEYWSR
                     RVDEVGLTPLIDVKELLQRHFDHILTYFKHAITNAVSEGLNSKIQIVKASARGFHRFE
                     SYRNRILFYCGKLNMAISS"
     misc_feature    5114..6298
                     /locus_tag="Cpha266_0006"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3464"
                     /db_xref="CDD:225995"
     misc_feature    5573..6286
                     /locus_tag="Cpha266_0006"
                     /note="Transposase; Region: DDE_Tnp_ISL3; pfam01610"
                     /db_xref="CDD:216603"
     gene            complement(6323..6733)
                     /locus_tag="Cpha266_0007"
                     /db_xref="GeneID:4568895"
     CDS             complement(6323..6733)
                     /locus_tag="Cpha266_0007"
                     /note="KEGG: spn:SP0811 transposase family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910507.1"
                     /db_xref="GI:119355863"
                     /db_xref="GeneID:4568895"
                     /translation="MFFTLTLGDSYFPKLAYSCFPITISPQDGVIDWMLGGKMDTVSM
                     GAFLRQVSHKHPEEFVMMVVDGAPSHRAEHLRVPKNMVLVKLPPYSPELNPVEHLWDE
                     LREKEFANRVFETLGAVIVGSSQNFVESPTAITS"
     misc_feature    complement(6386..>6664)
                     /locus_tag="Cpha266_0007"
                     /note="DDE superfamily endonuclease; Region: DDE_3;
                     pfam13358"
                     /db_xref="CDD:222070"
     misc_feature    complement(<6425..>6604)
                     /locus_tag="Cpha266_0007"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3335"
                     /db_xref="CDD:225872"
     gene            6781..8352
                     /locus_tag="Cpha266_0008"
                     /db_xref="GeneID:4568896"
     CDS             6781..8352
                     /locus_tag="Cpha266_0008"
                     /note="PFAM: Integrase, catalytic region;
                     KEGG: bfs:BF1534 putative transposase for insertion
                     sequence element IS21-like"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase catalytic subunit"
                     /protein_id="YP_910508.1"
                     /db_xref="GI:119355864"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="GeneID:4568896"
                     /translation="MRTQLKKLTMYNKVKEFAREGLSIRQISRKTGMDRVTVRKFLRM
                     TDEEFSAFLALQKRRLRKLQPYEQFVKDRVTDYPDCSATQVEDWLKEHHPVFPEVTTR
                     TIYSFVQWIRKAYDLPKPKGTPRAYHPVEQLPYGEQAQVDFGEYWMASADACKVKVHF
                     MIMLLSRSRRKFVSFSQQPITTRFVLEAHEQAFSFFEGIPHTLVYDQDSTIVTDENRG
                     AILYTEAFRKYLLHRSLKIHLCRKSDPESKGKIEAGVKYVKYNFLPGRRFVNLEVLNQ
                     EALLWLERTANAKEHATTRLIPDAEWQVEKQHLRPFEPLPYPISGTVGKEYHVRKDNT
                     ISYRGNFYSLPVGTYAGPGTLVVLEVRQNTLCLYAQEGRLLANHPIESGKGTVVINNN
                     HRRDTSSKLRELQDSLMLLFTNQEHAERFLESIHNRYPRYSRDQFLHVRNAISGCQQK
                     LIDDALAHCVDHHLFSSGEFHDILHHYRKQEEKQSHQAVFNTFRPKTLRSDMDRMLSF
                     VPDSSGITTYENIFS"
     misc_feature    6835..7674
                     /locus_tag="Cpha266_0008"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG4584"
                     /db_xref="CDD:226950"
     misc_feature    7249..7557
                     /locus_tag="Cpha266_0008"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:216050"
     gene            8358..9194
                     /locus_tag="Cpha266_0009"
                     /db_xref="GeneID:4568897"
     CDS             8358..9194
                     /locus_tag="Cpha266_0009"
                     /note="PFAM: IstB domain protein ATP-binding protein;
                     SMART: AAA ATPase;
                     KEGG: bfs:BF1535 insertion sequence IS21-like putative
                     ATP-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="IstB ATP binding domain-containing protein"
                     /protein_id="YP_910509.1"
                     /db_xref="GI:119355865"
                     /db_xref="InterPro:IPR002611"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="GeneID:4568897"
                     /translation="MERTITTIQEHARELNLTGLAGTVDLLLEEARKSEPSYSDFALT
                     LLESELSCRRKAHLERRRKIANLPLLHDLDHYDSGVQNGISQVQLQQLRQLLWLDQNF
                     NLILIGPSGTGKSYLAGGLCHEALKLGYHALFRTMDDLIQTIRFKEITAAAAREYKRL
                     LSAHLLVIDDIMMFPLEKSVAVGLFQLVNQLHEQTSFIITTNKSPKEWAEMLGDEVLA
                     TALLDRLLYKCEVIKLTGKSYRLEHRTTIFEQQQSPEGGGNRRKKQLPLQKGVGNHCK
                     MT"
     misc_feature    8358..9089
                     /locus_tag="Cpha266_0009"
                     /note="DNA replication protein [DNA replication,
                     recombination, and repair]; Region: DnaC; COG1484"
                     /db_xref="CDD:224401"
     misc_feature    8664..8972
                     /locus_tag="Cpha266_0009"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    8679..8702
                     /locus_tag="Cpha266_0009"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(8682..8705,8862..8864,8961..8963)
                     /locus_tag="Cpha266_0009"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    8850..8867
                     /locus_tag="Cpha266_0009"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     gene            complement(9259..9387)
                     /locus_tag="Cpha266_0010"
                     /pseudo
                     /db_xref="GeneID:4568898"
     gene            complement(9405..9935)
                     /locus_tag="Cpha266_0011"
                     /db_xref="GeneID:4568899"
     CDS             complement(9405..9935)
                     /locus_tag="Cpha266_0011"
                     /note="KEGG: pol:Bpro_3862 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910510.1"
                     /db_xref="GI:119355866"
                     /db_xref="GeneID:4568899"
                     /translation="MARPAVITDEMECLAKKIVKEANTARELRAGLSILIPKTCDITY
                     SETAELLGISVPTVVRIHRDISNQAAGKATPKGSWGGRRRQTLSLDEEARFLAEWVEK
                     AEQGGVLVVPPIHTALEQRLGKTVAVSTVYRMLARHGWRKVEPDTCHPKQNMEEQEEF
                     KKNSQRYWYKPPSKMY"
     misc_feature    complement(9519..9809)
                     /locus_tag="Cpha266_0011"
                     /note="Winged helix-turn helix; Region: HTH_29; pfam13551"
                     /db_xref="CDD:222216"
     misc_feature    complement(9447..9596)
                     /locus_tag="Cpha266_0011"
                     /note="Winged helix-turn helix; Region: HTH_33; pfam13592"
                     /db_xref="CDD:222248"
     gene            10031..10336
                     /locus_tag="Cpha266_0012"
                     /pseudo
                     /db_xref="GeneID:4568900"
     gene            complement(10369..11061)
                     /locus_tag="Cpha266_0013"
                     /db_xref="GeneID:4568901"
     CDS             complement(10369..11061)
                     /locus_tag="Cpha266_0013"
                     /note="PFAM: Rhodopirellula transposase family protein;
                     KEGG: ana:all8069 transposase unknown protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_910511.1"
                     /db_xref="GI:119355867"
                     /db_xref="InterPro:IPR011518"
                     /db_xref="GeneID:4568901"
                     /translation="MNALADGDPETLRLSIDTKATVHVGQYSRGGKSRGIKAVEAWDH
                     DMRPKEKLVPGGILEPVSGKSFLFFGSSNKTSDFLVDGLELWWNERKSELYNVKQLVI
                     NMDNGPECNGRRSQFLYRMTMFADMTGLNIRLIYYPPYHSKYNSIERYWAGLEKSWNG
                     YLLESVTTVINRAGNFAWRGIAAKARLVDTVYQKGVKLCGKDKKNLEKRLMRSPSLHW
                     WDISISPKTVFL"
     misc_feature    complement(10384..>11058)
                     /locus_tag="Cpha266_0013"
                     /note="Rhodopirellula transposase DDE domain; Region:
                     DDE_Tnp_ISAZ013; pfam07592"
                     /db_xref="CDD:148936"
     gene            complement(11058..11600)
                     /locus_tag="Cpha266_0014"
                     /db_xref="GeneID:4568902"
     CDS             complement(11058..11600)
                     /locus_tag="Cpha266_0014"
                     /note="KEGG: ana:all8069 transposase unknown protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910512.1"
                     /db_xref="GI:119355868"
                     /db_xref="GeneID:4568902"
                     /translation="MKTSVLSRNNISPEVSGLITRLVSLIPWPARRQAMGDVVVTILD
                     SKPRVAENEFGWNRSAVALGIKEFESGIVCVNDLTERHKPKSEEKHPELLEAIRKIME
                     PQSQAEPRLRTTLLYTNMTAQSVYNALLAEGWSEESLPAVRTISNILNRQNYRLRTVQ
                     KTKVEKKQQKPTPSSKTSGK"
     misc_feature    complement(<11130..11321)
                     /locus_tag="Cpha266_0014"
                     /note="Rhodopirellula transposase DDE domain; Region:
                     DDE_Tnp_ISAZ013; pfam07592"
                     /db_xref="CDD:148936"
     gene            11704..12462
                     /locus_tag="Cpha266_0015"
                     /db_xref="GeneID:4568903"
     CDS             11704..12462
                     /locus_tag="Cpha266_0015"
                     /note="PFAM: transposase, IS4 family protein;
                     KEGG: pca:Pcar_0986 ISGsu1, transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase, IS4 family protein"
                     /protein_id="YP_910513.1"
                     /db_xref="GI:119355869"
                     /db_xref="InterPro:IPR002559"
                     /db_xref="GeneID:4568903"
                     /translation="MDATVIDLCLRVFPWAEFRQRKGAIKLHYLYDHRSSLPAFMVMT
                     DGKKSDIRVARSQEKLDFHLLPDSIVSFDRAYIDFEWLYTLDQRKVWFVTRSKANIQY
                     RIIGQHQPIKNKQVTRDERIELIIEKSRAKYLKPLRLVCYTDQETGKAYEFITNNIKL
                     AASTIAAIYKSRWQIETFFRWIKQNLKIKSFQGTSQNAVLSQTWIAMCYYLRLSYIKF
                     KTKYRHSLQELTRMIAAVLIEHRLLIDISSLRSR"
     misc_feature    11704..12336
                     /locus_tag="Cpha266_0015"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:216602"
     misc_feature    <11854..12360
                     /locus_tag="Cpha266_0015"
                     /note="FOG: Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3385"
                     /db_xref="CDD:225920"
     gene            complement(12481..12588)
                     /locus_tag="Cpha266_0016"
                     /pseudo
                     /db_xref="GeneID:4568904"
     gene            12686..14092
                     /locus_tag="Cpha266_0017"
                     /db_xref="GeneID:4568905"
     CDS             12686..14092
                     /locus_tag="Cpha266_0017"
                     /note="PFAM: transposase, IS4 family protein;
                     KEGG: mes:Meso_4308 transposase, IS4"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase, IS4 family protein"
                     /protein_id="YP_910514.1"
                     /db_xref="GI:119355870"
                     /db_xref="InterPro:IPR002559"
                     /db_xref="GeneID:4568905"
                     /translation="MQLPYTNIHTDQPNQQALFPDCFEVSVAPVKGKKVVLDFQGGNA
                     TSDAGVLLLKEVESMTRIVPKLADCIADSRRTSSVMHSIPDLIAQRVYQIACGYEDGN
                     DSNSMRKDPALKMALNRLPESGDDLASQPTFSRLENMVTRPELYRMAVGFLDHFLDSY
                     TEAPRVIVLDFDDTEDVVHGKQQLALFNGYHQETCYQPLHVFEGLTGKLIASILRPGR
                     RPTGKEIVSYVKRIVRHIRSRWPETIIVYRGDSHYGVPEVYSFLAREQNCYSVTGLGG
                     NDVLLRSVKDIIEEVKKHGAGYRRYHTFQYQARSWKETRRVVAKVEMTEKGLNVRFIS
                     TDMQEAKAKTLYEQIYSARGNDELYIKAHKTFMKSDRTSCHRFLANQFRVFLHSAAYV
                     LVHAFQTNLLRGTALATATFETIRLKLLKIGAKVIEMKTRIKVHLPTSYPYKPILNKC
                     FAVLEHLRSVPWPSTAIP"
     misc_feature    12764..14068
                     /locus_tag="Cpha266_0017"
                     /note="Transposase DDE domain group 1; Region:
                     DDE_Tnp_1_4; pfam13701"
                     /db_xref="CDD:222326"
     gene            complement(14359..15489)
                     /locus_tag="Cpha266_0018"
                     /db_xref="GeneID:4568906"
     CDS             complement(14359..15489)
                     /locus_tag="Cpha266_0018"
                     /note="PFAM: Rhodopirellula transposase family protein;
                     KEGG: eba:ebA5952 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_910515.1"
                     /db_xref="GI:119355871"
                     /db_xref="InterPro:IPR011518"
                     /db_xref="GeneID:4568906"
                     /translation="MDIHDDDIDLIRIRFEKIEWALDERMRRLFAANEAYALGHGGVT
                     KVSQATGVSRRAIHVGLDELVAAKPPVPEQEKRIRKVGGGRKSITKTESGVLIALEQL
                     VEPTTRGDPESPLRWTCKSLRTISEELARQGFKVSYPKVADLLRELGYSLQANRKTLE
                     GADHPDRNAQFELINTQTKETIAGGNPVISVDTKKKELVGAFKNNGTNWRPQGEPEEV
                     KVHDFIDKDLGRANPYGVYDIGSNTGWVSVGTDHDTASFAVETIRRWWYTMGKPRYAD
                     ATKIMITADGGGSNGSKVRLWKLELQKLADELRMSIHVSHLPPGTSKWNKIEHRLFSY
                     ISMNWRGQPLISHEVIVNLIAGTTTKAGLKVYSELDDTTYPE"
     misc_feature    complement(14365..15198)
                     /locus_tag="Cpha266_0018"
                     /note="Rhodopirellula transposase DDE domain; Region:
                     DDE_Tnp_ISAZ013; pfam07592"
                     /db_xref="CDD:148936"
     gene            16159..17565
                     /locus_tag="Cpha266_0019"
                     /db_xref="GeneID:4568907"
     CDS             16159..17565
                     /locus_tag="Cpha266_0019"
                     /note="PFAM: transposase, IS4 family protein;
                     KEGG: mes:Meso_4308 transposase, IS4"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase, IS4 family protein"
                     /protein_id="YP_910516.1"
                     /db_xref="GI:119355872"
                     /db_xref="InterPro:IPR002559"
                     /db_xref="GeneID:4568907"
                     /translation="MQLPYTNIHTDQPNQQALFPDCFEVSVAPVKGKKVVLDFQGGNA
                     TSDAGVLLLKEVESMTRIVPKLADCIADSRRTSSVMHSIPDLIAQRVYQIACGYEDGN
                     DSNSMRKDPALKMALNRLPESGDDLASQPTFSRLENMVTRPELYRMAVGFLDHFLDSY
                     TEAPRVIVLDFDDTEDVVHGKQQLALFNGYHQETCYQPLHVFEGLTGKLIASILRPGR
                     RPTGKEIVSYVKRIVRHIRSRWPETIIVYRGDSHYGVPEVYSFLAREQNCYSVTGLGG
                     NDVLLRSVKDIIEEVKKHGAGYRRYHTFQYQARSWKETRRVVAKVEMTEKGLNVRFIS
                     TDMQEAKAKTLYEQIYSARGNDELYIKAHKTFMKSDRTSCHRFLANQFRVFLHSAAYV
                     LVHAFQTNLLRGTALATATFETIRLKLLKIGAKVIEMKTRIKVHLPTSYPYKPILNKC
                     FAVLEHLRSVPWPSTAIP"
     misc_feature    16237..17541
                     /locus_tag="Cpha266_0019"
                     /note="Transposase DDE domain group 1; Region:
                     DDE_Tnp_1_4; pfam13701"
                     /db_xref="CDD:222326"
     gene            17769..18017
                     /locus_tag="Cpha266_0020"
                     /db_xref="GeneID:4568908"
     CDS             17769..18017
                     /locus_tag="Cpha266_0020"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910517.1"
                     /db_xref="GI:119355873"
                     /db_xref="GeneID:4568908"
                     /translation="MASPMAGSFLARDASLLQSHELFRLGREVWIYDKISSDRVYSSG
                     GLFIATGASSTSQKTLTIVIKFDDNRKVREFAYHTSRF"
     gene            18030..18560
                     /locus_tag="Cpha266_0021"
                     /db_xref="GeneID:4568909"
     CDS             18030..18560
                     /locus_tag="Cpha266_0021"
                     /note="KEGG: bur:Bcep18194_B0172 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910518.1"
                     /db_xref="GI:119355874"
                     /db_xref="InterPro:IPR000437"
                     /db_xref="GeneID:4568909"
                     /translation="MKKIRTLLVLSMLLATGCQSTIPKDALVLNNESLATRQLQTRKY
                     QTKDEAKVLSSVAGVLQDLGFNLNESHSALGVISASKTRSAVNAGQQILAVTFALLGG
                     GVSATDDHQVMTASVVTKPVGEKSDYVAVRVTFQRLVYNTNGQVSKAESLQDSEIYQG
                     FFEKLSKSIFLEAQEI"
     sig_peptide     18030..18092
                     /locus_tag="Cpha266_0021"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 0.997) with cleavage site probability 0.870 at
                     residue 21"
     gene            complement(19639..19869)
                     /locus_tag="Cpha266_0022"
                     /pseudo
                     /db_xref="GeneID:4568910"
     gene            complement(19873..20707)
                     /locus_tag="Cpha266_0023"
                     /pseudo
                     /db_xref="GeneID:4568911"
     gene            complement(20845..22209)
                     /locus_tag="Cpha266_0024"
                     /db_xref="GeneID:4568912"
     CDS             complement(20845..22209)
                     /locus_tag="Cpha266_0024"
                     /note="KEGG: eba:ebA562 transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_910519.1"
                     /db_xref="GI:119355875"
                     /db_xref="GeneID:4568912"
                     /translation="MRKSKKAATMSLVHPNAAGIDIGSQFHDVAIPPDRAEETVKSFK
                     SFTGDLHAMAKWLTACRIDTIAMESTGVYWIPAFEILENYGFKVFLVNAREAKNVPGR
                     KTDSNDAQWLQKLHQLGLLRASFQPTSVIAELRAYLRQREKLLDYKAAHIQHMQKALM
                     QMNIQLHHVVSTITGKTGMDIIRAIVAGNRNPQELVKFRDVRCKNSIETMTAALTGNF
                     KPEHIFALMQSLELYDIYNEKAEACDREIQAVLDRLQQNSIPPDQPLPKAKYRECNKN
                     APAFDVRQTLFNIIGVDLTQITGLGSYLALKLVSECGADMSKWPTDKHFTSWLCLSPG
                     NKISGGKILSSRTRPSSSRAAALLRLAATAIGRTETALGAFYRRLATRTGKAKAVTAT
                     ARKIAVLFYNTLRYGMRYVDPGADYYEEQYKARILGQLRRRADSYGFSLQPMEIPDTA
                     IGVS"
     sig_peptide     complement(22153..22209)
                     /locus_tag="Cpha266_0024"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 0.721) with cleavage site probability 0.381 at
                     residue 19"
     misc_feature    complement(21748..22158)
                     /locus_tag="Cpha266_0024"
                     /note="Transposase; Region: DEDD_Tnp_IS110; pfam01548"
                     /db_xref="CDD:216564"
     misc_feature    complement(<21184..21330)
                     /locus_tag="Cpha266_0024"
                     /note="Transposase IS116/IS110/IS902 family; Region:
                     Transposase_20; pfam02371"
                     /db_xref="CDD:217002"
     gene            complement(22578..22913)
                     /locus_tag="Cpha266_0025"
                     /pseudo
                     /db_xref="GeneID:4568913"
     gene            complement(23043..24266)
                     /locus_tag="Cpha266_0026"
                     /db_xref="GeneID:4568914"
     CDS             complement(23043..24266)
                     /locus_tag="Cpha266_0026"
                     /note="PFAM: beta-lactamase domain protein;
                     flavodoxin/nitric oxide synthase;
                     KEGG: cte:CT2285 rubredoxin:oxygen oxidoreductase,
                     putative"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase domain-containing protein"
                     /protein_id="YP_910520.1"
                     /db_xref="GI:119355876"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="GeneID:4568914"
                     /translation="MIDNKILPVTQDVTWIGVLDPGLITFDIVMETKYGTTYNSYFIN
                     ADKKTIVETTKEKFWPIYLDKIKQVTNPEEIEYIIVDHTEPDHSGNVRNLLSVAPHAT
                     VVGSGNALKFLRDQTGHDFKSLVVKTGDTLDLGNKTLHFINAPNLHWPDTIYTWLEED
                     RVLFTCDSFGSHFCHEGMYDDAVGDFDDAFTYYYDAILRPFSKYMLQAIEKIAPLDIK
                     IICPGHGPILRSNWKKYVDLSHRLATKAIALPNEKNILIAYVSAYENTAVLAEKIAEG
                     LRESCDFTIEICDIENIHFSKLEDKLAHCYGLIVGSPTINQNILLQIYNLFAAINPIR
                     DKGKLAAAFGSYGWSGEGVKMIETNLSMLKLKVFDQNVMVKFKPHEAEFEKCRLFGKS
                     FADKMIEMFQLSCNL"
     misc_feature    complement(23082..24254)
                     /locus_tag="Cpha266_0026"
                     /note="Uncharacterized flavoproteins [Energy production
                     and conversion]; Region: FpaA; COG0426"
                     /db_xref="CDD:223503"
     misc_feature    complement(23595..24152)
                     /locus_tag="Cpha266_0026"
                     /note="Metallo-beta-lactamase superfamily; Region:
                     Lactamase_B; smart00849"
                     /db_xref="CDD:214854"
     misc_feature    complement(23085..23504)
                     /locus_tag="Cpha266_0026"
                     /note="Flavodoxin-like fold; Region: Flavodoxin_2;
                     cl00438"
                     /db_xref="CDD:241863"
     gene            complement(24550..26940)
                     /locus_tag="Cpha266_0027"
                     /db_xref="GeneID:4568915"
     CDS             complement(24550..26940)
                     /locus_tag="Cpha266_0027"
                     /note="PFAM: DNA polymerase B, exonuclease; DNA polymerase
                     B region;
                     SMART: DNA-directed DNA polymerase B;
                     KEGG: plt:Plut_0005 DNA-directed DNA polymerase B"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase B region"
                     /protein_id="YP_910521.1"
                     /db_xref="GI:119355877"
                     /db_xref="InterPro:IPR006133"
                     /db_xref="InterPro:IPR006134"
                     /db_xref="InterPro:IPR006172"
                     /db_xref="GeneID:4568915"
                     /translation="MDTLSHEILNNDLLFGKDKEENIVGAYQLSDTHIRLFFRNDEKI
                     SHRDEPFYPYFFLSESSLLEGFVPEENRKYWIIKLNGNNFYRFLAIFSSWKDFRSGLD
                     IINGKNRAASPEADTTNPAPSFIPLTYSKGDAVTQYFFQSGKTLFKGLDFSRLRRMQL
                     DIETCYDPDKKRTGSGIGDDEIIIVSLSDNTGWEQVIHSKNRGEKKLLEHLVEIIIAR
                     DPDVIEGHNIFSFDLPYIQKRCDRHNINFAIGRNGTTVRSYPSSIRFAERIIDYPYFE
                     IPGRHVIDTLFLVQGYDVSKRAMQSYGLKAVAKYFGFASPDRTYVEYKDIISTWENNP
                     DKLLAYALDDVRETRALASHLSGSNYYLSRMMPYTYAMTSRLGQAAKIEALFIREYLR
                     QKHSIPKPSSGQQHSGGYTEVFLKGILGPIVYADVESLYPSIMLTCGICPKTDDLRVF
                     PSVLGNLKDLRFKTKKLSGEEKQKGNLQMADNFDAMQGSFKILINAMYGYLGFNNGIF
                     NDFDEADKVTTTGQGIAKKMIHEFEARGCKVIEVDTDGILFVPPPGIVTENEERTLVR
                     EVSSLMPEGINIGYDGRYKKMISYMKKNYALLDDDNVMIVKGSSLTSRSSEKFGRDFV
                     KRGFEKLLSEDIAGLHDLYTEYKEKILAHALDIGDFSRTETLKSTMEQYLEDVRSGRR
                     SKSVTYEIALKNGKQVTKGERITYYISGTGGINQTFEKGKLASDWKKDNPDDNTVFYL
                     KRLDEHCQKFLPFFKPQDYSSIFSSDTLFSFTPEGIELIKEIIHTDTDTTGSAGLY"
     misc_feature    complement(25882..26502)
                     /locus_tag="Cpha266_0027"
                     /note="Uncharacterized bacterial subgroup of the DEDDy
                     3'-5' exonuclease domain of family-B DNA polymerases;
                     Region: DNA_polB_like2_exo; cd05785"
                     /db_xref="CDD:99828"
     misc_feature    complement(25300..26478)
                     /locus_tag="Cpha266_0027"
                     /note="DNA polymerase type-B family; Region: POLBc;
                     smart00486"
                     /db_xref="CDD:214691"
     misc_feature    complement(order(25909..25911,25921..25923,26029..26034,
                     26245..26253,26260..26265,26449..26460))
                     /locus_tag="Cpha266_0027"
                     /note="active site"
                     /db_xref="CDD:99828"
     misc_feature    complement(order(25909..25911,25921..25923,26245..26247,
                     26452..26454,26458..26460))
                     /locus_tag="Cpha266_0027"
                     /note="catalytic site [active]"
                     /db_xref="CDD:99828"
     misc_feature    complement(order(25909..25911,25921..25923,26029..26034,
                     26248..26253,26260..26265,26449..26457))
                     /locus_tag="Cpha266_0027"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:99828"
     misc_feature    complement(24682..25731)
                     /locus_tag="Cpha266_0027"
                     /note="DNA polymerase type-II B subfamily catalytic
                     domain. Bacteria contain five DNA polymerases (I, II, III,
                     IV and V). DNA polymerase II (Pol II) is a prototype for
                     the B-family of polymerases. The role of Pol II in a
                     variety of cellular activities, such as...; Region:
                     POLBc_Pol_II_B; cd05538"
                     /db_xref="CDD:99921"
     misc_feature    complement(order(25306..25308,25456..25458,25468..25470,
                     25558..25560,25648..25656,25663..25665))
                     /locus_tag="Cpha266_0027"
                     /note="active site"
                     /db_xref="CDD:99921"
     misc_feature    complement(order(25306..25308,25312..25314))
                     /locus_tag="Cpha266_0027"
                     /note="metal-binding site"
                     /db_xref="CDD:99921"
     gene            complement(27338..29203)
                     /locus_tag="Cpha266_0028"
                     /gene_synonym="gidA"
                     /db_xref="GeneID:4568916"
     CDS             complement(27338..29203)
                     /locus_tag="Cpha266_0028"
                     /gene_synonym="gidA"
                     /note="GidA; glucose-inhibited cell division protein A;
                     involved in the 5-carboxymethylaminomethyl modification
                     (mnm(5)s(2)U) of the wobble uridine base in some tRNAs"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA uridine 5-carboxymethylaminomethyl
                     modification protein GidA"
                     /protein_id="YP_910522.1"
                     /db_xref="GI:119355878"
                     /db_xref="InterPro:IPR002218"
                     /db_xref="InterPro:IPR004416"
                     /db_xref="GeneID:4568916"
                     /translation="MYDIIVAGAGHAGCEAVLAAARTGMSCLLITSDLSAIARMSCNP
                     AIGGVAKGQITREIDALGGEMAKAIDETGIQFRMLNKSKGAAMHSPRAQADRALYSVY
                     MRKIIEEQDNIDLVQDTVTGLDVESGAVRGAILPSGRIIKGKSVILCCGTFLNGLIHI
                     GMNHFPGGRTIAEPPVSGLTENLQSLGFRAGRLKTGTPPRIDSRSVNYSLVEEQSGDP
                     DPRPFSFHTDSLGHRAQVSCFVTKTKETTHELLRTGFSRSPLFSGKVQGVGPRYCPSV
                     EDKIFRFPDKNSHHIFLEPEGAETNEMYVNGFSTSLPEDIQLLALRSIPGLEHVKMIR
                     PGYAIEYDFFFPYQIKNTLETKIIENLYFAGQINGTSGYEEAAAQGLMAGINASLKIQ
                     NRKPFVLDRSQAYIGVLIDDLVTKDIIEPYRMFTSSAEHRISLRHDNADIRLCRMGHE
                     AGTVDFSSFTKTEYKISAIRQLRQLCDTMKLHPDQIISAMAGAAQQPPLQPIAISNLL
                     KRPEIDFENLLVLSEDFRAGVNEITTDPDVFEQVVIDLKYEGYLKRDLLMTEKIARLE
                     SHSIPGSFSYATVSGLSNEGREKLTLHKPETIGQASRIPGVSPSDISVLLIKIGR"
     misc_feature    complement(27341..29203)
                     /locus_tag="Cpha266_0028"
                     /gene_synonym="gidA"
                     /note="tRNA uridine 5-carboxymethylaminomethyl
                     modification enzyme GidA; Validated; Region: PRK05192"
                     /db_xref="CDD:235362"
     misc_feature    complement(28745..>28918)
                     /locus_tag="Cpha266_0028"
                     /gene_synonym="gidA"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl17500"
                     /db_xref="CDD:248054"
     misc_feature    complement(27974..>28285)
                     /locus_tag="Cpha266_0028"
                     /gene_synonym="gidA"
                     /note="tRNA (uracil-5-)-methyltransferase Gid; Reviewed;
                     Region: PRK05335"
                     /db_xref="CDD:235416"
     misc_feature    complement(27353..27565)
                     /locus_tag="Cpha266_0028"
                     /gene_synonym="gidA"
                     /note="GidA associated domain 3; Region: GIDA_assoc_3;
                     pfam13932"
                     /db_xref="CDD:206103"
     gene            29664..30065
                     /locus_tag="Cpha266_0029"
                     /db_xref="GeneID:4568917"
     CDS             29664..30065
                     /locus_tag="Cpha266_0029"
                     /note="KEGG: cch:Cag_1923 twin-arginine translocation
                     pathway signal"
                     /codon_start=1
                     /transl_table=11
                     /product="thiosulfate-binding protein SoxY"
                     /protein_id="YP_910523.1"
                     /db_xref="GI:119355879"
                     /db_xref="GeneID:4568917"
                     /translation="MAASISMMPSRLFAAWCEKCFSPCPIDNAFINTLGTRDFVQTDK
                     ITIVAPQVASDSSLVPVEIISSIKAERLYLFVEKNISPLVFQCTLYGSAEPYVSLNVK
                     LKESSLVYAVLKEGSRYYRASVHINVLAQAC"
     misc_feature    29748..30062
                     /locus_tag="Cpha266_0029"
                     /note="Sulfur oxidation protein SoxY; Region: SoxY;
                     pfam13501"
                     /db_xref="CDD:222179"
     gene            30107..30403
                     /locus_tag="Cpha266_0030"
                     /db_xref="GeneID:4568918"
     CDS             30107..30403
                     /locus_tag="Cpha266_0030"
                     /note="KEGG: cte:CT1018 sulfur oxidation protein SoxZ"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfur oxidation protein SoxZ"
                     /protein_id="YP_910524.1"
                     /db_xref="GI:119355880"
                     /db_xref="GeneID:4568918"
                     /translation="MRVLARELNGIVLLKIIIEHPSESGTRKDEQGNVIPAHFIREGR
                     IALNGAPLFDLDLGPSVSRDPFFQLKFAGKKGDQIKLEFTDSKFQEFSADCVVT"
     misc_feature    30107..30397
                     /locus_tag="Cpha266_0030"
                     /note="Sulphur oxidation protein SoxZ; Region: SoxZ;
                     pfam08770"
                     /db_xref="CDD:220011"
     gene            30479..30859
                     /locus_tag="Cpha266_0031"
                     /db_xref="GeneID:4568919"
     CDS             30479..30859
                     /locus_tag="Cpha266_0031"
                     /EC_number="1.-.-.-"
                     /note="PFAM: cytochrome c, class I;
                     KEGG: cch:Cag_2005 sulfide dehydrogenase, cytochrome
                     subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfide dehydrogenase (flavocytochrome),
                     cytochrome c subunit"
                     /protein_id="YP_910525.1"
                     /db_xref="GI:119355881"
                     /db_xref="InterPro:IPR003088"
                     /db_xref="InterPro:IPR008169"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="GeneID:4568919"
                     /translation="MQAKLRLWLTFCVVTPVLLLFGNAGLAEQTPAPKVLKPVTSKAV
                     GVTPRGQVLSLSCSSCHGTDGKSVGIMPSFYGKTPQYIETALLEFKSGKRYSTVMGRH
                     AKGYSDDEIHLIAQYCGIKGQKTK"
     sig_peptide     30479..30562
                     /locus_tag="Cpha266_0031"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 0.995) with cleavage site probability 0.855 at
                     residue 28"
     misc_feature    30536..30829
                     /locus_tag="Cpha266_0031"
                     /note="Cytochrome c, mono- and diheme variants [Energy
                     production and conversion]; Region: CccA; COG2010"
                     /db_xref="CDD:224921"
     misc_feature    30581..>30829
                     /locus_tag="Cpha266_0031"
                     /note="Cytochrome c; Region: Cytochrom_C; cl11414"
                     /db_xref="CDD:245607"
     gene            30874..32166
                     /locus_tag="Cpha266_0032"
                     /db_xref="GeneID:4568920"
     CDS             30874..32166
                     /locus_tag="Cpha266_0032"
                     /EC_number="1.-.-.-"
                     /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
                     oxidoreductase;
                     KEGG: cch:Cag_2004 sulfide dehydrogenase, flavoprotein
                     subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfide dehydrogenase (flavocytochrome),
                     flavoprotein subunit"
                     /protein_id="YP_910526.1"
                     /db_xref="GI:119355882"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="GeneID:4568920"
                     /translation="MSNKLSRRDFNKLLVSGVAGSAFGVFGGASSAFAAKNRVVVIGG
                     GFGGAAAAKYLKKLDPTLSVTLIEPKETFYTCPFSNWVLGGLKTMEDIGQTYTVLKTR
                     YGIDVVVDAAAGVDASKNAVTLKSGRVIKYDRLIVSPGIDFKWKAIEGYSQAVSETKM
                     PHAYQGGAQTILLHKQLLAMPDGGRVIITAPGNPFRCPPGPYERASLIANYLKKNKPK
                     SKIIILDAKDKFSKQALFRKGWEKLYPGMIEWRGSTTGGKISMVDGAAMTVTTEFGVE
                     KGDVINVIAPQQAGKIAFDCGLTDASGWCPVNPITFESTMHPGIHVIGDACIAGAMPK
                     SGFAASSHGKVAAASIIRLFQGKVPAPPSLVNTCYSLLAPGYGISVAGVYKLSAEGIV
                     EIPGSGGLTPLDADEEKLGEEATFAQGWYNNIAQDIWG"
     sig_peptide     30874..30978
                     /locus_tag="Cpha266_0032"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 1.000) with cleavage site probability 0.991 at
                     residue 35"
     misc_feature    30988..32082
                     /locus_tag="Cpha266_0032"
                     /note="Uncharacterized NAD(FAD)-dependent dehydrogenases
                     [General function prediction only]; Region: HcaD; COG0446"
                     /db_xref="CDD:223523"
     misc_feature    31948..32163
                     /locus_tag="Cpha266_0032"
                     /note="Flavocytochrome c sulphide dehydrogenase,
                     flavin-binding; Region: FCSD-flav_bind; pfam09242"
                     /db_xref="CDD:204176"
     gene            32395..34254
                     /gene="secD"
                     /locus_tag="Cpha266_0033"
                     /db_xref="GeneID:4568921"
     CDS             32395..34254
                     /gene="secD"
                     /locus_tag="Cpha266_0033"
                     /note="part of the preprotein secretory system; when
                     complexed with proteins SecF and YajC, SecDFyajC
                     stimulates the proton motive force-driven protein
                     translocation, and appears to be required for the release
                     of mature proteins from the extracytoplasmic side of the
                     membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecD"
                     /protein_id="YP_910527.1"
                     /db_xref="GI:119355883"
                     /db_xref="InterPro:IPR001036"
                     /db_xref="InterPro:IPR003335"
                     /db_xref="InterPro:IPR005791"
                     /db_xref="GeneID:4568921"
                     /translation="MKNKQFPLFLLLAVTAISLWSLWPTWRDYSLTKQIERFSSSEDS
                     LKFSLAHRDEIENARRKSLKLGLDLKGGMHLVMEVDQIDLFMQKAWNKDARFFELMDK
                     VKQKSVTSDARVIDLIVNEFTKENIRLSRYFYDIRNSDKEIVGKLEKESEDALLRAKE
                     IIRNRIDQYGVAEPVITTQGSRRIIIELAGVSDENRVRNLLKGTAKLEFKLLRDPDML
                     LRALDRVNSALVQASVQKPVVPDSLAVKDSAATASPAVAPPLDATASKQAKTAGPLYD
                     VIGVLPNGTVFTPEQSREFVLTLLQRADVQALLPQDSELLLSAKPEVGEKGEKYYPIY
                     LVKKTAELTGGVITEAKATFGSEGVQPEVMMSMNSDGTGKWARITGANIGKRIAIVLD
                     GAVYSAPVVQSKIPNGNSVINGIESLEEAKDLEIVLKAGALPAPVRIMEERTVGPSLG
                     ADYIRAGMLSLLWGFCAVSIFMLVYYRKAGIAADIALLLNILIVLSVLAGFNASLSLP
                     GIAGIVLTMGMAVDANVLIYERIREELDEGKPLKSAITLGYDRAFSSILDSHVTTLSA
                     AFLLYTYGIGPIQGFALTLMIGTAASLFTAIVVTREIFTILLGRNMMTEKSFG"
     sig_peptide     32395..32460
                     /gene="secD"
                     /locus_tag="Cpha266_0033"
                     /product="preprotein translocase subunit SecD"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 0.987) with cleavage site probability 0.976 at
                     residue 22"
     misc_feature    <33409..34224
                     /gene="secD"
                     /locus_tag="Cpha266_0033"
                     /note="preprotein translocase subunit SecD; Reviewed;
                     Region: secD; PRK05812"
                     /db_xref="CDD:235615"
     misc_feature    33502..34185
                     /gene="secD"
                     /locus_tag="Cpha266_0033"
                     /note="protein-export membrane protein, SecD/SecF family;
                     Region: 2A0604s01; TIGR00916"
                     /db_xref="CDD:233183"
     gene            34277..35212
                     /gene="secF"
                     /locus_tag="Cpha266_0034"
                     /db_xref="GeneID:4568922"
     CDS             34277..35212
                     /gene="secF"
                     /locus_tag="Cpha266_0034"
                     /note="forms a complex with SecD and YajC; SecDFyajC
                     stimulates the proton motive force-driven protein
                     translocation; seems to modulate the cycling of SecA by
                     stabilizing its membrane-inserted state and appears to be
                     required for the release of mature proteins from the
                     extracytoplasmic side of the membrane; in some organisms,
                     such as Bacillus subtilis, SecD is fused to SecF"
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecF"
                     /protein_id="YP_910528.1"
                     /db_xref="GI:119355884"
                     /db_xref="InterPro:IPR000731"
                     /db_xref="InterPro:IPR003335"
                     /db_xref="InterPro:IPR005665"
                     /db_xref="GeneID:4568922"
                     /translation="MRIFHKTSFDFIKYRKISYAISVFLLLIGIGSLFVKGLNYGIDF
                     RGGSEVLIRFEKNIDVAAVRSVLDNTGMSGTLKQYGLDRSFLFSTAFNGQTNELKSLI
                     SNSLNDRLKGNPHEIVRIDAVGPSIASDLKWSALKALLAALLAILLYVGIRFEIKFAT
                     AGVVAIFHDIFVVLGLFSLLGGVFDFMPLELDQSIIAAFLTIAGYSITDTVVVYDRIR
                     ERIRGQKPADYERIFNESMNQTLSRTIITSGTLLISVLVLFVFAGPAIRGFAFAVFMG
                     VFIGTYSSIFVAAPIVYDWLKLTKSSVKLRGGSAS"
     sig_peptide     34277..34384
                     /gene="secF"
                     /locus_tag="Cpha266_0034"
                     /product="preprotein translocase subunit SecF"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 0.964) with cleavage site probability 0.841 at
                     residue 36"
     misc_feature    34292..35161
                     /gene="secF"
                     /locus_tag="Cpha266_0034"
                     /note="preprotein translocase subunit SecF; Reviewed;
                     Region: secF; PRK13022"
                     /db_xref="CDD:237275"
     misc_feature    34370..34456
                     /gene="secF"
                     /locus_tag="Cpha266_0034"
                     /note="SecD/SecF GG Motif; Region: Sec_GG; pfam07549"
                     /db_xref="CDD:219463"
     misc_feature    34622..35167
                     /gene="secF"
                     /locus_tag="Cpha266_0034"
                     /note="Protein export membrane protein; Region: SecD_SecF;
                     pfam02355"
                     /db_xref="CDD:216990"
     gene            35469..36785
                     /locus_tag="Cpha266_0035"
                     /db_xref="GeneID:4568923"
     CDS             35469..36785
                     /locus_tag="Cpha266_0035"
                     /note="PFAM: PpiC-type peptidyl-prolyl cis-trans
                     isomerase;
                     KEGG: cte:CT2264 peptidyl-prolyl cis-trans isomerase SurA"
                     /codon_start=1
                     /transl_table=11
                     /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
                     /protein_id="YP_910529.1"
                     /db_xref="GI:119355885"
                     /db_xref="InterPro:IPR000297"
                     /db_xref="GeneID:4568923"
                     /translation="MKKMLTAAVFVMLVAFSFTLGNLHADVADRIVAVVGNEVILKSE
                     IDDRALMTVMQYPETQKDTRLKEKILAGIIDQKVILVKARIDSTQVDESTLDALTNER
                     LKMLASRFASKEAMEEKFGKSMGVIRQEIRNELKDQQLIETLRKKQLAGITVTHEETV
                     DFYRNHKQQLPQVSELVGLSQILKYPDLPQGSKDAALAQMKIVQAELKAGADFAATAR
                     KYSQDPGSAKLGGDLGYVQKGELVRSFEDAAFLLKDGKISDIVETRYGYHIIQRLEKK
                     PNAVHLRHILIAYDQSKTDEPGTVQLLSRIKSDVLAGRATFADMAKKYSDDPVSGKLG
                     GVILSGGSGKTLLPVASLRPQMMQIVGSLRNIGDISDPQKIDFQKGNLFYGIFQLNAK
                     IPVHQLNLEQDYASLEELALEAKKQERYNEWLSQLKKEVLVRISDI"
     sig_peptide     35469..35546
                     /locus_tag="Cpha266_0035"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 1.000) with cleavage site probability 0.999 at
                     residue 26"
     misc_feature    35553..35873
                     /locus_tag="Cpha266_0035"
                     /note="SurA N-terminal domain; Region: SurA_N; pfam09312"
                     /db_xref="CDD:150092"
     misc_feature    36033..36290
                     /locus_tag="Cpha266_0035"
                     /note="PPIC-type PPIASE domain; Region: Rotamase;
                     pfam00639"
                     /db_xref="CDD:216038"
     misc_feature    36267..>36473
                     /locus_tag="Cpha266_0035"
                     /note="PPIC-type PPIASE domain; Region: Rotamase_3;
                     pfam13616"
                     /db_xref="CDD:222266"
     gene            complement(36774..38705)
                     /locus_tag="Cpha266_0036"
                     /db_xref="GeneID:4568924"
     CDS             complement(36774..38705)
                     /locus_tag="Cpha266_0036"
                     /EC_number="5.99.1.3"
                     /note="KEGG: plt:Plut_0010 DNA gyrase, B subunit;
                     TIGRFAM: DNA gyrase, B subunit;
                     PFAM: DNA gyrase, subunit B domain protein; ATP-binding
                     region, ATPase domain protein domain protein; TOPRIM
                     domain protein; DNA topoisomerase, type IIA, subunit B,
                     region 2 domain protein;
                     SMART: DNA topoisomerase II"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit B"
                     /protein_id="YP_910530.1"
                     /db_xref="GI:119355886"
                     /db_xref="InterPro:IPR000565"
                     /db_xref="InterPro:IPR001241"
                     /db_xref="InterPro:IPR002288"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR006171"
                     /db_xref="InterPro:IPR011557"
                     /db_xref="InterPro:IPR011558"
                     /db_xref="InterPro:IPR013506"
                     /db_xref="GeneID:4568924"
                     /translation="MQETVPQAPSPYIASNIQILDGIEHVRKRPAMYIGDIHTRGLHH
                     LIYEIVDNSIDETLGGFNEYIFVSLNPDGSVTVIDHGRGIPVDIHPQKQKSALELVMT
                     VIGAGGKFDKGSYKVSGGLHGVGASVVNALSEWCEVEVYRDGKAYFQRFERGVPQGNV
                     REIGLSDQKGTKTTFKPDNLIFKTTEFRKDIIIDRMRELAFLNKNLSITVQDADGAQE
                     IFHYEGGLKEFVRFTDINRLSLIKEPIYFIGERDTTIVEIALQYNDSYQENVFSYVNN
                     INTHEGGTHVTGFRKALTRTLNLYAQKNDLLKNLKLSLTGDDFKEGLTAVISVKVEEP
                     QFEGQTKTKLGNSETQSIVESIVNELLSEFAESNPNVIKMIIEKVKGAAMSREAARKA
                     KELTRRKSVLESSGLPGKLADCSINDPEHCELYIVEGDSAGGSAKQGRDRSFQAILPL
                     KGKILNVEKARLHKMLENEEIKTIILALGTSFGEEEFSPEKLRYGKIIIMTDADVDGA
                     HIRTLLLTFFFRYMRSLIEAGKVYIAQPPLYLVKSGKDQQYAWDDEERNSITDTLKKM
                     QKGKANIHIQRYKGLGEMNPEQLWSTTMDPAHRSLLQVSVENAREADQIFSTLMGDKV
                     EPRREFIEKNARYVRRLDV"
     misc_feature    complement(36777..38687)
                     /locus_tag="Cpha266_0036"
                     /note="DNA gyrase subunit B; Validated; Region: gyrB;
                     PRK05644"
                     /db_xref="CDD:235542"
     misc_feature    complement(38262..38582)
                     /locus_tag="Cpha266_0036"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(38262..38264,38268..38273,38286..38288,
                     38292..38294,38328..38339,38454..38459,38463..38465,
                     38469..38471,38475..38477,38541..38543,38550..38552,
                     38562..38564))
                     /locus_tag="Cpha266_0036"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(38550..38552)
                     /locus_tag="Cpha266_0036"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(38331..38333,38337..38339,38457..38459,
                     38463..38465))
                     /locus_tag="Cpha266_0036"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(37521..38036)
                     /locus_tag="Cpha266_0036"
                     /note="TopoIIA_Trans_DNA_gyrase: Transducer domain, having
                     a ribosomal S5 domain 2-like fold, of the type found in
                     proteins of the type IIA family of DNA topoisomerases
                     similar to the B subunits of E. coli DNA gyrase and E.
                     coli Topoisomerase IV which are; Region:
                     TopoII_Trans_DNA_gyrase; cd00822"
                     /db_xref="CDD:238419"
     misc_feature    complement(37881..37883)
                     /locus_tag="Cpha266_0036"
                     /note="anchoring element; other site"
                     /db_xref="CDD:238419"
     misc_feature    complement(order(37527..37529,37539..37541,37551..37556,
                     37689..37691,37695..37700,37707..37709))
                     /locus_tag="Cpha266_0036"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    complement(order(37683..37685,37689..37691))
                     /locus_tag="Cpha266_0036"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    complement(37098..37442)
                     /locus_tag="Cpha266_0036"
                     /note="TOPRIM_TopoIIA_GyrB: topoisomerase-primase (TOPRIM)
                     nucleotidyl transferase/hydrolase domain of the type found
                     in proteins of the type IIA family of DNA topoisomerases
                     similar to the Escherichia coli GyrB subunit. TopoIIA
                     enzymes cut both strands of the...; Region:
                     TOPRIM_TopoIIA_GyrB; cd03366"
                     /db_xref="CDD:173786"
     misc_feature    complement(order(37188..37190,37194..37196,37200..37202,
                     37410..37412,37419..37424))
                     /locus_tag="Cpha266_0036"
                     /note="active site"
                     /db_xref="CDD:173786"
     misc_feature    complement(order(37200..37202,37422..37424))
                     /locus_tag="Cpha266_0036"
                     /note="putative metal-binding site [ion binding]; other
                     site"
                     /db_xref="CDD:173786"
     misc_feature    complement(36810..37004)
                     /locus_tag="Cpha266_0036"
                     /note="DNA gyrase B subunit, carboxyl terminus; Region:
                     DNA_gyraseB_C; pfam00986"
                     /db_xref="CDD:201537"
     gene            complement(38787..39170)
                     /locus_tag="Cpha266_0037"
                     /db_xref="GeneID:4568925"
     CDS             complement(38787..39170)
                     /locus_tag="Cpha266_0037"
                     /note="PFAM: protein of unknown function UPF0102;
                     KEGG: cte:CT2262 predicted endonuclease"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910531.1"
                     /db_xref="GI:119355887"
                     /db_xref="InterPro:IPR003509"
                     /db_xref="GeneID:4568925"
                     /translation="MSSDPHMLGIQGEQIAAAYLSRHGYRIIQRNYRYRRNEIDIIAK
                     KHATICFIEVKTRASLEKGHPSEAVTPKKQKEIIKAAKSYLFSLGTDRCECRFDVIAI
                     LVRSMKQEEIGLYDLDHFTDAFQAE"
     misc_feature    complement(38793..39170)
                     /locus_tag="Cpha266_0037"
                     /note="hypothetical protein; Reviewed; Region: PRK12497"
                     /db_xref="CDD:237119"
     gene            complement(39180..39797)
                     /gene="rnhB"
                     /locus_tag="Cpha266_0038"
                     /db_xref="GeneID:4568926"
     CDS             complement(39180..39797)
                     /gene="rnhB"
                     /locus_tag="Cpha266_0038"
                     /EC_number="3.1.26.4"
                     /note="RNH2; RNase HII; binds manganese; endonuclease
                     which specifically degrades the RNA of RNA-DNA hybrids"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease HII"
                     /protein_id="YP_910532.1"
                     /db_xref="GI:119355888"
                     /db_xref="InterPro:IPR001352"
                     /db_xref="GeneID:4568926"
                     /translation="MTTDYEYSLWPTLSLISGIDEAGRGPLAGPVVAAAVIFPRWFRP
                     RHAGLDKLDDSKKLSPNLREQLAPTIKTFAAFWAVAVIEPDIIDRINIFQATMQAMNN
                     AVASLHQPPELILVDGNRFMPNAPIPYETIVKGDAKVFSIAAASVLAKTHRDAIMTAY
                     GKEYPEYGFERHFGYPTASHIKAIETFGRTPVHRKSFRLKQLGEK"
     misc_feature    complement(39195..39746)
                     /gene="rnhB"
                     /locus_tag="Cpha266_0038"
                     /note="bacterial Ribonuclease HII-like; Region:
                     RNase_HII_bacteria_HII_like; cd07182"
                     /db_xref="CDD:187695"
     misc_feature    complement(order(39348..39350,39405..39407,39447..39449,
                     39507..39509,39516..39524,39729..39740))
                     /gene="rnhB"
                     /locus_tag="Cpha266_0038"
                     /note="RNA/DNA hybrid binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:187695"
     misc_feature    complement(order(39390..39392,39447..39449,39735..39740))
                     /gene="rnhB"
                     /locus_tag="Cpha266_0038"
                     /note="active site"
                     /db_xref="CDD:187695"
     gene            complement(39830..40219)
                     /locus_tag="Cpha266_0039"
                     /db_xref="GeneID:4568927"
     CDS             complement(39830..40219)
                     /locus_tag="Cpha266_0039"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910533.1"
                     /db_xref="GI:119355889"
                     /db_xref="GeneID:4568927"
                     /translation="MKDSRDFREFLSGGHAAGKRTFIVVLSLTTHHPLFSERSTRMPS
                     NVSFVVTALSFTAQMSINGRQRSLWPLKRDQRDRQGAEAEKLRMNRKVKQAARGMKRI
                     NGPISGKSFDPACRRNHCNEYLQLSEQ"
     gene            40727..42424
                     /locus_tag="Cpha266_0040"
                     /db_xref="GeneID:4568928"
     CDS             40727..42424
                     /locus_tag="Cpha266_0040"
                     /note="TIGRFAM: ribonuclease, Rne/Rng family;
                     PFAM: RNA binding S1 domain protein;
                     KEGG: plt:Plut_0012 ribonuclease E and G"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease"
                     /protein_id="YP_910534.1"
                     /db_xref="GI:119355890"
                     /db_xref="InterPro:IPR003029"
                     /db_xref="InterPro:IPR004659"
                     /db_xref="GeneID:4568928"
                     /translation="MKKSLNKQLLMNKTGDEIQVALVEEGRLAELIIERPESRRSIGD
                     IYLGRVHKVVEGLKAAFVDIGQKSDGFLHFSDVGTTTEDYRALIEDDDDDDTTGTDES
                     DGDEIAAVLSQPAVLPEQNGKSSARSGAKRLTAPAQDGEDGGRRQSYTQMIAGKLKPN
                     DSILVQVIKEPISTKGSRLTSDITIAGRFMVLLPFGGGQVAVSRRVIARKERSRLKKL
                     VRSMLPDGFGAIIRTVAEMQEETLLKQDLEKLLAKWTQIEEKLQDAVPPQLIFKEDTI
                     ISSVLRDSLNADVTEIVANSPVIYKETLNYIQWAAPEMEKNVTLYQGKLPLFEGYSIA
                     KDVESIFSRKVWLKSGGYIIIEHTEAMVVIDVNSGRYAAKREQEENSLKTNLEAAREI
                     VRQLRLRDIGGIIVVDFIDMLDQKNAKKVYDSMRTELRNDRAKSNILPMSDFGIMQIT
                     RERIRPSLMQRMGDQCPACGGTGVVQARFTTINQIERWLRKYALQNTMKLQQLDLYVS
                     PTVAEPLQQSEMNTELKWFLQHLLFVRVKPDESLRSDDFRFYSRKNNKEITAEYGDL"
     misc_feature    40778..42187
                     /locus_tag="Cpha266_0040"
                     /note="ribonuclease, Rne/Rng family; Region: RNaseEG;
                     TIGR00757"
                     /db_xref="CDD:233116"
     misc_feature    40832..>40990
                     /locus_tag="Cpha266_0040"
                     /note="S1_RNase_E: RNase E and RNase G, S1-like
                     RNA-binding domain. RNase E is an essential
                     endoribonuclease in the processing and degradation of RNA.
                     In addition to its role in mRNA degradation, RNase E has
                     also been implicated in the processing of rRNA, and...;
                     Region: S1_RNase_E; cd04453"
                     /db_xref="CDD:239900"
     misc_feature    <41171..41290
                     /locus_tag="Cpha266_0040"
                     /note="S1_like: Ribosomal protein S1-like RNA-binding
                     domain. Found in a wide variety of RNA-associated
                     proteins. Originally identified in S1 ribosomal protein.
                     This superfamily also contains the Cold Shock Domain
                     (CSD), which is a homolog of the S1 domain; Region:
                     S1_like; cl09927"
                     /db_xref="CDD:245202"
     gene            42441..43304
                     /gene="dapD"
                     /locus_tag="Cpha266_0041"
                     /db_xref="GeneID:4568929"
     CDS             42441..43304
                     /gene="dapD"
                     /locus_tag="Cpha266_0041"
                     /EC_number="2.3.1.117"
                     /note="catalyzes the formation of
                     N-succinyl-2-amino-6-ketopimelate from succinyl-CoA and
                     tetrahydrodipicolinate in the lysine biosynthetic pathway"
                     /codon_start=1
                     /transl_table=11
                     /product="2,3,4,5-tetrahydropyridine-2,6-carboxylate
                     N-succinyltransferase"
                     /protein_id="YP_910535.1"
                     /db_xref="GI:119355891"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="GeneID:4568929"
                     /translation="MTSYASLKEEISGLAPLSAVQLADYPDARRVFDDFKKLLNAGTV
                     RAAEKKEGEWQVNLWVKEGILLGMRLGRLVESHLVFPETGGGFDFFDKDTYPLRRMTL
                     EDRVRIVPGGSAVRDGSYLAPSVVMMPPAYVNVGAYVDEGTMIDSHALVGSCAQVGKN
                     VHLSAGVQVGGVLEPVGAVPVIIEDDVMVGGNCGIYEGTIVKERAVIGTGVILNGSTP
                     VYDLALETVYRKTSGHPLVIPAGAVVVAGSRRMKGDFALEHGLSLYTPVIIKYRDEKT
                     DSATALEQALR"
     misc_feature    42516..43301
                     /gene="dapD"
                     /locus_tag="Cpha266_0041"
                     /note="2,3,4,5-tetrahydropyridine-2,6-carboxylate
                     N-succinyltransferase; Provisional; Region: dapD;
                     PRK11830"
                     /db_xref="CDD:236996"
     misc_feature    42756..43187
                     /gene="dapD"
                     /locus_tag="Cpha266_0041"
                     /note="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP)
                     N-succinyltransferase (also called THP
                     succinyltransferase): THDP N-succinyltransferase catalyzes
                     the conversion of tetrahydrodipicolinate and succinyl-CoA
                     to N-succinyltetrahydrodipicolinate and CoA; Region:
                     LbH_THP_succinylT; cd03350"
                     /db_xref="CDD:100041"
     misc_feature    order(42762..42767,42774..42779,42828..42830,42834..42836,
                     42882..42890,42936..42938,43014..43016,43020..43022,
                     43074..43076,43173..43184)
                     /gene="dapD"
                     /locus_tag="Cpha266_0041"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:100041"
     misc_feature    order(42762..42764,42786..42788,42822..42824,42840..42842,
                     42876..42878,42897..42899,42924..42926,42930..42932,
                     42951..42953,42957..42962,42969..42971,43008..43016,
                     43029..43031,43062..43067)
                     /gene="dapD"
                     /locus_tag="Cpha266_0041"
                     /note="active site"
                     /db_xref="CDD:100041"
     misc_feature    order(42762..42764,42786..42788,42822..42824,42840..42842,
                     42876..42878,42897..42899,42957..42959)
                     /gene="dapD"
                     /locus_tag="Cpha266_0041"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100041"
     misc_feature    order(42930..42935,42951..42953,42969..42971,43008..43016,
                     43029..43031,43062..43067)
                     /gene="dapD"
                     /locus_tag="Cpha266_0041"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:100041"
     gene            43349..45067
                     /locus_tag="Cpha266_0042"
                     /db_xref="GeneID:4571233"
     CDS             43349..45067
                     /locus_tag="Cpha266_0042"
                     /EC_number="3.4.21.102"
                     /note="KEGG: cte:CT2258 carboxyl-terminal protease;
                     TIGRFAM: carboxyl-terminal protease;
                     PFAM: PDZ/DHR/GLGF domain protein; peptidase S41"
                     /codon_start=1
                     /transl_table=11
                     /product="C-terminal processing peptidase-3"
                     /protein_id="YP_910536.1"
                     /db_xref="GI:119355892"
                     /db_xref="InterPro:IPR001478"
                     /db_xref="InterPro:IPR004447"
                     /db_xref="InterPro:IPR005151"
                     /db_xref="GeneID:4571233"
                     /translation="MTCGKHMRQCLCRALISAGAASLLFVIVPVLGIHAAEHDKEYAE
                     TGKSIELFGHVVRELSEKYVDTVDVGKLIYIGIDGVLESLDPYTVFLDAGQSEELGEI
                     TSGQYAGIGLGLSKFGGAAYVTSVVEGYPAWKAGIRTGDRIMAINGVSLSKSNIDNLR
                     EMIKGPAGGSLTVKIEREKSGRPPAPETVTLVRQAVHLNTVSFAGIVDGVAYIVMDSF
                     SAKSAEELSAALQKLMKESEPEGRSLKGVVLDLRGNPGGLLTSAIDVAGLFVEKGSEV
                     LSIRGRHPEDRQAYTTQQSPFSSTIPLVVLIDGQSASASEIVSGAIQDLDRGIIIGER
                     SFGKGLVQSIVELPFNYSIKLTTAKYYTPSGRLIQKDLHSETELIKEGDVPPAGKEKR
                     AKVYYTAKKRSVYGGGGILPDISVSAVMLSEYEKALVKDGLIFRFAISYHSEHAEQPT
                     LPLDHPSLLLAFDKFLEDQKFSYTSQPEQEFEKLRTLLIKETPSDGNSEASALLGMKE
                     EIVRRKRLELSRNREHIARLLELEILRHYSETGAKRAGLHDDPVVRTALELLSDKKRY
                     SGILSR"
     sig_peptide     43349..43456
                     /locus_tag="Cpha266_0042"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 0.888) with cleavage site probability 0.825 at
                     residue 36"
     misc_feature    43487..>43627
                     /locus_tag="Cpha266_0042"
                     /note="C-terminal processing peptidase family S41; Region:
                     Peptidase_S41; cl02526"
                     /db_xref="CDD:243070"
     misc_feature    43526..44524
                     /locus_tag="Cpha266_0042"
                     /note="C-terminal peptidase (prc); Region: prc; TIGR00225"
                     /db_xref="CDD:232883"
     misc_feature    43667..43930
                     /locus_tag="Cpha266_0042"
                     /note="PDZ domain of C-terminal processing-,
                     tail-specific-, and tricorn proteases, which function in
                     posttranslational protein processing, maturation, and
                     disassembly or degradation, in Bacteria, Archaea, and
                     plant chloroplasts. May be responsible for...; Region:
                     PDZ_CTP_protease; cd00988"
                     /db_xref="CDD:238488"
     misc_feature    order(43673..43684,43688..43690,43823..43828,43835..43840)
                     /locus_tag="Cpha266_0042"
                     /note="protein binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238488"
     misc_feature    <44078..44458
                     /locus_tag="Cpha266_0042"
                     /note="C-terminal processing peptidase; serine protease
                     family S41; Region: Peptidase_S41_CPP; cd07560"
                     /db_xref="CDD:143476"
     misc_feature    order(44285..44287,44360..44362)
                     /locus_tag="Cpha266_0042"
                     /note="Catalytic dyad [active]"
                     /db_xref="CDD:143476"
     gene            complement(45059..45778)
                     /locus_tag="Cpha266_0043"
                     /db_xref="GeneID:4571234"
     CDS             complement(45059..45778)
                     /locus_tag="Cpha266_0043"
                     /note="KEGG: cch:Cag_0034 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910537.1"
                     /db_xref="GI:119355893"
                     /db_xref="GeneID:4571234"
                     /translation="MTESPTFIGSIGLLSLPNWIIHLSSTLEWGIAALMMFRYGMITG
                     RKDIRMFGISMLPHWVGSFFIIAYHLTGDSIPLLLDLSETVNLFGSAALLYAVLTLLK
                     KTSNPTPTGYATCLATIMIAGKPQSYLGEDIFDAILQVSSIVYITFLVLLIVVRKRDP
                     EVFSPLTVAGFWFVLVFISFTVFSIYLATEVRGNLSLSHDDLLHGLAESLLTLSNLMI
                     VIGIHRQTVWYEKLAKKAESA"
     misc_feature    complement(45479..45742)
                     /locus_tag="Cpha266_0043"
                     /note="Protein of unknown function (DUF2499); Region:
                     DUF2499; pfam10693"
                     /db_xref="CDD:220850"
     misc_feature    complement(45089..45385)
                     /locus_tag="Cpha266_0043"
                     /note="Protein of unknown function (DUF3593); Region:
                     DUF3593; pfam12159"
                     /db_xref="CDD:192948"
     gene            complement(45810..46952)
                     /locus_tag="Cpha266_0044"
                     /db_xref="GeneID:4571235"
     CDS             complement(45810..46952)
                     /locus_tag="Cpha266_0044"
                     /note="TIGRFAM: geranylgeranyl reductase;
                     PFAM: monooxygenase, FAD-binding; FAD dependent
                     oxidoreductase;
                     KEGG: cch:Cag_0035 geranylgeranyl reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="geranylgeranyl reductase"
                     /protein_id="YP_910538.1"
                     /db_xref="GI:119355894"
                     /db_xref="InterPro:IPR002938"
                     /db_xref="InterPro:IPR003042"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="InterPro:IPR010253"
                     /db_xref="InterPro:IPR011777"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="GeneID:4571235"
                     /translation="MRFDVAVIGGGPSGAVAAAELARAGIPTVLIERNLDHVKPCGGA
                     IPLGLIEEFGIPGELVEKKLSHMRARSPKGRIIEMNMPNGYVGMVRREKFDRYLRSEA
                     ERAGAVIVEGLVNTIRRSSFGFTISTLNDKVPPIEAHYIIGADGANSKTADELRFPPN
                     ELKVIAMQQRFKYTPELEQFRDIVEIWFDGEVSPDFYGWIFPKADHLAIGTGTEDRRH
                     SIKELQKRFIEKIGITEAPYLDEAAKIPMKPRKSFTAEGAILVGDAAGLVTPANGEGI
                     FFAMRSGKLAAQAMIGHLKHAEPLENYETGFRKLYAPIFFGLEVLQYVYYRNDRLRES
                     FVAICADDDVQQITFDSYLYKKMVPAPWSTQMKIFSKNIYHLVKGS"
     sig_peptide     complement(46896..46952)
                     /locus_tag="Cpha266_0044"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 0.935) with cleavage site probability 0.741 at
                     residue 19"
     misc_feature    complement(45819..46946)
                     /locus_tag="Cpha266_0044"
                     /note="geranylgeranyl reductase; Region: BchP-ChlP;
                     TIGR02023"
                     /db_xref="CDD:233689"
     gene            complement(46993..48462)
                     /locus_tag="Cpha266_0045"
                     /db_xref="GeneID:4571236"
     CDS             complement(46993..48462)
                     /locus_tag="Cpha266_0045"
                     /EC_number="6.1.1.14"
                     /note="Catalyzes a two-step reaction, first charging a
                     glycine molecule by linking its carboxyl group to the
                     alpha-phosphate of ATP, followed by transfer of the
                     aminoacyl-adenylate to its tRNA"
                     /codon_start=1
                     /transl_table=11
                     /product="glycyl-tRNA synthetase"
                     /protein_id="YP_910539.1"
                     /db_xref="GI:119355895"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002315"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="GeneID:4571236"
                     /translation="MSNTDSKRVQNVNLPPEKVMHKLVSLAKRRGFIFPSSEIYEGLS
                     SCFDYGPLGSEMKKNIKDLWWNAMTRRHQNIVGIDASIMMNPRVWEASGHVASFNDPM
                     IDDKATKRRYRADHLIENHIEKLRRDGKDDTALKVQTAYEQASTAADLNRALYDIIIA
                     EGIKAQDTGSGEWTEVRQFNLMFQCGMGALADKASIVYLRPETAQGIFVNFHNVRESS
                     RMKVPFGIAQIGKAFRNEIVKGNFIFRMVEFEQMEMQYFVKPGTQAEAFEAWREERFN
                     WYTSALGINRDKLHWYKHDKLAHYADLAYDIKFEFPFGIEEIEGIHSRTDFDLKQHQE
                     YSGKNMEYIDQLTNERYIPYVVETSAGCDRLFLALLSDAYSEDVVDGEPRISLRFSPK
                     VAPVKAAVLPLLKKGEMAEKAARIADDLRQLYMIQQDDAGSIGKRYRRQDEIGTPFCL
                     TIDHETLENDTLTIRHRDTASQERISASSIREFLAAGMV"
     misc_feature    complement(47005..48414)
                     /locus_tag="Cpha266_0045"
                     /note="glycyl-tRNA synthetase; Provisional; Region:
                     PRK04173"
                     /db_xref="CDD:235240"
     misc_feature    complement(<48205..48396)
                     /locus_tag="Cpha266_0045"
                     /note="Class II tRNA amino-acyl synthetase-like catalytic
                     core domain. Class II amino acyl-tRNA synthetases (aaRS)
                     share a common fold and generally attach an amino acid to
                     the 3' OH of ribose of the appropriate tRNA.   PheRS is an
                     exception in that it...; Region: class_II_aaRS-like_core;
                     cl00268"
                     /db_xref="CDD:241739"
     misc_feature    complement(48226..48240)
                     /locus_tag="Cpha266_0045"
                     /note="motif 1; other site"
                     /db_xref="CDD:238391"
     misc_feature    complement(47353..>47922)
                     /locus_tag="Cpha266_0045"
                     /note="Glycyl-tRNA synthetase (GlyRS)-like class II core
                     catalytic domain. GlyRS functions as a homodimer in
                     eukaryotes, archaea and some bacteria and as a
                     heterotetramer in the remainder of prokaryotes. It is
                     responsible for the attachment of glycine to the 3...;
                     Region: GlyRS-like_core; cd00774"
                     /db_xref="CDD:238397"
     misc_feature    complement(order(47371..47373,47380..47382,47386..47388,
                     47392..47394,47491..47493,47509..47514,47704..47706,
                     47710..47712,47716..47718,47725..47733,47755..47757,
                     47761..47763,47851..47853,47857..47859))
                     /locus_tag="Cpha266_0045"
                     /note="active site"
                     /db_xref="CDD:238397"
     misc_feature    complement(47755..47766)
                     /locus_tag="Cpha266_0045"
                     /note="motif 2; other site"
                     /db_xref="CDD:238397"
     misc_feature    complement(47371..47382)
                     /locus_tag="Cpha266_0045"
                     /note="motif 3; other site"
                     /db_xref="CDD:238397"
     misc_feature    complement(47008..47358)
                     /locus_tag="Cpha266_0045"
                     /note="GlyRS Glycyl-anticodon binding domain. GlyRS
                     belongs to class II aminoacyl-tRNA synthetases (aaRS).
                     This alignment contains the anticodon binding domain,
                     which is responsible for specificity in tRNA-binding, so
                     that the activated amino acid is...; Region:
                     GlyRS_anticodon; cd00858"
                     /db_xref="CDD:238435"
     misc_feature    complement(order(47068..47070,47074..47076,47104..47106,
                     47128..47130,47146..47148,47251..47256))
                     /locus_tag="Cpha266_0045"
                     /note="anticodon binding site; other site"
                     /db_xref="CDD:238435"
     gene            complement(48703..49020)
                     /locus_tag="Cpha266_0046"
                     /db_xref="GeneID:4571237"
     CDS             complement(48703..49020)
                     /locus_tag="Cpha266_0046"
                     /note="PFAM: ATP-dependent Clp protease adaptor protein
                     ClpS;
                     KEGG: cte:CT2237 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent Clp protease adaptor protein ClpS"
                     /protein_id="YP_910540.1"
                     /db_xref="GI:119355896"
                     /db_xref="InterPro:IPR002114"
                     /db_xref="InterPro:IPR003769"
                     /db_xref="GeneID:4571237"
                     /translation="MIFSVSTSLSATRPTPETRQTEQSSGPDLLDAYRVVLYNDEEHT
                     FDEVISQIIKAVQCNRQKAERCTWEVHTKGRSVVFVGMIDRCIKVSAVLEEIALKTEI
                     QTD"
     misc_feature    complement(48715..48930)
                     /locus_tag="Cpha266_0046"
                     /note="ATP-dependent Clp protease adaptor protein ClpS;
                     Region: ClpS; pfam02617"
                     /db_xref="CDD:217146"
     gene            complement(49083..50054)
                     /locus_tag="Cpha266_0047"
                     /db_xref="GeneID:4571238"
     CDS             complement(49083..50054)
                     /locus_tag="Cpha266_0047"
                     /EC_number="3.4.17.13"
                     /note="PFAM: peptidase U61, LD-carboxypeptidase A;
                     KEGG: plt:Plut_0019 muramoyltetrapeptide carboxypeptidase"
                     /codon_start=1
                     /transl_table=11
                     /product="muramoyltetrapeptide carboxypeptidase"
                     /protein_id="YP_910541.1"
                     /db_xref="GI:119355897"
                     /db_xref="InterPro:IPR003507"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="GeneID:4571238"
                     /translation="MPRHFFACMKTLLPKALRKGDTIGLISPSSHSAFPERIARAILY
                     LEERSFKVKPSTYLNCIDVNPAIADQQKLSDLHAMFEDTEVDAVICLRGGAGATRLLK
                     NIDYALIEANPKILIGYSDITALSLAILAYTGLVSFSGPMIATELYEPTPYTEEHFWG
                     MLTDPRYALSLKNHSQHRVTCLKPGDASGNLIGGNLSVLCSLIGTPYLPILDDAILFL
                     EDVNEPAYRIDRMLSHLLNAGLLSRCRAILFGQFTGTPEKAGEDTRLEHIFDYYATQA
                     HIEGPVMTGLSYGHIADLMTLPLGAPFQVTVRPRYFSLEARYPVIHA"
     misc_feature    complement(49152..49988)
                     /locus_tag="Cpha266_0047"
                     /note="LD-Carboxypeptidase, a serine protease, includes
                     microcin C7 self immunity protein; Region: Peptidase_S66;
                     cd07025"
                     /db_xref="CDD:132882"
     misc_feature    complement(order(49239..49244,49353..49358,49365..49370,
                     49374..49379,49443..49448,49452..49457,49758..49763))
                     /locus_tag="Cpha266_0047"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132882"
     misc_feature    complement(order(49185..49187,49398..49400,49695..49697))
                     /locus_tag="Cpha266_0047"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:132882"
     gene            complement(50094..50360)
                     /locus_tag="Cpha266_0048"
                     /db_xref="GeneID:4571239"
     CDS             complement(50094..50360)
                     /locus_tag="Cpha266_0048"
                     /note="PFAM: H+-transporting two-sector ATPase,
                     delta/epsilon subunit;
                     KEGG: plt:Plut_0020 ATP synthase F1, epsilon subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="H+-transporting two-sector ATPase subunit
                     delta/epsilon"
                     /protein_id="YP_910542.1"
                     /db_xref="GI:119355898"
                     /db_xref="InterPro:IPR001469"
                     /db_xref="GeneID:4571239"
                     /translation="MASSEKGFDIEIVTPQQQYFSGEIQSIIAPGRDGLFQVLKSHAP
                     LLSALKNGTVRLTLANKSEKTFTISDGFFEVSNNKAILLTEEIS"
     misc_feature    complement(<50100..50339)
                     /locus_tag="Cpha266_0048"
                     /note="mitochondrial ATP synthase delta subunit; Region:
                     F1-ATPase_delta; cd12152"
                     /db_xref="CDD:213395"
     misc_feature    complement(order(50106..50114,50118..50120,50136..50153,
                     50220..50234,50298..50300,50307..50309,50313..50321,
                     50328..50330))
                     /locus_tag="Cpha266_0048"
                     /note="gamma subunit interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:213395"
     misc_feature    complement(order(50103..50108,50148..50156,50160..50162,
                     50208..50210,50214..50219,50265..50267,50313..50315))
                     /locus_tag="Cpha266_0048"
                     /note="epsilon subunit interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:213395"
     misc_feature    complement(order(50190..50192,50232..50240,50244..50246,
                     50250..50252,50256..50261,50277..50279,50283..50285))
                     /locus_tag="Cpha266_0048"
                     /note="LBP interface [polypeptide binding]; other site"
                     /db_xref="CDD:213395"
     gene            complement(50376..51764)
                     /locus_tag="Cpha266_0049"
                     /db_xref="GeneID:4571240"
     CDS             complement(50376..51764)
                     /locus_tag="Cpha266_0049"
                     /EC_number="3.6.3.14"
                     /note="Produces ATP from ADP in the presence of a proton
                     gradient across the membrane. The beta chain is a
                     regulatory subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="F0F1 ATP synthase subunit beta"
                     /protein_id="YP_910543.1"
                     /db_xref="GI:119355899"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR000793"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004100"
                     /db_xref="InterPro:IPR005722"
                     /db_xref="GeneID:4571240"
                     /translation="MQEGKISQIIGPVVDVDFPEGQLPSILDALTITRPDGTKLVLET
                     QQHLGEERVRTVAMESTDGLIRGLSVTNTERPIQVPVGPEVLGRMLNVVGDPIDGRGS
                     VHTSKTYSIHRSAPKFDELSTKTEMFETGIKVIDLLEPYSRGGKTGLFGGAGVGKTVL
                     IMELINNIAKQQSGYSVFAGVGERTREGNDLWHEMMESGVIDKTALVFGQMNEPPGAR
                     ARVALTGLSIAEYFRDEENRDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLAT
                     EMGELQDRIVSTKKGSVTSVQAIYVPADDLTDPAPATAFAHLDATTVLSRSIAELGIY
                     PAVDPLDSTSRILDPNIVGDDHYDTAQAVKQILQRYKDLQDIIAILGMDELSDEDKLV
                     VSRARKVQRFLSQPFFVAEAFTGLAGKYVKLDETIKGFKEIIAGKHDNLPESAFYLVG
                     TIEEAVQKAKTL"
     misc_feature    complement(50379..51764)
                     /locus_tag="Cpha266_0049"
                     /note="F0F1 ATP synthase subunit beta; Validated; Region:
                     PRK09280"
                     /db_xref="CDD:236447"
     misc_feature    complement(51546..51749)
                     /locus_tag="Cpha266_0049"
                     /note="ATP synthase alpha/beta family, beta-barrel domain;
                     Region: ATP-synt_ab_N; pfam02874"
                     /db_xref="CDD:217261"
     misc_feature    complement(50718..51539)
                     /locus_tag="Cpha266_0049"
                     /note="F1 ATP synthase beta subunit, nucleotide-binding
                     domain. The F-ATPase is found in bacterial plasma
                     membranes, mitochondrial inner membranes and in
                     chloroplast thylakoid membranes. It has also been found in
                     the archaea Methanosarcina barkeri. It uses a...; Region:
                     F1-ATPase_beta; cd01133"
                     /db_xref="CDD:238553"
     misc_feature    complement(order(50730..50732,50736..50738,50742..50747,
                     50772..50777,50808..50816,50820..50822,50841..50843,
                     50853..50858,50865..50867,50916..50918,50937..50939,
                     50949..50951,50964..50969,50973..50981,50997..50999,
                     51009..51011,51018..51020,51111..51113,51126..51134,
                     51198..51200,51207..51215,51396..51398,51402..51404,
                     51408..51413,51417..51419,51468..51470))
                     /locus_tag="Cpha266_0049"
                     /note="alpha subunit interaction interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238553"
     misc_feature    complement(51291..51311)
                     /locus_tag="Cpha266_0049"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238553"
     misc_feature    complement(order(50763..50768,51018..51020,51030..51032,
                     51204..51206,51213..51218,51288..51296,51303..51305))
                     /locus_tag="Cpha266_0049"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238553"
     misc_feature    complement(51030..51044)
                     /locus_tag="Cpha266_0049"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238553"
     misc_feature    complement(order(50745..50750,50766..50768,50772..50774))
                     /locus_tag="Cpha266_0049"
                     /note="inhibitor binding site; inhibition site"
                     /db_xref="CDD:238553"
     misc_feature    complement(50379..50696)
                     /locus_tag="Cpha266_0049"
                     /note="ATP synthase alpha/beta chain, C terminal domain;
                     Region: ATP-synt_ab_C; pfam00306"
                     /db_xref="CDD:215848"
     gene            complement(51893..51965)
                     /locus_tag="Cpha266_R0001"
                     /note="tRNA-Thr3"
                     /db_xref="GeneID:4571241"
     tRNA            complement(51893..51965)
                     /locus_tag="Cpha266_R0001"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:4571241"
     gene            52157..52699
                     /locus_tag="Cpha266_0050"
                     /db_xref="GeneID:4571242"
     CDS             52157..52699
                     /locus_tag="Cpha266_0050"
                     /note="PFAM: Redoxin domain protein;
                     KEGG: cch:Cag_2013 thiol:disulfide interchange protein,
                     thioredoxin family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="redoxin domain-containing protein"
                     /protein_id="YP_910544.1"
                     /db_xref="GI:119355900"
                     /db_xref="InterPro:IPR006662"
                     /db_xref="InterPro:IPR011594"
                     /db_xref="InterPro:IPR013740"
                     /db_xref="GeneID:4571242"
                     /translation="MNNMNRIITIVAAGFMLLLATVSTAGAAQPGTQYPVAPSFSVTG
                     IDNRTITSQSLAGKVYIVNFFASWCPPCRAEIPAMIALQKAYKAKGFTFVGLAVNESG
                     STIRKFSLANGINYPVALADSKIIADYGRFIDGGIRAIPTSFIVDKSGRVVGIISGAR
                     DKAYFEAVILDLLKGTKPTK"
     sig_peptide     52157..52240
                     /locus_tag="Cpha266_0050"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 1.000) with cleavage site probability 0.750 at
                     residue 28"
     misc_feature    52274..52630
                     /locus_tag="Cpha266_0050"
                     /note="TlpA-like family; composed of  TlpA, ResA, DsbE and
                     similar proteins. TlpA, ResA and DsbE are bacterial
                     protein disulfide reductases with important roles in
                     cytochrome maturation. They are membrane-anchored proteins
                     with a soluble TRX domain containing a...; Region:
                     TlpA_like_family; cd02966"
                     /db_xref="CDD:239264"
     misc_feature    52325..52612
                     /locus_tag="Cpha266_0050"
                     /note="Thioredoxin-like; Region: Thioredoxin_8; pfam13905"
                     /db_xref="CDD:222448"
     misc_feature    order(52361..52363,52370..52372)
                     /locus_tag="Cpha266_0050"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239264"
     gene            52835..54700
                     /locus_tag="Cpha266_0051"
                     /db_xref="GeneID:4571243"
     CDS             52835..54700
                     /locus_tag="Cpha266_0051"
                     /EC_number="4.1.1.32"
                     /note="catalyzes the phosphorylation and decarboxylation
                     of oxaloacetate to form phosphoenolpyruvate using GTP"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate carboxykinase"
                     /protein_id="YP_910545.1"
                     /db_xref="GI:119355901"
                     /db_xref="InterPro:IPR008209"
                     /db_xref="InterPro:IPR008210"
                     /db_xref="GeneID:4571243"
                     /translation="MTLVDINAPDFVVNKKLLQWVQETADLCRPDLVHWCDGSQEEYD
                     LLCEQMVESGTFIRLSAEKRPNSFLCRSDPSDVARVEDRTYICSIRKQDAGPTNNWVA
                     PKEMKKILAGLYDGCMQGRTMYIIPFSMGPLGSHIAHIGVEITDSPYVVTNMRIMTRM
                     GRKVLDVLGANGDFVHCLHSVGAPLKAGDQDVSWPCSETKYIVHFPEERSIMSFGSGY
                     GGNALLGKKCFALRIASAMARDEGWLAEHMLILGVESPDGEKTYVSAAFPSACGKTNF
                     AMLIPPESFAGWKVTTIGDDIAWIKPGEDGRLHAINPEYGFFGVAPGTSDKSNPNAME
                     TLKKNCIFTNVALTPDGDVWWEGMTDDIPEELTDWRGNPWTPGCGRPSSHPNARFTAP
                     ASQCPSIDPDWENPHGVPISAFIFGGRRRDTIPLVYQSANWYFGVYMAATMGSEMTAA
                     AAGLIGDVRRDPYAMLPFCGYHMGDYFNHWLHIGRTVVDPPRIFGVNWFRKDDDGKFL
                     WPGFGENMRVLKWIVDRVRGRAGAVESPLGWMPRYEMLGFEGDDGLTQDQFTKLMSID
                     REAWKKELFSHEELLEKLYDRLPKEFSHIRELMLSTLWMSPEHWELAAERYSEDQ"
     misc_feature    52883..54631
                     /locus_tag="Cpha266_0051"
                     /note="Phosphoenolpyruvate carboxykinase (PEPCK), a
                     critical gluconeogenic enzyme, catalyzes the first
                     committed step in the diversion of tricarboxylic acid
                     cycle intermediates toward gluconeogenesis. It catalyzes
                     the reversible decarboxylation and...; Region: PEPCK_GTP;
                     cd00819"
                     /db_xref="CDD:238417"
     misc_feature    order(53069..53071,53486..53488,53492..53494,53510..53515,
                     53573..53575,53639..53659,53717..53722,53786..53788,
                     53792..53794,53819..53821,53996..53998,54359..54361,
                     54368..54370,54377..54379)
                     /locus_tag="Cpha266_0051"
                     /note="active site"
                     /db_xref="CDD:238417"
     misc_feature    order(53069..53071,53486..53488,53492..53494,53510..53515,
                     53786..53788,53996..53998)
                     /locus_tag="Cpha266_0051"
                     /note="substrate-binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238417"
     misc_feature    order(53513..53515,53573..53575,53654..53656,53717..53722,
                     53786..53788)
                     /locus_tag="Cpha266_0051"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238417"
     misc_feature    order(53642..53644,53648..53650,54089..54091,54326..54331,
                     54359..54361,54368..54370,54377..54379)
                     /locus_tag="Cpha266_0051"
                     /note="GTP binding site [chemical binding]; other site"
                     /db_xref="CDD:238417"
     gene            54772..55500
                     /locus_tag="Cpha266_0052"
                     /db_xref="GeneID:4571244"
     CDS             54772..55500
                     /locus_tag="Cpha266_0052"
                     /note="KEGG: cte:CT1620 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910546.1"
                     /db_xref="GI:119355902"
                     /db_xref="InterPro:IPR000437"
                     /db_xref="GeneID:4571244"
                     /translation="MKINAGLLLLFSVLVISGCSGKTDSAQTGSVLEASSSSVPKRYE
                     LKSGIVYYEPTELMGSKSVETLYFDDYGRREARETISDANVMGMKMHSHKMQITDGDY
                     VISYEIENSVNGKDEASKEATRTDMKEFREMAIMMGQTFDPEEMKRNFDYREEGVEEV
                     AGVNGTKYSISLNKEKPGERVYGVLYKKISVKSTFGTIVIKAKKIEENVAVPASKFEV
                     PAGYTIKDVNLEEEMRKASQSGEE"
     sig_peptide     54772..54849
                     /locus_tag="Cpha266_0052"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 0.996) with cleavage site probability 0.390 at
                     residue 26"
     misc_feature    <55333..55440
                     /locus_tag="Cpha266_0052"
                     /note="Domain of unknown function (DUF4412); Region:
                     DUF4412; pfam14371"
                     /db_xref="CDD:222715"
     gene            complement(55586..57445)
                     /locus_tag="Cpha266_0053"
                     /db_xref="GeneID:4571245"
     CDS             complement(55586..57445)
                     /locus_tag="Cpha266_0053"
                     /note="KEGG: plt:Plut_1667 ATP-requiring DNA helicase
                     RecQ;
                     TIGRFAM: ATP-dependent DNA helicase, RecQ family;
                     ATP-dependent DNA helicase RecQ;
                     PFAM: helicase domain protein; HRDC domain protein;
                     DEAD/DEAH box helicase domain protein;
                     SMART: DEAD-like helicases-like"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase RecQ"
                     /protein_id="YP_910547.1"
                     /db_xref="GI:119355903"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002121"
                     /db_xref="InterPro:IPR004589"
                     /db_xref="InterPro:IPR006293"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014021"
                     /db_xref="GeneID:4571245"
                     /translation="MTTDSLNPEKKRGCSDAALYETLRKVFGFRDFRPNQEMIVRTII
                     EKRDVFAVMPTGGGKSLCYQLPAVLLPGTCMVISPLIALMKDQVDGARANGIRAAFLN
                     SSLAPEERTLVLRDLLSNSLDLLYVAPERFTLDQFQEMLKRVNISMAVIDEAHCISEW
                     GHDFRPDYLSLSQLVTLFPDLPVAAFTATATHQVQRDILDKLALRNPFVVRASFDRAN
                     LYYDIRFKENASDQLVALLKQNSGKAGIIYRTSRKSVNETAALLKAKGFRVLPYHAGL
                     GDDERKQNQEAFIRDEVDVIVATVAFGMGIDKSNIRFVIHADLPKSIENYYQETGRAG
                     RDGEAARCTLLFSQSDIPKVRFFIDAMQDETERARALGAFSKVISFASTSVCRRKTLL
                     DYFGETYPHDNCNSCDICLGTREVVDCSLEAQMLLSAIARTEERFGATHIVDIVTGSA
                     NKKIRDFGHDRLKTYGVGKGRDKKFWRQLIDELLAQKVIAKSEGLYPTIVLLPKAVQI
                     LKNEARVEIVRVLEKKSAKAGKQELSGSYDHELFDQLRELRKQIADEQGIPPYVVFSD
                     RTLRDMASIFPENNEAMLSVSGVGEVKLDRYGRQFLNLINRYRSDHPERNALS"
     misc_feature    complement(55622..57385)
                     /locus_tag="Cpha266_0053"
                     /note="ATP-dependent DNA helicase RecQ; Region: recQ;
                     TIGR01389"
                     /db_xref="CDD:130456"
     misc_feature    complement(56879..57307)
                     /locus_tag="Cpha266_0053"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    complement(57266..57280)
                     /locus_tag="Cpha266_0053"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    complement(56981..56992)
                     /locus_tag="Cpha266_0053"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    complement(56411..56788)
                     /locus_tag="Cpha266_0053"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(56543..56551,56624..56629,56687..56698))
                     /locus_tag="Cpha266_0053"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(56441..56443,56450..56452,56462..56464,
                     56525..56527))
                     /locus_tag="Cpha266_0053"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     misc_feature    complement(55919..56194)
                     /locus_tag="Cpha266_0053"
                     /note="This DNA-binding domain is found in the RecQ
                     helicase among others and has a helix-turn-helix
                     structure; Region: RQC; smart00956"
                     /db_xref="CDD:214936"
     misc_feature    complement(55631..55834)
                     /locus_tag="Cpha266_0053"
                     /note="HRDC domain; Region: HRDC; pfam00570"
                     /db_xref="CDD:201312"
     gene            complement(59048..59395)
                     /locus_tag="Cpha266_0054"
                     /db_xref="GeneID:4571246"
     CDS             complement(59048..59395)
                     /locus_tag="Cpha266_0054"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910548.1"
                     /db_xref="GI:119355904"
                     /db_xref="GeneID:4571246"
                     /translation="MIVSYILSLSEPLSLPSTALLRIEIRDTSLADAPSVTLAETQQT
                     AEQVSGKTVVDGAIDLQKSFSPKATITLWAHLSLSGEKRIKKEDFITTRSYPITTIDE
                     NGQVLAELHPVSR"
     misc_feature    complement(<59075..>59155)
                     /locus_tag="Cpha266_0054"
                     /note="hybrid sensory kinase in two-component regulatory
                     system with RcsB and YojN; Provisional; Region: PRK10841"
                     /db_xref="CDD:182772"
     gene            complement(59403..60692)
                     /locus_tag="Cpha266_0055"
                     /db_xref="GeneID:4571247"
     CDS             complement(59403..60692)
                     /locus_tag="Cpha266_0055"
                     /note="PFAM: Radical SAM domain protein;
                     SMART: Elongator protein 3/MiaB/NifB;
                     KEGG: mbu:Mbur_1233 Fe-S protein, radical SAM family"
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM domain-containing protein"
                     /protein_id="YP_910549.1"
                     /db_xref="GI:119355905"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="GeneID:4571247"
                     /translation="MHYPYFPFFLSKQDRDTFMASSPYGGFTVNKAGAAILEWSNGSR
                     SMGEIVKKLQSRYVAESASIAAKTEQFIHDLAKKGYVLIKEKPMRWFDAPPPQTIFWE
                     ITSQCNLQCLHCVVSAGQSTEPDLSTARCFELLDEWAALGVEEITFSGGEPLLREDFF
                     DLAAAAAKNNLSISLATNGTLVTREVAKKLKALNVDVQISLDGSTAEIYGRVRGRKEA
                     FNDVVQGIRNTLAAGVNLTIGTVVTKNNIDDIPEILKFTERSGVPYFRLIPFVPSGRG
                     KHNRDLELDPLQIQTVSRELVEQRDRWSFTILPLEFELTFSPPSGEQADLSRPSECGG
                     ATNYCTVTPSGEVLPCHYFEGVVADSLRNRSFRDIWRNSRFLNYFRSIEIGDIQGYCH
                     GCDWLSECRGGCKAANFSRGDLFQSNCHCWVVKENHQ"
     misc_feature    complement(60450..60650)
                     /locus_tag="Cpha266_0055"
                     /note="Coenzyme PQQ synthesis protein D (PqqD); Region:
                     PqqD; cl05126"
                     /db_xref="CDD:244002"
     misc_feature    complement(59454..60398)
                     /locus_tag="Cpha266_0055"
                     /note="putative heme d1 biosynthesis radical SAM protein
                     NirJ2; Region: rSAM_NirJ2; TIGR04055"
                     /db_xref="CDD:188570"
     misc_feature    complement(59826..60392)
                     /locus_tag="Cpha266_0055"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    complement(order(59883..59888,59970..59972,60093..60095,
                     60159..60167,60237..60242,60246..60248,60348..60356,
                     60360..60362,60366..60368,60372..60374))
                     /locus_tag="Cpha266_0055"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     misc_feature    complement(59430..59693)
                     /locus_tag="Cpha266_0055"
                     /note="radical SAM additional 4Fe4S-binding SPASM domain;
                     Region: rSAM_more_4Fe4S; TIGR04085"
                     /db_xref="CDD:234461"
     gene            complement(60768..62186)
                     /locus_tag="Cpha266_0056"
                     /db_xref="GeneID:4571248"
     CDS             complement(60768..62186)
                     /locus_tag="Cpha266_0056"
                     /note="PFAM: peptidase M12A, astacin;
                     SMART: peptidase, metallopeptidases;
                     KEGG: rde:RD1_1303 zinc metalloproteinase nas-13
                     precursor, putative"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M12A, astacin"
                     /protein_id="YP_910550.1"
                     /db_xref="GI:119355906"
                     /db_xref="InterPro:IPR001506"
                     /db_xref="InterPro:IPR006025"
                     /db_xref="InterPro:IPR006026"
                     /db_xref="GeneID:4571248"
                     /translation="MARKKNGNTPQEYGEFSPSGKLRTAIIEGNTFGYKSVQYTDVDG
                     MAMFEGDIILGKVADVDSKTEQRKREIQQGVTLRGITITGAKYRWPNCKVPYTIDTAL
                     PNQSRVTDAIAHWEAKTKFRFILRTNANASSYPDWVTFRSGSGCSSYVGKQGGQQYIN
                     LASGCSKGNTIHEIGHTIGLWHEHSREDRNAFVTIHWDKIIAGYEHNFNQQISDGDDV
                     GAYDYGSIMHYPRTAFSTDGSETITPTDPSASIGQRTALSAGDIAAANSLCPTVSLCP
                     AAPKTCPGAPIQVCPVSPKLVCPPGIKLACPPGIKQLCPPGIKQSCPSAPIQVICPPG
                     IKLACPPGIKVTCPPVPKIPICPPSPVPGCAAGPTNKPWVGPEGYTTTYRLDPASGAY
                     YSDEAPPPGMNQMPPVVININFHGYQPPSIQSDYAQYDPSAYENQDWTATEYPDPGEE
                     ADDSITNEESEAPEDFNPECSE"
     misc_feature    complement(61374..61928)
                     /locus_tag="Cpha266_0056"
                     /note="Astacin (Peptidase family M12A); Region: Astacin;
                     pfam01400"
                     /db_xref="CDD:201773"
     misc_feature    complement(61389..61916)
                     /locus_tag="Cpha266_0056"
                     /note="Zinc-dependent metalloprotease, astacin_like
                     subfamily or peptidase family M12A, a group of
                     zinc-dependent proteolytic enzymes with a HExxH
                     zinc-binding site/active site. Members of this family may
                     have an amino terminal propeptide, which is cleaved to...;
                     Region: ZnMc_astacin_like; cd04280"
                     /db_xref="CDD:239807"
     misc_feature    complement(order(61500..61502,61641..61643,61659..61661,
                     61668..61673))
                     /locus_tag="Cpha266_0056"
                     /note="active site"
                     /db_xref="CDD:239807"
     gene            62761..65244
                     /locus_tag="Cpha266_0057"
                     /db_xref="GeneID:4571249"
     CDS             62761..65244
                     /locus_tag="Cpha266_0057"
                     /note="KEGG: noc:Noc_0380 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910551.1"
                     /db_xref="GI:119355907"
                     /db_xref="GeneID:4571249"
                     /translation="MAAYDLLDKSENPHRAAELLLEAGSLVDGEAEPKKWAAFRQLYA
                     QYSETSDPEAAITAYRDALSVWDPVLDRDAWVACHSGIGSLMVNLQPFGPKELDEAVM
                     HLESAVQAQPFLSSMLAVLYRFRSAGDPRENWQKRVHHLRQALLLIDRDEEPCGWAAA
                     NNELAIAIGDEPDADFGAALEERLRLHLESFGLLEGNKDDTWIDTCLSLSECYLFRGG
                     IDDRENQEQAERYARLALDAAGTEVSGPLRAEVLLNLARVLMAPGRFFDADRIRQCLS
                     CCDESAALIDPVRSPALMASVESFRANALLKLIQNGEPCDEERLAAHAEAALALLPGV
                     EHTSSRRSILQVAGEGMLAARHDERAAGYFREALDAAASALLFAESREGRMQRIWEFR
                     DTSALLAWSLLKLGDKENALVELEKGKGRFWRTDDEALSVAAIRSIVPSGGALLVANF
                     SCREGAVIVVTGERIEIVWLPSFGKDRLMALQRGGLDVASPGGWLRAYHMRNSEHEAW
                     RRMIEETGETLYRELWEPVLDLLQDMGIADDAELVWFPQGGSGVFPVHAAWRQDSDGS
                     KRWLIDRFTVRYAPDFQVLLSGESGVGCASGSLLLVANPCGDLDFSELECAWVRQYHT
                     GRELKLLHGIDATPDAVLDAIGSAGIVHFSTHAIFDLNRPLCSALLLAGGEPLSLERL
                     IPALEQKAPYLVVLSACETAMSRISSTPDEFLGFPAAFLHSGVRTVLATLWPVDDAAT
                     AVLTGRFYRELAVNNHSPSRALREAQNWIRSVTALELMELMREMKNAPPPAGPLAGRI
                     RTALRAFDPELKPFASPYYWAAFTISGKE"
     misc_feature    62806..63096
                     /locus_tag="Cpha266_0057"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cl02429"
                     /db_xref="CDD:243034"
     misc_feature    order(62806..62808,62818..62820,62827..62829,62887..62889,
                     62923..62925,62935..62937,62944..62946,63007..63009,
                     63058..63060,63070..63072,63079..63081)
                     /locus_tag="Cpha266_0057"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    order(62878..62883,62887..62892,62899..62904,62998..63003,
                     63010..63015,63022..63027)
                     /locus_tag="Cpha266_0057"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    64297..65235
                     /locus_tag="Cpha266_0057"
                     /note="CHAT domain; Region: CHAT; pfam12770"
                     /db_xref="CDD:221764"
     gene            65249..66577
                     /locus_tag="Cpha266_0058"
                     /db_xref="GeneID:4571250"
     CDS             65249..66577
                     /locus_tag="Cpha266_0058"
                     /note="PFAM: protein of unknown function DUF900, hydrolase
                     family protein;
                     KEGG: ter:Tery_2076 protein of unknown function DUF900,
                     hydrolase-like"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910552.1"
                     /db_xref="GI:119355908"
                     /db_xref="InterPro:IPR010297"
                     /db_xref="GeneID:4571250"
                     /translation="MTELVQQLALLDALLSNWDGVLVRMGAPDVLRDEALAALAVKLS
                     SAESPDDLDLLLDDLFDLVEDTPAYDYVRGLIARARLDTGTVAKTRGGYAGELVSDDE
                     KSLLFGASRLAGRALGNAVSADVEPCQVEVFFATNRKSSDASDLQFTGEHDAGGYTCG
                     VAHVTIPVGVHRAGVLEGKRWWHLLREKDDSRRYVVLGSVEKLAEDLFTTRIVEGAPE
                     CRDLLVFLHGFNVTFEDAARQAAQFAFDLQFQGRVVLYSWPSLGSLAGYCADEERAFL
                     SNGRFAGFLGMLEDGPWDKVHILAHSMGNRVMLYGLSGNSWPNGRISQVVFAAADVYV
                     ETFRELFPKIREKAALYTSYTSKKDRALLISGILHKAKRIGISRGEPFVMDGLETIDA
                     SKVDNGFPGHGYFAEETKLIEDISQLLGKGLSAGRRKLYQPPSKAYWDFR"
     misc_feature    65585..66532
                     /locus_tag="Cpha266_0058"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4782"
                     /db_xref="CDD:227121"
     gene            complement(66590..67027)
                     /locus_tag="Cpha266_0059"
                     /db_xref="GeneID:4571251"
     CDS             complement(66590..67027)
                     /locus_tag="Cpha266_0059"
                     /note="PFAM: SH3, type 3 domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="SH3 type 3 domain-containing protein"
                     /protein_id="YP_910553.1"
                     /db_xref="GI:119355909"
                     /db_xref="InterPro:IPR013247"
                     /db_xref="GeneID:4571251"
                     /translation="MAEENKNFWGTIPGILTGIGTVLTAATGFYMAISGGSPTAKHKP
                     EASAPPATAVMQATVQTTPAKEEVTPHLQDIFILKAVIDDPDGFTNVRSMKSSSSSIV
                     AKVTRNEQFHTYLQDGSWWQVKTADGKIGYMHTGHIRILQDPR"
     misc_feature    complement(66611..66760)
                     /locus_tag="Cpha266_0059"
                     /note="Bacterial SH3 domain; Region: SH3_3; cl17532"
                     /db_xref="CDD:248086"
     gene            67352..68095
                     /locus_tag="Cpha266_0060"
                     /db_xref="GeneID:4568798"
     CDS             67352..68095
                     /locus_tag="Cpha266_0060"
                     /note="PFAM: regulatory protein, TetR;
                     KEGG: sma:SAV1468 TetR-family transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="YP_910554.1"
                     /db_xref="GI:119355910"
                     /db_xref="InterPro:IPR001647"
                     /db_xref="GeneID:4568798"
                     /translation="MTTMARPFKALQMPNLSESIKEAAWRQINEFGASSLSLRKIARE
                     LGITAPAIYNYFPDRDALVTALIIDAYASFGDCQHEAGQAHPGQGREIERLKATGLAY
                     RKWALVHPLRYLLIFGNPVPGYVPPMQKLLPVMMRSLGTLVGIIAELHVLGRLHIEGV
                     PLPMLKPGNRFFALMETADEGMHAVYAVAMLIWSRVHGLVSLEITGQQLPFAEDGAAL
                     YLFELDSICRQFVRSPESAPDATGFSSNH"
     misc_feature    67403..>67741
                     /locus_tag="Cpha266_0060"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    67415..67549
                     /locus_tag="Cpha266_0060"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:201228"
     misc_feature    67637..67972
                     /locus_tag="Cpha266_0060"
                     /note="WHG domain; Region: WHG; pfam13305"
                     /db_xref="CDD:205485"
     gene            68108..68572
                     /locus_tag="Cpha266_0061"
                     /db_xref="GeneID:4568799"
     CDS             68108..68572
                     /locus_tag="Cpha266_0061"
                     /note="KEGG: rso:RSc0451 probable transmembrane protein"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transmembrane protein"
                     /protein_id="YP_910555.1"
                     /db_xref="GI:119355911"
                     /db_xref="GeneID:4568799"
                     /translation="MKKTIVAGLAGGMAMNLAMLLTFRTLGFGWDGKGILLTSPMQSH
                     KLIAVWTEIQPLPLVVNTPLPIILGLMLFGIGHAFIYRSVASAWPAGVLPRAMRMSGL
                     IFFMTFLFWEFFTPFNQFGEPLPLIALELSFWVVIATAEGIAIAWVMERRTA"
     sig_peptide     68108..68170
                     /locus_tag="Cpha266_0061"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 0.952) with cleavage site probability 0.305 at
                     residue 21"
     gene            68569..69876
                     /locus_tag="Cpha266_0062"
                     /db_xref="GeneID:4568800"
     CDS             68569..69876
                     /locus_tag="Cpha266_0062"
                     /note="PFAM: NADPH-dependent FMN reductase;
                     KEGG: cac:CAC0756 multimeric flavodoxin WrbA"
                     /codon_start=1
                     /transl_table=11
                     /product="NADPH-dependent FMN reductase"
                     /protein_id="YP_910556.1"
                     /db_xref="GI:119355912"
                     /db_xref="InterPro:IPR005025"
                     /db_xref="GeneID:4568800"
                     /translation="MKALIFDGSPEGDSTGGRLAEVLAELLAAKGYETGHIVLRQKTI
                     GNCNGCFQCWLKTPGICVLDDDNRELSQRFIGSDLLILLTPVTFGGYSPELKRMLDHF
                     IANVSPFFMTVNGETHHRNRYAAYPDLLVIGWLDQPDRVQESLFNHLAWRNSINFYAK
                     RSSWGIIERSAGSVVLRQKLADLFQGLDSPAERVEMKLPDVAAVSGKSGPPRKALLLC
                     GSPRMAKSTSDSLGGYLLDRLEAQGVETQTIYIYKMLHDGRKVQQMLDAVDSTDLCIL
                     AFPLYIDSLPAPVLSALRMIKEHRKARPAQGGFAAIANCGFIESAQNENALAACEAFA
                     GASGFNWMGSVSVGGGEGLVHGRPLAELGGPAIPYRRALDSVAQFLAAGKPVPEDARR
                     QLGRPFVQSWIFRFFGSRNWKKRARQNGVLHKLNDCPYQPSAR"
     misc_feature    68569..69021
                     /locus_tag="Cpha266_0062"
                     /note="NADPH-dependent FMN reductase; Region: FMN_red;
                     pfam03358"
                     /db_xref="CDD:217511"
     misc_feature    68569..>68874
                     /locus_tag="Cpha266_0062"
                     /note="Multimeric flavodoxin WrbA [General function
                     prediction only]; Region: WrbA; COG0655"
                     /db_xref="CDD:223728"
     misc_feature    69211..>69447
                     /locus_tag="Cpha266_0062"
                     /note="Flavodoxin-like fold; Region: Flavodoxin_2;
                     cl00438"
                     /db_xref="CDD:241863"
     gene            70230..72956
                     /locus_tag="Cpha266_0063"
                     /db_xref="GeneID:4568801"
     CDS             70230..72956
                     /locus_tag="Cpha266_0063"
                     /note="KEGG: aor:AO090010000188 predicted protein Pfam:
                     MACPF CHMI PROSITE: SER_RICH"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910557.1"
                     /db_xref="GI:119355913"
                     /db_xref="GeneID:4568801"
                     /translation="MPKKNAGTPAKKVKDALPSAGSSTAVKLATGSSGTPAAPSAGSS
                     ATVKPATGSSGTPAAPSTGSSTTGKPASGSPATGTPATGAQSSGTPPSGTGTAPAAVA
                     SQTTAGAWLSKNQAADYIQRFQDAGYDDLSDLLPEIIRTVLQSEKPGVVDRLVRIRTQ
                     ELRQPQPLPAPALKPGMEMDLSAPVLKGMDGISIKLPDLGFAPGPDKRGDVVSPASMT
                     DEDWLALAINSDMLMGLDLENFFEGESSTPQECFAPALWWKVPASREFFNCEHLSAKI
                     NTEITYTSKSATMVSAGFTSVTASVSTPWVSASVSHEKSYRNAQSSKISTLYIVGMYD
                     LDRVRVDLDECTVVSPRFVAAVENALADPNPKDALAKVFQKYGQIIGRQITLGGRLFF
                     VHVKEEMENSRIETLKSTTSAAIAGAYGAFGGSGSVSFGSSSEKQESSQSMNEKIAFQ
                     AIGGDVTLANEPEKWKDTIKSPAMWEVIRYDKIRYTYELLSPELRELVLMYWERPMGS
                     DEGPIVLPKAKVETMKSSDGVAITGFKIHFGQKVPGLSMRYYATSEDGSFYDWVNEGK
                     LCGTESNGASPLQDFLVELTGGLARRYELHYRAMRADDTFTEWVSGTKICGAKGMKIK
                     DIQAVLSPLGGGIVRIPAESFIPSEGKGTYDIGKYGTGIVNAAVPGEWVLTYQCQYTG
                     SKPVRRRLEALFASANESRPVKVEFNGAIVNGAALEYATGAWDTSGLRTARIGTVTLL
                     PGMNTLKISRPGPGSPHMKEFRLVAEVIDIPATSFIGTTPLGKNNYGLGVIDSGACGN
                     SVTVPYEFTFTGKKPTTLMLEGVYTAMDSRPVDIVINPEDEKPQTFSKVMATVTGSWW
                     KDRQRVETIGDVIVRPGKNTLMLRTTKNALPHIQEFRLVSKETFFDFDPDAD"
     gene            73902..74390
                     /locus_tag="Cpha266_0064"
                     /db_xref="GeneID:4568802"
     CDS             73902..74390
                     /locus_tag="Cpha266_0064"
                     /note="KEGG: cch:Cag_0441 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910558.1"
                     /db_xref="GI:119355914"
                     /db_xref="GeneID:4568802"
                     /translation="MSVSMKSWATPLAIGSFIILAVTGILMFFKIEGGYIKPVHEWLS
                     WAMVAGVLLHIFANWKSFLAYFSKIPAVSIISIGVIVTALAVFMPASRDGGNPKMKMM
                     KAIESARLETVAEISGKESSEIVAALKEKGIMVDDPTMTVRQIARTNNKEAMEVLGVV
                     FR"
     sig_peptide     73902..73967
                     /locus_tag="Cpha266_0064"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 0.702) with cleavage site probability 0.686 at
                     residue 22"
     misc_feature    73914..74078
                     /locus_tag="Cpha266_0064"
                     /note="Domain of unknown function (DUF4405); Region:
                     DUF4405; pfam14358"
                     /db_xref="CDD:222708"
     gene            74997..75524
                     /locus_tag="Cpha266_0065"
                     /db_xref="GeneID:4568803"
     CDS             74997..75524
                     /locus_tag="Cpha266_0065"
                     /note="KEGG: gvi:gll3454 unknown protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910559.1"
                     /db_xref="GI:119355915"
                     /db_xref="GeneID:4568803"
                     /translation="MKRALSAIGFHGTSKSNYEGIKRQGFLLSDNSYDWLGVGFYFFQ
                     DAPNRAKEWAKRHEDPIIIGAEISLDHCMDLLDNVWYELLHRVFIAYEGACRKKNIPM
                     AIQTPGNHRRDKIVIDMAVRALAERGFSVKTVRSVFKEGPECFQNSALTTQNHVQIAV
                     RDISTIVDFWSEELN"
     gene            75533..76708
                     /locus_tag="Cpha266_0066"
                     /db_xref="GeneID:4568804"
     CDS             75533..76708
                     /locus_tag="Cpha266_0066"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910560.1"
                     /db_xref="GI:119355916"
                     /db_xref="GeneID:4568804"
                     /translation="MDHNEIQNIVLDYVNSLSKDELERYNHDPKYDGEDAGAFGLAEY
                     SLEQKYDRCKKVLSITRSAVCANQGQLVQFMFLAAEKHKALRVLMQAPQRRDAGLIKE
                     KILELRDYIDFHLKKNIDRNIEYIYQYFDGRCDIKPRICIKGKSVVDKKHQIIRIFSD
                     KSLQYNSNVDIDKSSAYKYIKDNGRYYLQNDIPGSVKRNTYENSRLDIDKINHYMSID
                     ADLNSVWSNCWKNSPIDERNGLSFYKSTLIIPVTLLNNALDKEFVYEFNSKIDKEVGE
                     SVINPNEIERTIFAFLCIDHVEKWYFDEEDDVRIGYMIADLISFYLFLRVMYIEISDV
                     FANACQYLNECGVDITINKHVYAPVDEDLSAECVTGEDEYSKTNNNLIASISGLIAD"
     gene            76875..77174
                     /locus_tag="Cpha266_0067"
                     /db_xref="GeneID:4568805"
     CDS             76875..77174
                     /locus_tag="Cpha266_0067"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910561.1"
                     /db_xref="GI:119355917"
                     /db_xref="GeneID:4568805"
                     /translation="MRTRLRNCTISDIVLVCRSIFTSCQKSCELYSFSRDLNTSLFQK
                     ALIIEAAGNFKGLFCLLCVKSRCFPAVLVIKKAFSVSLQFVKKVWLAERLHQQQG"
     gene            complement(77474..81076)
                     /locus_tag="Cpha266_0068"
                     /db_xref="GeneID:4568806"
     CDS             complement(77474..81076)
                     /locus_tag="Cpha266_0068"
                     /note="PFAM: metallophosphoesterase; protein of unknown
                     function DUF323; NACHT nucleoside triphosphatase;
                     KEGG: cch:Cag_0856 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910562.1"
                     /db_xref="GI:119355918"
                     /db_xref="InterPro:IPR000767"
                     /db_xref="InterPro:IPR004504"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR005532"
                     /db_xref="InterPro:IPR007111"
                     /db_xref="GeneID:4568806"
                     /translation="MAVTWLHVSDFHLSDKGPYDQEVILRSLVESIRHFRENENREPD
                     LIFATGDIAQYGKAKEYEKATNFFDDLLDAAGLNRDRLFIVPGNHDVERKMGKGLTRT
                     LETNDDADEYFDPNTPTPHLTQKFHAFSEWYNDYFKTIRSFPTNTTCSPVELVTINGL
                     RLAVLPLNSALFCIDDHDHKKLFIGRRCLDAARKLLEAADLKVALIHHPLDWLSPIEQ
                     SNIEAKLEESVDILLQGHYHQTSTKSIIAENGGYLKLAAGAAYQTRQWPNTAMYATFD
                     GSGVTIFPIRYEDKPKERWTLDTSLYPSPSYTRQYPIPGRVASRQDSLLPSCACDRGM
                     NPDTGCPEIKSYERYREALRNLFGIVASRGLDNYQDIEIPLEDVFIDLHIRELCGNVD
                     AHDKGHTIETKKMSQDALLQEIFHGNARTNVLLLIGDPGSGKTTLLQHYAMLCLEGDH
                     GRLFPEAASVRVLFLELRKLNFDAHNKPVRLAAQIVELNRSLSLAADEAETWWREMSE
                     RERVLVLLDGLDEVTELEKRKAICQWIDEEGHAYPNRFFIVTTRKTGYVTSDGVELIQ
                     SHRRAALDDLLPDQQWDFLLKWFRAASKFEKERGFTIHDNTPPDDKARELYAYLYPQE
                     GDKGEEMSSEETEKKKKGLQQIAGIPLLLKLMALLYKLRDFKPDSRIALYRVVIVYLL
                     HGRDNARQISYGIDPEQSATVLGLLAYTMQKKTCLDLSEGEMKEIMESRFRLLTTTVG
                     LDTFFGFMVNRSGILKPNGKAFRFWHKTFQEYLASLEMLRCSKSDAFIRSIVQHYDDR
                     KWEWDETLRFYFAQIDADIFDSFMNQLFNPEITTDVLQRKLQLMKTLIRESRECSTGA
                     LCQKLKDSKLSLGVQWHVLDCLEVINKSAALDAVRNFHERTKQTYEPDDNLKQRVLDK
                     ADGLINQLERTAGINRNLPPKEKEKTKHDSQPKQRPRIISNTYEDDAQYILIPKTNEE
                     KREESIYFSKYPVTNKRYRSFIAALKKDAALQKQINDIAQNNRWDSKFAPWLKEGKND
                     LVALFRSKYDEDRKFGGDEQPVVGITWYAARTYCLWLSLMASNGQDTSRYRLPTEWEW
                     EYAAAGKEKRAYPWPKKKGEPNSTLLNYNDNVGATTPVGSYPEGATPEGLYDMAGNVW
                     EWTDSWWDDTTRSTRVLRGGGWNDDARHCRSAYRILVTPDLRLNIAGFRLAFVP"
     misc_feature    complement(<80804..81064)
                     /locus_tag="Cpha266_0068"
                     /note="Bacillus subtilis YydB and related proteins,
                     metallophosphatase domain; Region: MPP_YydB; cd07400"
                     /db_xref="CDD:163643"
     misc_feature    complement(<80789..81061)
                     /locus_tag="Cpha266_0068"
                     /note="Predicted phosphohydrolases [General function
                     prediction only]; Region: Icc; COG1409"
                     /db_xref="CDD:224327"
     misc_feature    complement(order(80810..80815,80924..80926,81041..81043,
                     81047..81049))
                     /locus_tag="Cpha266_0068"
                     /note="putative active site [active]"
                     /db_xref="CDD:163643"
     misc_feature    complement(order(80813..80815,80924..80926,81041..81043,
                     81047..81049))
                     /locus_tag="Cpha266_0068"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:163643"
     misc_feature    complement(80342..>80470)
                     /locus_tag="Cpha266_0068"
                     /note="metallophosphatase superfamily, metallophosphatase
                     domain; Region: MPP_superfamily; cl13995"
                     /db_xref="CDD:246597"
     misc_feature    complement(79463..79852)
                     /locus_tag="Cpha266_0068"
                     /note="AAA ATPase domain; Region: AAA_16; pfam13191"
                     /db_xref="CDD:221970"
     misc_feature    complement(79301..79813)
                     /locus_tag="Cpha266_0068"
                     /note="NACHT domain; Region: NACHT; pfam05729"
                     /db_xref="CDD:218719"
     misc_feature    complement(77486..78163)
                     /locus_tag="Cpha266_0068"
                     /note="Formylglycine-generating sulfatase enzyme; Region:
                     FGE-sulfatase; pfam03781"
                     /db_xref="CDD:217725"
     misc_feature    complement(77486..>78136)
                     /locus_tag="Cpha266_0068"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG1262"
                     /db_xref="CDD:224182"
     gene            complement(81122..81469)
                     /locus_tag="Cpha266_0069"
                     /db_xref="GeneID:4568807"
     CDS             complement(81122..81469)
                     /locus_tag="Cpha266_0069"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910563.1"
                     /db_xref="GI:119355919"
                     /db_xref="GeneID:4568807"
                     /translation="MKKSISGSNRRGKAGDITMQFKPVHYLGKVPMSGETGVPLFAVV
                     MAERSFSSFAGLGASPGFLNRRMNCRLAAQKTLIPASLLACMIDNRRINKRLYSFMQL
                     RPPCFTLCFLSQP"
     gene            81714..81941
                     /locus_tag="Cpha266_0070"
                     /db_xref="GeneID:4568808"
     CDS             81714..81941
                     /locus_tag="Cpha266_0070"
                     /note="KEGG: pol:Bpro_0451 helix-turn-helix protein, CopG
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="CopG family protein"
                     /protein_id="YP_910564.1"
                     /db_xref="GI:119355920"
                     /db_xref="GeneID:4568808"
                     /translation="MKTKEFDKAFDQGKDVTVYLDLGKASRVKQQHKRVNVDFPVWMI
                     DSLDKEATRLGVSRQSVIKVWLAERLQQQKG"
     gene            complement(82008..83015)
                     /locus_tag="Cpha266_0071"
                     /db_xref="GeneID:4568809"
     CDS             complement(82008..83015)
                     /locus_tag="Cpha266_0071"
                     /note="SMART: helix-turn-helix domain protein;
                     KEGG: dsy:DSY4506 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="YP_910565.1"
                     /db_xref="GI:119355921"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="GeneID:4568809"
                     /translation="MKSPMSGREMTLIKEARTMIFRKKEYPVCYHVYHCNDTQQQFTS
                     TELDEINLVQVYNQYRDEHNLPFPEEIRSIREAYGLSAAKMAEVLGLGTNTYRNYEQG
                     EVPSESNARLIQVAQDPEEFRKIVCLSCALKGNQLEKLNARIQHLIENRKKTTCIDIE
                     EYLMGSKLPDEYSGYLKPSLEKLGEMVVFFAEKLKPWKTKLNKLLFYADFLHFKRSGF
                     SISGTRYCAIPLGPVPDNFNSIFEWMEKKGALAIIEQEFPDGGTGERFFPAESRSFDE
                     RKFSAKELDTLNTVAFAFLKTGTKEIIAISHNENAWIENIHAGNGMISYLRYGFDLKA
                     L"
     misc_feature    complement(82638..83006)
                     /locus_tag="Cpha266_0071"
                     /note="putative zinc finger/helix-turn-helix protein, YgiT
                     family; Region: CxxCG_CxxCG_HTH; TIGR03830"
                     /db_xref="CDD:163542"
     misc_feature    complement(<82677..82811)
                     /locus_tag="Cpha266_0071"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(82713..82715,82788..82790,82800..82802))
                     /locus_tag="Cpha266_0071"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(82716..82718,82791..82793))
                     /locus_tag="Cpha266_0071"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(82710..82715,82725..82727,82734..82736,
                     82767..82772))
                     /locus_tag="Cpha266_0071"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(82074..82415)
                     /locus_tag="Cpha266_0071"
                     /note="Protein of unknown function (DUF4065); Region:
                     DUF4065; pfam13274"
                     /db_xref="CDD:222018"
     gene            complement(82993..83373)
                     /locus_tag="Cpha266_0072"
                     /db_xref="GeneID:4568810"
     CDS             complement(82993..83373)
                     /locus_tag="Cpha266_0072"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910566.1"
                     /db_xref="GI:119355922"
                     /db_xref="GeneID:4568810"
                     /translation="MTATKHQVHAFLRDFKNKLKIWSIVFRDDRGKNAQTLLDLEIRP
                     VDRQKIIEDLDAEDYSEGPIDDIMNKGPEMWVFGKEVKRCEIYIKITKVSPDASVICI
                     SFHIAEHRISYPLKTQCHEKPDER"
     gene            83897..85186
                     /locus_tag="Cpha266_0073"
                     /db_xref="GeneID:4568811"
     CDS             83897..85186
                     /locus_tag="Cpha266_0073"
                     /note="PFAM: DNA methylase N-4/N-6 domain protein;
                     KEGG: cch:Cag_1099 DNA modification methylase-like"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA methylase N-4/N-6 domain-containing protein"
                     /protein_id="YP_910567.1"
                     /db_xref="GI:119355923"
                     /db_xref="InterPro:IPR001091"
                     /db_xref="InterPro:IPR002295"
                     /db_xref="InterPro:IPR002941"
                     /db_xref="GeneID:4568811"
                     /translation="MNLLPDSSVHLIITSPPYWQLKDYGTENQIGFHDSYESYINNLN
                     LVWSECERVLHPGCRLCINIGDQFARSVYYGRYKVIPIRTEIIRFCETIGFDYMGAVI
                     WQKVTTTNTTGGASIMGSFPYPRNGILKLDYEFILLFKKQGDAPKPSKELKERSAMTT
                     EEWNTCFSGHWNFAGAKQDGHIAVFPEDLPHRLIRMFAFVGETVLDPFMGSGTTSLAA
                     KNLDRNSVGYEINPEFIGIAREKLNSNQTDFAGTEYVFQHDTLKGDISEMIERLPYRF
                     QDPHKLDKKIDPRKLTFGSRVEKGGGAKQEETFIVREILSPEMVRLSNGLTVRLIGVK
                     EDPFTREKAVGYLVDKIKGKRIFMKYDSMKYDGRNNLLCYLYLENRTFVNAHLIRSGL
                     VGIDGSYEYRYKQKFLAFSDENSTLVQTGRWSGIAAK"
     misc_feature    83897..84634
                     /locus_tag="Cpha266_0073"
                     /note="DNA modification methylase [DNA replication,
                     recombination, and repair]; Region: COG0863"
                     /db_xref="CDD:223931"
     misc_feature    83921..84616
                     /locus_tag="Cpha266_0073"
                     /note="DNA methylase; Region: N6_N4_Mtase; pfam01555"
                     /db_xref="CDD:216568"
     gene            complement(85239..85511)
                     /locus_tag="Cpha266_0074"
                     /db_xref="GeneID:4568812"
     CDS             complement(85239..85511)
                     /locus_tag="Cpha266_0074"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910568.1"
                     /db_xref="GI:119355924"
                     /db_xref="GeneID:4568812"
                     /translation="MRIENLDDVAEFARTVILNGVNLHPDDDFRNYVNIETGQPTYTE
                     EEASAYNRNMANAFSICDKCGVDIYGFMQKIFLVETGLDKVIPMPD"
     gene            complement(85805..86278)
                     /locus_tag="Cpha266_0075"
                     /db_xref="GeneID:4568813"
     CDS             complement(85805..86278)
                     /locus_tag="Cpha266_0075"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910569.1"
                     /db_xref="GI:119355925"
                     /db_xref="GeneID:4568813"
                     /translation="MKMPSTAKLIADLLYDYENEPETTFGDLVDGIEDLSIETGDLEL
                     SLAISKYRIEERYDRKYLGMRGDMDSVEADFIEAVRLLAFGRTFSEDRNASANFDNWD
                     YTLINSTIEKGQPYPAVLIYKVIGAREHELPLLEKAGYTLFNDTYLPPSAGKTSD"
     gene            86782..88353
                     /locus_tag="Cpha266_0076"
                     /db_xref="GeneID:4568814"
     CDS             86782..88353
                     /locus_tag="Cpha266_0076"
                     /note="PFAM: Integrase, catalytic region;
                     KEGG: bfs:BF1534 putative transposase for insertion
                     sequence element IS21-like"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase catalytic subunit"
                     /protein_id="YP_910570.1"
                     /db_xref="GI:119355926"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="GeneID:4568814"
                     /translation="MRTQLKKLTMYNKVKEFAREGLSIRQISRKTGMDRVTVRKFLRM
                     TDEEFSAFLALQKRRLRKLQPYEQFVKDRVTDYPDCSATQVEDWLKEHHPVFPEVTTR
                     TIYSFVQWIRKAYDLPKPKGTPRAYHPVEQLPYGEQAQVDFGEYWMASADACKVKVHF
                     MIMLLSRSRRKFVSFSQQPITTRFVLEAHEQAFSFFEGIPHTLVYDQDSTIVTDENRG
                     AILYTEAFRKYLLHRSLKIHLCRKSDPESKGKIEAGVKYVKYNFLPGRRFVNLEVLNQ
                     EALLWLERTANAKEHATTRLIPDAEWQVEKQHLRPFEPLPYPISGTVGKEYHVRKDNT
                     ISYRGNFYSLPVGTYAGPGTLVVLEVRQNTLCLYAQEGRLLANHPIESGKGTVVINNN
                     HRRDTSSKLRELQDSLMLLFTNQEHAERFLESIHNRYPRYSRDQFLHVRNAISGCQQK
                     LIDDALAHCVDHHLFSSGEFHDILHHYRKQEEKQSHQAVFNTFRPKTLRSDMDRMLSF
                     VPDSSGITTYENIFS"
     misc_feature    86836..87675
                     /locus_tag="Cpha266_0076"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG4584"
                     /db_xref="CDD:226950"
     misc_feature    87250..87558
                     /locus_tag="Cpha266_0076"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:216050"
     gene            88359..89195
                     /locus_tag="Cpha266_0077"
                     /db_xref="GeneID:4568815"
     CDS             88359..89195
                     /locus_tag="Cpha266_0077"
                     /note="PFAM: IstB domain protein ATP-binding protein;
                     SMART: AAA ATPase;
                     KEGG: bfs:BF1535 insertion sequence IS21-like putative
                     ATP-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="IstB ATP binding domain-containing protein"
                     /protein_id="YP_910571.1"
                     /db_xref="GI:119355927"
                     /db_xref="InterPro:IPR002611"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="GeneID:4568815"
                     /translation="MERTITTIQEHARELNLTGLAGTVDLLLEEARKSEPSYSDFALT
                     LLESELSCRRKAHLERRRKIANLPLLHDLDHYDSGVQNGISQVQLQQLRQLLWLDQNF
                     NLILIGPSGTGKSYLAGGLCHEALKLGYHALFRTMDDLIQTIRFKEITAAAAREYKRL
                     LSAHLLVIDDIMMFPLEKSVAVGLFQLVNQLHEQTSFIITTNKSPKEWAEMLGDEVLA
                     TALLDRLLYKCEVIKLTGKSYRLEHRTTIFEQQQSPEGGGNRRKKQLPLQKGVGNHCK
                     MT"
     misc_feature    88359..89090
                     /locus_tag="Cpha266_0077"
                     /note="DNA replication protein [DNA replication,
                     recombination, and repair]; Region: DnaC; COG1484"
                     /db_xref="CDD:224401"
     misc_feature    88665..88973
                     /locus_tag="Cpha266_0077"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    88680..88703
                     /locus_tag="Cpha266_0077"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(88683..88706,88863..88865,88962..88964)
                     /locus_tag="Cpha266_0077"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    88851..88868
                     /locus_tag="Cpha266_0077"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     gene            complement(89710..91446)
                     /locus_tag="Cpha266_0078"
                     /db_xref="GeneID:4568816"
     CDS             complement(89710..91446)
                     /locus_tag="Cpha266_0078"
                     /note="KEGG: ecp:ECP_4570 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910572.1"
                     /db_xref="GI:119355928"
                     /db_xref="GeneID:4568816"
                     /translation="MTIMSEITSSFNDFILKSVSRYLQTVVLIDDKIYPPKAVRTPTD
                     LQEPPSRHRKAASKSAEPVLEKKEVIDKLAEEIDQSEEVSFHDIQNSFAEKRIICSLY
                     QPKQGASFNSSSDVYNLCSVADVVVVDWDIHGDSGKKATELVVTLIEQSMKEVPHQLR
                     LVLIYTMDPNLGSVANSVYEAFSSQIDTALIDVLEDGNGLVFTSENARVVVLGKKINT
                     AFLQYSDFFVPEKDLAERTINEFSHLASGLLQCIILQGIASLRENNRRILMRFHKGLD
                     AAFLAHRALLMPDEAFGQIIPMLTDELRAVLEDNLGEHPLGDEIISKEIISDWCNKHW
                     KPVTVSDLQIGSSVDPTAFAIDVFCNGSNIADYSKYRGSRISGMLEMKDGLNKWKEKK
                     CDLLAEYLSSDEKGNFSHEMLSALMSQRIAYENSRKSLRLGVILRIKITEKPRYMLCL
                     QPVCDSVRVNEKGTPFIFCLLDVPNNGSIFTHTVKDSSDSTIRLVYKAKVTNCYISLF
                     SSNTGVVCASENGEGQFIFKDTEDKEYEWVAELKIEHAQRAAEEFGRILSRVGLNESE
                     WLRLKTKQLNNQ"
     gene            complement(91430..94393)
                     /locus_tag="Cpha266_0079"
                     /db_xref="GeneID:4570646"
     CDS             complement(91430..94393)
                     /locus_tag="Cpha266_0079"
                     /note="PFAM: ATP-binding region, ATPase domain protein
                     domain protein;
                     KEGG: ecp:ECP_4571 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="YP_910573.1"
                     /db_xref="GI:119355929"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="GeneID:4570646"
                     /translation="MAKFRTKARAVDMLGRQQIADASTAISELFKNAHDAYADNVEVD
                     LFKSDSLLVIRDDGIGMSPSEFEANWLVLGTDSKFSSAGKLHAYRPSNKPERAVMGEK
                     GIGRLAIAFLGPQVLVLTRSEKLDHNDTLTMCYLHWGLFEQQALNLDDIDIPVKSISG
                     GELPSLQDVSELLLENTRNVEQLQKRFPQCDLCSIIDDLSDFQVDPRDFEKSVQGLSL
                     SDHKCGTHFYIATANEVIIADIVAEKYTLTKEFTKCLLGFCNSTFAETSPPPIQTKFR
                     YWPTDNRYEDLIAPNEFFTTDDLALSDHFVSGEIDEYGQFNGIVRVYDQEYPDHVISW
                     KEGGGKPTECGPFRVEFGYLQGAHRESMADPDDWSILDSKLKQIGGLYVYRDRIRILP
                     YGNSNVDWLDIELRRNKGMGYYYFSYRRIYGAICTTRKENATLREKAGREGFQKDKAY
                     RQLKSVLENLFIQLAADFFRKDATHGDYFQERKDELDRLERARRKREQQITTKRTKLS
                     DTLDVFFSKVNERIPESEIATLSHHVQSRMQSASFMMDSDTASQELLDAEREANEKLA
                     LLRTTYTLIRPRGVGLTKQLTRDWDAYQREHNRLEIEVFEPFVKDVGKKLGSMAAQAK
                     IYIDQRRRLQELIKNVADEQNANVKNESKVLQETSSQTRRAAVNTARSAMKELRDTIE
                     AVNADLAHRDLNDLLPEQIEEIRSTYEKRIDSVASRNAETLGSVRELLAGIVESLENN
                     MQNSQLDIVEAMDTELESLREQAETDEELVQLGLAVAVINHEFVAAIKMIRGQLRELR
                     SWAMVNKDLLPVYQEIRTNFDHLDAHLNLFTPLQRRLYKKRVNIEGKEIIHYVRALFN
                     VRFERHKIHLEATQAFLDSHVTSYPSTIYPVFVNLIDNFIFWLKDKQGDRLISLDCTD
                     NSYHIKNNGPAINRRDAESIFEQGFSRKPGGRGLGLYISKKVLEKEGMTLALDKTLTM
                     DSGVSFNLSWSDNNE"
     misc_feature    complement(93911..94324)
                     /locus_tag="Cpha266_0079"
                     /note="Histidine kinase-, DNA gyrase B-, and HSP90-like
                     ATPase; Region: HATPase_c_3; pfam13589"
                     /db_xref="CDD:222246"
     misc_feature    complement(91493..92251)
                     /locus_tag="Cpha266_0079"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    complement(91502..91735)
                     /locus_tag="Cpha266_0079"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(91544..91555,91616..91621,91625..91627,
                     91631..91633,91637..91639,91703..91705,91712..91714,
                     91724..91726))
                     /locus_tag="Cpha266_0079"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(91712..91714)
                     /locus_tag="Cpha266_0079"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(91547..91549,91553..91555,91619..91621,
                     91625..91627))
                     /locus_tag="Cpha266_0079"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(94386..95501)
                     /locus_tag="Cpha266_0080"
                     /db_xref="GeneID:4570647"
     CDS             complement(94386..95501)
                     /locus_tag="Cpha266_0080"
                     /EC_number="2.1.1.37"
                     /note="KEGG: ecp:ECP_4572 modification methylase;
                     TIGRFAM: DNA-cytosine methyltransferase;
                     PFAM: C-5 cytosine-specific DNA methylase"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-cytosine methyltransferase"
                     /protein_id="YP_910574.1"
                     /db_xref="GI:119355930"
                     /db_xref="InterPro:IPR001525"
                     /db_xref="GeneID:4570647"
                     /translation="MNQQSEPTCSKIRVYDFFSGCGGTSVGFGRAGIQHALAVDSCSD
                     AISTYQKNFIGVPVITDPIETLNVDRIQNYFSHNPEVKLFCGCAPCQPFTKQKTNTKK
                     DAASDDRRGLLIYFSDIVHACLPELVFVENVPGLQKFSLEDGGPLAMFISRLKQNDYF
                     VDFDVIAAQDYGSPQVRRRFVLIASRLGKITLPAPTHGPNTKNSYVTVHDAIGNLPSV
                     KHGTEHPDNQNYPNHRAAMLSALNLERIRHTGANGRRDWPERLLPKCYAQKKDGKRYE
                     GHSDCYTRLAWGEPAPGLTTRCISYSNGRFGHPEQDRAITIREAAKLQGFPDDFIFTG
                     SLNSMARQIGNAVPVSVAEVFGRHFLNHVKAMESTNG"
     misc_feature    complement(94416..95474)
                     /locus_tag="Cpha266_0080"
                     /note="Site-specific DNA methylase [DNA replication,
                     recombination, and repair]; Region: Dcm; COG0270"
                     /db_xref="CDD:223348"
     misc_feature    complement(<94866..95468)
                     /locus_tag="Cpha266_0080"
                     /note="Cytosine-C5 specific DNA methylases; Methyl
                     transfer reactions play an important role in many aspects
                     of biology. Cytosine-specific DNA methylases are found
                     both in prokaryotes and eukaryotes. DNA methylation, or
                     the covalent addition of a methyl group...; Region:
                     Cyt_C5_DNA_methylase; cd00315"
                     /db_xref="CDD:238192"
     misc_feature    complement(order(95235..95237,95241..95243,95310..95321,
                     95376..95387,95433..95450))
                     /locus_tag="Cpha266_0080"
                     /note="cofactor binding site; other site"
                     /db_xref="CDD:238192"
     misc_feature    complement(order(94965..94967,94971..94973,95100..95105,
                     95109..95111,95175..95177,95193..95195,95202..95204,
                     95214..95222,95229..95234,95241..95243))
                     /locus_tag="Cpha266_0080"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238192"
     misc_feature    complement(order(94965..94967,94971..94973,95103..95105,
                     95109..95111,95220..95222,95232..95234,95241..95243))
                     /locus_tag="Cpha266_0080"
                     /note="substrate interaction site [chemical binding];
                     other site"
                     /db_xref="CDD:238192"
     misc_feature    complement(94431..>94667)
                     /locus_tag="Cpha266_0080"
                     /note="Cytosine-C5 specific DNA methylases; Methyl
                     transfer reactions play an important role in many aspects
                     of biology. Cytosine-specific DNA methylases are found
                     both in prokaryotes and eukaryotes. DNA methylation, or
                     the covalent addition of a methyl group...; Region:
                     Cyt_C5_DNA_methylase; cd00315"
                     /db_xref="CDD:238192"
     gene            complement(95816..97117)
                     /locus_tag="Cpha266_0081"
                     /db_xref="GeneID:4570648"
     CDS             complement(95816..97117)
                     /locus_tag="Cpha266_0081"
                     /note="KEGG: lpf:lpl0144 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910575.1"
                     /db_xref="GI:119355931"
                     /db_xref="GeneID:4570648"
                     /translation="MKNKGCRTIYAKVLAANDNRKQQVYFGGDFQAINIIPFDTIAPD
                     PDKPHIFKAPLNFWWLSDDESLHNASRAQLILYPQYPEVRFSGFLQGCSAAPSELMDE
                     RLRLAGRILFLGISPDGRIIGYLCHPESELAREFVSLGELPRSGVFLEPGLGTGVLDD
                     RSLLIEKLRVIHQKGWIRSRKLGSNGVILPCEAPNCGGMTLEAELDIIPNSRSEPDWL
                     GYEVKQYNVTNFQRINSGVLTLMTPEPTGGYYRSAGIEAFIRKFGYPDMTGAADRGDR
                     LNFGGIHKVGEYHRLTSLQIVLKGFDAIKGKITDATGGISLMNIEGEEAAVWGYAEVM
                     AKWNRKHNKAVYIPSRCVQSPERRYWYGNLIRIGTGTDFLKYLQAMAEGKVYYDPGIK
                     LENASTTPRTKQRSQFRIKSSNLPALYHSMDIVDLNEEQSE"
     gene            complement(97065..97595)
                     /locus_tag="Cpha266_0082"
                     /db_xref="GeneID:4570649"
     CDS             complement(97065..97595)
                     /locus_tag="Cpha266_0082"
                     /EC_number="3.1.-.-"
                     /note="PFAM: DNA mismatch endonuclease vsr;
                     KEGG: mmr:Mmar10_3056 DNA mismatch endonuclease vsr"
                     /codon_start=1
                     /transl_table=11
                     /product="T/G mismatch-specific endonuclease"
                     /protein_id="YP_910576.1"
                     /db_xref="GI:119355932"
                     /db_xref="InterPro:IPR004603"
                     /db_xref="GeneID:4570649"
                     /translation="MADVVSPETRSRMMSGIRSENTVPEMRVRRGLHARGFRFRLHCG
                     GLPGKPDIVFPKYRAVIFIHGCFWHAHECPLFKWPKTREDFWKKKIGKNRIRDLAVMD
                     ELARQGWRVLIVWECALKGKGRRPIDEVVDSCAEWLLSSSTKREIRGQHEIIDITIDH
                     EKQGLPDDLREGTRRK"
     misc_feature    complement(97239..97580)
                     /locus_tag="Cpha266_0082"
                     /note="Very Short Patch Repair (Vsr) Endonuclease.
                     Endonucleases in DNA repair that recognize damaged DNA and
                     cleave the phosphodiester backbone. Vsr endonucleases have
                     a common endonuclease topology that has been tailored for
                     recognition of TG mismatches; Region: Vsr; cd00221"
                     /db_xref="CDD:238136"
     misc_feature    complement(order(97248..97250,97299..97301,97308..97310,
                     97317..97319,97401..97403,97452..97454,97527..97532,
                     97557..97568))
                     /locus_tag="Cpha266_0082"
                     /note="additional DNA contacts [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238136"
     misc_feature    complement(order(97317..97319,97545..97547,97554..97556))
                     /locus_tag="Cpha266_0082"
                     /note="mismatch recognition site; other site"
                     /db_xref="CDD:238136"
     misc_feature    complement(order(97305..97307,97389..97391,97443..97445,
                     97521..97523))
                     /locus_tag="Cpha266_0082"
                     /note="active site"
                     /db_xref="CDD:238136"
     misc_feature    complement(order(97245..97247,97398..97400))
                     /locus_tag="Cpha266_0082"
                     /note="zinc binding site [ion binding]; other site"
                     /db_xref="CDD:238136"
     misc_feature    complement(97392..97397)
                     /locus_tag="Cpha266_0082"
                     /note="DNA intercalation site [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238136"
     gene            complement(97588..98865)
                     /locus_tag="Cpha266_0083"
                     /db_xref="GeneID:4570650"
     CDS             complement(97588..98865)
                     /locus_tag="Cpha266_0083"
                     /EC_number="2.1.1.37"
                     /note="KEGG: lpf:lpl0145 DNA
                     (cytosine-5-)-methyltransferase;
                     TIGRFAM: DNA-cytosine methyltransferase;
                     PFAM: C-5 cytosine-specific DNA methylase"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-cytosine methyltransferase"
                     /protein_id="YP_910577.1"
                     /db_xref="GI:119355933"
                     /db_xref="InterPro:IPR001525"
                     /db_xref="GeneID:4570650"
                     /translation="MNTTQSFSVLRQQAGLSIDKIAHITGYSQREVYRWEKNEVVPRK
                     MVLDQLTRIAQPLSTYGKDSSSFTFIDLFAGIGGMRKAFEELGGRCVFTSEWDKYSRQ
                     TYCANFDCDHEIGGDITKIDARDIPSHDILVAGFPCQPFSIAGVSKKNALGKPHGFAD
                     KTQGTLFFDVARVIEYHQPKAILLENVKNLQRHDKGKTFAVIKETLTELGYYFDWKII
                     DAGNWVPQHRERIFIAGFREDCGFSFDRFDLPHGNERPVIETILHPENGMEDEEPPYT
                     VGPLARISDRYTLSDHLWEYLQKYAEKHRAKGNGFGFGLVGPHDVARTLSARYYKDGS
                     EILVKQEGKNPRRLTPRECARLMGFDTPNGNSFVIPVSDTQAYRQFGNAVVVPVVMSV
                     ARYMLEYLMDGVSSDQLRFDFGILMADNAVQYG"
     misc_feature    complement(<98695..98838)
                     /locus_tag="Cpha266_0083"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: HipB; COG1396"
                     /db_xref="CDD:224314"
     misc_feature    complement(98701..98838)
                     /locus_tag="Cpha266_0083"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(98758..98760,98833..98835))
                     /locus_tag="Cpha266_0083"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(98755..98757,98830..98832))
                     /locus_tag="Cpha266_0083"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(98752..98757,98767..98769,98776..98778,
                     98809..98814))
                     /locus_tag="Cpha266_0083"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(97672..98667)
                     /locus_tag="Cpha266_0083"
                     /note="Cytosine-C5 specific DNA methylases; Methyl
                     transfer reactions play an important role in many aspects
                     of biology. Cytosine-specific DNA methylases are found
                     both in prokaryotes and eukaryotes. DNA methylation, or
                     the covalent addition of a methyl group...; Region:
                     Cyt_C5_DNA_methylase; cd00315"
                     /db_xref="CDD:238192"
     misc_feature    complement(97717..98661)
                     /locus_tag="Cpha266_0083"
                     /note="DNA-methyltransferase (dcm); Region: dcm;
                     TIGR00675"
                     /db_xref="CDD:233085"
     misc_feature    complement(order(98455..98457,98461..98463,98509..98520,
                     98575..98586,98632..98649))
                     /locus_tag="Cpha266_0083"
                     /note="cofactor binding site; other site"
                     /db_xref="CDD:238192"
     misc_feature    complement(order(97720..97722,97885..97890,97894..97899,
                     97978..97980,97984..97986,98176..98178,98182..98184,
                     98302..98307,98311..98313,98377..98379,98398..98400,
                     98431..98442,98449..98454,98461..98463))
                     /locus_tag="Cpha266_0083"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238192"
     misc_feature    complement(order(97720..97722,98176..98178,98182..98184,
                     98305..98307,98311..98313,98440..98442,98452..98454,
                     98461..98463))
                     /locus_tag="Cpha266_0083"
                     /note="substrate interaction site [chemical binding];
                     other site"
                     /db_xref="CDD:238192"
     gene            complement(99268..100713)
                     /locus_tag="Cpha266_0084"
                     /db_xref="GeneID:4570651"
     CDS             complement(99268..100713)
                     /locus_tag="Cpha266_0084"
                     /note="KEGG: lpn:lpg2913 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910578.1"
                     /db_xref="GI:119355934"
                     /db_xref="InterPro:IPR006025"
                     /db_xref="GeneID:4570651"
                     /translation="MIINSSELTGVLRQYNPWWSGNRFPDLPAWKRAAFHEIAHWVEN
                     PPAGRALLLSGARQVGKTTLFLQAIDELLAKGIPPGNILYATFDHPLLKLAGLDGLLR
                     LWDEAEPSKQGTEYLFLDEIQSIKEWQVWLKHQVDFEKRRRIAVTGSATPLAMEGQES
                     GVGRWHTIKLATLSFYEYLKLRNDPVPKLPAISSLADLFDMTPAWFSKTGSEARILTG
                     FFHEYLLRGGFPQTATVSSIPLAQKLLREDIVDKILKRDMTALFGVRRIIELEQTFLY
                     LCLHDGGMLDMQELSKNLEVKRPTAMSFISILEATHLIYRLQPFGYGKEILRGKHKIY
                     LADPAIAPGVLLKGISLLDNPTLLGQAAETAFFKHVFSRYYARSIAFSYWRGGKKGLE
                     VDIIADIGGRYVPFEVKYRSTAVETADLKGLTEFCRTRAVNKSCVITRNMEDFGIIPL
                     TGDNNIQALKIPAPLVCYWLGESETTSAVGS"
     misc_feature    complement(99367..100680)
                     /locus_tag="Cpha266_0084"
                     /note="Predicted ATPase (AAA+ superfamily) [General
                     function prediction only]; Region: COG1373"
                     /db_xref="CDD:224292"
     misc_feature    complement(100177..100572)
                     /locus_tag="Cpha266_0084"
                     /note="AAA domain; Region: AAA_14; pfam13173"
                     /db_xref="CDD:221955"
     misc_feature    complement(<99430..>99558)
                     /locus_tag="Cpha266_0084"
                     /note="Superfamily of nucleases including Short Patch
                     Repair (Vsr) Endonucleases, archaeal Holliday junction
                     resolvases, MutH methy-directed DNA mismatch-repair
                     endonucleases, and catalytic domains of many restriction
                     endonucleases, such as EcoRI, BamHI, and...; Region:
                     Restriction_endonuclease_like; cl00277"
                     /db_xref="CDD:241746"
     misc_feature    complement(order(99487..99489,99493..99495,99532..99534))
                     /locus_tag="Cpha266_0084"
                     /note="putative active site [active]"
                     /db_xref="CDD:238508"
     gene            complement(100871..101596)
                     /locus_tag="Cpha266_0085"
                     /db_xref="GeneID:4570652"
     CDS             complement(100871..101596)
                     /locus_tag="Cpha266_0085"
                     /note="PFAM: 4'-phosphopantetheinyl transferase;
                     KEGG: cte:CT2196 EntD/Gsp/HetI/Sfp family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="4'-phosphopantetheinyl transferase"
                     /protein_id="YP_910579.1"
                     /db_xref="GI:119355935"
                     /db_xref="InterPro:IPR008278"
                     /db_xref="GeneID:4570652"
                     /translation="MIIAKETVTLIHTDTKIHGLPETELYESLSDDEKTRAGRIHAAS
                     ERQNFIVRRGILRSLLGTTFGIEPFRIRFAATPVGKPFVAFPGNSGIFFNLSHSGNDI
                     VYAFSGHPETGIDIERIRTLEDIDELARNYFSAEEYAILMNQPGWKKNNAFIRIWSLK
                     EALIKASGWPLEQGLAAFDVAAYCQMNRFELPFGDIHTFTCIAPVFDYICGFATALAI
                     RLDRNEPLNIKRYSLQGGQFFEL"
     misc_feature    complement(<101048..101527)
                     /locus_tag="Cpha266_0085"
                     /note="Phosphopantetheinyl transferase [Coenzyme
                     metabolism]; Region: Sfp; COG2091"
                     /db_xref="CDD:225002"
     misc_feature    complement(<101093..101260)
                     /locus_tag="Cpha266_0085"
                     /note="4'-phosphopantetheinyl transferase superfamily;
                     Region: ACPS; pfam01648"
                     /db_xref="CDD:216625"
     gene            complement(102059..102997)
                     /locus_tag="Cpha266_0086"
                     /db_xref="GeneID:4570653"
     CDS             complement(102059..102997)
                     /locus_tag="Cpha266_0086"
                     /note="KEGG: cte:CT1464 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910580.1"
                     /db_xref="GI:119355936"
                     /db_xref="GeneID:4570653"
                     /translation="MKRITIPALLAIMLLLCQSLSFAAVSQFTGTWKNTDPNTAGVTK
                     LSITGNGNSLRMRAWGKCHPQDCDWGEVNAYAYAPGVSSDIDQNAQAVSALFTTGFSQ
                     TLVIVRPISRSSIRADIYTRFTDNSGRSNYTASYTFNRQLIVGPIGPIGPIGPIRPMP
                     SVEEDCISFNPSTVTVKNLDGRWTIVDGNHLMFNFGPNRTEALQALRIIKHYRMNSSC
                     FVGRPDPSFQYLLVNGRAPQGNMPGEDCVSFNPNTIEVRNIGGSWKIVDGSHWVFDFG
                     SKEDEARKAFAIIKKYGFTRSCFVGRPDPSFQYLKK"
     sig_peptide     complement(102926..102997)
                     /locus_tag="Cpha266_0086"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 1.000) with cleavage site probability 0.987 at
                     residue 24"
     gene            103347..104657
                     /locus_tag="Cpha266_0087"
                     /db_xref="GeneID:4570654"
     CDS             103347..104657
                     /locus_tag="Cpha266_0087"
                     /note="PFAM: protein of unknown function DUF894, DitE;
                     major facilitator superfamily MFS_1;
                     KEGG: cte:CT0102 transporter, putative"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator transporter"
                     /protein_id="YP_910581.1"
                     /db_xref="GI:119355937"
                     /db_xref="InterPro:IPR007114"
                     /db_xref="InterPro:IPR010290"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="GeneID:4570654"
                     /translation="MSNADESINGNDNSPAEQSPTTLKEKVLSAFPAFRSRNFRLYFI
                     GQIVSMVGTWLQMVAQGWLVLEMTGSAFWVGVAAAASSLPTLFLSLIGGVIVDRYNRK
                     TILLWTQSASMVLALVLGIITLTGSVTLAVILALAFLLGCVAAVATPAIQAFLSEMVD
                     RDQLHSAVALNAAIFNASRVIGPAIAGLMIAWIGTGGAFIANGLSYFAVIAALLAITI
                     ATPRKIPAVHQPPLQSIRDGIVYTWEHPVIRTIVMFVSVVSIFGWSFMSMLPVVAKQT
                     YGLGSDGMGYLFSAFGLGSLSGTVVVSMSSGKIRSSAMVIGGILVFSLALTAFTFASD
                     ERVAMAFLFIAGIGMLSAFATMTATVQRLVEDSYRGRVMSIYLMVLMGFMPLGNLQVG
                     FLSEQFGTAIAIRIGSIVVLLATIFLFSYRKEIQSAWHEYRMQE"
     misc_feature    103461..104603
                     /locus_tag="Cpha266_0087"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    103461..104543
                     /locus_tag="Cpha266_0087"
                     /note="H+ Antiporter protein; Region: 2A0121; TIGR00900"
                     /db_xref="CDD:162098"
     misc_feature    order(103503..103505,103512..103520,103524..103529,
                     103578..103580,103587..103592,103599..103601,
                     103611..103616,103620..103625,103776..103781,
                     103788..103793,103800..103805,103812..103814,
                     103848..103853,103860..103865,103881..103883,
                     104121..104123,104130..104135,104142..104147,
                     104154..104156,104196..104198,104208..104210,
                     104220..104222,104229..104231,104241..104243,
                     104382..104384,104391..104396,104403..104405,
                     104415..104420,104427..104429,104460..104465,
                     104472..104477,104484..104489,104496..104498)
                     /locus_tag="Cpha266_0087"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(104732..105310)
                     /locus_tag="Cpha266_0088"
                     /db_xref="GeneID:4570655"
     CDS             complement(104732..105310)
                     /locus_tag="Cpha266_0088"
                     /note="KEGG: eli:ELI_01410 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910582.1"
                     /db_xref="GI:119355938"
                     /db_xref="InterPro:IPR000437"
                     /db_xref="GeneID:4570655"
                     /translation="MQFGKTFQIPALIAVSCALVAPAPAMAEHGRNTRTVAAAVAAAA
                     IVGLAINAANHQGHYKDGRRYDNDRDSGEFDRGYRDGLYDTNRNNYNHTDAYRDGYRA
                     GQDERELRVSHNQSNRWEQGRHVADSNMMYKATDEAERYWNLPRGSATPVRSSYNEDS
                     GNYRVAVAAGYLRGVCVLDRYGRVIRFEDKRD"
     sig_peptide     complement(105227..105310)
                     /locus_tag="Cpha266_0088"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 1.000) with cleavage site probability 0.999 at
                     residue 28"
     gene            complement(105373..105780)
                     /locus_tag="Cpha266_0089"
                     /db_xref="GeneID:4570656"
     CDS             complement(105373..105780)
                     /locus_tag="Cpha266_0089"
                     /note="KEGG: rsp:RSP_2032 putative hypothetical Gifsy-1
                     prophage protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Gifsy-1 prophage protein"
                     /protein_id="YP_910583.1"
                     /db_xref="GI:119355939"
                     /db_xref="GeneID:4570656"
                     /translation="MKTKSLVFLLLFTLFSIRAYAADDRYEQVKFPRGASGTSIKSSI
                     VGYQGVNYTLDAKAGQTMTVKLQSSNLSNYFNIYAPGKGPGDEAMVIGDINGNSYSGV
                     LPSTGTYTIQVFLMRNAARRNEKASYTLDISVK"
     sig_peptide     complement(105715..105780)
                     /locus_tag="Cpha266_0089"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 1.000) with cleavage site probability 0.999 at
                     residue 22"
     gene            106136..106678
                     /locus_tag="Cpha266_0090"
                     /db_xref="GeneID:4570657"
     CDS             106136..106678
                     /locus_tag="Cpha266_0090"
                     /EC_number="1.8.4.11"
                     /note="KEGG: cte:CT0103 PilB-related protein;
                     TIGRFAM: methionine-R-sulfoxide reductase;
                     PFAM: Methionine sulfoxide reductase B"
                     /codon_start=1
                     /transl_table=11
                     /product="methionine-R-sulfoxide reductase"
                     /protein_id="YP_910584.1"
                     /db_xref="GI:119355940"
                     /db_xref="InterPro:IPR000437"
                     /db_xref="InterPro:IPR002579"
                     /db_xref="GeneID:4570657"
                     /translation="MHRMLMFIFFATVGLFACSGEPTSPKFSPSKAMSDSRALNPYYS
                     RTDTTKLDLPDSVWKKVLPPEVYEVARKAGTERAFTGKLWDFEGIGTYYCAACGNALF
                     RSDAKFASTCGWPSFFETVRPGSVEYRTDMAFGMARTEVLCGRCGAHLGHVFDDGPPP
                     TGKRFCMNSIVLDFEPDEGD"
     sig_peptide     106136..106195
                     /locus_tag="Cpha266_0090"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 0.982) with cleavage site probability 0.716 at
                     residue 20"
     misc_feature    106283..106669
                     /locus_tag="Cpha266_0090"
                     /note="Conserved domain frequently associated with peptide
                     methionine sulfoxide reductase [Posttranslational
                     modification, protein turnover, chaperones]; Region:
                     COG0229; cl15841"
                     /db_xref="CDD:247098"
     misc_feature    106298..106666
                     /locus_tag="Cpha266_0090"
                     /note="SelR domain; Region: SelR; pfam01641"
                     /db_xref="CDD:201899"
     gene            complement(106689..107087)
                     /locus_tag="Cpha266_0091"
                     /db_xref="GeneID:4570658"
     CDS             complement(106689..107087)
                     /locus_tag="Cpha266_0091"
                     /note="PFAM: PilT protein domain protein;
                     KEGG: eba:ebB17 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="PilT domain-containing protein"
                     /protein_id="YP_910585.1"
                     /db_xref="GI:119355941"
                     /db_xref="InterPro:IPR002716"
                     /db_xref="InterPro:IPR006162"
                     /db_xref="GeneID:4570658"
                     /translation="MRYLLDTNICIYIINSRPADVLKRFRQEQIGTIGISSITAAELT
                     FGVIKSGSEKNRRALEMFFTPLEILPFDGSIIWHYGRLRYYLEKLGQPIGALDTMIAS
                     HALALDTVLVTNNVREFMRVPGLRYENWAE"
     misc_feature    complement(106701..107078)
                     /locus_tag="Cpha266_0091"
                     /note="PIN domain of ribonucleases (toxins), VapC and
                     FitB, of prokaryotic toxin/antitoxin operons, Pyrococcus
                     horikoshii protein PH0500, and other similar bacterial and
                     archaeal homologs; Region: PIN_VapC-FitB; cd09881"
                     /db_xref="CDD:189051"
     misc_feature    complement(order(106731..106733,106788..106793,
                     106797..106802,106806..106808,106827..106829,
                     106836..106841,106848..106853,106857..106859,
                     106872..106880,106884..106886,106908..106910,
                     106917..106919,106950..106958,106962..106970,
                     106974..106979,106989..106991,107010..107012,
                     107019..107021,107043..107051,107055..107060,
                     107067..107075))
                     /locus_tag="Cpha266_0091"
                     /note="oligomeric interface; other site"
                     /db_xref="CDD:189051"
     misc_feature    complement(order(106743..106745,106797..106799,
                     106962..106964,107070..107072))
                     /locus_tag="Cpha266_0091"
                     /note="putative active site [active]"
                     /db_xref="CDD:189051"
     misc_feature    complement(order(106794..106796,106800..106805,
                     106836..106841,106845..106853,106857..106862,
                     106875..106877,106902..106904,106911..106916,
                     106953..106958,106962..106967,106974..106979))
                     /locus_tag="Cpha266_0091"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:189051"
     gene            complement(107084..107362)
                     /locus_tag="Cpha266_0092"
                     /db_xref="GeneID:4570659"
     CDS             complement(107084..107362)
                     /locus_tag="Cpha266_0092"
                     /note="KEGG: eba:ebD28 virulence associated protein B"
                     /codon_start=1
                     /transl_table=11
                     /product="virulence associated protein B"
                     /protein_id="YP_910586.1"
                     /db_xref="GI:119355942"
                     /db_xref="GeneID:4570659"
                     /translation="MYRGDPNDKERISIPMETAKIFQSGRSQAVRLPKEFRFQGKEVL
                     ISHFADGVLLLPIDKSWATLEAALEEFEPEFKLEREQPEAEKREAIAS"
     misc_feature    complement(107096..107311)
                     /locus_tag="Cpha266_0092"
                     /note="Virulence-associated protein and related proteins
                     [Function unknown]; Region: VagC; COG4456"
                     /db_xref="CDD:226863"
     gene            complement(107423..108994)
                     /locus_tag="Cpha266_0093"
                     /db_xref="GeneID:4570660"
     CDS             complement(107423..108994)
                     /locus_tag="Cpha266_0093"
                     /note="TIGRFAM: drug resistance transporter, EmrB/QacA
                     subfamily;
                     PFAM: major facilitator superfamily MFS_1;
                     KEGG: cch:Cag_0039 drug resistance transporter EmrB/QacA
                     subfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="EmrB/QacA family drug resistance transporter"
                     /protein_id="YP_910587.1"
                     /db_xref="GI:119355943"
                     /db_xref="InterPro:IPR001411"
                     /db_xref="InterPro:IPR004638"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR007114"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="GeneID:4570660"
                     /translation="MLPAAHAYETGSRRIIITLTVIVSAMLELIDTTIVNVAITEISG
                     NLGASIEDVAWVVTSYAIANVIVIPLSGFLGNLLGRRNYYIGSILLFTAASLLCGIAT
                     DIWTLVFFRFLQGIGGGALLPTSQAILYETYPPEDRGKATGIFSMGLVLGPTFGPLLG
                     GFLVDNFSWEWCFFVNIPVGLLAAWSAFTFIKEPKTVHKVVKIDWAGIGLLTIGIGSL
                     QFILERGESKDWFETPYITWFTIIAIVSLMLFVWWELRVEEPAVDLSVLARSHNLAIA
                     AVLTFVVGYGLYGSLFVFPVFVQRLLGFSALLTGTVLFPSALVTGIIALPLGIALQKG
                     ASAKILMTVGMAAFSIFCWELGQQTMQSGAGNFFWILLLRGVALGFIFIPVTMLAVAG
                     LHGKDIGQATGLNNMVRQLGGSFGIALTNTYIVKRVAEHRNEILSNLSPYDPAAVERL
                     NAIGQAAQSRMISPVEAEQVALRALEGTVTAQSYHLAYMDAFMLIALLFALCMPLLFF
                     IRIKKGEKADLSQAH"
     misc_feature    complement(107471..108952)
                     /locus_tag="Cpha266_0093"
                     /note="drug resistance transporter, EmrB/QacA subfamily;
                     Region: efflux_EmrB; TIGR00711"
                     /db_xref="CDD:129794"
     misc_feature    complement(<108419..108943)
                     /locus_tag="Cpha266_0093"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(108536..108538,108554..108559,
                     108566..108571,108605..108607,108614..108619,
                     108626..108631,108638..108643,108779..108784,
                     108788..108793,108803..108805,108812..108817,
                     108824..108826,108875..108880,108884..108892,
                     108899..108901))
                     /locus_tag="Cpha266_0093"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     misc_feature    complement(107735..>108178)
                     /locus_tag="Cpha266_0093"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     gene            complement(109147..110133)
                     /locus_tag="Cpha266_0094"
                     /db_xref="GeneID:4570661"
     CDS             complement(109147..110133)
                     /locus_tag="Cpha266_0094"
                     /note="PFAM: secretion protein HlyD family protein;
                     KEGG: cte:CT0105 multidrug resistance protein A"
                     /codon_start=1
                     /transl_table=11
                     /product="secretion protein HlyD family protein"
                     /protein_id="YP_910588.1"
                     /db_xref="GI:119355944"
                     /db_xref="InterPro:IPR006143"
                     /db_xref="GeneID:4570661"
                     /translation="MAEQEKNIGTAEKPEEKATNPLRLVITVLLVLAAVVWGGSKIRH
                     SFLYVETDNAQIEGDVYPVISKVPGTVQSVLVRTNQEVRRGDTLVLLDPADYKVKRDM
                     AEAALQNARASVSAAGEAATAAAATGQKLKSDLARSQNLRRQDVISPSEFDAVKAAAL
                     SSSAQSAAAESQHRGAAAQVTMRQAELRNADLQLSYTTITAPAAGHVSKKNVQPGQYV
                     APGQQLIALVGSSELWVVANFKETQLENIRTGQPVTIRVDAYPGKEFEGRVESISSGT
                     GARFALLPPDNASGNFVKVAQRVPVKILFTGKPDKDHKLAAGMNVVVEIKVK"
     misc_feature    complement(109159..109992)
                     /locus_tag="Cpha266_0094"
                     /note="efflux pump membrane protein (multidrug resistance
                     protein A); Region: 8a0101; TIGR00998"
                     /db_xref="CDD:233228"
     misc_feature    complement(109810..109947)
                     /locus_tag="Cpha266_0094"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     pfam13533"
                     /db_xref="CDD:205711"
     misc_feature    complement(<109297..109542)
                     /locus_tag="Cpha266_0094"
                     /note="HlyD family secretion protein; Region: HlyD_3;
                     pfam13437"
                     /db_xref="CDD:222128"
     gene            complement(110135..110608)
                     /locus_tag="Cpha266_0095"
                     /db_xref="GeneID:4570662"
     CDS             complement(110135..110608)
                     /locus_tag="Cpha266_0095"
                     /note="PFAM: UspA domain protein;
                     KEGG: cte:CT0106 universal stress protein family"
                     /codon_start=1
                     /transl_table=11
                     /product="UspA domain-containing protein"
                     /protein_id="YP_910589.1"
                     /db_xref="GI:119355945"
                     /db_xref="InterPro:IPR006015"
                     /db_xref="InterPro:IPR006016"
                     /db_xref="GeneID:4570662"
                     /translation="MKTKPKKIICAVDFSPLSDNLVTYAAGLRPYDAELTLLYIEKEG
                     KRTLNMLQNRLHAFSRYSELLVQANRSARFAVECGDPAAEILAYADRVHADLLLLGSH
                     GSTAFTRLLMGSTAETVLRRAACPVAIYKVPDRRTPARKRQEATTLLLKDNKQTA"
     misc_feature    complement(110222..110590)
                     /locus_tag="Cpha266_0095"
                     /note="Usp: Universal stress protein family. The universal
                     stress protein Usp is a small cytoplasmic bacterial
                     protein whose expression is enhanced when the cell is
                     exposed to stress agents. Usp enhances the rate of cell
                     survival during prolonged exposure to...; Region:
                     USP_Like; cd00293"
                     /db_xref="CDD:238182"
     misc_feature    complement(order(110261..110272,110300..110305,
                     110309..110314,110489..110491,110570..110578))
                     /locus_tag="Cpha266_0095"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238182"
     gene            complement(110611..111936)
                     /locus_tag="Cpha266_0096"
                     /db_xref="GeneID:4570663"
     CDS             complement(110611..111936)
                     /locus_tag="Cpha266_0096"
                     /note="PFAM: outer membrane efflux protein;
                     KEGG: cch:Cag_0041 outer membrane protein, putative"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane efflux protein"
                     /protein_id="YP_910590.1"
                     /db_xref="GI:119355946"
                     /db_xref="InterPro:IPR003423"
                     /db_xref="GeneID:4570663"
                     /translation="MKKTLKIHACIATAALMLAIPHRTDAVMPPPGAPMTLEETIMLV
                     KENNPALKAAAEEVNAADARIRQQKSAYYPQISASAGYRYIDPVSEMGFGGSEPLQFM
                     PNNNYEAKISAKATLLDFGRRGVEIDLAESGKNSAVHTLTLTRRDLSFSTVELFYGIL
                     FLRESIRVEEKEITALQKAFDYTSKRYQAGTATRFDVLTTDVRIQAARSKKLNLEHQV
                     RRNELALYRLTGIATDRPLELKGSFSVHPARPLESTLVAEAMKQRPEVQLAGENEQSA
                     KLRRSLAVKAGLPVVSATASWGAANGYQPDIDEIRENIAAGIHIELPIFTGFRTTAER
                     QEASARLRAATLRKLDTEEQVKTDVEETLHALETARKNILTTQSQVQLANLAAEHARA
                     RYQNGIATTLDLLDTESSLAQAELSRLQAAYDYVMNSYTLKRATGETFW"
     sig_peptide     complement(111856..111936)
                     /locus_tag="Cpha266_0096"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 0.999) with cleavage site probability 0.997 at
                     residue 27"
     misc_feature    complement(110623..111840)
                     /locus_tag="Cpha266_0096"
                     /note="type I secretion outer membrane protein, TolC
                     family; Region: type_I_sec_TolC; TIGR01844"
                     /db_xref="CDD:233594"
     gene            112186..114285
                     /locus_tag="Cpha266_0097"
                     /db_xref="GeneID:4570664"
     CDS             112186..114285
                     /locus_tag="Cpha266_0097"
                     /note="PFAM: sigma-54 factor, interaction
                     domain-containing protein; helix-turn-helix, Fis-type; GAF
                     domain protein; ATPase associated with various cellular
                     activities, AAA_5;
                     SMART: AAA ATPase;
                     KEGG: plt:Plut_0058 transcriptional regulator, fis family"
                     /codon_start=1
                     /transl_table=11
                     /product="Fis family transcriptional regulator"
                     /protein_id="YP_910591.1"
                     /db_xref="GI:119355947"
                     /db_xref="InterPro:IPR002078"
                     /db_xref="InterPro:IPR002197"
                     /db_xref="InterPro:IPR003018"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="GeneID:4570664"
                     /translation="MQNIAVHEASTLMRYISNAIGSIRDPQELFRTVTDKLRLVFEFD
                     SAFIITLDRDRRFINVVFEMVRFDLPDTIQRKKRPVAGSWIESHLGDEGVSVVAIEGE
                     MDRYPADFPVPRMLYDLGMRQVVLSPLRSGGKVIGFLNFVSREQKQWKESDKELLSTL
                     SSPVAVALSSALAYEELRQREAQTAMQLAVNNALLTIKDRSRMLLAVCEQIDKLVPCT
                     FLGIRVMDRDGNFRIFDNFMRETPSGFFPVSAHEKLDVPDFAEMARESFSLITSPGCF
                     SGEAFQLLCDKYRLVGLVREKFNICSLISVRLWDLPGSCAGLIISDTSRAFDEHDQET
                     VGLIVPQLSLALQNYLAFEEIDKLRRKLEGEKAYLFEEIKATHDFEEIKGESAVLASV
                     LHRVSQVAPTDATVLIQGETGTGKELFARALHNLSRRRNRMLVKVNCAALPATLIESE
                     LFGHEKGSFTGAIERRIGKFELAEGGTVFLDEVGELPLELQAKLLRVLQERELERLGG
                     RGVISVDVRVLAATNRNLEKEVAEGRFREDLFFRLNVFPLFVPPLRERREDIPLLALY
                     FAAKFARLMGKPHCEFRESDMLLLKAREWKGNIRELAHLVEQAVIVSDGRWLDFSTML
                     SPSLAFTEPREQGQLKSMREFEEQVAMMERELILEVLSQSNGRVSGEGGAAEKLGMHP
                     KTLYSRIEKLEIRKRYR"
     misc_feature    112231..112728
                     /locus_tag="Cpha266_0097"
                     /note="FOG: GAF domain [Signal transduction mechanisms];
                     Region: FhlA; COG2203"
                     /db_xref="CDD:225113"
     misc_feature    112258..112650
                     /locus_tag="Cpha266_0097"
                     /note="GAF domain; Region: GAF; pfam01590"
                     /db_xref="CDD:216590"
     misc_feature    113335..114225
                     /locus_tag="Cpha266_0097"
                     /note="psp operon transcriptional activator PspF; Region:
                     phageshock_pspF; TIGR02974"
                     /db_xref="CDD:234077"
     misc_feature    113353..113817
                     /locus_tag="Cpha266_0097"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    113413..113436
                     /locus_tag="Cpha266_0097"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(113416..113439,113626..113628,113752..113754)
                     /locus_tag="Cpha266_0097"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    113614..113631
                     /locus_tag="Cpha266_0097"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    113809..113811
                     /locus_tag="Cpha266_0097"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    114130..114261
                     /locus_tag="Cpha266_0097"
                     /note="Bacterial regulatory protein, Fis family; Region:
                     HTH_8; pfam02954"
                     /db_xref="CDD:202485"
     gene            complement(114296..115678)
                     /locus_tag="Cpha266_0098"
                     /db_xref="GeneID:4570665"
     CDS             complement(114296..115678)
                     /locus_tag="Cpha266_0098"
                     /note="PFAM: CBS domain containing protein; protein of
                     unknown function DUF21; transporter-associated region;
                     KEGG: plt:Plut_2077 CBS domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910592.1"
                     /db_xref="GI:119355948"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR002550"
                     /db_xref="InterPro:IPR005170"
                     /db_xref="GeneID:4570665"
                     /translation="MKRHTEHEFREPDNLSMEILFLLFLIIINGIFAMSEIALITTKR
                     TRLTKLAESGDKSAAAALKLGHEPTTFLSTIQIGITSIGILNGIVGQGALAEPFAVWL
                     ESLGMAHDASHIGATAVVVISITYITIVVGELVPKRLGQFNPEGAARLFARPMLMLAT
                     IARPFVRLLSVSTDTLLRLMGKSPQAMPSVTEEEIHAMLEEGSEAGVIEQQEHDMVRN
                     VFRLDDRQLGSLMVPRADIVYLDITRPLEENILRVTESEHSRFPVCNGGMQSLLGVVN
                     AKQLLSQTLKGGLNDFTSQLQPYVYVPETLTGMELLDHFRTSGTQMVFVVDEYGEVQG
                     LVTLQDMLEAVTGEFVPRNLEDSWAVEREDGSWLLDGLIPVPELKDKLELLSVPEEDK
                     GLYHTLSGLLMWSLGRMPQTGDVATWENWRLEIVDLDGNRIDKVLASKIPPPDTNGLK
                     QNGSAAGEKN"
     misc_feature    complement(114350..115594)
                     /locus_tag="Cpha266_0098"
                     /note="Hemolysins and related proteins containing CBS
                     domains [General function prediction only]; Region: TlyC;
                     COG1253"
                     /db_xref="CDD:224173"
     misc_feature    complement(115043..115594)
                     /locus_tag="Cpha266_0098"
                     /note="Domain of unknown function DUF21; Region: DUF21;
                     pfam01595"
                     /db_xref="CDD:216595"
     misc_feature    complement(114647..114976)
                     /locus_tag="Cpha266_0098"
                     /note="This cd contains two tandem repeats of the
                     cystathionine beta-synthase (CBS pair) domains associated
                     with the CorC_HlyC domain. CorC_HlyC is a transporter
                     associated domain. This small domain is found in Na+/H+
                     antiporters, in proteins involved in...; Region:
                     CBS_pair_CorC_HlyC_assoc; cd04590"
                     /db_xref="CDD:239963"
     misc_feature    complement(114356..114601)
                     /locus_tag="Cpha266_0098"
                     /note="Transporter associated domain; Region: CorC_HlyC;
                     smart01091"
                     /db_xref="CDD:215020"
     gene            complement(115662..115976)
                     /locus_tag="Cpha266_0099"
                     /db_xref="GeneID:4569453"
     CDS             complement(115662..115976)
                     /locus_tag="Cpha266_0099"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910593.1"
                     /db_xref="GI:119355949"
                     /db_xref="GeneID:4569453"
                     /translation="MPWYIAYRVRHKSMRFLRDSPMIFSCLNLFVRQYVIINEFLTAT
                     LTSFGSELLLSGIFDPDEQRRKEPWKGRKKKCGKNIPEKSYLYPETTGFPVRLLINET
                     PH"
     misc_feature    complement(<115827..>115946)
                     /locus_tag="Cpha266_0099"
                     /note="Conserved oligomeric complex COG6; Region: COG6;
                     pfam06419"
                     /db_xref="CDD:219018"
     gene            complement(116027..116800)
                     /locus_tag="Cpha266_0100"
                     /db_xref="GeneID:4569454"
     CDS             complement(116027..116800)
                     /locus_tag="Cpha266_0100"
                     /EC_number="1.3.5.1"
                     /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
                     protein;
                     KEGG: plt:Plut_2080 succinate dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="succinate dehydrogenase/fumarate reductase
                     iron-sulfur subunit"
                     /protein_id="YP_910594.1"
                     /db_xref="GI:119355950"
                     /db_xref="InterPro:IPR001041"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="InterPro:IPR006058"
                     /db_xref="GeneID:4569454"
                     /translation="MNFTLKIWRQSNTKAKGGLVTYNVADISAECSFFEMLDILNQQL
                     ITSGNDPVSFDHDCREGICGTCSLYINGRPHGPLKGITTCQLHMRSFSDGDTITIEPW
                     RAKAFPIVRDLIVDRSALDKIIQAGGYISVNTGGIPDANTLPVQKERSDASFDAAACI
                     GCGACVAACPNASAMLFAGAKVSHLSLLPQGKIEAARRVRNMVACMDELGFGNCSNSY
                     ACEAECPKGISVSVIARMNREFLGAKLFSEKDKAIRNAL"
     misc_feature    complement(116051..116800)
                     /locus_tag="Cpha266_0100"
                     /note="succinate dehydrogenase/fumarate reductase
                     iron-sulfur subunit; Validated; Region: PRK07570"
                     /db_xref="CDD:181038"
     misc_feature    complement(116438..116791)
                     /locus_tag="Cpha266_0100"
                     /note="2Fe-2S iron-sulfur cluster binding domain; Region:
                     Fer2_3; pfam13085"
                     /db_xref="CDD:221911"
     gene            complement(116807..118783)
                     /gene="sdhA"
                     /locus_tag="Cpha266_0101"
                     /db_xref="GeneID:4569455"
     CDS             complement(116807..118783)
                     /gene="sdhA"
                     /locus_tag="Cpha266_0101"
                     /EC_number="1.3.5.1"
                     /note="part of four member succinate dehydrogenase enzyme
                     complex that forms a trimeric complex (trimer of
                     tetramers); SdhA/B are the catalytic subcomplex and can
                     exhibit succinate dehydrogenase activity in the absence of
                     SdhC/D which are the membrane components and form
                     cytochrome b556; SdhC binds ubiquinone; oxidizes succinate
                     to fumarate while reducing ubiquinone to ubiquinol"
                     /codon_start=1
                     /transl_table=11
                     /product="succinate dehydrogenase flavoprotein subunit"
                     /protein_id="YP_910595.1"
                     /db_xref="GI:119355951"
                     /db_xref="InterPro:IPR001100"
                     /db_xref="InterPro:IPR003953"
                     /db_xref="InterPro:IPR004112"
                     /db_xref="InterPro:IPR011280"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="GeneID:4569455"
                     /translation="MKALFNDKHDSLMIPLAAGIPEGPISEKWTSYKSGARLVNPNNK
                     RKLDIIVVGTGLAGASAAATLGQLGYRVKVFCYQDTPRRAHSIAAQGGINAAKNYQND
                     GDSVYRLFYDTIKGGDYRAREANVYRLAEVSREIIDLCVAQGVPFAREYGGLLANRSF
                     GGAQVSRTFYARGQTGQQLLLGAYGALSRQIAAGTVTLYNRRDVLDMVIEEGKARGII
                     ARNLVTGEIESHSAHAVVLASGGYGNVFYLSTNAMGSNVTPAWSAYKKGAFFANPAFT
                     QIHPTCIPVHGDFQSKLTLMSESLRNDGRIWVPTDKAIAEKLRKNEITPLDVAEKDRD
                     YYLERRYPAFGNLVPRDVASRAAKERCDAGNGVGITGMAVYLDFADAIKRKGHDTIDA
                     LYGNLFQMYEQISADDPYKTPMKIYPAVHYTMGGLWVDYNLMTTVPGLFSIGECNFSD
                     HGANRLGASALMQGLADGYFILPYTIGNYLASEIHTPRIETGCSAFELAAQSVNDRLS
                     RLMHTGGKQSVDYFHRKLGLIMWEYCGMARTREGLIKALDLINELKTAFALDVRIPGG
                     MQEYNPELEKACRVADFIELGELMVRDALQRNESCGGHFREEFQTPEGEALRNDEEFA
                     FVGAWMYNGPDTKPSLHRENLQFSEIKLSQRCYK"
     misc_feature    complement(116810..118750)
                     /gene="sdhA"
                     /locus_tag="Cpha266_0101"
                     /note="succinate dehydrogenase flavoprotein subunit;
                     Reviewed; Region: sdhA; PRK07573"
                     /db_xref="CDD:236054"
     misc_feature    complement(117389..118519)
                     /gene="sdhA"
                     /locus_tag="Cpha266_0101"
                     /note="L-aspartate oxidase; Provisional; Region: PRK06175"
                     /db_xref="CDD:180442"
     misc_feature    complement(116813..117217)
                     /gene="sdhA"
                     /locus_tag="Cpha266_0101"
                     /note="Fumarate reductase flavoprotein C-term; Region:
                     Succ_DH_flav_C; pfam02910"
                     /db_xref="CDD:217281"
     gene            complement(118798..119526)
                     /locus_tag="Cpha266_0102"
                     /db_xref="GeneID:4569456"
     CDS             complement(118798..119526)
                     /locus_tag="Cpha266_0102"
                     /EC_number="1.3.5.1"
                     /note="TIGRFAM: succinate dehydrogenase (or fumarate
                     reductase) cytochrome b subunit, b558 family;
                     KEGG: cte:CT2268 succinate dehydrogenase, cytochrome
                     subunit, putative"
                     /codon_start=1
                     /transl_table=11
                     /product="succinate dehydrogenase subunit C"
                     /protein_id="YP_910596.1"
                     /db_xref="GI:119355952"
                     /db_xref="InterPro:IPR011138"
                     /db_xref="GeneID:4569456"
                     /translation="MVLPSPAGKTFLCSFSSEKTIVMNKSALLSSITKKVVMALAGLF
                     LATFLFVHLFINLMLLLDDGGQAFTTAASFMGTNPVIRIFEQVLFAGFLLHIVFGILV
                     SIQNRQSRPVSYSYSNRSDTSFLSKYMFHSGIVVLIFLLLHFFDFYFIKVGLVAPPPG
                     VEAHDFYHRSILLFSNNLYASFYLISFLFLGFHLNHATQSAFQSMGWNHSRYTGALKV
                     IGTIYAVVISGGFMAIPIFFLLFR"
     misc_feature    complement(118804..119439)
                     /locus_tag="Cpha266_0102"
                     /note="succinate dehydrogenase (or fumarate reductase)
                     cytochrome b subunit, b558 family; Region: sdhC_b558_fam;
                     TIGR02046"
                     /db_xref="CDD:131101"
     misc_feature    complement(118801..119427)
                     /locus_tag="Cpha266_0102"
                     /note="Succinate:quinone oxidoreductase (SQR)-like Type B
                     subfamily 2, transmembrane subunit; composed of proteins
                     with similarity to the SQRs of Geobacter metallireducens
                     and Corynebacterium glutamicum. SQR catalyzes the
                     oxidation of succinate to fumarate...; Region:
                     SQR_TypeB_2_TM; cd03498"
                     /db_xref="CDD:239578"
     misc_feature    complement(order(118888..118890,118912..118917,
                     118927..118929,119149..119151,119170..119175,
                     119182..119184,119221..119223,119422..119424))
                     /locus_tag="Cpha266_0102"
                     /note="putative Iron-sulfur protein interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239578"
     misc_feature    complement(order(118915..118917,118924..118926,
                     118936..118938,118948..118950,119128..119130,
                     119149..119151,119230..119232,119239..119244,
                     119392..119394,119401..119403,119410..119415))
                     /locus_tag="Cpha266_0102"
                     /note="proximal heme binding site [chemical binding];
                     other site"
                     /db_xref="CDD:239578"
     misc_feature    complement(order(118822..118824,118834..118836,
                     118978..118980,119008..119010,119017..119019,
                     119086..119088,119098..119100,119371..119373,
                     119383..119385))
                     /locus_tag="Cpha266_0102"
                     /note="distal heme binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239578"
     misc_feature    complement(order(118981..118983,118993..118998,
                     119080..119082,119092..119094,119101..119106,
                     119113..119118,119173..119175,119185..119187,
                     119197..119199,119224..119229))
                     /locus_tag="Cpha266_0102"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239578"
     gene            complement(119559..120194)
                     /locus_tag="Cpha266_0103"
                     /db_xref="GeneID:4569457"
     CDS             complement(119559..120194)
                     /locus_tag="Cpha266_0103"
                     /note="PFAM: cyclase family protein;
                     KEGG: cch:Cag_1936 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="cyclase family protein"
                     /protein_id="YP_910597.1"
                     /db_xref="GI:119355953"
                     /db_xref="InterPro:IPR007325"
                     /db_xref="GeneID:4569457"
                     /translation="MNIIDLTHSLEPGMPVYPGTPPPLFQELFSFADQGFRERQITLT
                     THTGTHLDVPSHILERGDDLDSFSVQHFAGPAAVISLNCSPTTRLAIGDLEAHLPSLR
                     GCDFLLLSSGWSRYWGSEKYFTGYPVLSMEAASALAGLGLKGIGVDMISVDDPDAHDL
                     PVHRIFLEKRIILVENLANLEQLPPVGFDFFCMPLKLSHSEASPVRAIAII"
     misc_feature    complement(119562..120194)
                     /locus_tag="Cpha266_0103"
                     /note="Kynurenine formamidase [Amino acid transport and
                     metabolism]; Region: COG1878"
                     /db_xref="CDD:224790"
     gene            120331..120849
                     /locus_tag="Cpha266_0104"
                     /db_xref="GeneID:4569458"
     CDS             120331..120849
                     /locus_tag="Cpha266_0104"
                     /note="KEGG: cte:CT0059 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910598.1"
                     /db_xref="GI:119355954"
                     /db_xref="GeneID:4569458"
                     /translation="MQYFMNLRSAGRLLTVVGFLLPLLSCGKSPEEKLMEKVIEHSTG
                     QKVDIDADGNKLTIESDGQKMEFQQQQKGVWPADIPSDVPEFSRGKIVAVTRASIPEN
                     ESWSVVYEDVKTSDIKEYEPRLKERGFTTSATFFSSDEGEHGTVSGQKGKLNVAVMAG
                     SGKASLSVVSEK"
     gene            120911..121306
                     /locus_tag="Cpha266_0105"
                     /db_xref="GeneID:4569459"
     CDS             120911..121306
                     /locus_tag="Cpha266_0105"
                     /note="PFAM: histidine triad (HIT) protein;
                     KEGG: plt:Plut_2076 Hit family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine triad (HIT) protein"
                     /protein_id="YP_910599.1"
                     /db_xref="GI:119355955"
                     /db_xref="InterPro:IPR001310"
                     /db_xref="GeneID:4569459"
                     /translation="MIAMHNSFYNPDCLFCRIAAGEIPADIVYRDEHVLAFRDINPAA
                     PEHLLIIPLKHIASLNELQSEDKEIAGHLLLAAGEVARRAGLYDSGYRMVFNTGADAL
                     QSVFHIHGHLIGGCRMGWPPFPGEVVGHG"
     misc_feature    120944..121255
                     /locus_tag="Cpha266_0105"
                     /note="Protein Kinase C Interacting protein related
                     (PKCI): PKCI and related proteins belong to the ubiquitous
                     HIT family of hydrolases that act on alpha-phosphates of
                     ribonucleotides. The members of this subgroup have a
                     conserved HxHxHxx motif (x is a...; Region: PKCI_related;
                     cd01276"
                     /db_xref="CDD:238607"
     misc_feature    order(121019..121021,121025..121030,121049..121051,
                     121055..121057,121196..121198,121217..121219,
                     121223..121225,121235..121237,121241..121243)
                     /locus_tag="Cpha266_0105"
                     /note="nucleotide binding site/active site [active]"
                     /db_xref="CDD:238607"
     misc_feature    order(121229..121231,121235..121237,121241..121249)
                     /locus_tag="Cpha266_0105"
                     /note="HIT family signature motif; other site"
                     /db_xref="CDD:238607"
     misc_feature    121235..121237
                     /locus_tag="Cpha266_0105"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238607"
     gene            121365..124133
                     /locus_tag="Cpha266_0106"
                     /db_xref="GeneID:4569460"
     CDS             121365..124133
                     /locus_tag="Cpha266_0106"
                     /EC_number="4.2.1.3"
                     /note="TIGRFAM: aconitate hydratase 1;
                     PFAM: aconitate hydratase domain protein;
                     KEGG: dge:Dgeo_1682 aconitate hydratase 1"
                     /codon_start=1
                     /transl_table=11
                     /product="aconitase"
                     /protein_id="YP_910600.1"
                     /db_xref="GI:119355956"
                     /db_xref="InterPro:IPR000573"
                     /db_xref="InterPro:IPR001030"
                     /db_xref="InterPro:IPR006249"
                     /db_xref="GeneID:4569460"
                     /translation="MRSQKDPSGVTRSLQTGDGTVLYCSLSALETSGFGAVSRLPKSM
                     KVLLESALRNVDDETVRQSDVMLLAEGACAGVKAVEVPFKPARVLLQDFTGVPALVDL
                     ASLREACLLSGGDPERINPVVPCDLVIDHSLQVDAYGTSDALKINLDLEFDRNRERYA
                     FLKWAERAFRNFRVVPPGTGIVHQVNLEYLSRVVCVENGIAFPDSLVGTDSHTTMING
                     LGVTGWGVGGIEAEAVMLGQPVYLLRPSVTGVRVHGELVAGVTATDLVLTMTERLRRV
                     GVVNDFVEFFGPGLDLLSLPDRATIANMAPEYGATMGFFPVDAVTLDYLHMTGRGSCC
                     DLVERYSKEQGLWRDPASDPLFTRVVDFDLGTVVPSVAGPGRPQDRIALSMVKESWLR
                     GFAELYGRQPKVRFPGARVMDNEEGKFFLPDAKPEGDGAGEGRHGFSLDDGAVVIAAI
                     TSCTNTSNPSVMIAAGLLAKAAVSRGLAVKPWVKTSMAPGSRVVSDYLEQSGLAVPLD
                     ALGFNIIGYGCTTCIGNSGPLPENVARAIDAKGVVAAAVLSGNRNFEGRIQSQVRANY
                     LMSPPLVVAYAIAGTMAIDLLTEPMGTDHDGIPVYLRDLWPTQGEVNSVRERSVRQKM
                     YADNYNDVFKGTTQWAEIPASEECLYRWDERSTYICRPPFLDRVAEVPPIPAPVLGAR
                     CLVLFGDSITTDHISPAGSIGASRPAGLYLQSLGVPPGEFNSFGSRRGNHEVMTRGTF
                     DNIRIRNRLAPGMEAGMTTWFSSDGSRREAMPIFDAAMRYLAENVPLVVIAGRDYGMG
                     SSRDWAAKGTLLLGVRAVVARSFERIHRANLVRMGVLPLEFADAGSPESIGLKGDEFF
                     EIPLGGTITPRERITVTATDPLSLEKKQFSVISRIDTPVEADYFRNGGILPAVLRKIL
                     KDEHKTEG"
     misc_feature    121371..124112
                     /locus_tag="Cpha266_0106"
                     /note="aconitate hydratase; Validated; Region: PRK09277"
                     /db_xref="CDD:236445"
     misc_feature    121623..>122513
                     /locus_tag="Cpha266_0106"
                     /note="Aconitase catalytic domain; Aconitase catalyzes the
                     reversible isomerization of citrate and isocitrate as part
                     of the TCA cycle; Region: Aconitase; cl00285"
                     /db_xref="CDD:241753"
     misc_feature    order(121635..121637,121644..121646,121992..121997)
                     /locus_tag="Cpha266_0106"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:153129"
     misc_feature    <122688..123110
                     /locus_tag="Cpha266_0106"
                     /note="Aconitase catalytic domain; Aconitase catalyzes the
                     reversible isomerization of citrate and isocitrate as part
                     of the TCA cycle; Region: Aconitase; cl00285"
                     /db_xref="CDD:241753"
     misc_feature    order(122721..122723,122919..122921,122928..122933,
                     123015..123017)
                     /locus_tag="Cpha266_0106"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:153129"
     misc_feature    123420..123938
                     /locus_tag="Cpha266_0106"
                     /note="Aconitase swivel domain. Aconitase (aconitate
                     hydratase) catalyzes the reversible isomerization of
                     citrate and isocitrate as part of the TCA cycle. This is
                     the aconitase swivel domain, which undergoes swivelling
                     conformational change in the enzyme...; Region:
                     Aconitase_swivel; cl00215"
                     /db_xref="CDD:241693"
     misc_feature    123759..123767
                     /locus_tag="Cpha266_0106"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238236"
     gene            124222..124515
                     /locus_tag="Cpha266_0107"
                     /db_xref="GeneID:4569461"
     CDS             124222..124515
                     /locus_tag="Cpha266_0107"
                     /note="PFAM: FeoA family protein;
                     KEGG: plt:Plut_2075 ferrous iron transport protein A"
                     /codon_start=1
                     /transl_table=11
                     /product="FeoA family protein"
                     /protein_id="YP_910601.1"
                     /db_xref="GI:119355957"
                     /db_xref="InterPro:IPR007167"
                     /db_xref="GeneID:4569461"
                     /translation="MNLSELQVGDKAEVTAVKAESAVRRRILDMGLIKGTCFKVLRVA
                     PLGDPMEIYFKGMYLSLRKKEAEGILVIKTGEHGDGVPMSRNRKTCCSAGDGG"
     misc_feature    124222..124434
                     /locus_tag="Cpha266_0107"
                     /note="FeoA domain; Region: FeoA; pfam04023"
                     /db_xref="CDD:217849"
     gene            124512..126650
                     /locus_tag="Cpha266_0108"
                     /db_xref="GeneID:4569462"
     CDS             124512..126650
                     /locus_tag="Cpha266_0108"
                     /note="TIGRFAM: ferrous iron transport protein B; small
                     GTP-binding protein;
                     PFAM: GTP-binding protein, HSR1-related; Ferrous iron
                     transport protein B domain protein; Ferrous iron transport
                     B domain protein; nucleoside recognition domain protein;
                     KEGG: cch:Cag_1929 ferrous iron transport protein B"
                     /codon_start=1
                     /transl_table=11
                     /product="ferrous iron transport protein B"
                     /protein_id="YP_910602.1"
                     /db_xref="GI:119355958"
                     /db_xref="InterPro:IPR002917"
                     /db_xref="InterPro:IPR003373"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR011619"
                     /db_xref="InterPro:IPR011640"
                     /db_xref="InterPro:IPR011642"
                     /db_xref="GeneID:4569462"
                     /translation="MIEKKGISVALAGNPNCGKSSLFNVLTGARQKVGNFSGVTIEKH
                     EGFLDFKGYSLKVVDLPGIYSLTPYSPEEIVTRRYLIDEKPDVVVNVIEGPNLERNLL
                     LTTQMMEMEVDFVVALNMIDEVEEKGISIDVKQLQKLLGCHIIPTSAKKKTGIDSLLD
                     HVVRAYRKDIDLKKNKLSFRPEVEESVHAIAALLMHQPELERFNPRWLAIKLLENDRE
                     VYHQVQQLPVWIKVELLLQDAIRIAARLFDSDPEVLITEDRHAFIRGAMKECVRQRSP
                     ERATMTDVIDSVVLNRVLGLPIFLFVVWAMFQLTFTLGSPLMDGLEYLFGLLGSSIEP
                     YLGNKILKSIIIDGIIAGVGGVLVFLPNIVLLFIALSFLEASGYMARAAFVIDKVMHR
                     IGLHGKSFIPMITGFGCSIPAIMATRTLKSPTDRLTTILVIPFMSCGAKLPVYVLLAG
                     AFFPPDVAANVLFGIYMLGIGVGLWTAWLLKSTVLKSDSEPFVMELPPYRWPALHAVF
                     FQAKVKAMMYLKKAGTLILGAVMLIWGVSNYPRNPVLDQWLASETSRIGALHMTPVEK
                     TSAIDAVRQQVQADQLEYSVAGRAGKMIEPLIKPLGFDWRIGIALVTGLVAKEVVVST
                     MGTIYALGQTDESSAELKSILKNDPGFSQATALSLMVFVLLYIPCVAAVGVMKKEIGR
                     WKPVLLYSVYVLAVSWILSFVTYRLALILL"
     misc_feature    124524..126647
                     /locus_tag="Cpha266_0108"
                     /note="Fe2+ transport system protein B [Inorganic ion
                     transport and metabolism]; Region: FeoB; COG0370"
                     /db_xref="CDD:223447"
     misc_feature    124539..125015
                     /locus_tag="Cpha266_0108"
                     /note="Ferrous iron transport protein B (FeoB) family;
                     Region: FeoB; cd01879"
                     /db_xref="CDD:206667"
     misc_feature    124548..124571
                     /locus_tag="Cpha266_0108"
                     /note="G1 box; other site"
                     /db_xref="CDD:206667"
     misc_feature    order(124557..124559,124563..124574,124866..124871,
                     124875..124877,124953..124961)
                     /locus_tag="Cpha266_0108"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206667"
     misc_feature    124626..124640
                     /locus_tag="Cpha266_0108"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206667"
     misc_feature    124629..124631
                     /locus_tag="Cpha266_0108"
                     /note="G2 box; other site"
                     /db_xref="CDD:206667"
     misc_feature    124686..124697
                     /locus_tag="Cpha266_0108"
                     /note="G3 box; other site"
                     /db_xref="CDD:206667"
     misc_feature    order(124695..124751,124761..124766)
                     /locus_tag="Cpha266_0108"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206667"
     misc_feature    124866..124877
                     /locus_tag="Cpha266_0108"
                     /note="G4 box; other site"
                     /db_xref="CDD:206667"
     misc_feature    124953..124961
                     /locus_tag="Cpha266_0108"
                     /note="G5 box; other site"
                     /db_xref="CDD:206667"
     misc_feature    125592..125867
                     /locus_tag="Cpha266_0108"
                     /note="Nucleoside recognition; Region: Gate; pfam07670"
                     /db_xref="CDD:219507"
     misc_feature    125892..126053
                     /locus_tag="Cpha266_0108"
                     /note="Ferrous iron transport protein B C terminus;
                     Region: FeoB_C; pfam07664"
                     /db_xref="CDD:203715"
     misc_feature    126258..126560
                     /locus_tag="Cpha266_0108"
                     /note="Nucleoside recognition; Region: Gate; pfam07670"
                     /db_xref="CDD:219507"
     gene            complement(126637..129036)
                     /locus_tag="Cpha266_0109"
                     /db_xref="GeneID:4569463"
     CDS             complement(126637..129036)
                     /locus_tag="Cpha266_0109"
                     /EC_number="5.99.1.2"
                     /note="KEGG: cte:CT0055 DNA topoisomerase I;
                     TIGRFAM: DNA topoisomerase I;
                     PFAM: TOPRIM domain protein; DNA topoisomerase, type IA,
                     central domain protein; DNA topoisomerase, type IA, zn
                     finger domain protein;
                     SMART: DNA topoisomerase I, ATP-binding; DNA topoisomerase
                     I, DNA-binding; Toprim sub domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase I"
                     /protein_id="YP_910603.1"
                     /db_xref="GI:119355959"
                     /db_xref="InterPro:IPR000380"
                     /db_xref="InterPro:IPR003601"
                     /db_xref="InterPro:IPR003602"
                     /db_xref="InterPro:IPR005733"
                     /db_xref="InterPro:IPR006154"
                     /db_xref="InterPro:IPR006171"
                     /db_xref="InterPro:IPR013497"
                     /db_xref="InterPro:IPR013498"
                     /db_xref="GeneID:4569463"
                     /translation="MALKSPAASARNRTLIVVESPSKAKTINKYLGDKYTVFASVGHI
                     KDLPKKEIGLDFDHHYEPRYEVIAGKEKVVRQLKKLADESNEILIATDPDREGEAIAW
                     HIANEVEFAHKPVFRVLFNEITKTAIIAAIQQPRQIDYRLVRSQQTRQGLDKIVGYKI
                     SPFLWNVVLRGLSAGRVQSVALRLICEREAEINGFQIQEYWSIAADFKTDLNETFRTK
                     LIKIKGDKPELSNQKKAETAAAEISERLFAVKEITTRVQQRKPPFPFTTSLLQQAASN
                     QLGFGSQKTMRIAQQLYEGIELGDEGATGLITYMRTDSIRIGTEATAEARNYITAQFG
                     KEYVGYGGAAKAGKNAQDAHEAIRPTSLLRKPESVKHFLSSDQFRLYELIWRRLLTAM
                     MAPAKIEQTRVDVEDREKEFTFRANGSRVLFAGFMRVYDDQQELDYEAQSSTRDDVEK
                     EQTVQLPEKLKEQDKLGLAGLDSKQSFTRPPARYSEATLVKDLDNYGIGRPSTYASIF
                     STLQDRRYVELQKKKIIPTELGKDVSLILVANFPELFNVGFTAHMEDELDKVASGDDE
                     YEAVLEKFYRPLETALSLRKSDPIIPQNSATETCDKCGKGQMTVKWTASGKFLGCSRY
                     PSCKNIKPLSSSKAKPKDTGIQCPSCKEGHMLLRDGRLGPFLACSSYPKCNTLLNLGK
                     QRQVEPMKIPPLLTTLVCPKCGAPMNLRSGKRGLWLGCSKFPKCRGRLAWGTLDEEVQ
                     RHWETLMTEHQKAHPTVALTMIDGRPVPLTLSVDDIITRAEEAGLIAAVPEEQQELTA
                     E"
     misc_feature    complement(126961..129006)
                     /locus_tag="Cpha266_0109"
                     /note="DNA topoisomerase I; Validated; Region: PRK06599"
                     /db_xref="CDD:235840"
     misc_feature    complement(128632..129000)
                     /locus_tag="Cpha266_0109"
                     /note="TOPRIM_TopoIA_TopoI: The topoisomerase-primase
                     (TORPIM) domain found in members of the type IA family of
                     DNA topoisomerases (Topo IA) similar to Escherichia coli
                     DNA topoisomerase I.   Type IA DNA topoisomerases remove
                     (relax) negative supercoils in the...; Region:
                     TOPRIM_TopoIA_TopoI; cd03363"
                     /db_xref="CDD:173783"
     misc_feature    complement(order(128749..128751,128755..128757,
                     128761..128763,128968..128970,128977..128982))
                     /locus_tag="Cpha266_0109"
                     /note="active site"
                     /db_xref="CDD:173783"
     misc_feature    complement(order(128719..128724,128728..128733,
                     128752..128754,128758..128760,128959..128961))
                     /locus_tag="Cpha266_0109"
                     /note="interdomain interaction site; other site"
                     /db_xref="CDD:173783"
     misc_feature    complement(order(128755..128757,128761..128763))
                     /locus_tag="Cpha266_0109"
                     /note="putative metal-binding site [ion binding]; other
                     site"
                     /db_xref="CDD:173783"
     misc_feature    complement(128752..128754)
                     /locus_tag="Cpha266_0109"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:173783"
     misc_feature    complement(127300..128619)
                     /locus_tag="Cpha266_0109"
                     /note="DNA Topoisomerase, subtype IA; DNA-binding,
                     ATP-binding and catalytic domain of bacterial DNA
                     topoisomerases I and III, and eukaryotic DNA topoisomerase
                     III and eubacterial and archael reverse gyrases.
                     Topoisomerases clevage single or double stranded DNA...;
                     Region: TOP1Ac; cd00186"
                     /db_xref="CDD:238110"
     misc_feature    complement(order(128461..128523,128536..128619))
                     /locus_tag="Cpha266_0109"
                     /note="domain I; other site"
                     /db_xref="CDD:238110"
     misc_feature    complement(order(127495..127500,127510..127512,
                     127516..127521,127528..127533,128104..128106,
                     128155..128157,128167..128169,128554..128556,
                     128566..128568,128578..128580,128587..128592))
                     /locus_tag="Cpha266_0109"
                     /note="DNA binding groove [nucleotide binding]"
                     /db_xref="CDD:238110"
     misc_feature    complement(order(127423..127425,128476..128478,
                     128488..128490))
                     /locus_tag="Cpha266_0109"
                     /note="phosphate binding site [ion binding]; other site"
                     /db_xref="CDD:238110"
     misc_feature    complement(order(127600..127632,127747..127803,
                     127807..127809,127816..127857,128257..128298,
                     128422..128448))
                     /locus_tag="Cpha266_0109"
                     /note="domain II; other site"
                     /db_xref="CDD:238110"
     misc_feature    complement(order(127858..127920,127954..127980,
                     128038..128124,128152..128232,128236..128256))
                     /locus_tag="Cpha266_0109"
                     /note="domain III; other site"
                     /db_xref="CDD:238110"
     misc_feature    complement(order(127465..127467,127531..127533,
                     127537..127539,127879..127881,127891..127893,
                     127900..127902,127975..127977,128203..128211,
                     128221..128223))
                     /locus_tag="Cpha266_0109"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238110"
     misc_feature    complement(order(127975..127977,128104..128106,
                     128110..128112))
                     /locus_tag="Cpha266_0109"
                     /note="catalytic site [active]"
                     /db_xref="CDD:238110"
     misc_feature    complement(order(127300..127407,127423..127467,
                     127477..127599))
                     /locus_tag="Cpha266_0109"
                     /note="domain IV; other site"
                     /db_xref="CDD:238110"
     misc_feature    complement(127138..127245)
                     /locus_tag="Cpha266_0109"
                     /note="Topoisomerase DNA binding C4 zinc finger; Region:
                     zf-C4_Topoisom; pfam01396"
                     /db_xref="CDD:110400"
     misc_feature    complement(126997..127107)
                     /locus_tag="Cpha266_0109"
                     /note="Topoisomerase DNA binding C4 zinc finger; Region:
                     zf-C4_Topoisom; pfam01396"
                     /db_xref="CDD:110400"
     misc_feature    complement(<126856..126939)
                     /locus_tag="Cpha266_0109"
                     /note="Topoisomerase DNA binding C4 zinc finger; Region:
                     zf-C4_Topoisom; pfam01396"
                     /db_xref="CDD:110400"
     gene            129197..130975
                     /locus_tag="Cpha266_0110"
                     /db_xref="GeneID:4569464"
     CDS             129197..130975
                     /locus_tag="Cpha266_0110"
                     /EC_number="3.5.1.28"
                     /note="PFAM: cell wall hydrolase/autolysin;
                     KEGG: plt:Plut_2072 N-acetylmuramoyl-L-alanine amidase"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylmuramoyl-L-alanine amidase"
                     /protein_id="YP_910604.1"
                     /db_xref="GI:119355960"
                     /db_xref="InterPro:IPR002508"
                     /db_xref="GeneID:4569464"
                     /translation="MVTGFVIRQYFLFIIMSSFGFRLFRLFFCQLCLVLALVSMALLD
                     AEGVVRPESATLSLQVSKGNGEGYRIKVFALRKAGNILIDVESFARALRLGFRQSNGF
                     LVIDEAETLSGSSCQLRDGNNFVSIVSKDPRQEPGTMQLQATPVQIASKLYLPVSQAC
                     RFFSLWLQREVRYDPATGLISAILWGERPAYSLKKFSSSIQDEPEPVGSNGKRAASSE
                     ALTVISGVSVENRENGALISFSAVGNSVRTLLMKPDKNGIAYLTFQNATGNVDEMTKS
                     FGVGIVQAVKAKRFQKGGFQVALSMDNRSYRINSMEVKRDDINNRYLVYVAGEPDTGG
                     GGMREKESQISRVIERDIEKWKFDTVVLDAGHGGKDPGAIGGHGTMEKDVVLNIVRDL
                     GSIIARQWPDIKVVYTRNSDVFIPLHERGKIANRSGGKLFVSIHCNANSKSHIRGQEV
                     YILGPHRTQKSLEVAMFENSVITREADYRERYKGFSTEYLIMSSMAQNAFAKQSTTLA
                     QDVLKRIERKGGTTSRGVHQAGFMVLWTPSMPSILIETGYLSNPEEERILRERKEQIR
                     IAEAVFQGLDRYRRNNETARLSAVER"
     sig_peptide     129197..129334
                     /locus_tag="Cpha266_0110"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 0.604) with cleavage site probability 0.361 at
                     residue 46"
     misc_feature    130271..130942
                     /locus_tag="Cpha266_0110"
                     /note="N-acetylmuramoyl-L-alanine amidase [Cell envelope
                     biogenesis, outer membrane]; Region: AmiC; COG0860"
                     /db_xref="CDD:223929"
     misc_feature    130271..130924
                     /locus_tag="Cpha266_0110"
                     /note="N-acetylmuramoyl-L-alanine amidase or MurNAc-LAA
                     (also known as peptidoglycan aminohydrolase, NAMLA
                     amidase, NAMLAA, Amidase 3, and peptidoglycan amidase; EC
                     3.5.1.28) is an autolysin that hydrolyzes the amide bond
                     between N-acetylmuramoyl and L-amino...; Region:
                     MurNAc-LAA; cd02696"
                     /db_xref="CDD:119407"
     misc_feature    order(130292..130294,130337..130339,130502..130504,
                     130829..130831)
                     /locus_tag="Cpha266_0110"
                     /note="active site"
                     /db_xref="CDD:119407"
     misc_feature    order(130292..130294,130337..130339,130502..130504)
                     /locus_tag="Cpha266_0110"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:119407"
     gene            131086..132072
                     /locus_tag="Cpha266_0111"
                     /db_xref="GeneID:4569465"
     CDS             131086..132072
                     /locus_tag="Cpha266_0111"
                     /EC_number="6.3.4.15"
                     /note="KEGG: cch:Cag_0077 biotin--acetyl-CoA-carboxylase
                     ligase;
                     TIGRFAM: biotin--acetyl-CoA-carboxylase ligase;
                     PFAM: biotin/lipoate A/B protein ligase; Helix-turn-helix,
                     type 11 domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="biotin--acetyl-CoA-carboxylase ligase"
                     /protein_id="YP_910605.1"
                     /db_xref="GI:119355961"
                     /db_xref="InterPro:IPR004143"
                     /db_xref="InterPro:IPR004408"
                     /db_xref="InterPro:IPR013196"
                     /db_xref="GeneID:4569465"
                     /translation="MNQISSSILHHLRLSGGFLSGEDISVSLGITRSAVWKHIGALRR
                     EGYRIDAVSGQGYRLFSLSGRPVHEEVSPWLTTRFIGRDLHYHELLESTNFSARVLAG
                     TGTREGSVVVADAQSGGRGRMMRSWVSPGGVNLYFSLILRPRVPGIRVPQLTLLAAAA
                     VHQALCSCVPEIASRIKWPNDIMVGEKKLCGVLCEMQSEPDMTHFVIIGIGINVNIGE
                     FPDELRNIATSLFLESGRMVSRPELLASVLNHFESLYEAWLLHDDLGFVLPYLHEYSL
                     VYRRQVIIRQTTGDVCGTVSGIARGGELMLDLDDARTVLISSGDCLLCRQSP"
     misc_feature    <131131..>131262
                     /locus_tag="Cpha266_0111"
                     /note="Biotin operon repressor [Transcription]; Region:
                     BirA; COG1654"
                     /db_xref="CDD:224568"
     misc_feature    131353..132054
                     /locus_tag="Cpha266_0111"
                     /note="Biotin-(acetyl-CoA carboxylase) ligase [Coenzyme
                     metabolism]; Region: BirA; COG0340"
                     /db_xref="CDD:223417"
     misc_feature    131401..131700
                     /locus_tag="Cpha266_0111"
                     /note="Biotin/lipoate A/B protein ligase family; Region:
                     BPL_LplA_LipB; pfam03099"
                     /db_xref="CDD:217367"
     gene            132085..133098
                     /locus_tag="Cpha266_0112"
                     /db_xref="GeneID:4569466"
     CDS             132085..133098
                     /locus_tag="Cpha266_0112"
                     /EC_number="2.8.1.6"
                     /note="KEGG: plt:Plut_2070 biotin synthase;
                     PFAM: Radical SAM domain protein; biotin and thiamin
                     synthesis associated;
                     SMART: Elongator protein 3/MiaB/NifB"
                     /codon_start=1
                     /transl_table=11
                     /product="biotin synthase"
                     /protein_id="YP_910606.1"
                     /db_xref="GI:119355962"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR010722"
                     /db_xref="GeneID:4569466"
                     /translation="MTRMRPVPLHPDILQAYAVLETGEPVCRELAFALGELHGPDVLD
                     LASLAHKVKLRHGGSSGSIHACSIMNARSGVCSENCRFCAQSAHHQAAIDVYGLVDVD
                     AVLFHARQTASEGISHFGIVTSGFGYKTLSKEFRQILAMIDRLHQELPDLEICASLGV
                     LGEEPALELARHGIAQYNINIQVAPRRYGELIADTHSVDDRIDTIKRLRRNNIDVCCG
                     GIIGVGEQMKERVEMIFAFADLDVSVIPLNILVPIDGTPLEGSPGIPLDDIVKTFALC
                     RLVHPRKIIKIAAGRETVMKDFQGLLMLSGADGLLTGGYLTTRGRATADDRMFMRQLQ
                     WFN"
     misc_feature    132190..133092
                     /locus_tag="Cpha266_0112"
                     /note="biotin synthase; Region: bioB; TIGR00433"
                     /db_xref="CDD:232973"
     misc_feature    132310..132861
                     /locus_tag="Cpha266_0112"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    order(132310..132312,132316..132318,132322..132324,
                     132328..132336,132448..132450,132463..132468,
                     132553..132555,132622..132624,132742..132744,
                     132829..132834)
                     /locus_tag="Cpha266_0112"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     misc_feature    132820..>132999
                     /locus_tag="Cpha266_0112"
                     /note="Biotin and Thiamin Synthesis associated domain;
                     Region: BATS; pfam06968"
                     /db_xref="CDD:219245"
     gene            133086..134270
                     /locus_tag="Cpha266_0113"
                     /db_xref="GeneID:4569467"
     CDS             133086..134270
                     /locus_tag="Cpha266_0113"
                     /EC_number="2.3.1.47"
                     /note="PFAM: aminotransferase, class I and II;
                     aminotransferase class-III;
                     KEGG: cch:Cag_0079 8-amino-7-oxononanoate synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="8-amino-7-oxononanoate synthase"
                     /protein_id="YP_910607.1"
                     /db_xref="GI:119355963"
                     /db_xref="InterPro:IPR001917"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="GeneID:4569467"
                     /translation="MVQLSGSMMPIRESIERELLALRQKGRYRELPSVTQRSGNRIRI
                     GGKLLLNLSSNDYLGLGDRREMLDRYLVTLREAGYAMTSSSSRLLTGNHPLYGELEQT
                     LADLYGREAALVFNSGYHANTGILPALSTRHDLILCDRLNHASIIDGLMIAAAPYIRY
                     RHGDYQHLEELLSDAAGRYRQLFIISESVFSMDGDLADLERLVALKKRYGAFLIIDEA
                     HGVGVFGQKGLGLCEVAGMVEGIDMIVGTFGKAFASVGAYAVMDTLFREYLINTMRPL
                     IFTTALPPAILGWSLAVVRQQAVMSDERNRLQALAARLRNALRERGLAVAGESQIVPV
                     VAGGDRQAVLLAEKLAAAGILALPVRPPTVPENSARLRLSLRADLQWEDIESVPELLQ
                     GL"
     misc_feature    133110..134267
                     /locus_tag="Cpha266_0113"
                     /note="8-amino-7-oxononanoate synthase; Reviewed; Region:
                     PRK05958"
                     /db_xref="CDD:235655"
     misc_feature    133128..134180
                     /locus_tag="Cpha266_0113"
                     /note="pyridoxal phosphate-dependent acyltransferase,
                     putative; Region: gly_Cac_T_rel; TIGR01825"
                     /db_xref="CDD:130884"
     misc_feature    order(133437..133442,133449..133451,133644..133646,
                     133731..133733,133740..133742,133824..133826,
                     133833..133835)
                     /locus_tag="Cpha266_0113"
                     /note="pyridoxal 5'-phosphate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:99742"
     misc_feature    133833..133835
                     /locus_tag="Cpha266_0113"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99742"
     gene            134275..134961
                     /locus_tag="Cpha266_0114"
                     /db_xref="GeneID:4569468"
     CDS             134275..134961
                     /locus_tag="Cpha266_0114"
                     /note="PFAM: protein of unknown function DUF452;
                     KEGG: plt:Plut_2068 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910608.1"
                     /db_xref="GI:119355964"
                     /db_xref="InterPro:IPR007398"
                     /db_xref="GeneID:4569468"
                     /translation="MKTAWISRTGELELLLFFAGWGMDSALAEHLWAHDDKEGFGMDI
                     LAFHDYGSLEISPGIREHFESYSKITLIAWSLGVWAAAHAALPRVDRAVALNGTLRPL
                     SERYGISPEVFFATHAGWSEQNRTRFYRRMCGSGEALDHFLSMAPLRSPADQKEELGF
                     LGESLIASENSPLPWGYDQIIIGDRDMVFPFQRQVIAWDGFGVSLVEGMPHFPFFHLK
                     SFREVLLCCK"
     misc_feature    134275..134940
                     /locus_tag="Cpha266_0114"
                     /note="Protein of unknown function (DUF452); Region:
                     DUF452; cl01062"
                     /db_xref="CDD:242278"
     gene            134949..135731
                     /locus_tag="Cpha266_0115"
                     /db_xref="GeneID:4569469"
     CDS             134949..135731
                     /locus_tag="Cpha266_0115"
                     /note="TIGRFAM: biotin biosynthesis protein BioC;
                     PFAM: Methyltransferase type 11; Methyltransferase type
                     12;
                     KEGG: plt:Plut_2067 biotin biosynthesis protein BioC"
                     /codon_start=1
                     /transl_table=11
                     /product="biotin biosynthesis protein BioC"
                     /protein_id="YP_910609.1"
                     /db_xref="GI:119355965"
                     /db_xref="InterPro:IPR011814"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR013217"
                     /db_xref="GeneID:4569469"
                     /translation="MLQVIDKGLVRERFSRTLHSYGSNAPVQNAMAVELARLICREEP
                     TCRFERVLEVGAGTGALTAELLKRCRISLYVANDLVGESLRYISREIEPWQPEAFRFL
                     EGDVETLTELPDRLDLVLSNAALQWLSDLEGFFRRVSALLKPGGLFAFTTFSARNMEE
                     LSSIQKVGLAYPTALDIERFASGSFTPLLIREDRKRLEFASPEEVLRHLSRTGVNGIS
                     RHAWTKSSYERFLHRYRQEFSSGGKVYLTYNPLYCCFRKRLS"
     misc_feature    134985..135719
                     /locus_tag="Cpha266_0115"
                     /note="biotin biosynthesis protein BioC; Region: BioC;
                     TIGR02072"
                     /db_xref="CDD:233708"
     misc_feature    135096..135407
                     /locus_tag="Cpha266_0115"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(135108..135128,135180..135185,135258..135266,
                     135312..135314)
                     /locus_tag="Cpha266_0115"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            135728..136402
                     /gene="bioD"
                     /locus_tag="Cpha266_0116"
                     /db_xref="GeneID:4569470"
     CDS             135728..136402
                     /gene="bioD"
                     /locus_tag="Cpha266_0116"
                     /EC_number="6.3.3.3"
                     /note="DTB synthetase; dethiobiotin synthase; involved in
                     production of dethiobiotin from ATP and
                     7,8-diaminononanoate and carbon dioxide; contains
                     magnesium"
                     /codon_start=1
                     /transl_table=11
                     /product="dithiobiotin synthetase"
                     /protein_id="YP_910610.1"
                     /db_xref="GI:119355966"
                     /db_xref="InterPro:IPR004472"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="GeneID:4569470"
                     /translation="MKGSVTAISGIGTGVGKTVVTGLLAQGLQKCDRKVVTQKIVQTG
                     CTGISSDILEHRRLMGSSLIDVDYEGVTCPYSFGYPASPHLAARLEGAAVEVMTLRRA
                     TFTLQKQFDHVLLEGVGGLLVPLAPDLLFADYIRDAGYPLILVTATGLGSINHTLLSL
                     EACIARRITLKAVICNRFGEIDTLIGDDTVEMTRHYLKKYGLRAPLFTLVGDTLDCGC
                     IESLFL"
     misc_feature    135794..136393
                     /gene="bioD"
                     /locus_tag="Cpha266_0116"
                     /note="dithiobiotin synthetase; Reviewed; Region: bioD;
                     PRK00090"
                     /db_xref="CDD:234625"
     gene            136426..137730
                     /locus_tag="Cpha266_0117"
                     /db_xref="GeneID:4569471"
     CDS             136426..137730
                     /locus_tag="Cpha266_0117"
                     /EC_number="2.6.1.-"
                     /note="TIGRFAM: adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase;
                     PFAM: aminotransferase class-III;
                     KEGG: cte:CT0047 adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase"
                     /protein_id="YP_910611.1"
                     /db_xref="GI:119355967"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR005815"
                     /db_xref="GeneID:4569471"
                     /translation="MTLPLPVIDLAFDRSHIWHPYTSLADPLPVYPVTGARGVYLELA
                     DGRRLVDGMSSWWAAIHGYNHPVLNQAVTTQLERMSHVMFGGLTHEPAITLAEQLAEL
                     TPEPLQKVFFSDSGSVSVEVAIKMAIQYWATLGETRKTRLLTVRSGYHGDTFAAMSVS
                     DPVTGMHRLFSGVLQRQIFAESPSCAFHDPWNEECIGDLRRKLERHADEIAAVIIEPV
                     VQGAGGMRFYAPRYLGRLRELCDEFGVLLIFDEIATGFGRSGKLFALEHAEVSPDILC
                     VGKALTGGYMTLAATLTTGVVAETISSGNPGLFMHGPTFMANPLACAVAAANIRLLLS
                     YDWKSKVAGIERGLESALSPCRTMEGVVDVRVLGAIGVVELENPVEMGLIQKKFVDRG
                     VWVRPFGRLVYLMPPYIITDEELGLLADAVTEVVYETLAESR"
     misc_feature    136447..137703
                     /locus_tag="Cpha266_0117"
                     /note="adenosylmethionine--8-amino-7-oxononanoate
                     transaminase; Validated; Region: PRK07986"
                     /db_xref="CDD:181189"
     misc_feature    136453..137703
                     /locus_tag="Cpha266_0117"
                     /note="Acetyl ornithine aminotransferase family. This
                     family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). The major
                     groups in this CD correspond to ornithine
                     aminotransferase, acetylornithine aminotransferase;
                     Region: OAT_like; cd00610"
                     /db_xref="CDD:99735"
     misc_feature    order(136768..136776,136870..136875,136879..136881,
                     137071..137073,137173..137175,137179..137184,
                     137260..137262)
                     /locus_tag="Cpha266_0117"
                     /note="inhibitor-cofactor binding pocket; inhibition site"
                     /db_xref="CDD:99735"
     misc_feature    order(136771..136776,136870..136875,137071..137073,
                     137173..137175,137182..137184,137260..137262)
                     /locus_tag="Cpha266_0117"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99735"
     misc_feature    137260..137262
                     /locus_tag="Cpha266_0117"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99735"
     gene            complement(138482..138694)
                     /locus_tag="Cpha266_0118"
                     /db_xref="GeneID:4569024"
     CDS             complement(138482..138694)
                     /locus_tag="Cpha266_0118"
                     /note="PFAM: protein of unknown function DUF1458;
                     KEGG: cte:CT2229 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910612.1"
                     /db_xref="GI:119355968"
                     /db_xref="InterPro:IPR009923"
                     /db_xref="GeneID:4569024"
                     /translation="MSSHIYKKIELVGSSPTSIEEAVNNAIEKASESIRNIRWVEILE
                     TRCHVENQKLMYWQVTVKIGFTLDDN"
     misc_feature    complement(138488..138685)
                     /locus_tag="Cpha266_0118"
                     /note="Dodecin; Region: Dodecin; pfam07311"
                     /db_xref="CDD:203610"
     gene            139074..140627
                     /locus_tag="Cpha266_0119"
                     /db_xref="GeneID:4569025"
     CDS             139074..140627
                     /locus_tag="Cpha266_0119"
                     /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
                     protein; Polysulphide reductase, NrfD;
                     KEGG: cch:Cag_1965 Fe-S-cluster-containing hydrogenase
                     components 1-like"
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin"
                     /protein_id="YP_910613.1"
                     /db_xref="GI:119355969"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="InterPro:IPR005614"
                     /db_xref="GeneID:4569025"
                     /translation="MNYGFVIDARKCIGCHACTVACKSENQVPLGVNRTWVKYVEKGS
                     FPETRRYFTVLRCNHCAEPPCVAICPVEALQKREDGIVDFDGRRCIGCKACAQACPYN
                     ALYIDPETHTSAKCNYCAHRKEVGLQPACVAICPQQAIVSGDLDDPSSKIAALVAGEQ
                     TVVRKPEKGTSPKLFYINGDGASLDPLQVSLEKEYHWSAQARGVGHFADKQKGAPAIE
                     KPHHEAPATGPAMRRVYDIPSKGAVWGWEVPAYVSAKAVSSGVFLLFFALTALLGQEL
                     SGMMQWAAWATSLVFLGLTGGFLIKDLDRPDRFSSVMLRPQFGSWLVKGGLTITGYGA
                     FLALWGASRFLQIPALERVALWGGALFALITAIYTAFLFGSAKGRDFWQSPMLLLHML
                     LNALLAGGSTMLLLGFGTGASVELFALLKQLLAAGFSLHLVIMLLELYGKHPSLQAER
                     TAEIIRSGSLKNEFWIGSFIAGNLLPLILSILSSDPLMLAAAAILGLCGVFYTEKVWV
                     QAPQRVPLS"
     misc_feature    139074..139610
                     /locus_tag="Cpha266_0119"
                     /note="Fe-S-cluster-containing hydrogenase components 1
                     [Energy production and conversion]; Region: HybA; COG0437"
                     /db_xref="CDD:223514"
     misc_feature    139080..139139
                     /locus_tag="Cpha266_0119"
                     /note="4Fe-4S binding domain; Region: Fer4; cl02805"
                     /db_xref="CDD:243197"
     misc_feature    139314..139388
                     /locus_tag="Cpha266_0119"
                     /note="4Fe-4S binding domain; Region: Fer4; pfam00037"
                     /db_xref="CDD:215671"
     misc_feature    139794..140576
                     /locus_tag="Cpha266_0119"
                     /note="Polysulphide reductase, NrfD; Region: NrfD;
                     pfam03916"
                     /db_xref="CDD:217790"
     gene            140647..143508
                     /locus_tag="Cpha266_0120"
                     /db_xref="GeneID:4569026"
     CDS             140647..143508
                     /locus_tag="Cpha266_0120"
                     /EC_number="1.2.1.2"
                     /note="PFAM: molybdopterin oxidoreductase; molydopterin
                     dinucleotide-binding region; molybdopterin oxidoreductase
                     Fe4S4 region;
                     KEGG: plt:Plut_0027 molybdenum enzyme related to
                     thiosulfate reductase and polysulfide reductase, large
                     subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase"
                     /protein_id="YP_910614.1"
                     /db_xref="GI:119355970"
                     /db_xref="InterPro:IPR006656"
                     /db_xref="InterPro:IPR006657"
                     /db_xref="InterPro:IPR006963"
                     /db_xref="GeneID:4569026"
                     /translation="MSYTHKPTVIESIAEKLHLIPDLHKENVRDGARRAAEEGSEISC
                     PPPSQWDNWVEYDSKSWPERKATEYMLVPTACFNCEAGCGLLAYVDKENMKIRKLVGN
                     PYHPASRGRNCAKGPATLNQIEDSDRVLYPMKRTGKRGEGKWARVTWDSVLDDIAGRM
                     RKAILEGRNNEISYHVGRPGHDGFMEWILRAWNVDGHNSHTNVCSSGARFGYAIWEGF
                     DRPSPDHANAKFILLVSAHLESGHYFNPHSQRIIEARMKGAKLAVLDPRLSNTASMSD
                     YWMPSYPGSEPAILLAMAKIIIDEGIYNRDYLENWVNWQAYLQTEYPGTPVTFENFID
                     ALKKEYSEYTPEYASKESGVDAAAIVEVARKIGEAGTQFSTHVWRSASSGNLGGWAVS
                     RTLHFLNVLTGSVGTPGGTSPSAWNKFKPTVHAEPKPQTYWNTLQLPDEYPLAHFEMS
                     FLLPHFLKEGRGKLDVYFTRVFNPVWTYPDGFSWIEALEDESKIGLHAALTPTWSETA
                     YFADYVLPMGHSAERHDLLSYETHAGKWIAYRQPVLRTALKRMGKPVKYTWEANPGEV
                     WEEDEFWIELTWRIDPDGTMGIRQYCMSPYRPGEKITIEEYYRYVFEHTHGLPEKAAE
                     EGLTAYDYMQKYGAFEVESNVYSLNEKPVAPADLQGSEVHQQSGLITKNGKAVGVEVN
                     GRSCTGFPTPSRKQEFFSQTMVDWKWPEYRVPGYIKSHIHQEIMNRSKGEFVLVPTFR
                     LPVLIHSRSGNAKWLAEIAHRNPVWINAADGAALHIENGDLIRVNTDIGFFVNRAWVT
                     EGIRPGVVACSHHIGRWRRDQDPEANRWATNRVQISKEGKGKWKMRVEESIQPYESND
                     PDSSRIFWSDGGVHQNITFPVHPDPISGMHCWHQKVRIEKAQDGDCYGDVFVDTERSF
                     AIYKEWLAMTRPAPGPGGLRRPLWLNRPFRPDEKTYYLQ"
     misc_feature    140857..142485
                     /locus_tag="Cpha266_0120"
                     /note="Molybdopterin-Binding (MopB) domain of the MopB
                     superfamily of proteins, a  large, diverse, heterogeneous
                     superfamily of enzymes that, in general, bind
                     molybdopterin as a cofactor. The MopB domain is found in a
                     wide variety of molybdenum- and...; Region:
                     Molybdopterin-Binding; cl09928"
                     /db_xref="CDD:245203"
     misc_feature    140860..143139
                     /locus_tag="Cpha266_0120"
                     /note="Anaerobic dehydrogenases, typically
                     selenocysteine-containing [Energy production and
                     conversion]; Region: BisC; COG0243"
                     /db_xref="CDD:223321"
     misc_feature    order(140989..140991,141247..141249,141253..141261,
                     141346..141351,141361..141366,141436..141444,
                     141502..141504,141778..141780,142057..142065,
                     142144..142152,142159..142161,142195..142200,
                     142213..142215)
                     /locus_tag="Cpha266_0120"
                     /note="molybdopterin cofactor binding site; other site"
                     /db_xref="CDD:238218"
     misc_feature    142843..143334
                     /locus_tag="Cpha266_0120"
                     /note="This CD contains the molybdopterin_binding
                     C-terminal (MopB_CT) region of tetrathionate reductase,
                     subunit A, (TtrA); respiratory arsenate As(V) reductase,
                     catalytic subunit (ArrA); and other related proteins;
                     Region: MopB_CT_Tetrathionate_Arsenate-R; cd02780"
                     /db_xref="CDD:239181"
     misc_feature    order(142843..142854,142858..142866,142870..142872,
                     143074..143076,143251..143253,143314..143319)
                     /locus_tag="Cpha266_0120"
                     /note="putative molybdopterin cofactor binding site; other
                     site"
                     /db_xref="CDD:239181"
     gene            143666..144622
                     /locus_tag="Cpha266_0121"
                     /db_xref="GeneID:4569027"
     CDS             143666..144622
                     /locus_tag="Cpha266_0121"
                     /note="PFAM: protein of unknown function DUF81;
                     KEGG: cte:CT0859 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910615.1"
                     /db_xref="GI:119355971"
                     /db_xref="InterPro:IPR002781"
                     /db_xref="GeneID:4569027"
                     /translation="MSSAAKKLLLKTAGTAGASILFFIIPGILYAFPADQTGQMAWWV
                     WVILLFAFSFILGIFSVLAGVGGGVLFVPIVSGFFPFHLDFIRGAGLVVALTGALSAG
                     APLMRKGLADLKLGLPMALVGSISSIAGALAGLAMPVAMVQLLLGLSIMFIAGIMIKS
                     GKSGYPEVKEPDTLSKILHISGIYHDEAMSKDIAWQIHRTPIGLFLFMIIGFIGGMFG
                     MGAGWANVPVFNLLMGVPLKVAVATSGLVLSINGAAAAWIYIFKGALLPLIAVPAVAG
                     IMLGSKIGAGLLTKVNTRSVRLIVISMLLLAGLRSLLKGFGI"
     sig_peptide     143666..143761
                     /locus_tag="Cpha266_0121"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 0.998) with cleavage site probability 0.997 at
                     residue 32"
     misc_feature    143783..144574
                     /locus_tag="Cpha266_0121"
                     /note="Predicted permeases [General function prediction
                     only]; Region: COG0730"
                     /db_xref="CDD:223802"
     gene            144619..145047
                     /locus_tag="Cpha266_0122"
                     /db_xref="GeneID:4569028"
     CDS             144619..145047
                     /locus_tag="Cpha266_0122"
                     /note="KEGG: cte:CT0860 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910616.1"
                     /db_xref="GI:119355972"
                     /db_xref="GeneID:4569028"
                     /translation="MKDTNREKPDEGDVQFVYAKVLDFVSHAGMVFIAAGYLIYVMQL
                     LPLSVSIRAVADNWHLSASDMQQKLHVPSGWSFMGSMADALHGDVVSYMSILFLCMAT
                     ILCLVFAVKVFFREKNYIYTAITFLQALVLLVAASGVISR"
     gene            145415..145924
                     /locus_tag="Cpha266_0123"
                     /db_xref="GeneID:4569029"
     CDS             145415..145924
                     /locus_tag="Cpha266_0123"
                     /note="KEGG: plt:Plut_0031 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910617.1"
                     /db_xref="GI:119355973"
                     /db_xref="GeneID:4569029"
                     /translation="MAETKKLAIIASQGTLDWAYPPFILASTAAAMDMEAVIFFTFYG
                     LPLLKKEIDAKVAPHTNPAMPMKMPFGSKEFQSYNWPIPNFISGNVPGFDSMATSLMK
                     ETFKKKGVATIEQLRGMCQEFGVRFIACQMTMEVFGFEKEEFIEGVEYGGAATFLEYA
                     ADANISLFI"
     misc_feature    145421..145918
                     /locus_tag="Cpha266_0123"
                     /note="DsrE/DsrF/DrsH-like family; Region: DrsE_2;
                     pfam13686"
                     /db_xref="CDD:205862"
     gene            146008..146487
                     /locus_tag="Cpha266_0124"
                     /db_xref="GeneID:4569030"
     CDS             146008..146487
                     /locus_tag="Cpha266_0124"
                     /note="PFAM: Rhodanese domain protein;
                     KEGG: cte:CT0843 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="rhodanese domain-containing protein"
                     /protein_id="YP_910618.1"
                     /db_xref="GI:119355974"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="GeneID:4569030"
                     /translation="MRRFIELIRNCLTDVREIMPWELVDRMRLNPELMILDVREPAEF
                     DAMHISGSLCVPRGILESACEWDHDETVPELVKAREREIVVVCRSGHRSVLAAHSMQV
                     LGFEDVVSLRTGLRGWNDYEEPLRNSAGEVVDSEVADAFFTSKLREDQKRPAEKHQA"
     misc_feature    146071..146361
                     /locus_tag="Cpha266_0124"
                     /note="Rhodanese Homology Domain (RHOD); an alpha beta
                     fold domain found duplicated in the rhodanese protein. The
                     cysteine containing enzymatically active version of the
                     domain is also found in the Cdc25 class of protein
                     phosphatases and a variety of proteins...; Region: RHOD;
                     cd00158"
                     /db_xref="CDD:238089"
     misc_feature    146266..146268
                     /locus_tag="Cpha266_0124"
                     /note="active site residue [active]"
                     /db_xref="CDD:238089"
     gene            146655..146891
                     /locus_tag="Cpha266_0125"
                     /db_xref="GeneID:4569031"
     CDS             146655..146891
                     /locus_tag="Cpha266_0125"
                     /note="PFAM: SirA family protein;
                     KEGG: cte:CT0847 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="SirA family protein"
                     /protein_id="YP_910619.1"
                     /db_xref="GI:119355975"
                     /db_xref="InterPro:IPR001455"
                     /db_xref="GeneID:4569031"
                     /translation="MSDIASNMDLNCEGLNCPLPILKTKKAVDGLQSGEVLKMTATDP
                     GSINDMASWAKRTGNELVSHTEQAGVHTFYIRKK"
     misc_feature    146682..146885
                     /locus_tag="Cpha266_0125"
                     /note="SirA, YedF, and YeeD. Two-layered alpha/beta
                     sandwich domain.  SirA (also known as UvrY,  and YhhP)
                     belongs to a family of bacterial two-component response
                     regulators that controls secondary metabolism and
                     virulence. The other member of this...; Region:
                     SirA_YedF_YeeD; cd00291"
                     /db_xref="CDD:238180"
     misc_feature    order(146682..146687,146694..146696,146703..146714,
                     146718..146720)
                     /locus_tag="Cpha266_0125"
                     /note="CPxP  motif; other site"
                     /db_xref="CDD:238180"
     gene            147068..148495
                     /locus_tag="Cpha266_0126"
                     /db_xref="GeneID:4569032"
     CDS             147068..148495
                     /locus_tag="Cpha266_0126"
                     /EC_number="6.3.5.9"
                     /EC_number="6.3.5.-"
                     /note="TIGRFAM: cobyrinic acid a,c-diamide synthase;
                     PFAM: Cobyrinic acid a,c-diamide synthase; CobB/CobQ
                     domain protein glutamine amidotransferase;
                     KEGG: plt:Plut_0034 cobyrinic acid a,c-diamide synthase
                     CbiA"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrogenobyrinic acid a,c-diamide synthase
                     (glutamine-hydrolysing) / cobyrinate a,c-diamide synthase"
                     /protein_id="YP_910620.1"
                     /db_xref="GI:119355976"
                     /db_xref="InterPro:IPR002586"
                     /db_xref="InterPro:IPR004484"
                     /db_xref="InterPro:IPR011698"
                     /db_xref="GeneID:4569032"
                     /translation="MDAVTLPRLMISAAQKSSGKTTISLGLLSHLKSRGVAVRSFKKG
                     PDYIDPMWHKLASGSECYNLDPYLMGQEGCLDSFFKNSRNGNSDFCLIEGNHGLHDGL
                     SLDGSDSSAGLASMLKTPVLLVVDSRKTNRGVAALVMGMQAMQPQADIAGVILNQVQS
                     ARQAAKQKLAIEHYCKVPVFGAIPVDEELVIPERHLGLTTVGETADAAKFITGAAERL
                     ERYCDMAAIRALFSMASPIGMPPLETRGINPVARARVGVFRDAAFCFYYPDNLAALQE
                     HGAELIFIDSMSESSLPDIDGLYLGGGFPESFFDAISSRRGLLRDVRERVKSGMPLYA
                     ECGGLIYLSRSAEYGGKRYDLAGVLPLDIGFQQRPAGHGYLDLRSSAESAWFKTGERI
                     RAHEFHYSRPLLSSGACSYQFEVLRGYGVTGERDGAVDNHVFASFAHVHALSTPGWAP
                     KFVSLASIYKDRCLSGWAVPPQRQD"
     misc_feature    147086..148426
                     /locus_tag="Cpha266_0126"
                     /note="Cobyrinic acid a,c-diamide synthase [Coenzyme
                     metabolism]; Region: CobB; COG1797"
                     /db_xref="CDD:224710"
     misc_feature    147830..148426
                     /locus_tag="Cpha266_0126"
                     /note="Type 1 glutamine amidotransferase (GATase1) domain
                     found in Cobyrinic Acid a,c-Diamide Synthase; Region:
                     GATase1_CobB; cd03130"
                     /db_xref="CDD:153224"
     misc_feature    order(148073..148075,148388..148390,148394..148396)
                     /locus_tag="Cpha266_0126"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:153224"
     gene            149068..149403
                     /locus_tag="Cpha266_0127"
                     /db_xref="GeneID:4569033"
     CDS             149068..149403
                     /locus_tag="Cpha266_0127"
                     /note="PFAM: DsrC family protein;
                     KEGG: cch:Cag_1957 sulfite reductase, dissimilatory-type,
                     gamma subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="DsrC family protein"
                     /protein_id="YP_910621.1"
                     /db_xref="GI:119355977"
                     /db_xref="InterPro:IPR007453"
                     /db_xref="GeneID:4569033"
                     /translation="MAIVVNGVSCETDENGYLVNLEDWTEDVAKVLAEGEEIEMTEAH
                     WDLVKFLRGYYDEYQIAPAVKVLTKAIAAEKDMDKKNASEFLYGLFPKGPGLQACKIA
                     GLPKPTGCV"
     misc_feature    149071..149400
                     /locus_tag="Cpha266_0127"
                     /note="DsrC like protein; Region: DsrC; pfam04358"
                     /db_xref="CDD:146805"
     misc_feature    149074..149400
                     /locus_tag="Cpha266_0127"
                     /note="Dissimilatory sulfite reductase (desulfoviridin),
                     gamma subunit [Inorganic ion transport and metabolism];
                     Region: DsrC; COG2920"
                     /db_xref="CDD:225472"
     gene            149458..150711
                     /locus_tag="Cpha266_0128"
                     /db_xref="GeneID:4569034"
     CDS             149458..150711
                     /locus_tag="Cpha266_0128"
                     /EC_number="1.8.99.3"
                     /note="KEGG: plt:Plut_0036 sulfite reductase,
                     dissimilatory-type alpha subunit;
                     TIGRFAM: sulfite reductase, dissimilatory-type alpha
                     subunit;
                     PFAM: nitrite and sulphite reductase 4Fe-4S region"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfite reductase, dissimilatory-type alpha
                     subunit"
                     /protein_id="YP_910622.1"
                     /db_xref="GI:119355978"
                     /db_xref="InterPro:IPR006067"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR011806"
                     /db_xref="GeneID:4569034"
                     /translation="MDGAEGAASKEVHHCNECGAHSGEKFLNPTPMLDELEKGPWPSF
                     ISGFKELAERTKKPMLRGVMDQLEYSYNTKMGYWKGGLVTVDGYGAGIITRYSMIKDK
                     FPEASEFHTMRIQPAPGLHYNTAMLRELCDIWEKYGSGLIALHGQTGDIMLQGIEQDK
                     VQACFDELNQAGWDLGGAGAGMRTAVSCIGPGRCENACYDNLKLHLHALKHFVGVLHR
                     PEWNYKLKFKFSGCPNDCTNSIMRSDLAVIGTWRDAIQVDRDEVKAWIEKKGVDALVN
                     QVINHCPTKAISLKDGEMVIETRDCVRCMHCLNAMPKALSPGKDRGISLLMGGKNTLK
                     VGVNMGSLIIPFMKMESEEDIEAFIEQIEAIIDWWDDSGLDHERIGETIERVGLKQFI
                     EGIGLEADINMVSRPRDNPYFKARY"
     misc_feature    149554..150693
                     /locus_tag="Cpha266_0128"
                     /note="sulfite reductase, dissimilatory-type alpha
                     subunit; Region: dsrA; TIGR02064"
                     /db_xref="CDD:233704"
     misc_feature    149785..149970
                     /locus_tag="Cpha266_0128"
                     /note="Nitrite/Sulfite reductase ferredoxin-like half
                     domain; Region: NIR_SIR_ferr; pfam03460"
                     /db_xref="CDD:217572"
     gene            150794..151873
                     /locus_tag="Cpha266_0129"
                     /db_xref="GeneID:4569035"
     CDS             150794..151873
                     /locus_tag="Cpha266_0129"
                     /EC_number="1.8.99.3"
                     /note="KEGG: plt:Plut_0037 sulfite reductase,
                     dissimilatory-type beta subunit;
                     TIGRFAM: sulfite reductase, dissimilatory-type beta
                     subunit;
                     PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
                     protein; nitrite/sulfite reductase, hemoprotein
                     beta-component, ferrodoxin domain protein; nitrite and
                     sulphite reductase 4Fe-4S region"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfite reductase, dissimilatory-type beta
                     subunit"
                     /protein_id="YP_910623.1"
                     /db_xref="GI:119355979"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="InterPro:IPR005117"
                     /db_xref="InterPro:IPR006067"
                     /db_xref="InterPro:IPR011808"
                     /db_xref="GeneID:4569035"
                     /translation="MSSPEKKWKTVESGPHTYEEALHPVVRKNYGKWKYHEIPKPGVL
                     VHVAESGDSLYTVRAGTPRQDTVDMIRRLCDIADKYCDGYLRFTVRNNVEFLTPKQEN
                     VEPMIRELESMGLPVGGTGMCVSSVSHTQGWLHCDIPATDASGVVKSMMDTLYAEFRG
                     MQMPNKVRLSTSCCSINCGGQADIAVVVKHTRPPRVNHDHLAMICELPKAVARCPVAA
                     IRPTVVNGKRSLMVDEEKCICCGACFGACPAMEINHPEHSKFAIWVGGKNSNARSKPS
                     TMSIVAHNLPNNPPRWPEVTDAVGKILLAYKEGGRPWERIGEWINRIGWKRFFEETGL
                     TFDEDMIDSYRHARTTFNQSAHVRF"
     misc_feature    150866..151870
                     /locus_tag="Cpha266_0129"
                     /note="sulfite reductase, dissimilatory-type beta subunit;
                     Region: dsrB; TIGR02066"
                     /db_xref="CDD:131121"
     misc_feature    150929..151132
                     /locus_tag="Cpha266_0129"
                     /note="Nitrite/Sulfite reductase ferredoxin-like half
                     domain; Region: NIR_SIR_ferr; pfam03460"
                     /db_xref="CDD:217572"
     gene            151889..153625
                     /locus_tag="Cpha266_0130"
                     /db_xref="GeneID:4569036"
     CDS             151889..153625
                     /locus_tag="Cpha266_0130"
                     /note="unknown function"
                     /codon_start=1
                     /transl_table=11
                     /product="putative glutamate synthase (NADPH) small
                     subunit"
                     /protein_id="YP_910624.1"
                     /db_xref="GI:119355980"
                     /db_xref="InterPro:IPR000103"
                     /db_xref="InterPro:IPR000759"
                     /db_xref="InterPro:IPR001100"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="GeneID:4569036"
                     /translation="MKVESNPILDYALNYEFPEFTELQGTEKIVAFGDHSHKCPVYVR
                     QVPPCSAECPAGEDIRGYQRFLNGVEKSEDPWKSAWETIVDTNPFPAVMGRICPHPCQ
                     GGCNRQYHDESVAINAVEQVVGNYGIEHNLQLPGPGEDTGKRVAVIGGGPAGLSAAYQ
                     LRRKGHAVTIFDANEKLGGMVLYGIMGYRVDRAVLEAEIQRIISLGVETKMGVRIGTD
                     ITLDQLEKEYDAVFVGIGAQVGRSLPITGSADTKGVTNAIDFLKNYEVEGDSIAVGKK
                     VVVIGDGNVAMDVARLALRLGSEAVLISGVPREEMACFANEFDDAIREGSAIHYMTGT
                     VEVLKGEEGVRGLLCSKMVKKEKGEEGWNSPIPFLRYKSTDETFEIPCDMVVAAIGQT
                     TNMEGFESVAGDRPWLKVDRYFRLPGKENVFGGGDAIKVDLITTAVGHGRKAAMAIDA
                     FVKGDSFAEQGYREVAKVQKQDILYFYHSPQAKRETIELENVVGNHQELLEALSREEA
                     KAESERCMSCGLCFDCKQCVSFCPQEAVKRFRDNPPGEVVYTDYSKCVGCHICSLVCP
                     SGYIQMGMGEGL"
     misc_feature    151889..153616
                     /locus_tag="Cpha266_0130"
                     /note="putative glutamate synthase (NADPH) small subunit;
                     Provisional; Region: PRK12771"
                     /db_xref="CDD:237198"
     misc_feature    152327..>152461
                     /locus_tag="Cpha266_0130"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; pfam13450"
                     /db_xref="CDD:205628"
     misc_feature    152714..152941
                     /locus_tag="Cpha266_0130"
                     /note="Pyridine nucleotide-disulphide oxidoreductase;
                     Region: Pyr_redox; pfam00070"
                     /db_xref="CDD:215691"
     gene            153669..154037
                     /locus_tag="Cpha266_0131"
                     /db_xref="GeneID:4569037"
     CDS             153669..154037
                     /locus_tag="Cpha266_0131"
                     /note="KEGG: cte:CT2246 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910625.1"
                     /db_xref="GI:119355981"
                     /db_xref="GeneID:4569037"
                     /translation="MSEDLIRRVEEAIACSRNWAEKGWPVTFGSRNVAVSSLKEAKAL
                     PSSFLYRQEALNYWNQARLMGNDAGDAGAKALDALKSGNMRAAHDALYLSQYIEKPLA
                     ENARTWHPLYEAFTAEISSC"
     gene            154089..154448
                     /locus_tag="Cpha266_0132"
                     /db_xref="GeneID:4569038"
     CDS             154089..154448
                     /locus_tag="Cpha266_0132"
                     /note="PFAM: DsrE family protein;
                     KEGG: cch:Cag_1952 DsrE protein"
                     /codon_start=1
                     /transl_table=11
                     /product="DsrE family protein"
                     /protein_id="YP_910626.1"
                     /db_xref="GI:119355982"
                     /db_xref="InterPro:IPR003787"
                     /db_xref="GeneID:4569038"
                     /translation="MKIGILLKEGPYNHQASDTAYKFAEAAIKKGHTIDAVFLYNDGV
                     GNVTKMMDPPQDDRNIAARWDALSKQHGVEILACIAASKRRGINDDVIIEGGTITGLG
                     TLTDIAIRNDRLITFGD"
     misc_feature    154092..154439
                     /locus_tag="Cpha266_0132"
                     /note="DsrE/DsrF-like family; Region: DrsE; cl00672"
                     /db_xref="CDD:242020"
     gene            154452..154841
                     /locus_tag="Cpha266_0133"
                     /db_xref="GeneID:4569039"
     CDS             154452..154841
                     /locus_tag="Cpha266_0133"
                     /note="PFAM: DsrE family protein;
                     KEGG: cch:Cag_1951 DsrF protein"
                     /codon_start=1
                     /transl_table=11
                     /product="DsrE family protein"
                     /protein_id="YP_910627.1"
                     /db_xref="GI:119355983"
                     /db_xref="InterPro:IPR003787"
                     /db_xref="GeneID:4569039"
                     /translation="MGNMDIEENTDIKKIMHVMRHAPHGTIYSYEGLEMILIMAAYEQ
                     DLSVVFIGDGIYALKKNQDTHAIGIKGFSKTFMALDGYDVEKLYVDRVSLEERGLTED
                     DLVVPVEVLTSAEIGGLMREQDVIIHH"
     misc_feature    154491..154838
                     /locus_tag="Cpha266_0133"
                     /note="sulfur relay protein TusC/DsrF; Region:
                     sulf_tusC_dsrF; TIGR03010"
                     /db_xref="CDD:200229"
     gene            154917..155210
                     /locus_tag="Cpha266_0134"
                     /db_xref="GeneID:4569040"
     CDS             154917..155210
                     /locus_tag="Cpha266_0134"
                     /note="PFAM: DsrH family protein;
                     KEGG: cte:CT0857 DsrH protein"
                     /codon_start=1
                     /transl_table=11
                     /product="DsrH family protein"
                     /protein_id="YP_910628.1"
                     /db_xref="GI:119355984"
                     /db_xref="InterPro:IPR007215"
                     /db_xref="GeneID:4569040"
                     /translation="MLHTINKSPFASDTFDTCGRFLLPGDPVLFIEDGVYAVQAGNRF
                     SSMIETIQKTNPVFALRPDLDARGIAAVDEGVTLVDYEGFVELVENHQVNSWL"
     misc_feature    154935..155198
                     /locus_tag="Cpha266_0134"
                     /note="DsrH like protein; Region: DsrH; pfam04077"
                     /db_xref="CDD:217876"
     gene            155257..155703
                     /locus_tag="Cpha266_0135"
                     /db_xref="GeneID:4569041"
     CDS             155257..155703
                     /locus_tag="Cpha266_0135"
                     /note="KEGG: plt:Plut_0043 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910629.1"
                     /db_xref="GI:119355985"
                     /db_xref="GeneID:4569041"
                     /translation="MTKALDRVIQQNRKEILDRWHGQALALFSEKMARGTPIFDLLNE
                     SMGMILDGFEEGSESCLEGVDSFARIFAVHPFPPSGSMRLFFELQFILAAFCPDEESR
                     DAMQTRIQAIMLDACDDFMAHREKIYQLKVEERQRSMYMALRRAEG"
     misc_feature    155266..155553
                     /locus_tag="Cpha266_0135"
                     /note="RsbT co-antagonist protein rsbRD N-terminal domain;
                     Region: RsbRD_N; pfam14361"
                     /db_xref="CDD:206529"
     gene            155700..156695
                     /locus_tag="Cpha266_0136"
                     /db_xref="GeneID:4569042"
     CDS             155700..156695
                     /locus_tag="Cpha266_0136"
                     /note="PFAM: Nitrate reductase, gamma subunit;
                     KEGG: plt:Plut_0044 DsrM protein"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate reductase, gamma subunit"
                     /protein_id="YP_910630.1"
                     /db_xref="GI:119355986"
                     /db_xref="InterPro:IPR003816"
                     /db_xref="GeneID:4569042"
                     /translation="MKKVLMPIVMVAVLGLIPFIGVTYAGLDYLFGVIIPYASVLIFI
                     AGFVYRLVDWLKRPVPFRITTTCGQEKSLDWIKQNKLDSPSRAWHAAFRVLFEVFFFR
                     SLFRNTRSELREGPSLVHGSSKWLWMGGLVFHWSLLVIGLRHARYFFVMVPDFIQLVE
                     GADRFFDLALPAFYLTDALVLSAVTFLFVRRMSDAKMRIISLQTDYFPLFLITGIVLV
                     GIIMRYIVKVDVMPVKDQMLRLVAFNFEAPAPIGALFYVHLFLVCVLAVYFPFSKLMH
                     MGAIFLSPTRNLCNNSREKRHVNPWNAAIKFRTYTEYEDEYREKMKKAKLPVEKQ"
     sig_peptide     155700..155777
                     /locus_tag="Cpha266_0136"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 0.982) with cleavage site probability 0.973 at
                     residue 26"
     misc_feature    156063..156536
                     /locus_tag="Cpha266_0136"
                     /note="Nitrate reductase gamma subunit; Region:
                     Nitrate_red_gam; cl00959"
                     /db_xref="CDD:242222"
     gene            156698..158347
                     /locus_tag="Cpha266_0137"
                     /db_xref="GeneID:4569043"
     CDS             156698..158347
                     /locus_tag="Cpha266_0137"
                     /note="KEGG: plt:Plut_0045 DsrK protein"
                     /codon_start=1
                     /transl_table=11
                     /product="DsrK protein"
                     /protein_id="YP_910631.1"
                     /db_xref="GI:119355987"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="InterPro:IPR006655"
                     /db_xref="GeneID:4569043"
                     /translation="MSKYLPKLSDLKKDFEEKPSILKGDYSKKEWWDTPFEFRDGNWS
                     FPAKPEVVEELGFPNSRKWSALDQDWKLPADWQKTISEGLKVRLKKFRSLKLYLDSCV
                     RCGACADKCHFFLGTGDPRNMPVLRAELLRSVYRNDFPLVEKILKGFSGSRKLTAEVI
                     KEWHMYYYQCTECRRCSVFCPLGIDTAEITMVARELLNLIGVNNNWILAPVANCNRTG
                     NHLGIEPHTFVQNIESLVEDIEDMTGVRVNPTFNRKGAEILFITPSGDVFGDPGVYTM
                     MGYLLLFHHIGLDYTISTYASEGGNFGMFTSNDMMKKLNAKMYHEAERLKVKWILGGE
                     CGHMWRVVHQYMNTMNGPADFLEVPVSPVTGTKFSNAAATKMVHIAEFTADLIYHKKL
                     KLDPRRNDHLKTTFHDSCNVARGMGMFEEPRFVLNNVCNSFHEMPENTIREQTFCCGS
                     GSGINSEENMEMRMRGGFPRANAVRHVRNQHQVDSLVTICAIDRASLPALMKYWNPGV
                     TVYGLHELVGNALVMQGEKKRKEDLREHPMKGFDDEEGDVD"
     misc_feature    156971..158260
                     /locus_tag="Cpha266_0137"
                     /note="Fe-S oxidoreductase [Energy production and
                     conversion]; Region: GlpC; COG0247"
                     /db_xref="CDD:223325"
     misc_feature    157910..158170
                     /locus_tag="Cpha266_0137"
                     /note="Cysteine-rich domain; Region: CCG; pfam02754"
                     /db_xref="CDD:202376"
     gene            158337..158732
                     /locus_tag="Cpha266_0138"
                     /db_xref="GeneID:4568779"
     CDS             158337..158732
                     /locus_tag="Cpha266_0138"
                     /note="KEGG: cte:CT2242 cytochrome DsrJ"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910632.1"
                     /db_xref="GI:119355988"
                     /db_xref="InterPro:IPR011031"
                     /db_xref="GeneID:4568779"
                     /translation="MSIKKNHIIFSLLALLLLAGSYAFMHVVQAADPVPPTPRPAASA
                     AIDSSKCIMPTAYMKANHMRVLHEWRNSSVRDGNRVHVAPNGSKFDKSLNTCLGCHAN
                     NRLFCFNCHMYANVKPKCWNCHISPMETP"
     sig_peptide     158337..158429
                     /locus_tag="Cpha266_0138"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 1.000) with cleavage site probability 0.999 at
                     residue 31"
     gene            158732..159508
                     /locus_tag="Cpha266_0139"
                     /db_xref="GeneID:4568780"
     CDS             158732..159508
                     /locus_tag="Cpha266_0139"
                     /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
                     protein;
                     KEGG: cte:CT2241 polysulfide reductase, subunit B,
                     putative"
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin iron-sulfur binding
                     domain-containing protein"
                     /protein_id="YP_910633.1"
                     /db_xref="GI:119355989"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="GeneID:4568780"
                     /translation="MNEQRRDFIRKTGLGVLAGLGVASGLFAESSFEKTVLPAWDEKP
                     VAGKIRWGMLVDTRTCNESCQECVLTCHHVHNVPDFGSRKDEVKWIWKSPYEKAFPTA
                     SQQFQNKETRDRSCLTLCNHCAESPCTKACPTEATFKRWDGIVAMDYHRCIGCRFCMA
                     ACPYGSRSFNWQDPRMAIKNPSADYPTRMQGVVEKCNFCSERLVKGLKPACVESCPNQ
                     ALTFGDLNDPESDIRKLLENNQTMQRKPELGTLPSVFYII"
     sig_peptide     158732..158818
                     /locus_tag="Cpha266_0139"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 0.992) with cleavage site probability 0.960 at
                     residue 29"
     misc_feature    158873..159505
                     /locus_tag="Cpha266_0139"
                     /note="Fe-S-cluster-containing hydrogenase components 1
                     [Energy production and conversion]; Region: HybA; COG0437"
                     /db_xref="CDD:223514"
     misc_feature    159161..159226
                     /locus_tag="Cpha266_0139"
                     /note="4Fe-4S binding domain; Region: Fer4; cl02805"
                     /db_xref="CDD:243197"
     gene            159518..160669
                     /locus_tag="Cpha266_0140"
                     /db_xref="GeneID:4568781"
     CDS             159518..160669
                     /locus_tag="Cpha266_0140"
                     /note="PFAM: Polysulphide reductase, NrfD;
                     KEGG: cte:CT2240 polysulfide reductase, subunit C,
                     putative"
                     /codon_start=1
                     /transl_table=11
                     /product="polysulfide reductase, NrfD"
                     /protein_id="YP_910634.1"
                     /db_xref="GI:119355990"
                     /db_xref="InterPro:IPR005614"
                     /db_xref="GeneID:4568781"
                     /translation="MIEKALKGNRNYWLWIAFLCLVIGSGLFAYSQQRWFGLTVTGMG
                     RDVSWGLYIAQFTFLVGVAASAVMVVLPYYLHNQKAFAKTVIIGEFMAVSATMMCLLF
                     ILADMGRPDRVLNVLLYPSPHAMVFWDVLVLNGYLVINFVSAWTVLGAERKGVPPPAW
                     IKPVIYLSIPWAVSIHTVTAFLYAGLPGRHLWLTAVLAPRFLASAFAAGTALLILVTL
                     ILKKTTGFDAGKEAREKLAVLVIYAGLVNFFLIGTEFFTAFYSNVPAHMQSLQYLFFG
                     LEGKSQLVPWMWVSLLAGIGALAMLFSQKRKSSNLWLAAASGAMVLSIWIDKGVGLII
                     GGFVPSPLEEIVEYSPTVTEIVITLGIWAIGTLLLTVLLKVAVAVKTMD"
     sig_peptide     159518..159607
                     /locus_tag="Cpha266_0140"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 0.984) with cleavage site probability 0.660 at
                     residue 30"
     misc_feature    159563..160612
                     /locus_tag="Cpha266_0140"
                     /note="Polysulphide reductase [Energy production and
                     conversion]; Region: COG5557; cl17901"
                     /db_xref="CDD:248455"
     gene            160906..161358
                     /locus_tag="Cpha266_0141"
                     /db_xref="GeneID:4568782"
     CDS             160906..161358
                     /locus_tag="Cpha266_0141"
                     /note="KEGG: cte:CT2239 porphyrin biosynthesis protein,
                     putative"
                     /codon_start=1
                     /transl_table=11
                     /product="porphyrin biosynthesis protein"
                     /protein_id="YP_910635.1"
                     /db_xref="GI:119355991"
                     /db_xref="GeneID:4568782"
                     /translation="MKIMKVFLPVNIRIDDKKILFVGGGSIAMHKMQTVEQYARNITI
                     LAPRIDDKLKAKGFCEIRKEYEKTDLEGFFLVYACTNDLEVNRRIKKDAEELRVLVNV
                     ADNSELSDFISPAVFKLDEMTVAISSNGQNAKKSVEWRNRIKAMLQES"
     misc_feature    160921..>161355
                     /locus_tag="Cpha266_0141"
                     /note="Siroheme synthase (precorrin-2
                     oxidase/ferrochelatase domain) [Coenzyme metabolism];
                     Region: CysG; COG1648"
                     /db_xref="CDD:224562"
     misc_feature    160933..161250
                     /locus_tag="Cpha266_0141"
                     /note="Putative NAD(P)-binding; Region: NAD_binding_7;
                     pfam13241"
                     /db_xref="CDD:222002"
     gene            161397..162785
                     /locus_tag="Cpha266_0142"
                     /db_xref="GeneID:4568783"
     CDS             161397..162785
                     /locus_tag="Cpha266_0142"
                     /EC_number="2.1.1.107"
                     /note="TIGRFAM: uroporphyrin-III C-methyltransferase;
                     PFAM: Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
                     methyltransferase;
                     KEGG: plt:Plut_0050 uroporphyrin-III
                     C-methyltransferase-like"
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen-III C-methyltransferase"
                     /protein_id="YP_910636.1"
                     /db_xref="GI:119355992"
                     /db_xref="InterPro:IPR000878"
                     /db_xref="InterPro:IPR003043"
                     /db_xref="InterPro:IPR006366"
                     /db_xref="GeneID:4568783"
                     /translation="MTKSDHSQRVDVSEKGYVYIIGAGPGDPELLTIKAERALQEADV
                     LLYDDLVSGELVDQFQGIKIYTGKRKDSHHFEQDEINSEIVRHALMGKKVARLKGGDP
                     FVFGRGGEEIEVLRKNGIRYEIIPGITAAYGASAYTEIPLTMRKISSSVAFCTGHPVN
                     KIQVPDADTLVYYMVASTVHDVLDAVVSKGRSENTKVAIVQNATRYNQKIFTGTLGEL
                     RRREKAVYSPALLIIGDNINQFIEKNWFSGKRKVLLTGGDAKRYNAMEHIMVHFPCRQ
                     VDGADRERVKEYFDDFSPYSTLLFTSKFSVKYFFASLFEYGKDVRHLAAATICATGKA
                     AALELQKHGVIPDLFFEPDGCADIVTMFRERGMTDEHILLPGSNLVDEYLVRELTTLR
                     NRVTPLCVYMHEAQEHAESIDLAFIDEIYFASPSCVNNFRTLYSSIPENITVTAADTR
                     TEKEYRSLFGES"
     misc_feature    161448..162101
                     /locus_tag="Cpha266_0142"
                     /note="Uroporphyrin-III C-methyltransferase
                     (S-Adenosyl-L-methionine:uroporphyrinogen III
                     methyltransferase, SUMT); Region: SUMT; cd11642"
                     /db_xref="CDD:212501"
     misc_feature    order(161469..161471,161538..161546,161691..161699,
                     161706..161717,161781..161786,161796..161798,
                     161859..161861,161865..161867,161910..161924,
                     161994..161996,162000..162005,162009..162011,
                     162075..162086)
                     /locus_tag="Cpha266_0142"
                     /note="active site"
                     /db_xref="CDD:212501"
     misc_feature    order(161469..161471,161691..161699,161706..161711,
                     161781..161786,161913..161915,161994..161996,
                     162000..162005,162078..162086)
                     /locus_tag="Cpha266_0142"
                     /note="SAM binding site [chemical binding]; other site"
                     /db_xref="CDD:212501"
     misc_feature    order(161481..161498,161502..161504,161697..161699,
                     161703..161711,161721..161726,161730..161732,
                     161742..161747,161766..161768,161772..161774,
                     161778..161780,161790..161795,161817..161819,
                     161823..161831,161841..161855)
                     /locus_tag="Cpha266_0142"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212501"
     misc_feature    162204..>162689
                     /locus_tag="Cpha266_0142"
                     /note="Uroporphyrinogen-III synthase (HemD) catalyzes the
                     asymmetrical cyclization of tetrapyrrole (linear) to
                     uroporphyrinogen-III, the fourth step in the biosynthesis
                     of heme. This ubiquitous enzyme is present in eukaryotes,
                     bacteria and archaea. Mutations in...; Region: HemD;
                     cd06578"
                     /db_xref="CDD:119440"
     misc_feature    order(162300..162308,162396..162398,162525..162527,
                     162597..162599,162663..162677)
                     /locus_tag="Cpha266_0142"
                     /note="active site"
                     /db_xref="CDD:119440"
     gene            162814..163638
                     /locus_tag="Cpha266_0143"
                     /db_xref="GeneID:4568784"
     CDS             162814..163638
                     /locus_tag="Cpha266_0143"
                     /note="PFAM: Cobyrinic acid a,c-diamide synthase;
                     KEGG: rpc:RPC_4497 cobyrinic acid a,c-diamide synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="cobyrinic acid a,c-diamide synthase"
                     /protein_id="YP_910637.1"
                     /db_xref="GI:119355993"
                     /db_xref="InterPro:IPR002586"
                     /db_xref="GeneID:4568784"
                     /translation="MKRSKAVFKFSNSDPMKIAVSGKGGVGKTTISSLIALGLAEKGK
                     KVLAIDADPNGNLAEALGYNSGESGRITPLIERKALIEERTGARPGEMGGYFVLNPKV
                     DDFVERFSVPVGGLRTMVMGELKEALSGCYCAENALLRSFLRHLMVDRDEWVVLDMEA
                     GFEHLTRGTAQSVDLLLIVVEPGARSIATAHKLQRLALQSGIPRTGFLVNKLYSPSQK
                     EQIIPELEGGEILASIPFDEMAVEADLAARSPFGSCSLMKESLRPLIEALSDNSTG"
     misc_feature    162859..163560
                     /locus_tag="Cpha266_0143"
                     /note="CO dehydrogenase maturation factor [Cell division
                     and chromosome partitioning]; Region: CooC; COG3640"
                     /db_xref="CDD:226166"
     misc_feature    162862..163353
                     /locus_tag="Cpha266_0143"
                     /note="The accessory protein CooC, which contains a
                     nucleotide-binding domain (P-loop) near the N-terminus,
                     participates in the maturation of the nickel center of
                     carbon monoxide dehydrogenase (CODH). CODH from
                     Rhodospirillum rubrum catalyzes the reversible...; Region:
                     CooC; cd02034"
                     /db_xref="CDD:238991"
     misc_feature    162877..162900
                     /locus_tag="Cpha266_0143"
                     /note="P-loop; other site"
                     /db_xref="CDD:238991"
     misc_feature    <163273..163542
                     /locus_tag="Cpha266_0143"
                     /note="The Fer4_NifH superfamily contains a variety of
                     proteins which share a common ATP-binding domain.
                     Functionally, proteins in this superfamily use the energy
                     from hydrolysis of NTP to transfer electron or ion;
                     Region: Fer4_NifH; cl17203"
                     /db_xref="CDD:247757"
     gene            164039..165280
                     /locus_tag="Cpha266_0144"
                     /db_xref="GeneID:4568785"
     CDS             164039..165280
                     /locus_tag="Cpha266_0144"
                     /note="KEGG: rpb:RPB_0308 twin-arginine translocation
                     pathway signal"
                     /codon_start=1
                     /transl_table=11
                     /product="twin-arginine translocation pathway signal"
                     /protein_id="YP_910638.1"
                     /db_xref="GI:119355994"
                     /db_xref="InterPro:IPR000437"
                     /db_xref="GeneID:4568785"
                     /translation="MSNEQKPTSRREFLRSSAFGLSAVLGGLPLIQGCSKESGQEKGA
                     PNIGTSGKKLKSSYLPITDATPIILAHELGFYKELGIDSEKPVLIRGWAPMAEAFMAG
                     RFNLTHLLAPIPIYMRYSKGFPVKVVAWDHINGSALTVGKESGIKSCADLGGKQIAIP
                     YWYSMHNIILQMIAREHGIEPVIQSKTAPLTSKQMNLFVMAPPDMPTAIASKAIDGYI
                     VAEPFNAAGEVLAGGRIVRFTGDVWKNHPCCVAVMNEKELEDKEWSHKVIQALVKAEL
                     WALNNVEEAAHILSKDGAQYLPLPEKIVKRAMMKYDLETYGAGSGTGAIQNPDWHASR
                     ISYEPYQFESATRHIVEMLKQTRVDGDAAFLKALDPGKVHKELMYTAGVEAAAAALGG
                     LGQFAGVNSASPLVREEVIKV"
     misc_feature    164192..164908
                     /locus_tag="Cpha266_0144"
                     /note="NMT1-like family; Region: NMT1_2; pfam13379"
                     /db_xref="CDD:222087"
     misc_feature    164222..164893
                     /locus_tag="Cpha266_0144"
                     /note="NMT1/THI5 like; Region: NMT1; pfam09084"
                     /db_xref="CDD:220105"
     gene            165457..166257
                     /locus_tag="Cpha266_0145"
                     /db_xref="GeneID:4568786"
     CDS             165457..166257
                     /locus_tag="Cpha266_0145"
                     /note="PFAM: binding-protein-dependent transport systems
                     inner membrane component;
                     KEGG: pau:PA14_34520 putative sulfonate ABC transporter,
                     permease protein"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport system inner
                     membrane protein"
                     /protein_id="YP_910639.1"
                     /db_xref="GI:119355995"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="GeneID:4568786"
                     /translation="MAKQNDTSNKGSQEMTARLADRGFYLLGVVLFMIVWQIASALKL
                     FGADFSESFSPLAAMLALFEMIKNGELIHHALPSLRRVLTGLSLAVVVALPLGVLVGY
                     FKRIEQLTYVVFQFMRMISPLAWMPIAIIIFGVGDVAVIFLLWLVAIWPLILNTSHGA
                     GRVSPLWVNMAKTMGAKDSGILRKVIIPAAVPDMLTGLRLAVGVSWIILVPAEMLGVP
                     DGLGYFILDTRDRFRYDQLMATIMAIGMIGYLLDSANRWLIHKFSWKM"
     misc_feature    165505..166242
                     /locus_tag="Cpha266_0145"
                     /note="ABC-type nitrate/sulfonate/bicarbonate transport
                     system, permease component [Inorganic ion transport and
                     metabolism]; Region: TauC; COG0600"
                     /db_xref="CDD:223673"
     misc_feature    165760..166215
                     /locus_tag="Cpha266_0145"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(165784..165795,165799..165828,165835..165840,
                     165844..165846,165892..165897,165901..165903,
                     165907..165909,165916..165921,165925..165927,
                     165937..165942,165949..165951,166000..166002,
                     166042..166047,166054..166056,166075..166086,
                     166093..166098,166135..166140,166168..166173,
                     166180..166185,166189..166194,166201..166206,
                     166213..166215)
                     /locus_tag="Cpha266_0145"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(165802..165846,166075..166092)
                     /locus_tag="Cpha266_0145"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(165844..165846,165877..165879,166093..166095,
                     166129..166131,166138..166140,166168..166170)
                     /locus_tag="Cpha266_0145"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(165952..165990,166006..166011,166021..166023)
                     /locus_tag="Cpha266_0145"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            166278..167090
                     /locus_tag="Cpha266_0146"
                     /db_xref="GeneID:4568787"
     CDS             166278..167090
                     /locus_tag="Cpha266_0146"
                     /note="PFAM: ABC transporter related;
                     SMART: AAA ATPase;
                     KEGG: mja:MJ0412 putative taurine transport system
                     ATP-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_910640.1"
                     /db_xref="GI:119355996"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="GeneID:4568787"
                     /translation="MTSGRQVLISVQHVSKTYKKGGREFHALRDCTFDILKNEFLVVV
                     GPTGCGKSTLLNLLAGIEFPTSGSILLNGAPVTGPGADRGMIFQDYALLPWRSVLKNA
                     ELGFEFMKKPMKGDQIKAEAMRYLEMVGLGYAVNKHPGELSGGMKRRASLAMILAIKP
                     VILLMDGAFNALDSKTKMTMHQEITRIWETEKNTVVFVTSDLDEAVKLADRIIVLNKD
                     GALEAILVNELPRPRLGSAARDPDFHHRFIAFRETVMNVIKKDAGLRTCAIS"
     misc_feature    166296..167045
                     /locus_tag="Cpha266_0146"
                     /note="ABC-type nitrate/sulfonate/bicarbonate transport
                     system, ATPase component [Inorganic ion transport and
                     metabolism]; Region: TauB; COG1116"
                     /db_xref="CDD:224041"
     misc_feature    166302..166928
                     /locus_tag="Cpha266_0146"
                     /note="ATP-binding cassette domain of the nitrate and
                     sulfonate transporters; Region:
                     ABC_NrtD_SsuB_transporters; cd03293"
                     /db_xref="CDD:213260"
     misc_feature    166410..166433
                     /locus_tag="Cpha266_0146"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213260"
     misc_feature    order(166419..166424,166428..166436,166539..166541,
                     166773..166778,166875..166877)
                     /locus_tag="Cpha266_0146"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213260"
     misc_feature    166530..166541
                     /locus_tag="Cpha266_0146"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213260"
     misc_feature    166701..166730
                     /locus_tag="Cpha266_0146"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213260"
     misc_feature    166761..166778
                     /locus_tag="Cpha266_0146"
                     /note="Walker B; other site"
                     /db_xref="CDD:213260"
     misc_feature    166785..166796
                     /locus_tag="Cpha266_0146"
                     /note="D-loop; other site"
                     /db_xref="CDD:213260"
     misc_feature    166863..166883
                     /locus_tag="Cpha266_0146"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213260"
     gene            167113..167934
                     /locus_tag="Cpha266_0147"
                     /db_xref="GeneID:4568788"
     CDS             167113..167934
                     /locus_tag="Cpha266_0147"
                     /note="PFAM: ABC transporter related;
                     SMART: AAA ATPase;
                     KEGG: mja:MJ0412 putative taurine transport system
                     ATP-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_910641.1"
                     /db_xref="GI:119355997"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="GeneID:4568788"
                     /translation="MKTTMNGIAAPEKPLLEIRDVSKTFMKDGKEFLVLERVNLSINE
                     GEFVCILGPTGCGKSVTLQIVAGLLEQSSGSVILDGKEEHGPGPHKGMVFQEYALLPW
                     RTVVENVEIGLELKGISKKERRRIAEEQLDLVGLKGAESRMVHEISGGMRQRAAIARA
                     LANRPKILLMDEPFEALDALTKEEMQIQILKAWEKTKTTIFFVTHDVDEAIFLSDKLC
                     VMDINPGRVKKIITNTLPRPRHELVCRTDKAFCEMRDQIIQLYSSLKDEELDLVF"
     misc_feature    167149..167892
                     /locus_tag="Cpha266_0147"
                     /note="ABC-type nitrate/sulfonate/bicarbonate transport
                     system, ATPase component [Inorganic ion transport and
                     metabolism]; Region: TauB; COG1116"
                     /db_xref="CDD:224041"
     misc_feature    167158..167817
                     /locus_tag="Cpha266_0147"
                     /note="ATP-binding cassette domain of the nitrate and
                     sulfonate transporters; Region:
                     ABC_NrtD_SsuB_transporters; cd03293"
                     /db_xref="CDD:213260"
     misc_feature    167266..167289
                     /locus_tag="Cpha266_0147"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213260"
     misc_feature    order(167275..167280,167284..167292,167395..167397,
                     167623..167628,167725..167727)
                     /locus_tag="Cpha266_0147"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213260"
     misc_feature    167386..167397
                     /locus_tag="Cpha266_0147"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213260"
     misc_feature    167551..167580
                     /locus_tag="Cpha266_0147"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213260"
     misc_feature    167611..167628
                     /locus_tag="Cpha266_0147"
                     /note="Walker B; other site"
                     /db_xref="CDD:213260"
     misc_feature    167635..167646
                     /locus_tag="Cpha266_0147"
                     /note="D-loop; other site"
                     /db_xref="CDD:213260"
     misc_feature    167713..167733
                     /locus_tag="Cpha266_0147"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213260"
     gene            167957..168703
                     /locus_tag="Cpha266_0148"
                     /db_xref="GeneID:4568789"
     CDS             167957..168703
                     /locus_tag="Cpha266_0148"
                     /note="PFAM: cytochrome c, class I;
                     KEGG: sus:Acid_3506 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c, class I"
                     /protein_id="YP_910642.1"
                     /db_xref="GI:119355998"
                     /db_xref="InterPro:IPR000437"
                     /db_xref="InterPro:IPR003088"
                     /db_xref="InterPro:IPR008168"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="GeneID:4568789"
                     /translation="MKTNNAGLRPFARAVLIGSAMISGMLTGCSEKKTVETPPKEPEK
                     TVAASNESPLKGLRLYLGYCFICHGQTGRGDGPYAASLTAKPADLTNRGYFSARTDQQ
                     IYDFISKGGIAHGKSIHMRPFGMQLTRQQIMGLVSYVRVLNEGRTVDLEKSSGNTADD
                     IYGMSCIMCHGSDGNGDGEIARKLNIAIRPLGSKAVQDMSDQQLYAIISGGITDTARV
                     NASYMPAWSNSLTKEQIDELVAYIRELGKP"
     sig_peptide     167957..168043
                     /locus_tag="Cpha266_0148"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 0.666) with cleavage site probability 0.553 at
                     residue 29"
     misc_feature    168119..168385
                     /locus_tag="Cpha266_0148"
                     /note="Cytochrome c; Region: Cytochrom_C; pfam00034"
                     /db_xref="CDD:215669"
     misc_feature    168434..168691
                     /locus_tag="Cpha266_0148"
                     /note="Cytochrome c; Region: Cytochrom_C; pfam00034"
                     /db_xref="CDD:215669"
     gene            168834..170876
                     /locus_tag="Cpha266_0149"
                     /db_xref="GeneID:4568790"
     CDS             168834..170876
                     /locus_tag="Cpha266_0149"
                     /EC_number="1.2.99.2"
                     /note="PFAM: Prismane;
                     KEGG: gme:Gmet_1902 carbon-monoxide dehydrogenase,
                     catalytic subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="carbon monoxide dehydrogenase"
                     /protein_id="YP_910643.1"
                     /db_xref="GI:119355999"
                     /db_xref="InterPro:IPR000577"
                     /db_xref="InterPro:IPR004137"
                     /db_xref="GeneID:4568790"
                     /translation="MSLKERIKLVHRLNYSKEEVIKHTANKAVAEMVEHMDKEAISNT
                     FDRFAQQHPQCGYGLTGACCAFCSYGPCRVTEKTLYSVCGKDVDLIVAGNALRRLASG
                     MAAHGAHAREVFIALKAAAEGSAPIPIKCPEKGVAVARALGIETEGKTIEAICGEIAD
                     IFIDDLQRSLPKRHETLHALAPKERAELWERLGIIPISAYHECFEVNNLTSHGTDSDF
                     ESHMQAFLRTVLAYAITTVTSTSLATDIVYGLPRRSKLNVNLGSIVPDGCVNIGINGH
                     APMVAFAICDIVGTPKIMEKVKRAGADTIRLYGMCCTGGEFIERDLNIPLVAMASSAE
                     MAVATGAFDAIVVDQQDVLPGMMHVARQFHTRVITTSPSGRKEGAIVLELDYYLKNLD
                     KIYELAEEILDIAIDNYRNRESKKVHVPNIRAKVELGFSVEEVMKLFNGSMPDKKIHG
                     LAALLKAGKIRGIVNFGSCGNVRGAVFERNQIIIAKQLIKNDVLVTAHGCSGMGLLFA
                     GLAHPDASVLCGTGLREVVQAKDIPPVLHVGACTDSTRASQIMAYTANAAAQPNPAMP
                     FAMVAADPAAEKTMGARYAFVLNGIETYSCVQDNTLASDRFIDYVSNRLRTIVGAAMN
                     WNPDPYRTSEDILCMLDEKRAALGWPVRDYTIGTKEEIEDKIPDTVEIGRSICTII"
     misc_feature    168903..170777
                     /locus_tag="Cpha266_0149"
                     /note="carbon-monoxide dehydrogenase, catalytic subunit;
                     Region: CO_DH_cata; TIGR01702"
                     /db_xref="CDD:130763"
     misc_feature    168915..170780
                     /locus_tag="Cpha266_0149"
                     /note="The HCP family of iron-sulfur proteins includes
                     hybrid cluster protein (HCP), acetyl-CoA synthase (ACS),
                     and carbon monoxide dehydrogenase (CODH), all of which
                     contain [Fe4-S4] metal clusters at their active sites.
                     These proteins have a conserved...; Region: HCP_like;
                     cl14655"
                     /db_xref="CDD:246686"
     misc_feature    order(169125..169127,169131..169136,169143..169148,
                     170562..170567)
                     /locus_tag="Cpha266_0149"
                     /note="ACS interaction site; other site"
                     /db_xref="CDD:238330"
     misc_feature    order(169134..169136,169143..169145,169155..169157,
                     169164..169166,170559..170567)
                     /locus_tag="Cpha266_0149"
                     /note="CODH interaction site; other site"
                     /db_xref="CDD:238330"
     misc_feature    order(170238..170240,170331..170333,170454..170456,
                     170559..170561,170565..170567)
                     /locus_tag="Cpha266_0149"
                     /note="metal cluster binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238330"
     gene            170931..171131
                     /locus_tag="Cpha266_0150"
                     /db_xref="GeneID:4568791"
     CDS             170931..171131
                     /locus_tag="Cpha266_0150"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910644.1"
                     /db_xref="GI:119356000"
                     /db_xref="GeneID:4568791"
                     /translation="MLFDCEKQAMERWTIAEHKVCDGCPYRGSVAGEPPFCIMRQNPP
                     ECFVARLSGRAAVTGQDKPSGA"
     gene            complement(171220..172038)
                     /gene="mazG"
                     /locus_tag="Cpha266_0151"
                     /db_xref="GeneID:4568792"
     CDS             complement(171220..172038)
                     /gene="mazG"
                     /locus_tag="Cpha266_0151"
                     /EC_number="3.6.1.19"
                     /note="functions in degradation of stringent response
                     intracellular messenger ppGpp; in Escherichia coli this
                     gene is co-transcribed with the toxin/antitoxin genes
                     mazEF; activity of MazG is inhibited by MazEF in vitro;
                     ppGpp inhibits mazEF expression; MazG thus works in
                     limiting the toxic activity of the MazF toxin induced
                     during starvation; MazG also interacts with the GTPase
                     protein Era"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside triphosphate pyrophosphohydrolase"
                     /protein_id="YP_910645.1"
                     /db_xref="GI:119356001"
                     /db_xref="InterPro:IPR000886"
                     /db_xref="InterPro:IPR004518"
                     /db_xref="InterPro:IPR011551"
                     /db_xref="GeneID:4568792"
                     /translation="MPIPRNTTTEERKAAILAKRERSLSEHFERVVSLVDVLRNECPW
                     DRKQTPASLAHLLLEESYELVHAIDENDDIELKKELGDLFLHLCFQVILAEETQKFTF
                     SDVFEALSAKLIGRHPHVFGDTVADTEQEVLKNWETLKLQEGRKKLLDGVPKAMSELL
                     RAYRVQKKVSGVGFDWQNDEGVLDKLVEEIAELKNAATKEEQEEEFGDLLFTVVNYSR
                     FIGANPEDALRKATNKFMKRFEAVEATVQQSGRNWQAFSAEELDLLWQKAKNEL"
     misc_feature    complement(171223..171981)
                     /gene="mazG"
                     /locus_tag="Cpha266_0151"
                     /note="nucleoside triphosphate pyrophosphohydrolase;
                     Reviewed; Region: mazG; PRK09562"
                     /db_xref="CDD:236569"
     misc_feature    complement(171619..171954)
                     /gene="mazG"
                     /locus_tag="Cpha266_0151"
                     /note="Nucleoside Triphosphate Pyrophosphohydrolase (EC
                     3.6.1.8) N-terminal tandem-domain of MazG proteins from
                     Escherichia coli and bacterial homologs; Region:
                     NTP-PPase_MazG_Nterm; cd11528"
                     /db_xref="CDD:212135"
     misc_feature    complement(order(171700..171705,171709..171717,
                     171721..171735,171742..171744,171769..171771,
                     171778..171780,171784..171801,171808..171813,
                     171820..171822,171835..171837,171844..171846,
                     171853..171858,171865..171870,171877..171879,
                     171886..171891,171937..171939,171946..171951))
                     /gene="mazG"
                     /locus_tag="Cpha266_0151"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212135"
     misc_feature    complement(order(171793..171795,171802..171804,
                     171850..171852,171859..171861))
                     /gene="mazG"
                     /locus_tag="Cpha266_0151"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:212135"
     misc_feature    complement(171232..171564)
                     /gene="mazG"
                     /locus_tag="Cpha266_0151"
                     /note="Nucleoside Triphosphate Pyrophosphohydrolase (EC
                     3.6.1.8) C-terminal tandem-domain of MazG proteins from
                     Escherichia coli and bacterial homologs'; Region:
                     NTP-PPase_MazG_Cterm; cd11529"
                     /db_xref="CDD:212136"
     misc_feature    complement(order(171244..171246,171256..171258,
                     171265..171267,171310..171312,171319..171324,
                     171331..171360,171364..171366,171373..171381,
                     171400..171402,171406..171411,171415..171423,
                     171427..171435,171457..171462,171478..171483,
                     171517..171525,171532..171534,171544..171546,
                     171553..171558,171562..171564))
                     /gene="mazG"
                     /locus_tag="Cpha266_0151"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212136"
     misc_feature    complement(order(171415..171417,171424..171429,
                     171436..171438,171463..171465,171472..171474,
                     171484..171486,171511..171519))
                     /gene="mazG"
                     /locus_tag="Cpha266_0151"
                     /note="active site"
                     /db_xref="CDD:212136"
     misc_feature    complement(order(171415..171417,171424..171429,
                     171463..171465,171472..171477))
                     /gene="mazG"
                     /locus_tag="Cpha266_0151"
                     /note="putative chemical substrate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:212136"
     misc_feature    complement(order(171415..171417,171424..171426,
                     171463..171465,171472..171474))
                     /gene="mazG"
                     /locus_tag="Cpha266_0151"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:212136"
     gene            172146..172817
                     /locus_tag="Cpha266_0152"
                     /db_xref="GeneID:4568793"
     CDS             172146..172817
                     /locus_tag="Cpha266_0152"
                     /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
                     KEGG: cte:CT2085 oxidoreductase, short-chain
                     dehydrogenase/reductase family"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="YP_910646.1"
                     /db_xref="GI:119356002"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR002424"
                     /db_xref="InterPro:IPR013968"
                     /db_xref="GeneID:4568793"
                     /translation="MELKGSIAVVTGSSTGIGYHTARLLLEKGAEVYGLSRRATAVRH
                     DRFHWLQCDVTIAEEIDRAFDAVLERHGCVDILVNNAGFGLFGDLETLQPDEWHRLLA
                     TNLTAVFLCTRRVIPSMKERRRGMILNIGSVAGKRGFKGGAAYSATKFAINGLSESLM
                     DDLREFGIRVSCVNPGSVETEFFDRAGMQPKKAMDPAHLAGFLVSIIELPDSMLPDQI
                     TVRPL"
     misc_feature    172146..172811
                     /locus_tag="Cpha266_0152"
                     /note="short chain dehydrogenase; Provisional; Region:
                     PRK07326"
                     /db_xref="CDD:235990"
     misc_feature    172167..172772
                     /locus_tag="Cpha266_0152"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    order(172179..172181,172185..172196,172251..172259,
                     172299..172307,172383..172391,172452..172454,
                     172533..172541,172578..172580,172590..172592,
                     172668..172679,172683..172688)
                     /locus_tag="Cpha266_0152"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    order(172455..172457,172539..172541,172578..172580,
                     172590..172592)
                     /locus_tag="Cpha266_0152"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            172835..174262
                     /gene="trmE"
                     /locus_tag="Cpha266_0153"
                     /gene_synonym="mnmE; thdF"
                     /db_xref="GeneID:4568794"
     CDS             172835..174262
                     /gene="trmE"
                     /locus_tag="Cpha266_0153"
                     /gene_synonym="mnmE; thdF"
                     /note="in Escherichia coli this protein is involved in the
                     biosynthesis of the hypermodified nucleoside
                     5-methylaminomethyl-2-thiouridine, which is found in the
                     wobble position of some tRNAs and affects ribosomal
                     frameshifting; shows potassium-dependent dimerization and
                     GTP hydrolysis; also involved in regulation of
                     glutamate-dependent acid resistance and activation of
                     gadE"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA modification GTPase TrmE"
                     /protein_id="YP_910647.1"
                     /db_xref="GI:119356003"
                     /db_xref="InterPro:IPR002917"
                     /db_xref="InterPro:IPR004520"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR005289"
                     /db_xref="GeneID:4568794"
                     /translation="MQQETGIHPIVQCDPIAAIATPLGVGALAVVRISGATAFDIAGR
                     VFRKARDPHQPLSETPGYTAHFGRLYDGLTLIDEVIALVFRSPSSFTAEDMVEFTCHG
                     GPVVTRHVLQLLLDNGCRLAEPGEFTRRAFLNGKIDLLQAEAIGEMIHARSESAYRTA
                     VIQMKGDLSATLGALREKLLRSCALLELELDFSEEDVEFQSREELRVEIASLQSEVAR
                     LVDSYQHGRLLTEGVATVIAGRPNAGKSTLLNTLLGEERAIVSHMPGTTRDYIEECFI
                     HDKTMFRLTDTAGLRETGEEIEHEGVRRSRMKMAEADLLLYLLDLSREGMAEEIKEIV
                     ALKAAHASSKFLVVANKIDLVPDATTLLCRLGEEAGCEAIGISARQKLGIDELKSRMS
                     SMVEGLDKLHEASVLVTSLRHYEALRNAGDALRNAQNLLDEQADTELIAFELRAALDY
                     VGEITGKVVNEEILHAIFERFCIGK"
     misc_feature    172874..174259
                     /gene="trmE"
                     /locus_tag="Cpha266_0153"
                     /gene_synonym="mnmE; thdF"
                     /note="tRNA modification GTPase TrmE; Reviewed; Region:
                     trmE; PRK05291"
                     /db_xref="CDD:235392"
     misc_feature    172877..173242
                     /gene="trmE"
                     /locus_tag="Cpha266_0153"
                     /gene_synonym="mnmE; thdF"
                     /note="GTP-binding protein TrmE N-terminus; Region:
                     TrmE_N; pfam10396"
                     /db_xref="CDD:204472"
     misc_feature    173525..174022
                     /gene="trmE"
                     /locus_tag="Cpha266_0153"
                     /gene_synonym="mnmE; thdF"
                     /note="trmE is a tRNA modification GTPase; Region: trmE;
                     cd04164"
                     /db_xref="CDD:206727"
     misc_feature    173549..173572
                     /gene="trmE"
                     /locus_tag="Cpha266_0153"
                     /gene_synonym="mnmE; thdF"
                     /note="G1 box; other site"
                     /db_xref="CDD:206727"
     misc_feature    order(173558..173560,173564..173575,173882..173887,
                     173891..173893,173963..173971)
                     /gene="trmE"
                     /locus_tag="Cpha266_0153"
                     /gene_synonym="mnmE; thdF"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206727"
     misc_feature    173594..173644
                     /gene="trmE"
                     /locus_tag="Cpha266_0153"
                     /gene_synonym="mnmE; thdF"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206727"
     misc_feature    173633..173635
                     /gene="trmE"
                     /locus_tag="Cpha266_0153"
                     /gene_synonym="mnmE; thdF"
                     /note="G2 box; other site"
                     /db_xref="CDD:206727"
     misc_feature    order(173687..173719,173723..173767)
                     /gene="trmE"
                     /locus_tag="Cpha266_0153"
                     /gene_synonym="mnmE; thdF"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206727"
     misc_feature    173690..173701
                     /gene="trmE"
                     /locus_tag="Cpha266_0153"
                     /gene_synonym="mnmE; thdF"
                     /note="G3 box; other site"
                     /db_xref="CDD:206727"
     misc_feature    173882..173893
                     /gene="trmE"
                     /locus_tag="Cpha266_0153"
                     /gene_synonym="mnmE; thdF"
                     /note="G4 box; other site"
                     /db_xref="CDD:206727"
     misc_feature    173963..173971
                     /gene="trmE"
                     /locus_tag="Cpha266_0153"
                     /gene_synonym="mnmE; thdF"
                     /note="G5 box; other site"
                     /db_xref="CDD:206727"
     misc_feature    174038..174250
                     /gene="trmE"
                     /locus_tag="Cpha266_0153"
                     /gene_synonym="mnmE; thdF"
                     /note="Catalytic cysteine-containing C-terminus of GTPase,
                     MnmE; Region: GTPase_Cys_C; pfam12631"
                     /db_xref="CDD:204989"
     gene            174413..174754
                     /locus_tag="Cpha266_0154"
                     /db_xref="GeneID:4568795"
     CDS             174413..174754
                     /locus_tag="Cpha266_0154"
                     /note="SMART: Rhodanese domain protein;
                     KEGG: plt:Plut_0533 rhodanese-like"
                     /codon_start=1
                     /transl_table=11
                     /product="rhodanese domain-containing protein"
                     /protein_id="YP_910648.1"
                     /db_xref="GI:119356004"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="GeneID:4568795"
                     /translation="MIQKGALLVDVREPHEVARKSFDVPDSMLIPLSQLHKRFKEIPA
                     KRQTVIACRSGNRSVTAVRFLMSHGYSKAVNLQDGIIRWEKEGLPVRRPLKQKSGSWF
                     TRLFGRKSPVQ"
     misc_feature    174413..174664
                     /locus_tag="Cpha266_0154"
                     /note="Rhodanese Homology Domain (RHOD); an alpha beta
                     fold domain found duplicated in the rhodanese protein. The
                     cysteine containing enzymatically active version of the
                     domain is also found in the Cdc25 class of protein
                     phosphatases and a variety of proteins...; Region: RHOD;
                     cd00158"
                     /db_xref="CDD:238089"
     misc_feature    174566..174568
                     /locus_tag="Cpha266_0154"
                     /note="active site residue [active]"
                     /db_xref="CDD:238089"
     gene            complement(175164..175500)
                     /locus_tag="Cpha266_0155"
                     /pseudo
                     /db_xref="GeneID:4568796"
     gene            complement(175509..176249)
                     /locus_tag="Cpha266_0156"
                     /db_xref="GeneID:4568797"
     CDS             complement(175509..176249)
                     /locus_tag="Cpha266_0156"
                     /note="PFAM: protein of unknown function DUF169;
                     KEGG: mma:MM2037 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910649.1"
                     /db_xref="GI:119356005"
                     /db_xref="InterPro:IPR003748"
                     /db_xref="GeneID:4568797"
                     /translation="MTPEQLSQTLVTSEELVYHPIAVKFVTSLSELPEGIHKFGASSG
                     ERLPKSFLCAMWGDCLRGAAPFYTTREHQLCGGGAIAAGFGSLLPLEVAEKFMIGDGK
                     LFGTMKALRCSMESTMPFEDGEFEAQIIGPLSAMNNDTLRPDVVLIVCKPYQGQHILR
                     AYGFDSGELVHGIAGGSTCEMVSSYVKKTGKPTFTLGDTGGNAGLSLEPDELLLAFPY
                     DKLETAVSNLSRICRTSTMHRHTIVHER"
     misc_feature    complement(175566..176231)
                     /locus_tag="Cpha266_0156"
                     /note="Uncharacterized ArCR, COG2043; Region: DUF169;
                     pfam02596"
                     /db_xref="CDD:217131"
     gene            176617..177366
                     /locus_tag="Cpha266_0157"
                     /db_xref="GeneID:4568453"
     CDS             176617..177366
                     /locus_tag="Cpha266_0157"
                     /note="PFAM: short-chain dehydrogenase/reductase SDR;
                     KEGG: bld:BLi02990 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="YP_910650.1"
                     /db_xref="GI:119356006"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="GeneID:4568453"
                     /translation="MKRVIIIGATSGIGRALASLYIAEGWTTGLCGRRTAFLEDLRSV
                     AGKQVLVRAMDVTDTVAARKVFVELVQVMGGVDLVIISAGTGYLDPSFPWEKELETLK
                     TNVTGFAAIAHAAFEVFRHQGFGHLAGISSIAAIRGGSVPAYHASKAFVSNYLQGVRC
                     LAAASGLQIHVTDILPGFVDTAMAKGDGLFWVASPEKAALQIFRAISKKKYRVCITKR
                     WQIIAILLRVMPSGVYNGLLCRKKGKVDRGM"
     misc_feature    176617..177306
                     /locus_tag="Cpha266_0157"
                     /note="Short-chain dehydrogenases of various substrate
                     specificities [General function prediction only]; Region:
                     DltE; COG0300"
                     /db_xref="CDD:223377"
     sig_peptide     176617..176673
                     /locus_tag="Cpha266_0157"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 0.811) with cleavage site probability 0.735 at
                     residue 19"
     misc_feature    176626..177306
                     /locus_tag="Cpha266_0157"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:245206"
     misc_feature    order(176638..176640,176644..176649,176653..176655,
                     176710..176718,176860..176868,177004..177012,
                     177046..177048,177058..177060,177142..177153)
                     /locus_tag="Cpha266_0157"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(176926..176928,177010..177012,177046..177048,
                     177058..177060)
                     /locus_tag="Cpha266_0157"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            complement(177557..177979)
                     /locus_tag="Cpha266_0158"
                     /pseudo
                     /db_xref="GeneID:4568454"
     gene            178019..178270
                     /locus_tag="Cpha266_0159"
                     /pseudo
                     /db_xref="GeneID:4568455"
     gene            178891..181584
                     /locus_tag="Cpha266_0160"
                     /db_xref="GeneID:4568456"
     CDS             178891..181584
                     /locus_tag="Cpha266_0160"
                     /note="PFAM: TPR repeat-containing protein;
                     SMART: TIR protein; Tetratricopeptide domain protein;
                     KEGG: ccr:CC1413 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910651.1"
                     /db_xref="GI:119356007"
                     /db_xref="InterPro:IPR000157"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="GeneID:4568456"
                     /translation="MTTTRLRRQYQYFAFISYSHTDAKVAEWLHRKLESYRLPNAVLR
                     KSDGQLPRHVRPIFRDIADLSSGSLARTLREEIGQSQFLIVICSPDSAKSEWVEMEVS
                     HFLTLRGHEFVIPVIIKGTPYAKDAVDECLPLSLLRTEVDLLGISFAGQSKEQVLLKT
                     VSALLDIKYDSLYDRHRRRQRRQRMFAATVVTVMFVVVLTASLFSFIQWNRAEQRRAE
                     AEQLLNYLLLDLHPKLKQFGRLDILESVAEKSREYIDYISTDVRDPIDAIQAISLRRN
                     MAEVYQSVGKLENAEALHLKNISVLKKLEQIDPKMEIIHLLKGEEHQALASIRKTEGR
                     FQDALHESLTAFSVFKSFVSVKSDARWRSAKASSEQRLSDAYYDLGMGKQAAWHINSA
                     VSDFRRILHEHSAGDNSYKADLAYALVSKSRVEVKWGTTSRAYSVFVEASELFRQHLE
                     EHPEDREVRASFANVVSDLAAMLKDMGRLEDALIYWDLAIDAERELVTFEPLNVRWHA
                     DLSETMMNKANALGRLGRTGEGFLLYEEVSRHQRKLIALQPKVARWRATYAWCRHNMA
                     IEYARLGKNKGAIDLWNDAIATIEQLRKDGRAKREWLLDLCNMLDQRATITAENGNFE
                     KAEQDIKASQAIRASLISDSNSSPDELSQMGLNQARKALLDYYRKDYSHAMVSIKAAE
                     GYLRRAVKLDEANCEWRAHLAGTLRNSSVIHRAAGFPDKAKRAIDECIVILEKLRIRQ
                     PSDKKIRVDLSQAYNNQGNLYNDFGSIKSSVSAWEKSLTLDSDPAQREFLATRLGTLA
                     YQYILLQDPGKSEMSARKALEVDAAPWIQINLGHALFLQDMREAAKAQYLNAMRKDGK
                     ILASISADFVDMENHGIHVRNAIQMLDELRGAALETNNEKQ"
     misc_feature    178933..179256
                     /locus_tag="Cpha266_0160"
                     /note="TIR domain; Region: TIR_2; pfam13676"
                     /db_xref="CDD:222311"
     misc_feature    181144..181452
                     /locus_tag="Cpha266_0160"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(181144..181149,181153..181158,181165..181170,
                     181255..181260,181282..181287,181294..181299,
                     181372..181377,181384..181389,181396..181401)
                     /locus_tag="Cpha266_0160"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(181162..181164,181198..181200,181210..181212,
                     181219..181221,181282..181284,181318..181320,
                     181330..181332,181339..181341,181381..181383,
                     181417..181419,181429..181431,181438..181440)
                     /locus_tag="Cpha266_0160"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     gene            complement(181999..182385)
                     /locus_tag="Cpha266_0161"
                     /db_xref="GeneID:4568457"
     CDS             complement(181999..182385)
                     /locus_tag="Cpha266_0161"
                     /note="KEGG: cte:CT0487 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910652.1"
                     /db_xref="GI:119356008"
                     /db_xref="GeneID:4568457"
                     /translation="MKSFIDAVKNNKTGFVIKNSVFLPFHCEILTIWLGKEMSLLSTP
                     DLITDLTDAEILGIREGNYYTNLVFRKRGDLAKELGHHKGHIILRAAEKGADIFQVEN
                     IHYVRIGFHDHHKELSLEMIDNPFDL"
     gene            complement(182418..183893)
                     /locus_tag="Cpha266_0162"
                     /db_xref="GeneID:4568458"
     CDS             complement(182418..183893)
                     /locus_tag="Cpha266_0162"
                     /note="KEGG: plt:Plut_1726 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910653.1"
                     /db_xref="GI:119356009"
                     /db_xref="GeneID:4568458"
                     /translation="MLPTLTRHALCLLVFVLVVAGVTGISGILIAAEAFDINAAASPV
                     AIENNLPPVWLVAPFATLLVMIATGPLLFHRFWEQHYPKVSTGLGFIVAVYYVFMIEN
                     GLQVLEHTLEEYLSFIALISSLFVVAGGILIRIERRGTPLINASLLFIGAVISNLVGT
                     TGASMLLIRPYMRINAGRIKAFHIVFFIIIVSNIGGALTPVGDPPLFLGFLKGVPFFW
                     VFPKLILPWIITIAGLLFIFIFLDAKAGHGKMKGTEPDGEISITGKRNFFFLAIIITS
                     VFLDPAVIEGVPSLQKLFHLPFGIRELIMFIVAVTAYKYSNPAAFKGNEFNFEPIKEV
                     AFLFIGIFATMIPALELIGNYAETHAEVFSVSRFYWLTGVLSGVLDNAPTYLNFFAGA
                     LGKFGLDIDIPEDIILFANGVNSAIQGDVSSDIYLMAISVASVFFGALTYIGNAPNFM
                     VKNIAAQADVDVPDFLEYIYKYSIPILLPFLMLIWVLFFNY"
     sig_peptide     complement(183798..183893)
                     /locus_tag="Cpha266_0162"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 0.998) with cleavage site probability 0.963 at
                     residue 32"
     misc_feature    complement(182442..183734)
                     /locus_tag="Cpha266_0162"
                     /note="Na+/H+ antiporter NhaD and related arsenite
                     permeases [Inorganic ion transport and metabolism];
                     Region: ArsB; COG1055"
                     /db_xref="CDD:223983"
     misc_feature    complement(182433..183506)
                     /locus_tag="Cpha266_0162"
                     /note="Anion permease ArsB/NhaD.  These permeases have
                     been shown to translocate sodium, arsenate, antimonite,
                     sulfate and organic anions across biological membranes in
                     all three kingdoms of life.  A typical anion permease
                     contains 8-13 transmembrane helices...; Region:
                     ArsB_NhaD_permease; cl17221"
                     /db_xref="CDD:247775"
     misc_feature    complement(order(182436..182474,182556..182609,
                     182670..182675,182757..182804,182859..182894,
                     182913..182924,182958..182996,183024..183029,
                     183051..183089,183183..183215,183216..183218,
                     183279..183350,183363..183371,183372..183410,
                     183414..183464))
                     /locus_tag="Cpha266_0162"
                     /note="transmembrane helices; other site"
                     /db_xref="CDD:238344"
     gene            complement(183989..184252)
                     /locus_tag="Cpha266_0163"
                     /db_xref="GeneID:4568459"
     CDS             complement(183989..184252)
                     /locus_tag="Cpha266_0163"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910654.1"
                     /db_xref="GI:119356010"
                     /db_xref="GeneID:4568459"
                     /translation="MIEKRKNKPNQTETISSILFSASASTDFTNSRAKENPFIPTVNN
                     VNNRYAIAQHQMAQEALSFQYRSSPDCFIKAVSVACRIRELLT"
     sig_peptide     complement(184151..184252)
                     /locus_tag="Cpha266_0163"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 0.882) with cleavage site probability 0.774 at
                     residue 34"
     gene            184699..186093
                     /locus_tag="Cpha266_0164"
                     /db_xref="GeneID:4568460"
     CDS             184699..186093
                     /locus_tag="Cpha266_0164"
                     /note="TIGRFAM: putative methyltransferase;
                     KEGG: rba:RB3371 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="putative methyltransferase"
                     /protein_id="YP_910655.1"
                     /db_xref="GI:119356011"
                     /db_xref="InterPro:IPR011610"
                     /db_xref="GeneID:4568460"
                     /translation="MSLKFSSSFLLNSIDAWEEDRKDRFDLDALTQSFHESVPALGFI
                     DWKITVVERGYAETVLPLTPNSSNQYIAHQGPLMLLAAEYTGGLALTSLFHRVPIIGF
                     WPSVDENAGYMWGAKASIKWITPSCHNLTCKARIEKERWEGLAKRFANSNKVVVTIPV
                     KMFNGDKLVAVADFTYWAQDINSLKRNAYDVEKIDLLYEHKTKTTAKLIVGLRALEQE
                     KPIDQRRFDDPYAFMLAGKHGITLARRFSVATPQLQNMISARTQHLDECVKQFSLGKT
                     KFNVVNIGAGYDSRFWRLNIANAVIYDLDLPVMLHERKRIFDYSRNNAIHNVDIDLEI
                     QSIDQALLEKSDFDSELPTFFIWEGGSMYFMDENIESILGSIRRIVNQDSRIWLDYVS
                     KDLVEISTGIPEAEGFIYNIRKMGEPFINGYNDIGVLAGKYDLVIAQNIRSGELLNIE
                     EDVYSHYSFCVLKS"
     misc_feature    184798..185226
                     /locus_tag="Cpha266_0164"
                     /note="HGG motif-containing thioesterase, possibly
                     involved in aromatic compounds catabolism [Secondary
                     metabolites biosynthesis,    transport, and catabolism];
                     Region: PaaI; COG2050"
                     /db_xref="CDD:224961"
     misc_feature    order(184915..184920,185032..185037,185044..185049)
                     /locus_tag="Cpha266_0164"
                     /note="active site 2 [active]"
                     /db_xref="CDD:239524"
     misc_feature    order(184933..184935,184945..184950,184957..184959,
                     185008..185016)
                     /locus_tag="Cpha266_0164"
                     /note="active site 1 [active]"
                     /db_xref="CDD:239524"
     misc_feature    185311..185964
                     /locus_tag="Cpha266_0164"
                     /note="O-Methyltransferase involved in polyketide
                     biosynthesis [Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: COG3315"
                     /db_xref="CDD:225852"
     misc_feature    185332..185826
                     /locus_tag="Cpha266_0164"
                     /note="Leucine carboxyl methyltransferase; Region: LCM;
                     pfam04072"
                     /db_xref="CDD:217872"
     gene            186106..188586
                     /locus_tag="Cpha266_0165"
                     /db_xref="GeneID:4568461"
     CDS             186106..188586
                     /locus_tag="Cpha266_0165"
                     /note="PFAM: response regulator receiver; ATP-binding
                     region, ATPase domain protein domain protein; Hpt domain
                     protein;
                     KEGG: bxe:Bxe_B2006 periplasmic sensor hybrid histidine
                     kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="multi-sensor hybrid histidine kinase"
                     /protein_id="YP_910656.1"
                     /db_xref="GI:119356012"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR008207"
                     /db_xref="GeneID:4568461"
                     /translation="MPASYSSRPSVLKRGVDFFQNDYERNKLTIDYIRYIGLWGHPLY
                     YLLCAFIFPQPYESFELRFASAISFIPILFHQRYPEKFRSLLMLYWYLWLTFTFPVVF
                     TYLMLMNDFSGLWLVAETVMLFVFIIFITNYFLLFVLFFSGILIAYAGFVLDTGAHLL
                     ITKEIIEYFVSIPIAILLGLLVNSTNKKGELAQERNSVLQSLAGSIAHEMRNPLGQIR
                     HCLYSIQNLLPQVNPEECDKPLGKEKLETLYERVSRGQLAVKRGAQVIDMVLSEVRER
                     PIGPESFTYLSATRVTRNALDEFGYESEQDRRRVHLETKDSFIFHINETLFVFVLFNL
                     LKNALFYFKTHPHSEISVRLERGERFNYLYFRDTGPGISSETLPFIFDSFYTTGKASG
                     TGLGLSYCKRIMTAFGGSITCKSVEGEYSEFILSFPVISEQDMNLYTERVIAVGQADF
                     QGKRLLIVDDSALYRSILKKYFAPLQVEIDEAAGGREALDLLSIRRYDLVIMDLNMPS
                     MSGYETVERLRRGEAGPQSCSVPVVAHSSESVMTARSKSENAGMQAFIAKPCSQAELI
                     SSLRSVLDTIPERNYPGSPFSGRKVLLVDDSALNRDLLAMYLRDSGIEVTVSDSGAEA
                     LNILRNQDFELLITDIHMPGMDGLELTRTIRSSRSEQLCRLPIIGLSGAVEEEVVARK
                     AGMNDFRIKTDSPNLLLASIGRQLSVSGAEPIREKVVKEYPQAVKVTSPYGLSASESE
                     ELRQIFLEEFRDTPVNLRRALKENDMRSLKEESHKLKGSAAILGAMALSKAAEELELH
                     CRFERRDDPAPKIERIIEALDELSARND"
     misc_feature    186286..>186627
                     /locus_tag="Cpha266_0165"
                     /note="Bacterial export proteins, family 1; Region:
                     Bac_export_1; cl00734"
                     /db_xref="CDD:242057"
     misc_feature    186349..187404
                     /locus_tag="Cpha266_0165"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    187141..187386
                     /locus_tag="Cpha266_0165"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(187198..187200,187204..187206,187210..187212,
                     187216..187221,187285..187296,187342..187344,
                     187348..187350,187363..187368,187372..187374)
                     /locus_tag="Cpha266_0165"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(187210..187212,187216..187218,187285..187287,
                     187291..187293)
                     /locus_tag="Cpha266_0165"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    187468..187815
                     /locus_tag="Cpha266_0165"
                     /note="Response regulator receiver domain; Region:
                     Response_reg; pfam00072"
                     /db_xref="CDD:200976"
     misc_feature    187471..187824
                     /locus_tag="Cpha266_0165"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(187480..187485,187612..187614,187636..187638,
                     187711..187713,187768..187770,187777..187782)
                     /locus_tag="Cpha266_0165"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    187612..187614
                     /locus_tag="Cpha266_0165"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(187621..187626,187630..187638)
                     /locus_tag="Cpha266_0165"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    187777..187785
                     /locus_tag="Cpha266_0165"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    187876..188211
                     /locus_tag="Cpha266_0165"
                     /note="Response regulator receiver domain; Region:
                     Response_reg; pfam00072"
                     /db_xref="CDD:200976"
     misc_feature    187879..188223
                     /locus_tag="Cpha266_0165"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(187888..187893,188020..188022,188044..188046,
                     188116..188118,188167..188169,188176..188181)
                     /locus_tag="Cpha266_0165"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    188020..188022
                     /locus_tag="Cpha266_0165"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(188029..188034,188038..188046)
                     /locus_tag="Cpha266_0165"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    188176..188184
                     /locus_tag="Cpha266_0165"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    188320..188577
                     /locus_tag="Cpha266_0165"
                     /note="Histidine Phosphotransfer domain, involved in
                     signalling through a two part component systems in which
                     an autophosphorylating histidine protein kinase serves as
                     a phosphoryl donor to a response regulator protein; the
                     response regulator protein is...; Region: HPT; cd00088"
                     /db_xref="CDD:238041"
     misc_feature    order(188425..188427,188434..188439,188482..188484,
                     188491..188493)
                     /locus_tag="Cpha266_0165"
                     /note="putative binding surface; other site"
                     /db_xref="CDD:238041"
     misc_feature    188425..188427
                     /locus_tag="Cpha266_0165"
                     /note="active site"
                     /db_xref="CDD:238041"
     gene            188924..189253
                     /locus_tag="Cpha266_0166"
                     /db_xref="GeneID:4568462"
     CDS             188924..189253
                     /locus_tag="Cpha266_0166"
                     /note="PFAM: TPR repeat-containing protein;
                     Tetratricopeptide TPR_2 repeat protein;
                     SMART: Tetratricopeptide domain protein;
                     KEGG: pmt:PMT0296 TPR repeat"
                     /codon_start=1
                     /transl_table=11
                     /product="TPR repeat-containing protein"
                     /protein_id="YP_910657.1"
                     /db_xref="GI:119356013"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="GeneID:4568462"
                     /translation="MMVRRICFFSLMLSLVFFMSGADNVGPLTAEDYYKSGKIKYHKD
                     DYSGAIEDYNKAAELAPDVAKIFGSRGAARRKLGDREGAIADAQKAARLGDKDAQRIL
                     RMLDLGW"
     sig_peptide     188924..188992
                     /locus_tag="Cpha266_0166"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 0.999) with cleavage site probability 0.559 at
                     residue 23"
     misc_feature    189011..189202
                     /locus_tag="Cpha266_0166"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:222112"
     misc_feature    189014..>189220
                     /locus_tag="Cpha266_0166"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(189014..189019,189023..189028,189035..189040,
                     189125..189130,189134..189139,189146..189151)
                     /locus_tag="Cpha266_0166"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(189032..189034,189068..189070,189080..189082,
                     189089..189091,189134..189136,189170..189172,
                     189182..189184,189191..189193)
                     /locus_tag="Cpha266_0166"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     gene            complement(189446..190774)
                     /locus_tag="Cpha266_0167"
                     /db_xref="GeneID:4568463"
     CDS             complement(189446..190774)
                     /locus_tag="Cpha266_0167"
                     /EC_number="1.4.1.3"
                     /note="PFAM: Glu/Leu/Phe/Val dehydrogenase, C terminal;
                     Glu/Leu/Phe/Val dehydrogenase, dimerisation region;
                     KEGG: cte:CT2023 glutamate dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate dehydrogenase"
                     /protein_id="YP_910658.1"
                     /db_xref="GI:119356014"
                     /db_xref="InterPro:IPR006095"
                     /db_xref="InterPro:IPR006096"
                     /db_xref="InterPro:IPR006097"
                     /db_xref="GeneID:4568463"
                     /translation="MTTWPLMSERKESCECAIPYDIIETGIHSKPNPFKTAQRQLDEA
                     AALIGLDPAAHQLLRWPLRELHVAMPVKMDDGSTKVFRGFRVQYNDARGPNKGGIRFH
                     AEETIDTIRALAAWMTWKTAVLDLPLGGAKGGVICNPKSMSPGELERLSRAYIRQAGR
                     ILGLEKDVAAPDIYTTPQIMAWMADEYSFMQGNNEFGVISGKPLALGGSAGRNDATAR
                     GGIACVIEAAKELGIELQGATAAIQGYGNVGSFAHKLATELLGMKIIAVSDSGGGIYN
                     PDGLLYDEVKAHKEKTGSVTGFPGSDSVSDETLLELNVTVLFPSALEQVITEHNAQNI
                     RAGIIAELANGPTTPEADKILFENGCYVIPDFLCNAGGVTVSYFEMVQNTYGYYWEED
                     DVRKRLEKKMKTAFHSVHETSRKYKVHNRLGACIVAIERVAEAMKLRGWY"
     misc_feature    complement(189449..190681)
                     /locus_tag="Cpha266_0167"
                     /note="Glutamate dehydrogenase/leucine dehydrogenase
                     [Amino acid transport and metabolism]; Region: GdhA;
                     COG0334"
                     /db_xref="CDD:223411"
     misc_feature    complement(190205..190594)
                     /locus_tag="Cpha266_0167"
                     /note="Glu/Leu/Phe/Val dehydrogenase, dimerisation domain;
                     Region: ELFV_dehydrog_N; pfam02812"
                     /db_xref="CDD:202408"
     misc_feature    complement(189473..190156)
                     /locus_tag="Cpha266_0167"
                     /note="NAD(P) binding domain of glutamate dehydrogenase,
                     subgroup 1; Region: NAD_bind_1_Glu_DH; cd01076"
                     /db_xref="CDD:133445"
     misc_feature    complement(order(189743..189751,189809..189814,
                     189965..189970,190031..190039))
                     /locus_tag="Cpha266_0167"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:133445"
     gene            complement(190837..191235)
                     /locus_tag="Cpha266_0168"
                     /db_xref="GeneID:4568464"
     CDS             complement(190837..191235)
                     /locus_tag="Cpha266_0168"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910659.1"
                     /db_xref="GI:119356015"
                     /db_xref="GeneID:4568464"
                     /translation="MTEIKRKGLFSKIESRIDAIVLVEETTIGFFFVAGLQAILSIWQ
                     GLPVLVDAAIFALSSLFIRQFQSRVAAITLTLYAAVSVALAATNTAGAYFGGNNNIFL
                     SAILLWASIRAAEATIKLHGKFAIPENPKK"
     gene            complement(191334..192296)
                     /locus_tag="Cpha266_0169"
                     /db_xref="GeneID:4568465"
     CDS             complement(191334..192296)
                     /locus_tag="Cpha266_0169"
                     /note="KEGG: mlo:mlr7467 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910660.1"
                     /db_xref="GI:119356016"
                     /db_xref="GeneID:4568465"
                     /translation="MNLQLGQAIKIVAQTKVYLLYRTMVYGAIVGVVAIVLGILVLIG
                     TVFGSGAAFVLFLITLFAGSFGFRLLRDYVLYLLQAGHIALITEIAETGTLPPGISQT
                     SWAKEKVMKYYKEVSVLALVDQLVKGVLVTLNRTIFNVFNALPIPALEGLAGIVQRIV
                     NFSLTYIDESVIAYTFRTRNENVFDAAKSGILVYCQSWKAVLMNAVALTVLSYLFVIL
                     MTTLFMIPLGAVSLMLPSSWSFVKFALFVLALFLGISTKWILFDPIACTSTLLTFLNE
                     AETTKPDPAWESKIEMVSDQFRTLKTKAGEMMRGTAKSREAQST"
     gene            complement(192336..193247)
                     /locus_tag="Cpha266_0170"
                     /db_xref="GeneID:4568466"
     CDS             complement(192336..193247)
                     /locus_tag="Cpha266_0170"
                     /note="TIGRFAM: monofunctional biosynthetic peptidoglycan
                     transglycosylase;
                     PFAM: glycosyl transferase, family 51;
                     KEGG: cch:Cag_0146 monofunctional biosynthetic
                     peptidoglycan transglycosylase"
                     /codon_start=1
                     /transl_table=11
                     /product="monofunctional biosynthetic peptidoglycan
                     transglycosylase"
                     /protein_id="YP_910661.1"
                     /db_xref="GI:119356017"
                     /db_xref="InterPro:IPR001264"
                     /db_xref="InterPro:IPR011812"
                     /db_xref="GeneID:4568466"
                     /translation="MKLVKNLFILLLLFFIADIARYAFYPDIGRLAYENPKKSAFMLY
                     REAEWEKQGLYEKTVKQQWVPIEKVSPNLIKAVLIAEDDKFWQHEGFDYKAIGVALEK
                     NIAEKKFKMGGSTISQQLAKNLFLSPSKNPIRKIKEAILTWRIEKTLTKRRILEIYIN
                     VAEWGDGIFGIEQASRHYYGVSAARLTAQQASKLASVLPNPIRYSPKGSSSYVHNRSR
                     KILAIMKKRGIVLPDYDAVMTTAQPDTTTVDSVTIGIPQELIDQAASPDSSIDKTIEA
                     DHAPHDGAPGQKENTAIPDSPNSEKQP"
     misc_feature    complement(192576..193145)
                     /locus_tag="Cpha266_0170"
                     /note="Transglycosylase; Region: Transgly; cl17702"
                     /db_xref="CDD:248256"
     misc_feature    complement(192558..193133)
                     /locus_tag="Cpha266_0170"
                     /note="monofunctional biosynthetic peptidoglycan
                     transglycosylase; Provisional; Region: mtgA; PRK00056"
                     /db_xref="CDD:234603"
     gene            193428..193844
                     /locus_tag="Cpha266_0171"
                     /db_xref="GeneID:4568467"
     CDS             193428..193844
                     /locus_tag="Cpha266_0171"
                     /note="KEGG: plt:Plut_1980 C-type cytochrome, putative"
                     /codon_start=1
                     /transl_table=11
                     /product="C-type cytochrome, putative"
                     /protein_id="YP_910662.1"
                     /db_xref="GI:119356018"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="GeneID:4568467"
                     /translation="MKRVFIGLVTGLLCFPVAQSRAATPDGKEVFERNCSVCHSVNPP
                     SKSAPPILPISGRYHMQFSTKSAGVAAMAAFMKAPSKQKSVIEPEAITRFGLMPPMAL
                     GDAELTAVAGWVWDQGGSASGRGSGRGAGQGAGGCN"
     sig_peptide     193428..193496
                     /locus_tag="Cpha266_0171"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 1.000) with cleavage site probability 0.984 at
                     residue 23"
     misc_feature    193503..193772
                     /locus_tag="Cpha266_0171"
                     /note="Cytochrome c; Region: Cytochrom_C; pfam00034"
                     /db_xref="CDD:215669"
     gene            complement(193926..194001)
                     /locus_tag="Cpha266_R0002"
                     /note="tRNA-Arg4"
                     /db_xref="GeneID:4568468"
     tRNA            complement(193926..194001)
                     /locus_tag="Cpha266_R0002"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:4568468"
     gene            complement(194046..195920)
                     /locus_tag="Cpha266_0172"
                     /db_xref="GeneID:4568469"
     CDS             complement(194046..195920)
                     /locus_tag="Cpha266_0172"
                     /note="TIGRFAM: DNA mismatch repair protein MutL;
                     PFAM: ATP-binding region, ATPase domain protein domain
                     protein; DNA mismatch repair protein, C-terminal domain
                     protein;
                     KEGG: plt:Plut_1981 DNA mismatch repair protein"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutL"
                     /protein_id="YP_910663.1"
                     /db_xref="GI:119356019"
                     /db_xref="InterPro:IPR002099"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR013507"
                     /db_xref="GeneID:4568469"
                     /translation="MAKIARLPDNVANKISAGEVVQRPASVIKELLENAIDACASKIT
                     VTIKDAGKELVQIVDNGIGMSRQDALLSVERFATSKISGVEDLDSLMSLGFRGEALPS
                     IASVSQFELKTKPEGALLGFRFRCDGGEPVEESEVNAEKGTTITVRNLFYNVPARRKF
                     LKSNATEFRHIFESVKSLALAYPEIEWKMVSDDEELFHFRTPDIYERLDAFYGENFSL
                     SLIPVSEENDYLSISGFLGKPGMQKRQKLDQYIYVNRRIIQNRMLSQALQQAYGELLV
                     ERQAPFALLFLGIDPSRIDVNVHPAKLEVKFEDERSVRTMFYPVIKRTIQLHDFSPDA
                     AEKEPCSIKEGTLDCSSRKLGFQDIAEPASTTSTLYANYRQGAFGDTPFERPAYAEKE
                     PRPSSINTGFERFEPDLREGGDLFSTTLQARPYEDDNTPDPGENDPKIWQLHNKYIIC
                     QIKTGMMIIDQHVAHERVLYERAVDVMNQNVPNSQQLLFPQKIELRAWEYEVFEEIRD
                     DLYRLGFNLRSFGAKTVMIEGIPQDVRPGTEVTILQDMITEFQENSSKLKLERRENLA
                     RSYSCRNAIMAGQKLSLEEMRSLIDNLFATRVPYTCPHGRPVIIKLSLDQLDRMFGRK
                     "
     misc_feature    complement(194052..195914)
                     /locus_tag="Cpha266_0172"
                     /note="DNA mismatch repair protein; Reviewed; Region:
                     mutL; PRK00095"
                     /db_xref="CDD:234630"
     misc_feature    complement(195477..195851)
                     /locus_tag="Cpha266_0172"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(195486..195488,195492..195497,
                     195510..195512,195543..195545,195621..195632,
                     195729..195734,195738..195740,195744..195746,
                     195750..195752,195810..195812,195819..195821,
                     195831..195833))
                     /locus_tag="Cpha266_0172"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(195819..195821)
                     /locus_tag="Cpha266_0172"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(195624..195626,195630..195632,
                     195732..195734,195738..195740))
                     /locus_tag="Cpha266_0172"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(194949..195311)
                     /locus_tag="Cpha266_0172"
                     /note="MutL_Trans: transducer domain, having a ribosomal
                     S5 domain 2-like fold, conserved in the C-terminal domain
                     of DNA mismatch repair (MutL/MLH1/PMS2) family. This
                     transducer domain is homologous to the second domain of
                     the DNA gyrase B subunit, which is...; Region: MutL_Trans;
                     cd00782"
                     /db_xref="CDD:238405"
     misc_feature    complement(195015..195017)
                     /locus_tag="Cpha266_0172"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238405"
     misc_feature    complement(194178..194597)
                     /locus_tag="Cpha266_0172"
                     /note="MutL C terminal dimerisation domain; Region:
                     MutL_C; pfam08676"
                     /db_xref="CDD:219965"
     gene            196237..198909
                     /locus_tag="Cpha266_0173"
                     /db_xref="GeneID:4568470"
     CDS             196237..198909
                     /locus_tag="Cpha266_0173"
                     /note="TIGRFAM: ATPase, P-type (transporting), HAD
                     superfamily, subfamily IC;
                     PFAM: cation transporting ATPase domain protein domain
                     protein; Haloacid dehalogenase domain protein hydrolase;
                     cation transporting ATPase domain protein; E1-E2
                     ATPase-associated domain protein;
                     KEGG: plt:Plut_1234 ATPase, E1-E2 type"
                     /codon_start=1
                     /transl_table=11
                     /product="P-type HAD superfamily ATPase"
                     /protein_id="YP_910664.1"
                     /db_xref="GI:119356020"
                     /db_xref="InterPro:IPR000695"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="InterPro:IPR006068"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="GeneID:4568470"
                     /translation="MKTGHLTCWHCLTTEDVFNKLQTTSGGLSSSEAFRLLGVYGPNR
                     IHAERRTSPLKLLVAQFKNVLILTLLIATLLSVYLGHGFEAVAIAVIVLFAVLLGFVQ
                     EFRAEKAIEALREMAAPLARVMRDGKEAVINASELVPGDILLLAVGDRVAADARLLQA
                     SNLRADEASLTGESLPSEKDVEAVLSEDAAPGDQKNMVFAGTSISYGRASAVVVSTGM
                     ATEFGRIAAMLQNVETEKTPLQKNLDKVGSALAGVALLIVLVIVVFGLFRGQSFIEML
                     IFGIALAVAVVPEALPAVVTISLALGVQRMVKRNALMRRLPVVETLGSTTVICSDKTG
                     TLTRDEMTVRTLYSSGVFIDVNGSGYNPEGSLAVVDGGSLPESLNELLLAGVLCNDAR
                     IVKSDSGFWGVAGDPTEGALLVVARKAGLNELTLRQLYERLDERPFSSETKKMMTLHR
                     MGETTKAFIKGAPEVLLADSVAVRCSEGVKALDDPLRAALLAEADNLGKRALRVLAFA
                     VKDGADMSSAGDGMTFLGFAGMIDPPRAEAGDAVRQCLAAGIRPVMITGDHPLTAEAI
                     ARELGILRDGKVVTGAMLQTMSAEELRHSVGSVSVFARVAPEHKLRIVEALQMNGEVV
                     AMTGDGVNDAPALKKADIGISMGLTGTDVSKEASAMMLMDDNFATIVAAVEEGRGIYD
                     NIKKYLTYLLSSNIGELGLMAGATLMGIPLPLSAVQILYVNLATDGFPALALAVDPSE
                     RDIMLRSPNNPKKGIFTPSVLAFMLTGGIWSTMVNLSLFLWAFASGRTLQESMTMTFV
                     SLVLIQFFKAYNFRSEKVSLFVRPFANRWLNLAIVWELVMLIAIINVPFLQRLFGTCL
                     LTPEDWVIVIGSAMTVVPIIELLKWLMRSGRFGF"
     misc_feature    196261..>196425
                     /locus_tag="Cpha266_0173"
                     /note="Cation transporter/ATPase, N-terminus; Region:
                     Cation_ATPase_N; pfam00690"
                     /db_xref="CDD:201397"
     misc_feature    196276..198900
                     /locus_tag="Cpha266_0173"
                     /note="Cation transport ATPase [Inorganic ion transport
                     and metabolism]; Region: MgtA; COG0474"
                     /db_xref="CDD:223550"
     misc_feature    196540..197199
                     /locus_tag="Cpha266_0173"
                     /note="E1-E2 ATPase; Region: E1-E2_ATPase; pfam00122"
                     /db_xref="CDD:215733"
     misc_feature    197392..197664
                     /locus_tag="Cpha266_0173"
                     /note="Putative hydrolase of sodium-potassium ATPase alpha
                     subunit; Region: Hydrolase_like2; pfam13246"
                     /db_xref="CDD:222006"
     misc_feature    <198037..>198168
                     /locus_tag="Cpha266_0173"
                     /note="Soluble P-type ATPase [General function prediction
                     only]; Region: COG4087"
                     /db_xref="CDD:226572"
     misc_feature    198367..198882
                     /locus_tag="Cpha266_0173"
                     /note="Cation transporting ATPase, C-terminus; Region:
                     Cation_ATPase_C; pfam00689"
                     /db_xref="CDD:216063"
     gene            complement(198999..200054)
                     /gene="hemE"
                     /locus_tag="Cpha266_0174"
                     /db_xref="GeneID:4568471"
     CDS             complement(198999..200054)
                     /gene="hemE"
                     /locus_tag="Cpha266_0174"
                     /EC_number="4.1.1.37"
                     /note="catalyzes the formation of coproporphyrinogen from
                     uroporphyrinogen III"
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen decarboxylase"
                     /protein_id="YP_910665.1"
                     /db_xref="GI:119356021"
                     /db_xref="InterPro:IPR000257"
                     /db_xref="InterPro:IPR006361"
                     /db_xref="GeneID:4568471"
                     /translation="MLKNDLFLRALKRQPCSRTPIWVMRQAGRYLPEYRAVREKTDFL
                     TLCKTPELAAEVTIQPVDLMGVDAAIIFSDILVVNEAMGMDVEIIESKGIRLSPAIRS
                     QVDIDRLIIPDINEKLGYVMDAIRLTKKELDNRVPLIGFSGAAWTLFTYAVEGGGSKN
                     YAFAKKMMYREPKMAHMLLSKISSVITEYVLMQIEAGADAIQIFDSWASALSEDDYRE
                     FALPYIKENVQAIKTKYPDTPVIVFSKDCNTILSEIADTGCDAMGLGWNMDIAKARKE
                     LNDRVCIQGNMDPTVLYGTPDKIRSEAAKILKQFGQHTATSGHVFNLGHGILPDVDPA
                     NLKLLVEFVKEESVKYH"
     misc_feature    complement(199020..200036)
                     /gene="hemE"
                     /locus_tag="Cpha266_0174"
                     /note="methylcobalamin:coenzyme M methyltransferase;
                     Validated; Region: PRK06252"
                     /db_xref="CDD:235753"
     misc_feature    complement(199020..200033)
                     /gene="hemE"
                     /locus_tag="Cpha266_0174"
                     /note="Uroporphyrinogen decarboxylase (URO-D) is a dimeric
                     cytosolic enzyme that decarboxylates the four acetate side
                     chains of uroporphyrinogen III (uro-III) to create
                     coproporphyrinogen III, without requiring any prosthetic
                     groups or cofactors. This reaction...; Region: URO-D;
                     cd00717"
                     /db_xref="CDD:238368"
     misc_feature    complement(order(199080..199082,199326..199328,
                     199434..199439,199443..199445,199584..199586,
                     199602..199604,199632..199634,199776..199778,
                     199791..199793,199827..199847,199926..199928,
                     199941..199943,199953..199955,199968..199985))
                     /gene="hemE"
                     /locus_tag="Cpha266_0174"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238368"
     misc_feature    complement(order(199080..199082,199437..199439,
                     199602..199604,199833..199835,199968..199970,
                     199980..199982))
                     /gene="hemE"
                     /locus_tag="Cpha266_0174"
                     /note="active site"
                     /db_xref="CDD:238368"
     gene            complement(200220..201068)
                     /locus_tag="Cpha266_0175"
                     /db_xref="GeneID:4570556"
     CDS             complement(200220..201068)
                     /locus_tag="Cpha266_0175"
                     /EC_number="1.3.5.1"
                     /note="PFAM: protein of unknown function DUF224,
                     cysteine-rich region domain protein;
                     KEGG: plt:Plut_1993 succinate/fumarate oxidoreductase,
                     putative"
                     /codon_start=1
                     /transl_table=11
                     /product="succinate dehydrogenase subunit C"
                     /protein_id="YP_910666.1"
                     /db_xref="GI:119356022"
                     /db_xref="InterPro:IPR000173"
                     /db_xref="InterPro:IPR004017"
                     /db_xref="GeneID:4570556"
                     /translation="MKRYAYYLSCINESMTKELDRSIDLWQKDLDLELIKLHESTCCG
                     GSNLEYVSPKHFALVNARNIAHAEKLGLDLVVSCNTCLMTIRTAKKKLDSSAELKCEV
                     NEILKKEGLEYKGTSEVRHLLWILIEDVGLDVIKSKVKVPLKNYKIAPFYGCHILRPS
                     TVLGKDNPLDPSSLDQLIEALGGTTIPYEHKNRCCGFHTLLVAEEESLNVAAEALNEA
                     IESKADFIVTPCPLCHTVLDGYQAKALKQAHINASIPVFHLSEMVGLALGYTKKQLGI
                     KRHIVS"
     misc_feature    complement(200223..201065)
                     /locus_tag="Cpha266_0175"
                     /note="Heterodisulfide reductase, subunit B [Energy
                     production and conversion]; Region: HdrB; COG2048"
                     /db_xref="CDD:224959"
     misc_feature    complement(200811..201059)
                     /locus_tag="Cpha266_0175"
                     /note="Cysteine-rich domain; Region: CCG; pfam02754"
                     /db_xref="CDD:202376"
     misc_feature    complement(200355..200627)
                     /locus_tag="Cpha266_0175"
                     /note="Cysteine-rich domain; Region: CCG; pfam02754"
                     /db_xref="CDD:202376"
     misc_feature    complement(<200265..200438)
                     /locus_tag="Cpha266_0175"
                     /note="Type 1 periplasmic binding fold superfamily;
                     Region: Periplasmic_Binding_Protein_Type_1; cl10011"
                     /db_xref="CDD:245225"
     gene            complement(201087..202157)
                     /locus_tag="Cpha266_0176"
                     /db_xref="GeneID:4570557"
     CDS             complement(201087..202157)
                     /locus_tag="Cpha266_0176"
                     /EC_number="1.3.5.1"
                     /note="KEGG: plt:Plut_1994 succinate
                     dehydrogenase/fumarate reductase iron-sulfur protein;
                     TIGRFAM: succinate dehydrogenase and fumarate reductase
                     iron-sulfur protein;
                     PFAM: ferredoxin"
                     /codon_start=1
                     /transl_table=11
                     /product="succinate dehydrogenase subunit B"
                     /protein_id="YP_910667.1"
                     /db_xref="GI:119356023"
                     /db_xref="InterPro:IPR001041"
                     /db_xref="InterPro:IPR004489"
                     /db_xref="InterPro:IPR006058"
                     /db_xref="GeneID:4570557"
                     /translation="MNSRKEPINSMHMTGAAEQHKEEKRDITFRVFRFNPQVDIKPYF
                     DDYTIPVERGITVLRALNYIKEHVDPTVSYRAFCQAGICGSCGMRVNGISKLACTTQV
                     WDELDRCKEPGILRVEPLRNMPPIKDLIVDMDPLVDKMKHYMNWVDSSMPESEMGKKE
                     FLVSEDEFLKYDKATDCILCASCVSECTILRAHKEYVSPAVLLKSYRMNVDSRDSIHD
                     TRLAELVKDHGVWDCTHCYRCQETCVKSIPIMDAIHGIRENALEVRGTKDTSGAKHAE
                     AFMDDIAKKGKLVEATLPFRTNGVLWTLQNLLPMAVKMIMKRRTPPPPPMVKPSKGIK
                     AFREEFREMTEHVKDDHQTHNK"
     misc_feature    complement(201372..202079)
                     /locus_tag="Cpha266_0176"
                     /note="Succinate dehydrogenase/fumarate reductase, Fe-S
                     protein subunit [Energy production and conversion];
                     Region: FrdB; COG0479"
                     /db_xref="CDD:223555"
     misc_feature    complement(<201885..202046)
                     /locus_tag="Cpha266_0176"
                     /note="2Fe-2S iron-sulfur cluster binding domain.
                     Iron-sulfur proteins play an important role in electron
                     transfer processes and in various enzymatic reactions. The
                     family includes plant and algal ferredoxins, which act as
                     electron carriers in photosynthesis...; Region: fer2;
                     cd00207"
                     /db_xref="CDD:238126"
     misc_feature    complement(order(201900..201911,201915..201917,
                     201924..201926,201939..201944))
                     /locus_tag="Cpha266_0176"
                     /note="catalytic loop [active]"
                     /db_xref="CDD:238126"
     misc_feature    complement(order(201900..201902,201909..201911,
                     201924..201926))
                     /locus_tag="Cpha266_0176"
                     /note="iron binding site [ion binding]; other site"
                     /db_xref="CDD:238126"
     gene            complement(202132..203835)
                     /locus_tag="Cpha266_0177"
                     /db_xref="GeneID:4570558"
     CDS             complement(202132..203835)
                     /locus_tag="Cpha266_0177"
                     /EC_number="1.3.5.1"
                     /note="KEGG: plt:Plut_1995 succinate dehydrogenase or
                     fumarate reductase, flavoprotein subunit;
                     TIGRFAM: succinate dehydrogenase or fumarate reductase,
                     flavoprotein subunit;
                     PFAM: fumarate reductase/succinate dehydrogenase
                     flavoprotein domain protein; HI0933 family protein; FAD
                     dependent oxidoreductase; FAD-dependent pyridine
                     nucleotide-disulphide oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="succinate dehydrogenase subunit A"
                     /protein_id="YP_910668.1"
                     /db_xref="GI:119356024"
                     /db_xref="InterPro:IPR001100"
                     /db_xref="InterPro:IPR003952"
                     /db_xref="InterPro:IPR003953"
                     /db_xref="InterPro:IPR004112"
                     /db_xref="InterPro:IPR004792"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR014006"
                     /db_xref="GeneID:4570558"
                     /translation="MKPFDIVIVGGGGAGLYAAMEAMKTNPSLNIAVLSKVYPNRSHT
                     SAAQGGANAALANKAKDDTVEMHIFDTIKGSDYLADQDAVDILCSEAPKIIRELDNIG
                     TPWSRLDDNTIAQRPFGGAGRPRCCYCADKTGHTILQTLYEQCLKKGVFFFNEYFSLS
                     LSVNNSRMRGLLAINMKTGKIEAFPAKTVIFATGGYAKMYWNRSSNAAGNTGDGQAIA
                     YRAGIPLKDMEFVQFHPTGLRKSGLLVTEGARGEGGYLVNKDGERFMSRYAPEKMELG
                     PRDLVSRSIETEILQGRGFDSPAGKYIHLDLTHLGAELIKSRLPQIREMSMNFEGVDP
                     IEEPIPVRPTAHYSMGGIDTDNYGRTVMDGVYAAGECACVSVHGANRLGGNSLLDILV
                     FGRIAGHTAAEEAGKFEPGNISPEEIKAKDEELRSFMQSSGHYERYGALREELGQTLA
                     LNVGIYREASKISRGMEDLSLLKDRFKKIRVFDSSDIFNTNLIQVLELQNMLDLAETV
                     ATGALAREESRGSHTRNDFPTRNDEKWHKHTLATLENGTVKLGQKPVTMGRYELQERT
                     Y"
     misc_feature    complement(202645..203823)
                     /locus_tag="Cpha266_0177"
                     /note="L-aspartate oxidase; Provisional; Region: PRK06175"
                     /db_xref="CDD:180442"
     misc_feature    complement(202135..203748)
                     /locus_tag="Cpha266_0177"
                     /note="succinate dehydrogenase or fumarate reductase,
                     flavoprotein subunitGram-negative/mitochondrial subgroup;
                     Region: sdhA_frdA_Gneg; TIGR01812"
                     /db_xref="CDD:233582"
     misc_feature    complement(202135..202512)
                     /locus_tag="Cpha266_0177"
                     /note="Fumarate reductase flavoprotein C-term; Region:
                     Succ_DH_flav_C; pfam02910"
                     /db_xref="CDD:217281"
     gene            complement(203961..204407)
                     /locus_tag="Cpha266_0178"
                     /db_xref="GeneID:4570559"
     CDS             complement(203961..204407)
                     /locus_tag="Cpha266_0178"
                     /note="PFAM: CBS domain containing protein;
                     KEGG: cte:CT2044 CBS domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="signal-transduction protein"
                     /protein_id="YP_910669.1"
                     /db_xref="GI:119356025"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="GeneID:4570559"
                     /translation="MHQLITLRTLPVSDLMQKDYHTIKGSCTVAEALQLMKRTKESGL
                     IVEPRNEDDCYGIVTEKDILEKVIDPGEDVHRDPWNTPIFQIMSKPIISVNPSLRIKY
                     ALRLMKRTNVRRLTVMENNKVIGVLNMTDVLHAVEELPIHDDNIAL"
     misc_feature    complement(204009..204374)
                     /locus_tag="Cpha266_0178"
                     /note="FOG: CBS domain [General function prediction only];
                     Region: COG0517"
                     /db_xref="CDD:223591"
     misc_feature    complement(204003..204356)
                     /locus_tag="Cpha266_0178"
                     /note="The CBS domain, named after human CBS, is a small
                     domain originally identified in cystathionine
                     beta-synthase and is subsequently found in a wide range of
                     different proteins. CBS domains usually occur in tandem
                     repeats. They associate to form a so-called...; Region:
                     CBS_pair_17; cd04630"
                     /db_xref="CDD:240001"
     gene            complement(204591..205232)
                     /locus_tag="Cpha266_0179"
                     /db_xref="GeneID:4570560"
     CDS             complement(204591..205232)
                     /locus_tag="Cpha266_0179"
                     /note="PFAM: beta-lactamase domain protein;
                     KEGG: plt:Plut_1997 hydroxyacylglutathione hydrolase,
                     putative"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase domain-containing protein"
                     /protein_id="YP_910670.1"
                     /db_xref="GI:119356026"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="GeneID:4570560"
                     /translation="MIIKQFRTGGDRNLGYLAADEVSGDALVVDASYNPGMIYNFACE
                     HGLTIRYLFSTHGHSDHTNGNATTSQLTGLKPLLYGDTCPETGISVRAGARFPLGSGS
                     VLIIHTPGHTEDSICLHVGDALFTGDTLFTGKVGGTMTAEQALAEYDSLRNKLMRLPD
                     ETRVFPGHDYGSSPASTIAEEKKSNPFLLQPDFRSFLALKQNWAAYKKEHGIA"
     misc_feature    complement(204669..205196)
                     /locus_tag="Cpha266_0179"
                     /note="Metallo-beta-lactamase superfamily; Region:
                     Lactamase_B; cl00446"
                     /db_xref="CDD:241867"
     gene            complement(205257..205565)
                     /locus_tag="Cpha266_0180"
                     /db_xref="GeneID:4570561"
     CDS             complement(205257..205565)
                     /locus_tag="Cpha266_0180"
                     /note="KEGG: plt:Plut_1998 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910671.1"
                     /db_xref="GI:119356027"
                     /db_xref="GeneID:4570561"
                     /translation="MKFLAIMGHEETRPMVRNLFKEYQVNLFSNVAIRGCNCQKPALM
                     EQSWWPADEMIGTYSSLCFAILDDDKAEAIMLELEKNPIAVDKDFPARAFLMHVEKTA
                     "
     gene            complement(205588..208794)
                     /locus_tag="Cpha266_0181"
                     /db_xref="GeneID:4570562"
     CDS             complement(205588..208794)
                     /locus_tag="Cpha266_0181"
                     /note="PFAM: acriflavin resistance protein;
                     KEGG: cch:Cag_0123 AcrB/AcrD/AcrF family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="acriflavin resistance protein"
                     /protein_id="YP_910672.1"
                     /db_xref="GI:119356028"
                     /db_xref="InterPro:IPR001036"
                     /db_xref="GeneID:4570562"
                     /translation="MNEGIAGKLAKQFINSKITPLLMIASLLVGVMATFMTPREEEPQ
                     IVVPLVDLYIPYPGATPSEVEERVAKPVERALTEIPGVDFVYSTSMPDVALVTVRYKV
                     GEDTEQSMVKLWSVLMKNMDKMPAGAQFPLIKKVAIDDVPVLNLTFWSKTKDPYQLRQ
                     TVAAVGDELKQIESIGDVEIKGGLKRQVRVVLNKEKLSQFNISALQIARQIQQSNSQM
                     TAGDFKQMNNEIIVRSGRFLESADDVRGIVVGIYGASPVYLRDVSEVIDGPEEVNNYT
                     FFGWGAAGPKNAATGEYPAVTLTVAKRKGTDATVLANKVMTKVEGLKKTTIPSDITVT
                     ETRNYGETASEKVFTLLEHLIMAVVAVTIVVGFFLGWRGALVVFASVPITFALTLLIY
                     YLLDYSLNRVTLFALIFVTGIVVDDSIIIAENIHRHFAMKRQPRLQAAITAISEVGNP
                     TILATFTVIAAVLPMVFVSGLMGPYMSPMPIGASLAMVFSLLVALIATPWLSYRLLKT
                     EEGHHEEYDITKTGYYKLFNSILSPFIESKLKTWLAFGGVAILLIGAIALVPLKAVQM
                     KMLPFDNKNEFQVIVDMPEGTALEQTARVTKEISAYLKTVPEVSSYQYYVGTNAPINF
                     NGLVRHYYLRQADNMGDIQVNLIHKGERSLQSHDIAKKVRSAVQNIALKYNGNAKIVE
                     IPPGPPVLSTLVAEIYGPSQKEQIALAGEVKKIFSQTPGVVDVDWLVEDDQRVYDLEV
                     NKEQAAFRGVSAEQIAQTLRMSLHGVEVGLLHTRKSIEPVTIQLRLPQNQRTSIQDLS
                     GIFVQSQGMGSLTTRLRAGEMIPLSSLVTIKEKIQDKSIYRKDLRQVVYVTADVAGAT
                     ESPVYAMLAMDKKIEQLKLPGGYSISPLYTSAPTSQAKSSMKWDGEWQITFEVFRDLG
                     TAFAVVLVIIYLLIIGWFQSFKTPLIMMIAIPLSLVGIIPGHWIHGAFFTATSMIGMI
                     ALAGIMVRNSVLLIDFIQIRREEGVDLKQAVIESAAVRTRPIILTSGAVVIGSLVMLF
                     DPIFQGLAISLIWGGVLSTILTLVVVPLVYYMAEKKSH"
     misc_feature    complement(205597..208773)
                     /locus_tag="Cpha266_0181"
                     /note="Cation/multidrug efflux pump [Defense mechanisms];
                     Region: AcrB; COG0841"
                     /db_xref="CDD:223911"
     misc_feature    complement(207322..>207735)
                     /locus_tag="Cpha266_0181"
                     /note="Protein export membrane protein; Region: SecD_SecF;
                     cl14618"
                     /db_xref="CDD:246677"
     gene            complement(208787..209203)
                     /locus_tag="Cpha266_0182"
                     /db_xref="GeneID:4570563"
     CDS             complement(208787..209203)
                     /locus_tag="Cpha266_0182"
                     /note="KEGG: plt:Plut_2000 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910673.1"
                     /db_xref="GI:119356029"
                     /db_xref="InterPro:IPR000437"
                     /db_xref="GeneID:4570563"
                     /translation="MKGQNNSVAFIAVLITLLAGCGKGEQHTNNAKTKPDQALSLPLF
                     QTESTLNARGEEVILVPKSSVFQQGGLTGVFVVGDDQKATIRWIRTGRIDHGSVVVLG
                     GIDKGEMVIANYNPELKEGVSVTKSQAVTREATSNE"
     misc_feature    complement(208829..>209041)
                     /locus_tag="Cpha266_0182"
                     /note="RND family efflux transporter, MFP subunit; Region:
                     RND_mfp; TIGR01730"
                     /db_xref="CDD:233547"
     gene            complement(209243..210568)
                     /locus_tag="Cpha266_0183"
                     /db_xref="GeneID:4570564"
     CDS             complement(209243..210568)
                     /locus_tag="Cpha266_0183"
                     /note="PFAM: outer membrane efflux protein;
                     KEGG: cch:Cag_0122 LipD protein, putative"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane efflux protein"
                     /protein_id="YP_910674.1"
                     /db_xref="GI:119356030"
                     /db_xref="InterPro:IPR003423"
                     /db_xref="GeneID:4570564"
                     /translation="MKVYKTLIGIMLAGSIALPGCVQAAEKTIKLSLGEAVSMARENN
                     RTIKAAQSRVAQAEAKIVQTRQSYLPKVTLSETAVITNDPGAALVFKLQQNIITQSDF
                     IPDRLNNADVINDFNTSLLVMQPVYNPDASTGRTIAFTAKKAQEQMAARTTETVELQV
                     SKLYYGLILARKNIEAVEQSIITMKNHSNEADKAYRVGLLTKSDKLSTDVRLAELLEQ
                     KLMLHDAIKNATDALKVMLNLDANLTIIPTEDLVVDKRLPVVDEKNTPEGRSDLKALQ
                     TYREIAGYQEKMAQAAKLPRVNAFFQTNLHSSDIFSGGSSWALGMTMQWNIYDGMATT
                     GRIQEAKAQQLEAMYNHEEAKSQSLVEIKKAQRDLKTAKARIAVSQESLEEARVSLDY
                     IGTQFKTGMAMTFELLMREGAYTYAKLRLNQAKYDYCIARSELAYYSAR"
     sig_peptide     complement(210494..210568)
                     /locus_tag="Cpha266_0183"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 1.000) with cleavage site probability 1.000 at
                     residue 25"
     misc_feature    complement(209252..210481)
                     /locus_tag="Cpha266_0183"
                     /note="type I secretion outer membrane protein, TolC
                     family; Region: type_I_sec_TolC; TIGR01844"
                     /db_xref="CDD:233594"
     gene            complement(210575..210850)
                     /locus_tag="Cpha266_0184"
                     /db_xref="GeneID:4570565"
     CDS             complement(210575..210850)
                     /locus_tag="Cpha266_0184"
                     /note="KEGG: plt:Plut_2002 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910675.1"
                     /db_xref="GI:119356031"
                     /db_xref="GeneID:4570565"
                     /translation="MLVCCQEILQLDDKDMDDVILRLKKVNGQIQGLIRMVENSDNCE
                     KVIVQFQAAKAALDKTYSLVLDRSLKECMSHNDTENVGRILKLISKH"
     misc_feature    complement(210581..210805)
                     /locus_tag="Cpha266_0184"
                     /note="Transcriptional regulators CsoR (copper-sensitive
                     operon repressor), RcnR, and FrmR, and related domains;
                     this domain superfamily was previously known as DUF156;
                     Region: CsoR-like_DUF156; cd10148"
                     /db_xref="CDD:197385"
     misc_feature    complement(order(210584..210613,210617..210622,
                     210632..210634,210641..210649,210653..210661,
                     210665..210670,210677..210682,210689..210694,
                     210698..210703,210707..210715,210719..210727,
                     210731..210742,210749..210754,210758..210763,
                     210770..210772,210779..210784,210791..210796,
                     210803..210805))
                     /locus_tag="Cpha266_0184"
                     /note="putative homotetramer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:197385"
     misc_feature    complement(order(210584..210595,210602..210604,
                     210647..210649,210659..210661,210668..210670,
                     210677..210682,210689..210694,210698..210703,
                     210707..210715,210719..210727,210731..210742,
                     210749..210754,210758..210763,210770..210772,
                     210779..210784,210791..210796,210803..210805))
                     /locus_tag="Cpha266_0184"
                     /note="putative homodimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:197385"
     misc_feature    complement(order(210602..210604,210647..210649,
                     210725..210727))
                     /locus_tag="Cpha266_0184"
                     /note="putative allosteric switch controlling residues;
                     other site"
                     /db_xref="CDD:197385"
     misc_feature    complement(order(210635..210637,210647..210649,
                     210722..210724))
                     /locus_tag="Cpha266_0184"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:197385"
     misc_feature    complement(order(210596..210601,210605..210613,
                     210617..210622,210632..210637,210641..210646,
                     210653..210658,210665..210667))
                     /locus_tag="Cpha266_0184"
                     /note="putative homodimer-homodimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:197385"
     gene            complement(210923..211795)
                     /locus_tag="Cpha266_0185"
                     /db_xref="GeneID:4570566"
     CDS             complement(210923..211795)
                     /locus_tag="Cpha266_0185"
                     /note="PFAM: alpha/beta hydrolase fold;
                     KEGG: cch:Cag_0591 proline iminopeptidase, putative"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="YP_910676.1"
                     /db_xref="GI:119356032"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR003089"
                     /db_xref="InterPro:IPR008262"
                     /db_xref="GeneID:4570566"
                     /translation="MSFADTTRGKIYYEDTGWGVSDNREVVLFFNGWSISARYWIPVI
                     DRLSSQYRCLSFDQSGTGRTVCSHSCLSFSVEGFADEASELLVHLGLLGSRKLHIVGH
                     SMGGMIATEICNRHPESLVSATIVNCGIFDDELLKSFHHVLVGGMIDVAMLFKGVFLL
                     EPFKSLFIDRAIGRPIDQKYRTVFVEDFVASDTRAATAVGKFAIDPEIIGKYTAEAVK
                     IGAPLLCVVGMADRTIPPEGMQTLYNRRIEQSDFLTRLARFDHAGHLPMLEVLPEFEQ
                     ALRNHFYAASKLLG"
     misc_feature    complement(210956..211795)
                     /locus_tag="Cpha266_0185"
                     /note="Predicted hydrolases or acyltransferases
                     (alpha/beta hydrolase superfamily) [General function
                     prediction only]; Region: MhpC; COG0596"
                     /db_xref="CDD:223669"
     misc_feature    complement(<211427..>211546)
                     /locus_tag="Cpha266_0185"
                     /note="homoserine O-acetyltransferase; Provisional;
                     Region: metX; cl17114"
                     /db_xref="CDD:247710"
     gene            complement(211792..212448)
                     /locus_tag="Cpha266_0186"
                     /db_xref="GeneID:4570567"
     CDS             complement(211792..212448)
                     /locus_tag="Cpha266_0186"
                     /note="PFAM: Isoprenylcysteine carboxyl methyltransferase;
                     KEGG: mac:MA2698 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="isoprenylcysteine carboxyl methyltransferase"
                     /protein_id="YP_910677.1"
                     /db_xref="GI:119356033"
                     /db_xref="InterPro:IPR007269"
                     /db_xref="GeneID:4570567"
                     /translation="MAMHDELPFRIIFAGIYVAGFLMRGLFIQRMKPQEKPIIPEAGN
                     AGEISRFRVIFQKVMFFLWIAIVASYTWYPPWVEALHFPFPTWLRYGGAIAAAVSFLF
                     LFLTMKTLGRYWSPLPRLMEGHKLVITGPYRFIRHPMYTAMMLLFIAFILITANAAVT
                     VFSLIATVLTVKWALNEEKMLIGFFGDEYRAYMTRTGAFLPAPRKMVRHIFFNQHEKL
                     "
     misc_feature    complement(211846..>212259)
                     /locus_tag="Cpha266_0186"
                     /note="Putative protein-S-isoprenylcysteine
                     methyltransferase [Posttranslational modification, protein
                     turnover, chaperones]; Region: STE14; COG2020"
                     /db_xref="CDD:224931"
     gene            212717..213394
                     /locus_tag="Cpha266_0187"
                     /db_xref="GeneID:4570568"
     CDS             212717..213394
                     /locus_tag="Cpha266_0187"
                     /note="KEGG: cte:CT2051 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910678.1"
                     /db_xref="GI:119356034"
                     /db_xref="GeneID:4570568"
                     /translation="MKKEHATISGRKKRFCVIMEVVGKSKALVVLESCLQESTVYFSN
                     HEKILKCNPYCRYVRYIPDFDVFQWTFEVDDPRNNPIVAIFFVRQTEEHIPTDSAVFR
                     RYVGESRAPIDTETPGKKIIWETVESAPELLFNNDHTFIGKTFSEIFLLHQTDNRTTV
                     HFETNISLDFKLSFPLNLMPEPALKFMSDMIMSKIMQQATESMLCQVQSDICCSMPEI
                     ATEGGKK"
     gene            213535..214821
                     /locus_tag="Cpha266_0188"
                     /db_xref="GeneID:4570569"
     CDS             213535..214821
                     /locus_tag="Cpha266_0188"
                     /note="PFAM: coenzyme F420 hydrogenase/dehydrogenase beta
                     subunit domain protein;
                     KEGG: ter:Tery_0742 coenzyme F420
                     hydrogenase/dehydrogenase beta subunit-like"
                     /codon_start=1
                     /transl_table=11
                     /product="coenzyme F420 hydrogenase/dehydrogenase subunit
                     beta"
                     /protein_id="YP_910679.1"
                     /db_xref="GI:119356035"
                     /db_xref="InterPro:IPR007516"
                     /db_xref="InterPro:IPR007525"
                     /db_xref="GeneID:4570569"
                     /translation="MQHSVVSLKTSSLPMTKPSKIQTPRFDEPLCSKCGLCMGNAWPV
                     KESLESCVFRCGWVENHEKRIFGRVRNPDDSDELRFGISLKRFNATLKKPVNGAQWSG
                     IITRISTMALQTNLVDAVLTLHGEPLQPKAVLAKTAQDIHEARGNKPVLSPVLQALHT
                     AYREKTRRLLVVGAACHVHMVRDFTRKSPYFADLDLYIVGIPCTDNLEPSHLQWVFRN
                     ISKNPETVINFEFMQDYRVHILHKAGKVEKIPFFCLPSAVMKVGVFPNSCLSCFDYIN
                     SLSDITVGYLGAPYSKNRKTQWIIVRTERGEKLLDLINDEIETSPEVFFGDSHSAVQA
                     ALQPTLMPILQPEKLDDRKAMPKWLGIYLSRKKAKSGPGGTEFAKYSIDIHAIRNFYF
                     LKMYRPDDIGIVPTHIYDLLSQYDLSSIQRIIEARI"
     misc_feature    213799..214008
                     /locus_tag="Cpha266_0188"
                     /note="Coenzyme F420 hydrogenase/dehydrogenase, beta
                     subunit N-term; Region: FrhB_FdhB_N; pfam04422"
                     /db_xref="CDD:218081"
     misc_feature    214027..214503
                     /locus_tag="Cpha266_0188"
                     /note="Coenzyme F420 hydrogenase/dehydrogenase, beta
                     subunit C terminus; Region: FrhB_FdhB_C; pfam04432"
                     /db_xref="CDD:218086"
     gene            214842..215615
                     /locus_tag="Cpha266_0189"
                     /db_xref="GeneID:4570570"
     CDS             214842..215615
                     /locus_tag="Cpha266_0189"
                     /note="PFAM: short-chain dehydrogenase/reductase SDR;
                     KEGG: ath:At4g13250 short-chain dehydrogenase/reductase
                     (SDR) family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="YP_910680.1"
                     /db_xref="GI:119356036"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR002424"
                     /db_xref="GeneID:4570570"
                     /translation="MKNIVITGSSRGIGLGLAHAFLSKGCRVMISSSNSSNLDKALNE
                     LVEQHGSEHISAKTCDVANYQEVQDLWDHAQKSIGQVDIWINNAGIAHPLLPFWKLDM
                     TQIGHTLDVNLAGTINGSHVAIRGMIEQGSGYLYNLEGQGADGGIIHGMGVFGTSKAA
                     VHYFSKSLIEETRSLKIKVGTIIPGIIRTELQAKTSQQTDAGRLFLSLLGENVREATE
                     DLAKRILANNTHGVCINRMTTPDMIGKIATLPINFLLGR"
     misc_feature    214845..215558
                     /locus_tag="Cpha266_0189"
                     /note="Short-chain alcohol dehydrogenase of unknown
                     specificity [General function prediction only]; Region:
                     COG4221"
                     /db_xref="CDD:226674"
     misc_feature    214851..215453
                     /locus_tag="Cpha266_0189"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    order(214863..214865,214869..214880,214935..214943,
                     215016..215024,215100..215108,215172..215174,
                     215253..215261,215301..215303,215313..215315,
                     215391..215402,215406..215411)
                     /locus_tag="Cpha266_0189"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    order(215175..215177,215259..215261,215301..215303,
                     215313..215315)
                     /locus_tag="Cpha266_0189"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            complement(215789..216013)
                     /locus_tag="Cpha266_0190"
                     /db_xref="GeneID:4570571"
     CDS             complement(215789..216013)
                     /locus_tag="Cpha266_0190"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910681.1"
                     /db_xref="GI:119356037"
                     /db_xref="GeneID:4570571"
                     /translation="MPQLPQNIIPEELTKPAAAIVSGAFLLSPLGIPPFIRGIPRVLL
                     AGAGGFLAGAVAEKVIENIGQILPPQPEDD"
     gene            complement(216052..216417)
                     /locus_tag="Cpha266_0191"
                     /db_xref="GeneID:4570572"
     CDS             complement(216052..216417)
                     /locus_tag="Cpha266_0191"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910682.1"
                     /db_xref="GI:119356038"
                     /db_xref="GeneID:4570572"
                     /translation="MANESRKGGFFSVFRKEEKSVANKSAITSQQSETKAASSEKPAV
                     SVSREMTPKPVANVKPAATAEQQEKPVVFEAIDTTAAFSACWKAFGDLGLSQIKTVDM
                     VLTMLSNSIAKITDGQQTK"
     gene            complement(216448..217989)
                     /locus_tag="Cpha266_0192"
                     /db_xref="GeneID:4570573"
     CDS             complement(216448..217989)
                     /locus_tag="Cpha266_0192"
                     /note="KEGG: plt:Plut_1700 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910683.1"
                     /db_xref="GI:119356039"
                     /db_xref="GeneID:4570573"
                     /translation="MIADKVQTLYPRVSEYFGKIRNGNRYLEHILEVDSFWKNFEHSP
                     CRKVVLQGSEMPADACVSDEYDLVYAGGSLGLLHASVMASKYARKVLVFDRHMSGKPS
                     RDWNISWNELEKLEQVGLFSYEEINASIACRYKTGWAEFYVENGRKKRLYIDNVLDCA
                     VESDQLLSIARQKILADECNRIVDKMTFMRCFQFPESVVIEVENNMHERVYFRAKVFV
                     DAMGVHSPVAMQLNDGASFTHLCPTVGTVSSGLENVDPDIGEILVSTEPADTSSGRGR
                     QLIWEGFPAGGDRYTTYLFFYDSRSSDNDKSLLGLFETYFLKLPSYKKPGKDFVVHRP
                     VYGVIPAYYHDGFERTRQVADNNILMLGDAAALGSPLTFCGFGSFVRNLKSLTEGLEK
                     ALACNSFEKKNLEQISAYEPNVAAMANLMKFMCYNKYTDHPNFVNELMNEVMIVLDGL
                     PPRYREAMFKDTLELSDLLLIGLNVAWKYPGVLMATATKLGLEGSLGMMKNMIGWAMS
                     SKASN"
     misc_feature    complement(216874..217797)
                     /locus_tag="Cpha266_0192"
                     /note="geranylgeranyl reductase family; Region: GG-red-SF;
                     TIGR02032"
                     /db_xref="CDD:233693"
     gene            218179..218400
                     /locus_tag="Cpha266_0193"
                     /db_xref="GeneID:4570574"
     CDS             218179..218400
                     /locus_tag="Cpha266_0193"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910684.1"
                     /db_xref="GI:119356040"
                     /db_xref="GeneID:4570574"
                     /translation="MSQDSAKLFLAQMKQDKELSDKIHNAATKEDRWTIIRQEGFDFT
                     REELDHATVTELNHFERWNWEAKLLADWL"
     misc_feature    218179..218322
                     /locus_tag="Cpha266_0193"
                     /note="Nitrogen fixation protein of unknown function;
                     Region: Nif11; pfam07862"
                     /db_xref="CDD:219612"
     gene            complement(218428..219309)
                     /locus_tag="Cpha266_0194"
                     /db_xref="GeneID:4570575"
     CDS             complement(218428..219309)
                     /locus_tag="Cpha266_0194"
                     /EC_number="4.1.2.13"
                     /note="PFAM: deoxyribose-phosphate
                     aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase;
                     KEGG: cch:Cag_1641 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="aldolase"
                     /protein_id="YP_910685.1"
                     /db_xref="GI:119356041"
                     /db_xref="InterPro:IPR002915"
                     /db_xref="GeneID:4570575"
                     /translation="MAEYDKDKQAKEYYTDVPVEKHGFFLKGAHSLDWGMKNRLSRIF
                     RPDTGRTVMFAIDHGYFQGPTTGLERPDVNIVPLMSHADAIMLTRGMLRTTVPPSLTR
                     AVVMRCSGGPSILKELSDEELAVDIEDAIRMNVAAITLQIFIGGEFETRSIHNMTRLI
                     DMGLRYGIPTMAVTAVGKDMVRDAKYFRLACRIAAELGAQIVKTYYVPEDFETVVASC
                     PVPIVMAGGKKISELEAVTMSYQAIQEGAAGVDMGRNIFQSDAPLAMMKTVGKVVHEN
                     MPPAEAYEYFQSIRREG"
     misc_feature    complement(218467..219216)
                     /locus_tag="Cpha266_0194"
                     /note="DhnA-type fructose-1,6-bisphosphate aldolase and
                     related enzymes [Carbohydrate transport and metabolism];
                     Region: FbaB; COG1830"
                     /db_xref="CDD:224743"
     misc_feature    complement(218488..219159)
                     /locus_tag="Cpha266_0194"
                     /note="Class I fructose-1,6-bisphosphate (FBP) aldolases
                     of the archaeal type (DhnA homologs); Region: DhnA;
                     cd00958"
                     /db_xref="CDD:188645"
     misc_feature    complement(order(218515..218523,218581..218589,
                     218650..218652,218659..218661))
                     /locus_tag="Cpha266_0194"
                     /note="putative active site; other site"
                     /db_xref="CDD:188645"
     misc_feature    complement(218659..218661)
                     /locus_tag="Cpha266_0194"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:188645"
     gene            complement(219381..221498)
                     /locus_tag="Cpha266_0195"
                     /db_xref="GeneID:4570576"
     CDS             complement(219381..221498)
                     /locus_tag="Cpha266_0195"
                     /note="PFAM: class II aldolase/adducin family protein;
                     short-chain dehydrogenase/reductase SDR; KR;
                     KEGG: plt:Plut_0410 short chain dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="short chain dehydrogenase"
                     /protein_id="YP_910686.1"
                     /db_xref="GI:119356042"
                     /db_xref="InterPro:IPR001303"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR013968"
                     /db_xref="GeneID:4570576"
                     /translation="MQNLWNDAELQRSVNGQRSANDIPVELAELVYASRLLGSESTLV
                     MHGGGNTSVKSELHDIIGYRVNVIFIKGSGVNLAGVDAHDFMPVRIEPLQKLQHLYAT
                     GGRSSEEDIQQFSTQRFKNFLYLNLFYLTEHMVNHSLSPSIETLLHAFLPHRFIFHTH
                     STALLTLSNQPDGQDLCREVLGESFGMVPYIKPGLGLARSAATAYESAPSIRGLVLQK
                     HGLVTFADTPDEAYHCMIESANLLEERITRAGRKVFPSVSLPAGIASLEDTAPVIRGA
                     VVEEIMPGSRDYRQFVLEFRTSPDILAYVNSDSLSDVSQRGAMTPDFIIRTKNRPLIV
                     PTPDASDLDAFKTAVHEAVERYDAEYRAYFQRRRQAAGIEVSMLDPLPRVVLVPGLGL
                     FGLGRTAREAAVNADIAESTASAILDAESVGRFESITEQEVFDIEYWEMEQAKMTKVR
                     HDVFAGKVALVTGAASGIGLATARAFRQRGAELVILDLNPEALQQAAEELGGGVLPIA
                     CDVTDRAAVRRAFDKVCRRYGGLDILVSNVGVALQGRIGDVPDEVLRRSFELNFFSHQ
                     SIAQEAVRIMRLQGTGGVLLFNVSKQAVNPGPDFGPYGLPKAATMFLVRQYALDHGRD
                     GIRANGINADRIRTGLLTDEMIKIRSTARGLNEREYMAGNLLQVEVTAEDVAEAFVHQ
                     ALETKTTGSIVTVDGGNIAAALR"
     misc_feature    complement(219384..221498)
                     /locus_tag="Cpha266_0195"
                     /note="short chain dehydrogenase; Validated; Region:
                     PRK08324"
                     /db_xref="CDD:236241"
     misc_feature    complement(220788..221408)
                     /locus_tag="Cpha266_0195"
                     /note="Class II Aldolase and Adducin N-terminal domain;
                     Region: Aldolase_II; smart01007"
                     /db_xref="CDD:214970"
     misc_feature    complement(order(220842..220844,221019..221021,
                     221025..221027,221067..221075))
                     /locus_tag="Cpha266_0195"
                     /note="active site"
                     /db_xref="CDD:238232"
     misc_feature    complement(order(220842..220844,221019..221021,
                     221025..221027))
                     /locus_tag="Cpha266_0195"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238232"
     misc_feature    complement(order(220812..220814,220845..220847,
                     220929..220931,220971..220976,220980..220982,
                     220989..220997,221010..221015,221019..221021))
                     /locus_tag="Cpha266_0195"
                     /note="intersubunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238232"
     misc_feature    complement(219402..220133)
                     /locus_tag="Cpha266_0195"
                     /note="rhamnulose-1-phosphate aldolase/alcohol
                     dehydrogenase, classical (c) SDRs; Region: R1PA_ADH_SDR_c;
                     cd08943"
                     /db_xref="CDD:187647"
     misc_feature    complement(order(219582..219587,219591..219602,
                     219678..219680,219690..219692,219729..219737,
                     219819..219821,219882..219890,219966..219974,
                     220032..220040,220095..220106,220110..220112))
                     /locus_tag="Cpha266_0195"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:187647"
     misc_feature    complement(order(219678..219680,219690..219692,
                     219729..219731,219816..219818))
                     /locus_tag="Cpha266_0195"
                     /note="active site"
                     /db_xref="CDD:187647"
     gene            complement(221628..222833)
                     /locus_tag="Cpha266_0196"
                     /db_xref="GeneID:4570577"
     CDS             complement(221628..222833)
                     /locus_tag="Cpha266_0196"
                     /note="KEGG: rpa:RPA2614 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910687.1"
                     /db_xref="GI:119356043"
                     /db_xref="GeneID:4570577"
                     /translation="MSTKRIITKEDVHLKARLLSEGAKVTVNKPPKTGFNPFRAMVLN
                     GSDLATLVRPEPYTRLEVQVNGDDVEFYDCGKHLASGRMQEWFSWRDGTLSNGRPVNA
                     AVIGMNQDIINIHYSYSCDNNNTGRSCRFCFFFADQHVSVGQDLAKMPFQKIEALAKE
                     QAEAVKIATDNGWRGTLVVIGGLVAPERRSQVVDLVEIVMAPLREQLSPEVFNELHIT
                     ANLYPPDDFKDMERWKASGINSTEFDLEVTDPDYFKAICPGKCATYPLEYWHAAQDAS
                     VEIFGPGRGTTSFILMGLEPMNCMLEGVEERLSKGVYPNMLVYQPVPGADMFRMPPPN
                     ADWLVEASEKLADLYFKYQDRFDMPLATDHRPGYTRMGRSQYIMLTADVIARRLYEQG
                     YELPAAYPV"
     misc_feature    complement(221814..222503)
                     /locus_tag="Cpha266_0196"
                     /note="Elongator protein 3, MiaB family, Radical SAM;
                     Region: Elp3; smart00729"
                     /db_xref="CDD:214792"
     gene            complement(222922..223140)
                     /locus_tag="Cpha266_0197"
                     /db_xref="GeneID:4570578"
     CDS             complement(222922..223140)
                     /locus_tag="Cpha266_0197"
                     /note="KEGG: cch:Cag_1643 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910688.1"
                     /db_xref="GI:119356044"
                     /db_xref="GeneID:4570578"
                     /translation="MLKGSFTELWNKAMIYTGSGWLVLVCMIWLSGHFRDSGEQIVFV
                     SVLAAGYVAVYVLGFYIKHRHSEKTAKL"
     gene            complement(223223..223699)
                     /locus_tag="Cpha266_0198"
                     /db_xref="GeneID:4570579"
     CDS             complement(223223..223699)
                     /locus_tag="Cpha266_0198"
                     /note="PFAM: 2-vinyl bacteriochlorophyllide hydratase;
                     KEGG: plt:Plut_0408 2-vinyl bacteriochlorophyllide
                     hydratase"
                     /codon_start=1
                     /transl_table=11
                     /product="2-oxoglutarate synthase subunit,
                     2-oxoacid-ferredoxin oxidoreductase subunit CD"
                     /protein_id="YP_910689.1"
                     /db_xref="GI:119356045"
                     /db_xref="InterPro:IPR009905"
                     /db_xref="GeneID:4570579"
                     /translation="MPRYTPEQLAQRNTTVWTDVQLILAPIQFVFFLIGVGVTYLHYI
                     NPDIIAFFWVDVAILFKSFLFALLFFTGAYFEKEIFDKWIFSREFLWEDIGSVTAGAF
                     HILYFILAFTGASREVLVWEAFLAYFTYIANAMQYIVRILLEKRNEKILRNSNALS"
     misc_feature    complement(223268..223690)
                     /locus_tag="Cpha266_0198"
                     /note="2-vinyl bacteriochlorophyllide hydratase (BCHF);
                     Region: BCHF; pfam07284"
                     /db_xref="CDD:148725"
     gene            complement(224260..224598)
                     /locus_tag="Cpha266_0199"
                     /db_xref="GeneID:4570580"
     CDS             complement(224260..224598)
                     /locus_tag="Cpha266_0199"
                     /note="KEGG: pol:Bpro_4964 transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910690.1"
                     /db_xref="GI:119356046"
                     /db_xref="GeneID:4570580"
                     /translation="MWLSHLYIHPPERNPNKEYRRKAGSKSKPTQSRNIFECIMLTVQ
                     RTGCQDQANLKEQFGMPFATYTHFARRQRKGFFAKHESSYDESSACTRYWWMKSNRQR
                     KKTAQSAIYL"
     gene            224962..226368
                     /locus_tag="Cpha266_0200"
                     /db_xref="GeneID:4570581"
     CDS             224962..226368
                     /locus_tag="Cpha266_0200"
                     /note="PFAM: Radical SAM domain protein;
                     SMART: Elongator protein 3/MiaB/NifB;
                     KEGG: cch:Cag_0116 elongator protein 3/MiaB/NifB"
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM domain-containing protein"
                     /protein_id="YP_910691.1"
                     /db_xref="GI:119356047"
                     /db_xref="InterPro:IPR005839"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="GeneID:4570581"
                     /translation="MCSVRVIKKLNIMPLRLLFIAPKGKKDSKTNQKPLFHMAIGVLV
                     SLTPDEHTIEIADEHFGDTINYDGDYDLVGITSRTIDATRAYEIADEFRRKGKKVILG
                     GLHVSFNPEEARSHADSIVSGEAENLWATVLEDASSGQLKPAYDSKDFPLVTKIVPLD
                     YERIARASKRGKVDGSKSIPIYITRGCPYECSFCVTPNFTGKLYRYQNPEDLVRQIET
                     AKKVFFKAKGKSSKPWFMLCDENLGINKKKLWENLALLKECNINYSVFFSMNFLEDKE
                     TVRRLVDSGCNMVLVGFESIKQSTLEAYNKGHVNSAEKFASVIEECRSAGLNIQGNFL
                     VNPALDTFEDMDDLVEFVGKNHVFMPIFQIITPYPGTKMYLEYKEKGLITDEDWEKYN
                     AINLVIRSEHYDPIAFQHKFMTSYYKTYSWGKIANRVRRNPYKFLNLITSLAFKKNLK
                     EQLETFERNHNIRTARTP"
     misc_feature    225100..225378
                     /locus_tag="Cpha266_0200"
                     /note="B12 binding domain (B12-BD). Most of the members
                     bind different cobalamid derivates, like B12
                     (adenosylcobamide) or methylcobalamin or methyl-Co(III)
                     5-hydroxybenzimidazolylcobamide. This domain is found in
                     several enzymes, such as glutamate mutase; Region:
                     B12-binding_like; cl00293"
                     /db_xref="CDD:241759"
     misc_feature    order(225181..225189,225193..225201,225271..225273,
                     225343..225345,225352..225354)
                     /locus_tag="Cpha266_0200"
                     /note="B12 binding site [chemical binding]; other site"
                     /db_xref="CDD:239016"
     misc_feature    225493..226122
                     /locus_tag="Cpha266_0200"
                     /note="Elongator protein 3, MiaB family, Radical SAM;
                     Region: Elp3; smart00729"
                     /db_xref="CDD:214792"
     gene            complement(226551..227177)
                     /locus_tag="Cpha266_0201"
                     /db_xref="GeneID:4570582"
     CDS             complement(226551..227177)
                     /locus_tag="Cpha266_0201"
                     /note="PFAM: Proto-chlorophyllide reductase 57 kD subunit;
                     KEGG: plt:Plut_1486 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="proto-chlorophyllide reductase 57 kD subunit"
                     /protein_id="YP_910692.1"
                     /db_xref="GI:119356048"
                     /db_xref="InterPro:IPR013580"
                     /db_xref="GeneID:4570582"
                     /translation="MKAVILYDSKTKGGSTEMLIDSIGQQLAESGLYVEKAKCIATAD
                     YSFIKEFDIVILGAPVYNFIVSPQLLGAFLQGNLKKHLKKKRVALFLTCWTAESMAAV
                     FYLPQLKMHLLTNRILVEKIFHPVESSSDNAIESFVDDLLKQYERSIGSRNKSIIWSD
                     EAQDWLEVVPGFLREKIRSMAAEYAIMNGYKEITVEMLDIARHEIGEK"
     misc_feature    complement(226821..227177)
                     /locus_tag="Cpha266_0201"
                     /note="NADPH-dependent FMN reductase; Region: FMN_red;
                     pfam03358"
                     /db_xref="CDD:217511"
     misc_feature    complement(<226887..227165)
                     /locus_tag="Cpha266_0201"
                     /note="Flavodoxin domain; Region: Flavodoxin_5; cl17428"
                     /db_xref="CDD:247982"
     misc_feature    complement(226572..226706)
                     /locus_tag="Cpha266_0201"
                     /note="Proto-chlorophyllide reductase 57 kD subunit;
                     Region: PCP_red; pfam08369"
                     /db_xref="CDD:203920"
     gene            227469..227696
                     /locus_tag="Cpha266_0202"
                     /db_xref="GeneID:4570583"
     CDS             227469..227696
                     /locus_tag="Cpha266_0202"
                     /note="KEGG: cch:Cag_0191 chlorosome envelope protein B"
                     /codon_start=1
                     /transl_table=11
                     /product="chlorosome envelope protein B"
                     /protein_id="YP_910693.1"
                     /db_xref="GI:119356049"
                     /db_xref="GeneID:4570583"
                     /translation="MSNGTSNDFSGAITNLMDTLGKLGQQQVEMLNNGIKTGSQMIEP
                     LGKTVTDLAGNMLNMVNQVLQSVSSALAPKK"
     gene            227835..228842
                     /locus_tag="Cpha266_0203"
                     /db_xref="GeneID:4570584"
     CDS             227835..228842
                     /locus_tag="Cpha266_0203"
                     /note="PFAM: aminoglycoside phosphotransferase;
                     KEGG: cte:CT2055 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="aminoglycoside phosphotransferase"
                     /protein_id="YP_910694.1"
                     /db_xref="GI:119356050"
                     /db_xref="InterPro:IPR002575"
                     /db_xref="GeneID:4570584"
                     /translation="MNTEHHIRCFYGQEDRNQLQITPIQGDASTRRYYRVSGPKGSAI
                     ACCDPLLRETTTDDYPFLIVYDLLRRNDIPVPEVIAVNAGEGLLLIEDCGTLQLQYLV
                     FPECGSLAADIYRDVIDTLAGIQAITGDSSQLPFRLSFDREKLMFEFDFFIEHALMGY
                     FAPVSGGVDVGALRSEFKAIADILVQPERFVLNHRDFHSRNIMIRDGKPVIIDFQDAR
                     MGLPQYDAVSIIRDSYVALDQTLADELKTRHYQALMDRNGITMSHDEYLYLFDLMAFQ
                     RNIKAIGTFSYQTAVLKKTQYEHSIAPALRYLPDYISGRNELKKAGRLLQPVIEQRHE
                     R"
     misc_feature    227865..228689
                     /locus_tag="Cpha266_0203"
                     /note="Predicted phosphotransferase related to Ser/Thr
                     protein kinases [General function prediction only];
                     Region: COG3178"
                     /db_xref="CDD:225719"
     misc_feature    227895..228569
                     /locus_tag="Cpha266_0203"
                     /note="Phosphotransferase enzyme family; Region: APH;
                     pfam01636"
                     /db_xref="CDD:216618"
     gene            228839..229774
                     /locus_tag="Cpha266_0204"
                     /db_xref="GeneID:4570585"
     CDS             228839..229774
                     /locus_tag="Cpha266_0204"
                     /note="PFAM: Nucleotidyl transferase;
                     KEGG: plt:Plut_2007 mannose-1-phosphate
                     guanylyltransferase, putative"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotidyl transferase"
                     /protein_id="YP_910695.1"
                     /db_xref="GI:119356051"
                     /db_xref="InterPro:IPR005835"
                     /db_xref="GeneID:4570585"
                     /translation="MKAFVLAAGFGTRLRPFTHRIPKPLIPVLNLPALLYTFALLKDA
                     GITDIICNIHHHADDVRESVASFGIEGLAISFSEETTILGTGGGLKKCEQLFDDEDFL
                     LINSDIITDIDFSAFIRHHKLSGLPGTLALYETPEAMAIGCIGIENGQVKDFRNMRNT
                     GLKSSLIYTGTALLSPKIFRYLNEDFSSIVDTGFTGLIDHGGLGAFRHSGSWMDIGTP
                     EDYLDANNGKGMLPERLTRRVRDAIGIEPHRIAADAWIASGARVIRSVIGSRCMVSRN
                     AVVENSVLLPGAVVAEGECLLNSIRDRENTLQTIP"
     misc_feature    228839..229630
                     /locus_tag="Cpha266_0204"
                     /note="dTDP-glucose pyrophosphorylase [Cell envelope
                     biogenesis, outer membrane]; Region: RfbA; COG1209"
                     /db_xref="CDD:224130"
     misc_feature    228842..229510
                     /locus_tag="Cpha266_0204"
                     /note="NTP_transferase_like_1 is a member of the
                     nucleotidyl transferase family; Region:
                     NTP_transferase_like_1; cd06422"
                     /db_xref="CDD:133044"
     misc_feature    order(228854..228862,228992..228994,229151..229153,
                     229157..229159)
                     /locus_tag="Cpha266_0204"
                     /note="Substrate binding site; other site"
                     /db_xref="CDD:133044"
     misc_feature    order(229157..229159,229478..229480,229484..229486)
                     /locus_tag="Cpha266_0204"
                     /note="metal-binding site"
                     /db_xref="CDD:133044"
     misc_feature    229604..>229717
                     /locus_tag="Cpha266_0204"
                     /note="Glucose-1-phosphate adenylyltransferase, C-terminal
                     Left-handed parallel beta helix (LbH) domain:
                     Glucose-1-phosphate adenylyltransferase is also known as
                     ADP-glucose synthase or ADP-glucose pyrophosphorylase. It
                     catalyzes the first committed and...; Region:
                     LbH_G1P_AT_C; cd04651"
                     /db_xref="CDD:100056"
     gene            229800..230963
                     /locus_tag="Cpha266_0205"
                     /db_xref="GeneID:4570586"
     CDS             229800..230963
                     /locus_tag="Cpha266_0205"
                     /note="PFAM: Uncharacterised conserved protein UCP016719;
                     KEGG: cch:Cag_0194 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910696.1"
                     /db_xref="GI:119356052"
                     /db_xref="InterPro:IPR008302"
                     /db_xref="GeneID:4570586"
                     /translation="MVKTGLDIFLENIDGYRNRTIGMIVNQTSVTSDLRYSWNVLREK
                     GLDIRKIFSPEHGLFATEQDQIAVGSQPVPDIELVSLYGSSSDTLIPDCTTLDDLDLI
                     LFDIQDVGARYYTYVNTLALFMEAATGRDLEIMVLDRPNPLGGAVVEGPLLDMAYRSF
                     VGIFPVPVRHGMTPGELALLYRDWKKLDIRLSVLSMRGWSRTMLFHETGLPWVPPSPN
                     MPTVESAAVYPGMCLFEGLNASEGRGTTTPFQLLGAPFINPNHLLEQCKGTGFEGIYL
                     RPTWFKPTFHKFQGEAIGGLWIHVCDQNRFRPFATAVALTAALHKLYPVDLRFLDGVY
                     EFNDTIPAFDLLAGTDSVRHALLDGNDTPSIISSWQQDETAFLVTKEQYHLYR"
     misc_feature    229860..230957
                     /locus_tag="Cpha266_0205"
                     /note="Protein of unknown function (DUF1343); Region:
                     DUF1343; pfam07075"
                     /db_xref="CDD:219287"
     gene            230985..232397
                     /locus_tag="Cpha266_0206"
                     /db_xref="GeneID:4570587"
     CDS             230985..232397
                     /locus_tag="Cpha266_0206"
                     /note="PFAM: Na+/solute symporter;
                     KEGG: cch:Cag_0195 sodium:solute symporter family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Na+/solute symporter"
                     /protein_id="YP_910697.1"
                     /db_xref="GI:119356053"
                     /db_xref="InterPro:IPR001734"
                     /db_xref="GeneID:4570587"
                     /translation="MQALDIAIIVFFLAGSILLGLWQGKSNKNTGDYFLGGHKFPWIV
                     AMLSIVATETSVLTFVSVPGLAYRGDWTFLQLPLGYILGRILVSILLLPVYFKNGVTS
                     IYEVIGSRFGTGMQKLASIVFLVTRILGDGVRFLATGVVVQVVTGWSLPVSVMIIGVV
                     TLVYTITGGLKTVVWLDSIQFGLYLLGGIITIAFILLHLESSPQETFAALADAGKLAV
                     LNTGGNILFNPMTFGSAFTGGIFLSLASHGIDYMMVQRVLGCRDLGSARKALIGSGFF
                     VFFQFMIFLLAGSLMYLFMQGSVTEKDREFASFIVNYLPSGLKGLLLAGILSAAMSTI
                     ASSINSLAASTVTDLLGGRVSLNFSKLISAGWAVVLIGIALIFDESDKAIIMVGLEIA
                     SFTYGGLLGLFLLSKTTQKYHPASLAIGLLASMGIVFVLKLYGIAWTWYILVSVSVNI
                     MITILVNTMLRSIMSKGEQS"
     misc_feature    230997..232355
                     /locus_tag="Cpha266_0206"
                     /note="uncharacterized subgroup of the Na(+)/iodide (NIS)
                     cotransporter subfamily; putative solute-binding domain;
                     Region: SLC5sbd_NIS-like_u1; cd11493"
                     /db_xref="CDD:212062"
     misc_feature    order(231135..231137,231144..231146,231969..231971,
                     231978..231983)
                     /locus_tag="Cpha266_0206"
                     /note="Na binding site [ion binding]; other site"
                     /db_xref="CDD:212062"
     gene            232510..232761
                     /locus_tag="Cpha266_0207"
                     /db_xref="GeneID:4570588"
     CDS             232510..232761
                     /locus_tag="Cpha266_0207"
                     /note="PFAM: bacteriochlorophyll C binding protein;
                     KEGG: cte:CT2062 chlorosome envelope protein E"
                     /codon_start=1
                     /transl_table=11
                     /product="bacteriochlorophyll C binding protein"
                     /protein_id="YP_910698.1"
                     /db_xref="GI:119356054"
                     /db_xref="InterPro:IPR001470"
                     /db_xref="GeneID:4570588"
                     /translation="MSKISGAFTQWAEAYGRFVEIFTDGHWWVTGDCMENVGKTTKRL
                     LRNAYPYIYGGGSSVDIKGSSPDKGGYATPTKEIKRRFE"
     misc_feature    232516..232758
                     /locus_tag="Cpha266_0207"
                     /note="Bacteriochlorophyll C binding protein; Region:
                     Bac_chlorC; pfam02043"
                     /db_xref="CDD:216856"
     gene            complement(232932..233630)
                     /locus_tag="Cpha266_0208"
                     /db_xref="GeneID:4570589"
     CDS             complement(232932..233630)
                     /locus_tag="Cpha266_0208"
                     /note="PFAM: NAD-dependent epimerase/dehydratase; NmrA
                     family protein;
                     KEGG: cte:CT2065 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent epimerase/dehydratase"
                     /protein_id="YP_910699.1"
                     /db_xref="GI:119356055"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR008030"
                     /db_xref="GeneID:4570589"
                     /translation="MNNTCDYRGTVLVAGSTGKTGLWVVKRLQHYGIPVRVLVRSARK
                     AAVFGNTVEVAVGLVQNSADLTEAVKGCDAVISALGSSQFFGEASPAEVDRNGAIRLA
                     DEASRMGVRHFAMVSSIAVTRWYHPLNLFAGVLSMKYAAEEHVRSLFSRENRSYTIVR
                     PGGLKDGDPLQFRLHVDQGDRIWNGWINRSDVAELLVESLWLESAKNKTFEVINEAEE
                     VQESLEQYYGKLSN"
     misc_feature    complement(232986..233603)
                     /locus_tag="Cpha266_0208"
                     /note="atypical (a) SDRs, subgroup 5; Region: SDR_a5;
                     cd05243"
                     /db_xref="CDD:187554"
     misc_feature    complement(233031..233600)
                     /locus_tag="Cpha266_0208"
                     /note="NADH(P)-binding; Region: NAD_binding_10; pfam13460"
                     /db_xref="CDD:222146"
     misc_feature    complement(order(233139..233150,233217..233219,
                     233277..233282,233352..233354,233391..233396,
                     233454..233459,233511..233513,233571..233582,
                     233586..233588))
                     /locus_tag="Cpha266_0208"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187554"
     misc_feature    complement(order(233217..233219,233229..233231,
                     233277..233279,233349..233351))
                     /locus_tag="Cpha266_0208"
                     /note="putative active site [active]"
                     /db_xref="CDD:187554"
     gene            233837..235177
                     /locus_tag="Cpha266_0209"
                     /db_xref="GeneID:4570590"
     CDS             233837..235177
                     /locus_tag="Cpha266_0209"
                     /note="PFAM: pentapeptide repeat protein;
                     KEGG: plt:Plut_2015 pentapeptide repeat family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="pentapeptide repeat-containing protein"
                     /protein_id="YP_910700.1"
                     /db_xref="GI:119356056"
                     /db_xref="InterPro:IPR001646"
                     /db_xref="GeneID:4570590"
                     /translation="MKQIWHLAGIVLLTVSGFLPVSSAIGFDPDAVKLLVKSPKEWNA
                     FRQQHSMQPVDLDKAKLEDADLEGANLSNSSLVRAELSGANLNNADLRGSNLQQAFIK
                     KADLKGADLREAYLVKVNLKEAFMEKSMLQKANLQSANLRWTRFHRADLAGSNLQDAV
                     LFETSFVDADLRGANLKGALYVGNANFSGAKISSNTITPSGEKATASWAAIRDAEYIK
                     EADAAMPVYASLPVMVFASPSAGLKSASASSGQAVMGSKQQQALMVDDVETWNTMRAA
                     NPELKIELKEEKLENARLKGVNLQKASMPGADFEDANLDEAMMEGADLSKADFQKADM
                     KKVKLQGANLSGANLDRSFMEGADLRNANLSGANLFGAMLKDANLSGANLSGASLFET
                     DLEGANLSGANLKGANLVEPNLKNAIISPDTILPSGKNATQSWAVIKGATFVKP"
     sig_peptide     233837..233917
                     /locus_tag="Cpha266_0209"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 0.991) with cleavage site probability 0.573 at
                     residue 27"
     misc_feature    234056..234175
                     /locus_tag="Cpha266_0209"
                     /note="Pentapeptide repeats (8 copies); Region:
                     Pentapeptide; pfam00805"
                     /db_xref="CDD:109845"
     misc_feature    234086..234889
                     /locus_tag="Cpha266_0209"
                     /note="Pentapeptide repeats containing protein [Function
                     unknown]; Region: COG1357"
                     /db_xref="CDD:224276"
     misc_feature    234146..234262
                     /locus_tag="Cpha266_0209"
                     /note="Pentapeptide repeats (8 copies); Region:
                     Pentapeptide; pfam00805"
                     /db_xref="CDD:109845"
     misc_feature    234251..234370
                     /locus_tag="Cpha266_0209"
                     /note="Pentapeptide repeats (8 copies); Region:
                     Pentapeptide; pfam00805"
                     /db_xref="CDD:109845"
     misc_feature    234755..234874
                     /locus_tag="Cpha266_0209"
                     /note="Pentapeptide repeats (8 copies); Region:
                     Pentapeptide; pfam00805"
                     /db_xref="CDD:109845"
     misc_feature    234800..235033
                     /locus_tag="Cpha266_0209"
                     /note="Pentapeptide repeats (9 copies); Region:
                     Pentapeptide_4; pfam13599"
                     /db_xref="CDD:205777"
     misc_feature    234920..235054
                     /locus_tag="Cpha266_0209"
                     /note="Pentapeptide repeats (8 copies); Region:
                     Pentapeptide; pfam00805"
                     /db_xref="CDD:109845"
     gene            complement(235220..235477)
                     /locus_tag="Cpha266_0210"
                     /db_xref="GeneID:4570591"
     CDS             complement(235220..235477)
                     /locus_tag="Cpha266_0210"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910701.1"
                     /db_xref="GI:119356057"
                     /db_xref="GeneID:4570591"
                     /translation="MTVILTSAVQPCNRHQNRRGQNSYWPLLNVMNVRVTEKVFTPYL
                     RTTDKLKNRFPRAILRQWKSPEKAQQQIFILHVLRIKKAAL"
     gene            complement(235520..235813)
                     /locus_tag="Cpha266_0211"
                     /db_xref="GeneID:4570592"
     CDS             complement(235520..235813)
                     /locus_tag="Cpha266_0211"
                     /note="KEGG: plt:Plut_2016 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910702.1"
                     /db_xref="GI:119356058"
                     /db_xref="GeneID:4570592"
                     /translation="MIQFRVGDPIVYHKPKTSFSPGPRAKQVYPLQHGEDYHYVVDKF
                     WTVSQVNRDGTLEVTTRTGKKHLLDAGDPNICKAHLIQHILFRKRFPSLADLL"
     gene            235828..236106
                     /locus_tag="Cpha266_0212"
                     /db_xref="GeneID:4570593"
     CDS             235828..236106
                     /locus_tag="Cpha266_0212"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910703.1"
                     /db_xref="GI:119356059"
                     /db_xref="GeneID:4570593"
                     /translation="MLVIGLFNWVFRHLSLFFSANRTLVVFRFVGGPVFFGLWRLKEL
                     SPFAPRSAPGNYERCFYVLKLLTYFFFDGYLKIKNERMVYGSTKWMMR"
     gene            complement(236076..237254)
                     /locus_tag="Cpha266_0213"
                     /db_xref="GeneID:4570594"
     CDS             complement(236076..237254)
                     /locus_tag="Cpha266_0213"
                     /EC_number="3.6.3.16"
                     /note="KEGG: cte:CT2070 ArsA ATPase family protein;
                     TIGRFAM: arsenite-activated ATPase ArsA;
                     PFAM: Anion-transporting ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="arsenite-activated ATPase ArsA"
                     /protein_id="YP_910704.1"
                     /db_xref="GI:119356060"
                     /db_xref="InterPro:IPR003348"
                     /db_xref="GeneID:4570594"
                     /translation="MRLILMTGKGGVGKTSMAAATGLRCAELGYKTLVLSTDPAHSLA
                     DSFDMALGHNPNRVSNNLWGAELDVLKELEQNWGTVKRYITGVLQARGLEGIQAEELA
                     ILPGMDEIFGLVRVFRHHKEGDYDVLIIDSAPTGTALRLLSIPEVAGWYMRRLYKPFE
                     KVALYLRPLVEPIFRPLAGFSLPDKEMMDVPYEFYEQIDALGKILTDHAVTSVRLVTN
                     PEKMVIKESLRAHAYLGLYNIAVDLVIANRIIPPEVTDPYFTFWKENQTLYRQEIQDN
                     FAPLPVKEVPLYSREICGMQTLEKLKEMLYGNEDPAQVYYKEQTFQIKQTTQGFTLEL
                     YIPGIPKDQIQLGKNGDELHVRIGNHRRNMVLPQALASLKTTGAEMDGDHLIIHFVEP
                     "
     misc_feature    complement(236334..237254)
                     /locus_tag="Cpha266_0213"
                     /note="Anion-transporting ATPase; Region: ArsA_ATPase;
                     pfam02374"
                     /db_xref="CDD:217004"
     misc_feature    complement(236400..237248)
                     /locus_tag="Cpha266_0213"
                     /note="ArsA ATPase functionas as an efflux pump located on
                     the inner membrane of the cell. This ATP-driven oxyanion
                     pump catalyzes the extrusion of arsenite, antimonite and
                     arsenate. Maintenance of a low intracellular concentration
                     of oxyanion produces...; Region: ArsA; cd02035"
                     /db_xref="CDD:238992"
     misc_feature    complement(237207..237233)
                     /locus_tag="Cpha266_0213"
                     /note="P loop; other site"
                     /db_xref="CDD:238992"
     misc_feature    complement(order(236862..236864,237141..237143,
                     237207..237218,237222..237224))
                     /locus_tag="Cpha266_0213"
                     /note="Nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238992"
     misc_feature    complement(order(236841..236864,237135..237143))
                     /locus_tag="Cpha266_0213"
                     /note="DTAP/Switch II; other site"
                     /db_xref="CDD:238992"
     misc_feature    complement(237135..237143)
                     /locus_tag="Cpha266_0213"
                     /note="Switch I; other site"
                     /db_xref="CDD:238992"
     gene            complement(237528..238454)
                     /locus_tag="Cpha266_0214"
                     /db_xref="GeneID:4570701"
     CDS             complement(237528..238454)
                     /locus_tag="Cpha266_0214"
                     /note="PFAM: TPR repeat-containing protein;
                     Tetratricopeptide TPR_2 repeat protein;
                     SMART: Tetratricopeptide domain protein;
                     KEGG: cte:CT2075 TPR domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="TPR repeat-containing protein"
                     /protein_id="YP_910705.1"
                     /db_xref="GI:119356061"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="GeneID:4570701"
                     /translation="MHSIHRTFITATVFILVFTLSARGESPEDFIELGIVKGRSGDTS
                     GALDDFNRALILDPKNSGAYYNRGLVNGQLGNFSAAIADYTSAIKLNPHFPGTYNNRG
                     FAHAATGNYRAAIIDISKAIALDPLIPELYNNRGTVKMSLKDYIGAIEDFTKAARLNP
                     KLAGPFNNRGLAKSLAGNIMGAIEDFTLALVRDQTYDAAWYNRGNARLSSGDFNGAIE
                     DYKKALVLQPDLIEAYNNRAFAKASLGDYRGAVDDMNILIEKGTENAMTYYNRGLAKK
                     MLGDLNGAIADFLKASNLGDTLSVSALREMVK"
     sig_peptide     complement(238380..238454)
                     /locus_tag="Cpha266_0214"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 0.992) with cleavage site probability 0.971 at
                     residue 25"
     misc_feature    complement(238176..>238397)
                     /locus_tag="Cpha266_0214"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(237582..238382)
                     /locus_tag="Cpha266_0214"
                     /note="FOG: TPR repeat [General function prediction only];
                     Region: NrfG; COG0457"
                     /db_xref="CDD:223533"
     misc_feature    complement(order(238233..238238,238245..238250,
                     238257..238262,238338..238343,238350..238355,
                     238359..238364))
                     /locus_tag="Cpha266_0214"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(238194..238196,238203..238205,
                     238215..238217,238251..238253,238296..238298,
                     238305..238307,238317..238319,238353..238355))
                     /locus_tag="Cpha266_0214"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(237972..238268)
                     /locus_tag="Cpha266_0214"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(238029..238034,238041..238046,
                     238053..238058,238134..238139,238146..238151,
                     238155..238160,238245..238250,238257..238262,
                     238266..238268))
                     /locus_tag="Cpha266_0214"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(237990..237992,237999..238001,
                     238011..238013,238047..238049,238092..238094,
                     238101..238103,238113..238115,238149..238151,
                     238194..238196,238203..238205,238215..238217,
                     238251..238253))
                     /locus_tag="Cpha266_0214"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(237573..237860)
                     /locus_tag="Cpha266_0214"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(237621..237626,237633..237638,
                     237645..237650,237726..237731,237738..237743,
                     237747..237752,237837..237842,237849..237854,
                     237858..237860))
                     /locus_tag="Cpha266_0214"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(237582..237584,237591..237593,
                     237603..237605,237639..237641,237684..237686,
                     237693..237695,237705..237707,237741..237743,
                     237786..237788,237795..237797,237807..237809,
                     237843..237845))
                     /locus_tag="Cpha266_0214"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     gene            238734..239249
                     /locus_tag="Cpha266_0215"
                     /db_xref="GeneID:4570702"
     CDS             238734..239249
                     /locus_tag="Cpha266_0215"
                     /note="TIGRFAM: rare lipoprotein A;
                     PFAM: Rare lipoprotein A;
                     KEGG: cch:Cag_1684 rare lipoprotein A"
                     /codon_start=1
                     /transl_table=11
                     /product="rare lipoprotein A"
                     /protein_id="YP_910706.1"
                     /db_xref="GI:119356062"
                     /db_xref="InterPro:IPR005132"
                     /db_xref="InterPro:IPR012997"
                     /db_xref="GeneID:4570702"
                     /translation="MRDEKRNFTIPFYALLIGAWYTALQITFPAFSSAQPPEFSIQSI
                     TNQPSASSSGMLSDQPKSRTFLRVAEGKASYYSNQFHGRRTANGETFDMNELTAAHPS
                     LPFGTWVRVINLRNGKDVVVRINDRGPFVRGRIIDLSAGAAKRIGLFKSGTANVRIEP
                     VKHSPEDPMAG"
     sig_peptide     238734..238838
                     /locus_tag="Cpha266_0215"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 0.844) with cleavage site probability 0.655 at
                     residue 35"
     misc_feature    238935..239207
                     /locus_tag="Cpha266_0215"
                     /note="Rare lipoprotein A (RlpA)-like double-psi
                     beta-barrel; Region: DPBB_1; pfam03330"
                     /db_xref="CDD:217497"
     misc_feature    <238941..>239219
                     /locus_tag="Cpha266_0215"
                     /note="Lipoproteins [Cell envelope biogenesis, outer
                     membrane]; Region: RlpA; COG0797"
                     /db_xref="CDD:223868"
     gene            complement(239375..239815)
                     /locus_tag="Cpha266_0216"
                     /db_xref="GeneID:4570703"
     CDS             complement(239375..239815)
                     /locus_tag="Cpha266_0216"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910707.1"
                     /db_xref="GI:119356063"
                     /db_xref="GeneID:4570703"
                     /translation="MTNHQNQQVSFALTEITTENLSITPETFDTDKPVQMNIGLNFGI
                     NSEKQSLKTLFKASFHQDDQEFMVIETGCAFTLDPNSWKMLSNDEIRRFILPKTLAAH
                     FSVLTAGTARGILHVKTENTPLNKFIIPANNLDGLIQKDIVLNY"
     gene            complement(240184..240360)
                     /locus_tag="Cpha266_0217"
                     /db_xref="GeneID:4570704"
     CDS             complement(240184..240360)
                     /locus_tag="Cpha266_0217"
                     /note="PFAM: Rubredoxin-type Fe(Cys)4 protein;
                     KEGG: plt:Plut_1978 rubredoxin-like"
                     /codon_start=1
                     /transl_table=11
                     /product="rubredoxin-type Fe(Cys)4 protein"
                     /protein_id="YP_910708.1"
                     /db_xref="GI:119356064"
                     /db_xref="InterPro:IPR001052"
                     /db_xref="InterPro:IPR004039"
                     /db_xref="GeneID:4570704"
                     /translation="MEKWVCVPCGYVYDPEIGDPDSGVEPGTPFENIPDDWCCPVCGV
                     DKSLFEPYDERRNR"
     misc_feature    complement(240199..240360)
                     /locus_tag="Cpha266_0217"
                     /note="Rubredoxin [Energy production and conversion];
                     Region: COG1773"
                     /db_xref="CDD:224687"
     misc_feature    complement(240205..240354)
                     /locus_tag="Cpha266_0217"
                     /note="Rubredoxin; nonheme iron binding domains containing
                     a [Fe(SCys)4] center. Rubredoxins are small nonheme iron
                     proteins. The iron atom is coordinated by four cysteine
                     residues (Fe(S-Cys)4), but iron can also be replaced by
                     cobalt, nickel or zinc. They are...; Region: rubredoxin;
                     cd00730"
                     /db_xref="CDD:238372"
     misc_feature    complement(order(240235..240237,240244..240246,
                     240334..240336,240343..240345))
                     /locus_tag="Cpha266_0217"
                     /note="iron binding site [ion binding]; other site"
                     /db_xref="CDD:238372"
     gene            complement(240597..241397)
                     /gene="dapF"
                     /locus_tag="Cpha266_0218"
                     /db_xref="GeneID:4570705"
     CDS             complement(240597..241397)
                     /gene="dapF"
                     /locus_tag="Cpha266_0218"
                     /EC_number="5.1.1.7"
                     /note="involved in lysine biosynthesis; DAP epimerase;
                     produces DL-diaminopimelate from LL-diaminopimelate"
                     /codon_start=1
                     /transl_table=11
                     /product="diaminopimelate epimerase"
                     /protein_id="YP_910709.1"
                     /db_xref="GI:119356065"
                     /db_xref="InterPro:IPR001653"
                     /db_xref="GeneID:4570705"
                     /translation="MQINFSKLSGAGNDFIIIDNRALAIHLTQPQINALCTRRTGVGA
                     DGLILVEPSLHCDFTMKYFNADGFPGSMCGNGGRCAVYFAFMQGVTSAEPEHFSFEAN
                     SNRYDAEVTNSETVRLHMLDARDFRYHMEIEGFACTFVNTGSPHVVIFADDINAINVA
                     EKGVAIRRNTDFFPEGTNVNFVEITSPSSIALRTFERGVEEETLACGTGAVAAAIISR
                     KLGKILPNSVKVTVKSGDMLEVSFSENMQNITLTGPAKIVYQGSVTIP"
     misc_feature    complement(240600..241397)
                     /gene="dapF"
                     /locus_tag="Cpha266_0218"
                     /note="diaminopimelate epimerase; Provisional; Region:
                     dapF; PRK00450"
                     /db_xref="CDD:234768"
     misc_feature    complement(<241146..241385)
                     /gene="dapF"
                     /locus_tag="Cpha266_0218"
                     /note="Diaminopimelate epimerase; Region: DAP_epimerase;
                     pfam01678"
                     /db_xref="CDD:216645"
     misc_feature    complement(240624..240986)
                     /gene="dapF"
                     /locus_tag="Cpha266_0218"
                     /note="Diaminopimelate epimerase; Region: DAP_epimerase;
                     pfam01678"
                     /db_xref="CDD:216645"
     gene            241814..244009
                     /locus_tag="Cpha266_0219"
                     /db_xref="GeneID:4570706"
     CDS             241814..244009
                     /locus_tag="Cpha266_0219"
                     /note="KEGG: plt:Plut_1976 photosystem P840 reaction
                     center, large subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="photosystem P840 reaction center, large subunit"
                     /protein_id="YP_910710.1"
                     /db_xref="GI:119356066"
                     /db_xref="InterPro:IPR001280"
                     /db_xref="GeneID:4570706"
                     /translation="MAEQVNPAGVKPKGSVPPPKGNAPSPKGNGASGGPSVIKEQDAA
                     KMRRFLFQRTETRSTKWYQIFDTEKLDDEQVVGGHLALLGVMGFLMAIYYISGIQVFP
                     WGAPGFHDNWFYLTIKPRMVSMGIDTYSTRSADLEQAATNLLGWALLHVISGSILLFG
                     GWRHWTHNLTNPFTGRAGNFRDFRFLGKFGDVVFSGTSAKSYKDALGPHAVYMSLLFL
                     GWGLIMWLALGWAPVPDFQTINSETFMSFVWFVVFFALGIYWWNNPPNAATHLNDDMK
                     AAFSVHLTAIGYINIALGVIAFVAFQQPSFAPYYKELDNLVFYLYGEPFNRVSYDFVQ
                     EGGQIVSGSKEFTEFAPYAILPKNGEAFGMSRVVINLITFNHIICGVLYVFAGVYHGG
                     QYLLKIQLNGLYNQIKSIWITKGRDQEVQVKILGTVMALCFATMLSVYAVIVWNTICE
                     LNIFGTNIMMSFYWLKPLPMFQWMFADPSINDWVMAHVITAGSLFSLIALVRIAFFAH
                     TSPLWDDLGLKKNSYSFPCLGPVYGGTCGVSIQDQLWFAMLWGVKGLSAVCWYIDGAW
                     IASMMYGVPVADAKAWDSVAGLQHHYTSGIFYYFWTETVTIFSSSHLSTILMIGHLIW
                     FISFAVWFEDRGSRLEGADIQTRTVRWLGKKFLNRDVTFRFPVLTISDSKLAGTFLYF
                     GGTFMLVFLFIANGFYQTNSPLPPTVGDASLSGQQMLTQVVDYLMKLIA"
     misc_feature    <243257..243496
                     /locus_tag="Cpha266_0219"
                     /note="Photosystem I psaA/psaB protein; Region: PsaA_PsaB;
                     cl08224"
                     /db_xref="CDD:244868"
     gene            244107..244808
                     /locus_tag="Cpha266_0220"
                     /db_xref="GeneID:4570707"
     CDS             244107..244808
                     /locus_tag="Cpha266_0220"
                     /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
                     protein;
                     KEGG: cch:Cag_0344 photosystem P840 reaction center
                     iron-sulfur protein"
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin"
                     /protein_id="YP_910711.1"
                     /db_xref="GI:119356067"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="GeneID:4570707"
                     /translation="MAEPVKQPDVPPAPVSKAAPAAPKAAPKAASPAAKQGEVKPKIS
                     AAPKQTSGKIRLEALNVNLGRTGIRQESALPVKKAPPKAAPKPAPGGAKPAPGAKPAP
                     KTAGAPAGTPVAKSAPAAGTPLAKAAPRAKSHYFIIENLCVGCGLCLDKCPPKVNAIG
                     YKFYGDVQEGGFRCYIDQDACISCSACFSTDECPSGALIEVLPDGQVLDFSFTPPERL
                     DFDLRFLHRFHREVR"
     misc_feature    244530..244694
                     /locus_tag="Cpha266_0220"
                     /note="4Fe-4S dicluster domain; Region: Fer4_7; pfam12838"
                     /db_xref="CDD:221801"
     gene            244888..245670
                     /locus_tag="Cpha266_0221"
                     /db_xref="GeneID:4570708"
     CDS             244888..245670
                     /locus_tag="Cpha266_0221"
                     /EC_number="2.4.1.83"
                     /note="PFAM: glycosyl transferase, family 2;
                     KEGG: plt:Plut_1974 dolichyl-phosphate
                     beta-D-mannosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="dolichyl-phosphate beta-D-mannosyltransferase"
                     /protein_id="YP_910712.1"
                     /db_xref="GI:119356068"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="GeneID:4570708"
                     /translation="MQQKLKKKGDICDLPNEKYEAPVALVIIPTYNEADNIEKLLVAI
                     FKMYPSSVDVLVIDDNSPDGTADIVREVQAYERKLHLVTRAGKLGLGTAYLKGFAYAL
                     DHGYRFIIEMDADYSHDPEMIRTLLEKMAEADLVLGSRYLNNTVNVINWPLRRLILSK
                     AASIYTRYVSGLPVSDPTSGFKCFKREVLETLDLKKVHSEGYSFQIEMNYRVWKKGFA
                     IVEVPIVFTDRTVGKSKMTRKNIREAIWIVWLLKLKTILRML"
     misc_feature    244963..245640
                     /locus_tag="Cpha266_0221"
                     /note="DPM1_like represents putative enzymes similar to
                     eukaryotic DPM1; Region: DPM1_like; cd06442"
                     /db_xref="CDD:133062"
     misc_feature    order(244972..244974,244978..244980,245230..245232)
                     /locus_tag="Cpha266_0221"
                     /note="Ligand binding site; other site"
                     /db_xref="CDD:133062"
     misc_feature    order(245062..245064,245227..245232)
                     /locus_tag="Cpha266_0221"
                     /note="Putative Catalytic site; other site"
                     /db_xref="CDD:133062"
     misc_feature    245224..245232
                     /locus_tag="Cpha266_0221"
                     /note="DXD motif; other site"
                     /db_xref="CDD:133062"
     gene            complement(245800..247875)
                     /locus_tag="Cpha266_0222"
                     /gene_synonym="fusA"
                     /db_xref="GeneID:4570709"
     CDS             complement(245800..247875)
                     /locus_tag="Cpha266_0222"
                     /gene_synonym="fusA"
                     /note="EF-G; promotes GTP-dependent translocation of the
                     ribosome during translation; many organisms have multiple
                     copies of this gene"
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor G"
                     /protein_id="YP_910713.1"
                     /db_xref="GI:119356069"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR005517"
                     /db_xref="GeneID:4570709"
                     /translation="MQSIQPDQLRNIVITGHAGAGKTILCESLALAMGVTNRLGSIDD
                     GTTLSDYSAEEVQRKHSLNTSVIHGFWNDKKINIIDTPGLLDFQGDVKSAMRVADTVL
                     ITVNAANGVEVGTDATWDYTKEYHKPTMFVLSRLDADRTNFNNTLEELRDHFGHLVTP
                     IQFPAEEGLGHHILIDVLMMKQLEFSPDRPGNMTISTIPDLYLKRAEEMHQQLVEAVA
                     ETDEELMNRYFEVGNLTEEELRTGIKSALLTRTFFPVFCTSPLHLIGTERLLNIIVNL
                     CPSPIERGPEHALCSLDDTERLLQPDPDGPTIAFIFKTMSEPRVGEISYLRVYSGHLE
                     TGHELIDVQTGQPEKIGQVYTIIGQKKTPVEKLLAGDIGMVVKLKDAHTNDTLADKGS
                     NCRISPILFPVPVLASAIIPVTQGDEEKISAGLHHLHEEDPSFTIMHDVEFNQTILKT
                     FGETHLEIIISRLQNKFNVTVEIAPIKIPYRETIRVTSTAQGKYKKQSGGRGQYGDVW
                     VRLEPKERDSGFEFSSEVVGGVVPTRYIPAVEKGLRESIEAGVLAGYPVVDMKAIVYD
                     GSFHPVDSSEFAFKIAASMAFKAAFDKAKPLLLEPFYELNVFAPEQYTGEIVGEISSK
                     RGKILGMDTDARFQIVKALIPQAALTSFHHALIRLTQSRARYTYKFNHYEEAPPEIVK
                     QVTSEKSVA"
     misc_feature    complement(247036..247845)
                     /locus_tag="Cpha266_0222"
                     /gene_synonym="fusA"
                     /note="Elongation factor G (EF-G) family; Region:
                     EF-G_bact; cd04170"
                     /db_xref="CDD:206733"
     misc_feature    complement(245824..247830)
                     /locus_tag="Cpha266_0222"
                     /gene_synonym="fusA"
                     /note="elongation factor G; Reviewed; Region: PRK12740"
                     /db_xref="CDD:237186"
     misc_feature    complement(247807..247830)
                     /locus_tag="Cpha266_0222"
                     /gene_synonym="fusA"
                     /note="G1 box; other site"
                     /db_xref="CDD:206733"
     misc_feature    complement(order(247429..247431,247441..247443,
                     247549..247554,247621..247626,247678..247683,
                     247783..247788,247795..247797,247804..247809,
                     247819..247821,247825..247827))
                     /locus_tag="Cpha266_0222"
                     /gene_synonym="fusA"
                     /note="putative GEF interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:206733"
     misc_feature    complement(order(247093..247095,247099..247101,
                     247462..247467,247471..247473,247627..247629,
                     247693..247698,247804..247824))
                     /locus_tag="Cpha266_0222"
                     /gene_synonym="fusA"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206733"
     misc_feature    complement(order(247681..247683,247687..247701))
                     /locus_tag="Cpha266_0222"
                     /gene_synonym="fusA"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206733"
     misc_feature    complement(247696..247698)
                     /locus_tag="Cpha266_0222"
                     /gene_synonym="fusA"
                     /note="G2 box; other site"
                     /db_xref="CDD:206733"
     misc_feature    complement(247627..247638)
                     /locus_tag="Cpha266_0222"
                     /gene_synonym="fusA"
                     /note="G3 box; other site"
                     /db_xref="CDD:206733"
     misc_feature    complement(247576..247632)
                     /locus_tag="Cpha266_0222"
                     /gene_synonym="fusA"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206733"
     misc_feature    complement(247465..247476)
                     /locus_tag="Cpha266_0222"
                     /gene_synonym="fusA"
                     /note="G4 box; other site"
                     /db_xref="CDD:206733"
     misc_feature    complement(247093..247101)
                     /locus_tag="Cpha266_0222"
                     /gene_synonym="fusA"
                     /note="G5 box; other site"
                     /db_xref="CDD:206733"
     misc_feature    complement(246709..246957)
                     /locus_tag="Cpha266_0222"
                     /gene_synonym="fusA"
                     /note="EFG_mtEFG_II: this subfamily represents the domain
                     II of elongation factor G (EF-G) in bacteria and, the
                     C-terminus of mitochondrial Elongation factor G1 (mtEFG1)
                     and G2 (mtEFG2)_like proteins found in eukaryotes. During
                     the process of peptide synthesis...; Region: EFG_mtEFG_II;
                     cd04088"
                     /db_xref="CDD:239755"
     misc_feature    complement(246091..246438)
                     /locus_tag="Cpha266_0222"
                     /gene_synonym="fusA"
                     /note="EFG_mtEFG1_IV: domains similar to domain IV of the
                     bacterial translational elongation factor (EF) EF-G.
                     Included in this group is a domain of mitochondrial
                     Elongation factor G1 (mtEFG1) proteins homologous to
                     domain IV of EF-G. Eukaryotic cells harbor 2...; Region:
                     EFG_mtEFG1_IV; cd01434"
                     /db_xref="CDD:238715"
     misc_feature    complement(245845..246078)
                     /locus_tag="Cpha266_0222"
                     /gene_synonym="fusA"
                     /note="EFG_mtEFG_C: domains similar to the C-terminal
                     domain of the bacterial translational elongation factor
                     (EF) EF-G.  Included in this group is the C-terminus of
                     mitochondrial Elongation factor G1 (mtEFG1) and G2
                     (mtEFG2) proteins. Eukaryotic cells harbor 2...; Region:
                     EFG_mtEFG_C; cd03713"
                     /db_xref="CDD:239683"
     gene            248120..249433
                     /gene="eno"
                     /locus_tag="Cpha266_0223"
                     /db_xref="GeneID:4570710"
     CDS             248120..249433
                     /gene="eno"
                     /locus_tag="Cpha266_0223"
                     /EC_number="4.2.1.11"
                     /note="enolase; catalyzes the formation of
                     phosphoenolpyruvate from 2-phospho-D-glycerate in
                     glycolysis"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopyruvate hydratase"
                     /protein_id="YP_910714.1"
                     /db_xref="GI:119356070"
                     /db_xref="InterPro:IPR000941"
                     /db_xref="GeneID:4570710"
                     /translation="MPIIRKILARQILDSRGNPTVEVDVYTENSFGRAAVPSGASTGV
                     HEAVELRDGDSAVYLGKGVLKAVDHVNTVINDRLKGMFVTDQEEIDMAMLALDGTPNK
                     SRLGANALLGVSMACAKAGAEYSGLPLYRYIGGTMANTLPVPMMNVLNGGAHADNTVD
                     FQEFMIMPVGFSSYSDALRSGAEIFHALKSLLKSKGLSTAVGDEGGFAPNLKSNEEAI
                     ELVIEAVGKAGYKIGSSTANGGLGDAQVMIALDPASSEFYDAAKQKYVFKKSSKQELS
                     SLEMAEYWEKWASDYPIISIEDGMAEDDWDGWKILTDKIGSRVQLVGDDLFVTNTSRL
                     ALGIERGVGNSILVKVNQIGTLTETLQAIDLARRNGYTAVISHRSGETEDSTIAQIAV
                     ATNAGQIKTGSLSRSDRMAKYNELLRIEEELGLQAKYPALSAFRV"
     misc_feature    248120..249427
                     /gene="eno"
                     /locus_tag="Cpha266_0223"
                     /note="enolase; Provisional; Region: eno; PRK00077"
                     /db_xref="CDD:234617"
     misc_feature    248135..249385
                     /gene="eno"
                     /locus_tag="Cpha266_0223"
                     /note="Enolase: Enolases are homodimeric enzymes that
                     catalyse the reversible dehydration of
                     2-phospho-D-glycerate to phosphoenolpyruvate as part of
                     the glycolytic and gluconeogenesis pathways. The reaction
                     is facilitated by the presence of metal ions; Region:
                     enolase; cd03313"
                     /db_xref="CDD:239429"
     misc_feature    order(248141..248143,248147..248173,248183..248185,
                     248216..248218,248582..248590,248651..248656,
                     248663..248668,248675..248680,248717..248722,
                     248741..248743,248747..248749,249260..249268,
                     249335..249343,249347..249352,249359..249361,
                     249368..249373,249380..249382)
                     /gene="eno"
                     /locus_tag="Cpha266_0223"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239429"
     misc_feature    order(248240..248242,248870..248872,249008..249010,
                     249089..249091)
                     /gene="eno"
                     /locus_tag="Cpha266_0223"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:239429"
     misc_feature    order(248579..248581,248729..248731,249164..249166,
                     249248..249256,249317..249319)
                     /gene="eno"
                     /locus_tag="Cpha266_0223"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:239429"
     gene            249641..249946
                     /locus_tag="Cpha266_0224"
                     /db_xref="GeneID:4570711"
     CDS             249641..249946
                     /locus_tag="Cpha266_0224"
                     /note="PFAM: Septum formation initiator;
                     KEGG: plt:Plut_1971 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="septum formation initiator"
                     /protein_id="YP_910715.1"
                     /db_xref="GI:119356071"
                     /db_xref="InterPro:IPR007060"
                     /db_xref="GeneID:4570711"
                     /translation="MKMVNEVWAHISADPKKFFFLIALILFSVWFLFDDYGVVKRIRM
                     EADHRLLQQKHLEAERLILNNELRIRNAYAPDSIEKAAREKYNFRKEGEILFIIRNK"
     misc_feature    249731..249943
                     /locus_tag="Cpha266_0224"
                     /note="Septum formation initiator; Region: DivIC; cl17659"
                     /db_xref="CDD:248213"
     gene            249984..252017
                     /locus_tag="Cpha266_0225"
                     /db_xref="GeneID:4570712"
     CDS             249984..252017
                     /locus_tag="Cpha266_0225"
                     /EC_number="1.17.7.1"
                     /note="KEGG: cch:Cag_0349 IspG protein;
                     TIGRFAM: 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate
                     synthase;
                     PFAM: IspG family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
                     synthase"
                     /protein_id="YP_910716.1"
                     /db_xref="GI:119356072"
                     /db_xref="InterPro:IPR004588"
                     /db_xref="GeneID:4570712"
                     /translation="MFQYRRRFTREVPFGKIALGGYMPIRVESMTNTHTLDTVATVKQ
                     CRRLYEAGCEIIRLTVPTERDAENLRSIRDQLRSDGIDTPLVADIHFSSRAAFKAVEF
                     VENIRINPGNYATKQKFSAETYTDDEYQEEIERVRKEFLPLVYKAREFGASMRIGTNH
                     GSLSDRIVSRYGNSPEGMVEAALEFARICEEEGYHDVLFSMKSSNVKVMIQAYRLLAV
                     KADAELRYAYPLHLGVTEAGDGDEGRVKSAMGIGALLEDGLGDTIRVSLTEDPVNEVP
                     VGFAIVKKYNDLQLIRGENGHVPIKQLIENQGSSFTNELPPFDPFSYQRRISRSFFVG
                     GFAIGGDSMPRVETEAVIPLCRPEELFHEIMQRLLPEESIDAIRSELVGVRVNTVEDL
                     ELLDELLSRLGEAKRFITVSTKDIELFFRLLDKVEKVRLDITEGEMLDRNIFDRLTND
                     RLASVEFCFLHETSGAGVPAEVLGLLAQKAGLQGLERIFFSILSAHSVFVYRRLVQFF
                     SKRGFDYPLVIRFRQMDSVKLDCLISCAVQTGSLFSDGIGDVLALQTGLDVAAEITLA
                     FNILQGARIRMSKTEFISCPGCGRTYFDLEKAAASIKLRLSHLKGLKVGIMGCVVNGP
                     GEMADADFGYVGSGKGRISLYVGKECVEENLPESAAVDRLVGLIQEKGKWVNP"
     misc_feature    249999..>250847
                     /locus_tag="Cpha266_0225"
                     /note="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
                     synthase; Validated; Region: PRK00694"
                     /db_xref="CDD:234812"
     misc_feature    250008..>250832
                     /locus_tag="Cpha266_0225"
                     /note="GcpE protein; Region: GcpE; pfam04551"
                     /db_xref="CDD:218143"
     misc_feature    <251499..252014
                     /locus_tag="Cpha266_0225"
                     /note="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
                     synthase; Validated; Region: PRK00694"
                     /db_xref="CDD:234812"
     gene            252086..252865
                     /locus_tag="Cpha266_0226"
                     /db_xref="GeneID:4570713"
     CDS             252086..252865
                     /locus_tag="Cpha266_0226"
                     /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
                     KEGG: plt:Plut_1969 oxidoreductase, short-chain
                     dehydrogenase/reductase family"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="YP_910717.1"
                     /db_xref="GI:119356073"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR002424"
                     /db_xref="InterPro:IPR013968"
                     /db_xref="GeneID:4570713"
                     /translation="MLFTLVTGASMGIGEAFARKFAETGTSLLLVARSEDKLLALAEE
                     LKASGATDVRILAEDLSREGSPERIYEFCLRENIAIDVLVNCAGLSFAGDFDKLPVGK
                     LEEIMAVNMLALCRLTRLFLPGMIKRKGGGIMNIASIGGFQGVPGLALYSATKSFVIT
                     LTEALHTELKETGVKAVAVCPGFIQTGFLAKAGHSQDGILLPVYSRDLVVKAAIKGYK
                     KNRLRIFPTVIDFLLVFSQRFVPRKTAVKLADVLSSARSRR"
     misc_feature    252098..252832
                     /locus_tag="Cpha266_0226"
                     /note="Short-chain dehydrogenases of various substrate
                     specificities [General function prediction only]; Region:
                     DltE; COG0300"
                     /db_xref="CDD:223377"
     misc_feature    252098..>252664
                     /locus_tag="Cpha266_0226"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    order(252107..252109,252113..252124,252179..252187,
                     252257..252265,252341..252349,252410..252412,
                     252491..252499,252536..252538,252548..252550,
                     252626..252637,252641..252646)
                     /locus_tag="Cpha266_0226"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    order(252413..252415,252497..252499,252536..252538,
                     252548..252550)
                     /locus_tag="Cpha266_0226"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            252936..253008
                     /locus_tag="Cpha266_R0003"
                     /note="tRNA-Thr1"
                     /db_xref="GeneID:4570714"
     tRNA            252936..253008
                     /locus_tag="Cpha266_R0003"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:4570714"
     gene            253022..253104
                     /locus_tag="Cpha266_R0004"
                     /note="tRNA-Tyr1"
                     /db_xref="GeneID:4570715"
     tRNA            253022..253104
                     /locus_tag="Cpha266_R0004"
                     /product="tRNA-Tyr"
                     /db_xref="GeneID:4570715"
     gene            253131..253203
                     /locus_tag="Cpha266_R0005"
                     /note="tRNA-Thr2"
                     /db_xref="GeneID:4570716"
     tRNA            253131..253203
                     /locus_tag="Cpha266_R0005"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:4570716"
     gene            253227..253302
                     /locus_tag="Cpha266_R0006"
                     /note="tRNA-Trp1"
                     /db_xref="GeneID:4570793"
     tRNA            253227..253302
                     /locus_tag="Cpha266_R0006"
                     /product="tRNA-Trp"
                     /db_xref="GeneID:4570793"
     gene            253349..253540
                     /gene="secE"
                     /locus_tag="Cpha266_0227"
                     /db_xref="GeneID:4570794"
     CDS             253349..253540
                     /gene="secE"
                     /locus_tag="Cpha266_0227"
                     /note="forms a complex with SecY and SecG; SecYEG forms a
                     putative protein-conducting channel to which secA binds
                     and translocates targeted polypeptides across the
                     cytoplasmic membrane, a process driven by ATP and a
                     proton-motive force"
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecE"
                     /protein_id="YP_910718.1"
                     /db_xref="GI:119356074"
                     /db_xref="InterPro:IPR001901"
                     /db_xref="InterPro:IPR005807"
                     /db_xref="GeneID:4570794"
                     /translation="MNKYVGKVGQYYRDVVSEMRKVVWPGKDELKDLTIVVLTVSGIL
                     ALFTFLVDWVINAVMGLLL"
     misc_feature    253349..253534
                     /gene="secE"
                     /locus_tag="Cpha266_0227"
                     /note="preprotein translocase subunit SecE; Reviewed;
                     Region: secE; PRK07597"
                     /db_xref="CDD:236066"
     gene            253562..254137
                     /locus_tag="Cpha266_0228"
                     /db_xref="GeneID:4570795"
     CDS             253562..254137
                     /locus_tag="Cpha266_0228"
                     /note="KEGG: plt:Plut_1967 NusG antitermination factor;
                     TIGRFAM: transcription termination/antitermination factor
                     NusG;
                     PFAM: transcription antitermination protein NusG;
                     SMART: NGN domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription antitermination protein nusG"
                     /protein_id="YP_910719.1"
                     /db_xref="GI:119356075"
                     /db_xref="InterPro:IPR001062"
                     /db_xref="InterPro:IPR003257"
                     /db_xref="InterPro:IPR006645"
                     /db_xref="GeneID:4570795"
                     /translation="MNTRKKAVEEQGVPGPRWYALRIYSGHERKVKEGIEAEVARCGL
                     ADKILQIYVPYERFVEVKNGKKRSLTKNAFPGYVLIEAVLDKQTRNVILDMPSVMGFL
                     GVDDVPTPLRPEEVEKILVTENTVEHRAVIEAPFRIGDSVKVIDGPFSSLTGVVHEVC
                     TERMKVKVMISFFGRSTPTELDFSQVKSVSQ"
     misc_feature    253610..254131
                     /locus_tag="Cpha266_0228"
                     /note="transcription antitermination protein NusG;
                     Validated; Region: nusG; PRK05609"
                     /db_xref="CDD:180161"
     misc_feature    253610..253921
                     /locus_tag="Cpha266_0228"
                     /note="Bacterial N-Utilization Substance G (NusG)
                     N-terminal (NGN) domain, subgroup 1; Region: NGN_Bact_1;
                     cd09891"
                     /db_xref="CDD:193580"
     misc_feature    order(253619..253621,253721..253723,253781..253783,
                     253790..253792,253796..253798,253892..253894,
                     253916..253918)
                     /locus_tag="Cpha266_0228"
                     /note="putative homodimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:193580"
     misc_feature    253958..254122
                     /locus_tag="Cpha266_0228"
                     /note="NusG contains an NGN domain at its N-terminus and
                     KOW motif at its C-terminus; Region: KOW_NusG; cd06091"
                     /db_xref="CDD:240515"
     misc_feature    order(253994..254008,254015..254017,254051..254053,
                     254078..254086,254090..254101,254111..254116)
                     /locus_tag="Cpha266_0228"
                     /note="heterodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240515"
     misc_feature    253994..254005
                     /locus_tag="Cpha266_0228"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240515"
     gene            254181..254606
                     /gene="rplK"
                     /locus_tag="Cpha266_0229"
                     /db_xref="GeneID:4570796"
     CDS             254181..254606
                     /gene="rplK"
                     /locus_tag="Cpha266_0229"
                     /note="binds directly to 23S ribosomal RNA"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L11"
                     /protein_id="YP_910720.1"
                     /db_xref="GI:119356076"
                     /db_xref="InterPro:IPR000911"
                     /db_xref="InterPro:IPR006519"
                     /db_xref="GeneID:4570796"
                     /translation="MAKKIIGFIKLQIPAGAANPAPPVGPALGQKGVNIMEFCKQFNA
                     KTQAEAGMITPVVITVYSDKSFTFITKTPPAAVLLLKEAQLKKGSGEPNRNKVGTVSR
                     EQVRRIAELKMPDLNAVDVAGAEQMVMGTARSMGIVVEN"
     misc_feature    254181..254603
                     /gene="rplK"
                     /locus_tag="Cpha266_0229"
                     /note="50S ribosomal protein L11; Validated; Region: rplK;
                     PRK00140"
                     /db_xref="CDD:234661"
     misc_feature    254205..254597
                     /gene="rplK"
                     /locus_tag="Cpha266_0229"
                     /note="Ribosomal protein L11. Ribosomal protein L11,
                     together with proteins L10 and L7/L12, and 23S rRNA, form
                     the L7/L12 stalk on the surface of the large subunit of
                     the ribosome. The homologous eukaryotic cytoplasmic
                     protein is also called 60S ribosomal...; Region:
                     Ribosomal_L11; cd00349"
                     /db_xref="CDD:100101"
     misc_feature    order(254208..254210,254268..254270,254400..254408,
                     254418..254420,254439..254441,254514..254516,
                     254529..254537,254547..254549,254556..254561,
                     254568..254573,254577..254585)
                     /gene="rplK"
                     /locus_tag="Cpha266_0229"
                     /note="23S rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:100101"
     misc_feature    order(254208..254210,254349..254351,254355..254366,
                     254376..254378,254382..254387,254517..254522,
                     254529..254534)
                     /gene="rplK"
                     /locus_tag="Cpha266_0229"
                     /note="L7/L12 interface [polypeptide binding]; other site"
                     /db_xref="CDD:100101"
     misc_feature    order(254256..254258,254268..254270)
                     /gene="rplK"
                     /locus_tag="Cpha266_0229"
                     /note="putative thiostrepton binding site; other site"
                     /db_xref="CDD:100101"
     misc_feature    order(254457..254459,254466..254468)
                     /gene="rplK"
                     /locus_tag="Cpha266_0229"
                     /note="L25 interface [polypeptide binding]; other site"
                     /db_xref="CDD:100101"
     gene            254677..255366
                     /gene="rplA"
                     /locus_tag="Cpha266_0230"
                     /db_xref="GeneID:4570797"
     CDS             254677..255366
                     /gene="rplA"
                     /locus_tag="Cpha266_0230"
                     /note="in Escherichia coli and Methanococcus, this protein
                     autoregulates expression; the binding site in the mRNA
                     mimics the binding site in the 23S rRNA"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L1"
                     /protein_id="YP_910721.1"
                     /db_xref="GI:119356077"
                     /db_xref="InterPro:IPR002143"
                     /db_xref="InterPro:IPR005878"
                     /db_xref="GeneID:4570797"
                     /translation="MAGKKYRDAVAKTDRFQEYDLVDAVEKIREITQVKFDATIDIAM
                     KLGVDPRHADQVVRGTVMLPHGTGKTVSVLVVCKEAKAEEAVAAGADFVGFEEYVEKI
                     QNGWTGVDVIIATPDVMGQLGKVAKILGPRGLMPNPKSGTVTMDVAKAVKEVKAGKIE
                     FRVDKAGNVHAPVGKVSFQSEQLVENITSFLKEVVRLKPSAAKGQYVQGIALSSTMSP
                     SVKVKREKFVA"
     misc_feature    254737..255342
                     /gene="rplA"
                     /locus_tag="Cpha266_0230"
                     /note="Ribosomal protein L1.  The L1 protein, located near
                     the E-site of the ribosome, forms part of the L1 stalk
                     along with 23S rRNA.  In bacteria and archaea, L1
                     functions both as a ribosomal protein that binds rRNA, and
                     as a translation repressor that binds...; Region:
                     Ribosomal_L1; cd00403"
                     /db_xref="CDD:238235"
     misc_feature    order(254776..254784,254791..254793,254797..254799,
                     254803..254805,254809..254811,255172..255174,
                     255178..255180,255184..255186,255322..255327,
                     255331..255333)
                     /gene="rplA"
                     /locus_tag="Cpha266_0230"
                     /note="mRNA/rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238235"
     gene            255384..255902
                     /gene="rplJ"
                     /locus_tag="Cpha266_0231"
                     /db_xref="GeneID:4570798"
     CDS             255384..255902
                     /gene="rplJ"
                     /locus_tag="Cpha266_0231"
                     /note="binds the two ribosomal protein L7/L12 dimers and
                     anchors them to the large ribosomal subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L10"
                     /protein_id="YP_910722.1"
                     /db_xref="GI:119356078"
                     /db_xref="InterPro:IPR001790"
                     /db_xref="InterPro:IPR002363"
                     /db_xref="GeneID:4570798"
                     /translation="MKRDKKEQIVQDVAEKIDRSQGIYLTEFQGLSVAKMAELRNEFR
                     KAGVEYRVVKNTLIKKALRDLSSADRLASGLKSTTAVAFGYDDPLAPAKIIRKFSKTN
                     EALKFKMASIDGVVYDADSLPALSEMLSKTENIGRAAGLINGVVSSVPMVVNAVARNL
                     VSVLDQIAKQKQ"
     misc_feature    255387..255893
                     /gene="rplJ"
                     /locus_tag="Cpha266_0231"
                     /note="Ribosomal protein L10 family, L10 subfamily;
                     composed of bacterial 50S ribosomal protein and eukaryotic
                     mitochondrial 39S ribosomal protein, L10. L10 occupies the
                     L7/L12 stalk of the ribosome. The N-terminal domain (NTD)
                     of L10 interacts with L11 protein...; Region:
                     Ribosomal_L10; cd05797"
                     /db_xref="CDD:240223"
     misc_feature    order(255399..255404,255411..255413,255543..255554,
                     255561..255563)
                     /gene="rplJ"
                     /locus_tag="Cpha266_0231"
                     /note="23S rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:240223"
     misc_feature    order(255648..255650,255717..255719,255726..255728,
                     255774..255776,255783..255788,255795..255800,
                     255804..255815,255849..255854,255858..255866,
                     255873..255878,255882..255887,255891..255893)
                     /gene="rplJ"
                     /locus_tag="Cpha266_0231"
                     /note="Interface with L7/L12 ribosomal proteins
                     [polypeptide binding]; other site"
                     /db_xref="CDD:240223"
     gene            255969..256346
                     /gene="rplL"
                     /locus_tag="Cpha266_0232"
                     /db_xref="GeneID:4570799"
     CDS             255969..256346
                     /gene="rplL"
                     /locus_tag="Cpha266_0232"
                     /note="present in two forms; L12 is normal, while L7 is
                     aminoacylated at the N-terminal serine; the only multicopy
                     ribosomal protein; 4:1 ratio of L7/L12 per ribosome; two
                     L12 dimers bind L10; critically important for translation
                     efficiency and fidelity; stimulates GTPase activity of
                     translation factors"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L7/L12"
                     /protein_id="YP_910723.1"
                     /db_xref="GI:119356079"
                     /db_xref="InterPro:IPR000206"
                     /db_xref="InterPro:IPR013823"
                     /db_xref="GeneID:4570799"
                     /translation="MSIETLVEEIGKLTLTEASELVKALEEKFGVSAAPAMMAGVMAA
                     APAGDAPAQEEKTEFDVVLTAAGESKINVIKVVRALTGLGLKEAKDLVDGAPKTVKEG
                     ISKDEAEKVAKELKDVGASVELK"
     misc_feature    255969..256340
                     /gene="rplL"
                     /locus_tag="Cpha266_0232"
                     /note="Ribosomal protein L7/L12. Ribosomal protein L7/L12
                     refers to the large ribosomal subunit proteins L7 and L12,
                     which are identical except that L7 is acetylated at the N
                     terminus. It is a component of the L7/L12 stalk, which is
                     located at the surface of...; Region: Ribosomal_L7_L12;
                     cd00387"
                     /db_xref="CDD:100102"
     misc_feature    order(255969..255971,256008..256016,256023..256028,
                     256035..256037,256044..256046,256089..256091,
                     256098..256103,256107..256115,256137..256142,
                     256203..256205,256209..256214,256218..256220,
                     256224..256229,256269..256274,256278..256280,
                     256287..256289)
                     /gene="rplL"
                     /locus_tag="Cpha266_0232"
                     /note="core dimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100102"
     misc_feature    order(255978..255980,255987..255989,255999..256001,
                     256038..256040,256053..256055)
                     /gene="rplL"
                     /locus_tag="Cpha266_0232"
                     /note="peripheral dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:100102"
     misc_feature    order(256020..256022,256029..256034,256044..256046,
                     256053..256055)
                     /gene="rplL"
                     /locus_tag="Cpha266_0232"
                     /note="L10 interface [polypeptide binding]; other site"
                     /db_xref="CDD:100102"
     misc_feature    order(256176..256181,256188..256193,256200..256202,
                     256221..256226,256233..256235)
                     /gene="rplL"
                     /locus_tag="Cpha266_0232"
                     /note="L11 interface [polypeptide binding]; other site"
                     /db_xref="CDD:100102"
     misc_feature    order(256179..256181,256191..256193,256200..256202,
                     256221..256226,256233..256235)
                     /gene="rplL"
                     /locus_tag="Cpha266_0232"
                     /note="putative EF-Tu interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:100102"
     misc_feature    order(256179..256181,256188..256193,256200..256202)
                     /gene="rplL"
                     /locus_tag="Cpha266_0232"
                     /note="putative EF-G interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:100102"
     gene            256527..260465
                     /gene="rpoB"
                     /locus_tag="Cpha266_0233"
                     /db_xref="GeneID:4570800"
     CDS             256527..260465
                     /gene="rpoB"
                     /locus_tag="Cpha266_0233"
                     /EC_number="2.7.7.6"
                     /note="DNA-dependent RNA polymerase catalyzes the
                     transcription of DNA into RNA using the four
                     ribonucleoside triphosphates as substrates; beta subunit
                     is part of the catalytic core which binds with a sigma
                     factor to produce the holoenzyme"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta"
                     /protein_id="YP_910724.1"
                     /db_xref="GI:119356080"
                     /db_xref="InterPro:IPR007120"
                     /db_xref="InterPro:IPR007121"
                     /db_xref="InterPro:IPR007641"
                     /db_xref="InterPro:IPR007644"
                     /db_xref="InterPro:IPR007645"
                     /db_xref="InterPro:IPR010243"
                     /db_xref="GeneID:4570800"
                     /translation="MQFDKSEVHVKVADATPTPCIDFSKIQSVIDPPDLLKVQLDSFH
                     NFIQDSVPLAKRRDQGLERVLRSAFPITDTRGLYLLEYISYSFDKPKYTVEDCIERGL
                     TYDVSLKVKLKLSYKDEPDEADWKETIQQEVYLGRIPYMTERGTFIVNGAERVVVAQL
                     HRSPGVVFSEAIHPNGKKMYSAKIVPTRGSWIEFQTDINNQIFVYIDQKKNFLVTALL
                     RAIGFAKDEDILGLFDLVEEVKITSAKKEQLIGQYLASDIVDMQTGEVVSARTAITED
                     IVDQIIAAGYKSVRVMKSFSGNDKGPDKSIIINTILNDNSATEEEALEIVYEELRANE
                     APDIDAARSFLERTFFNQKKYDLGDVGRYRIRKKLSKEFEELHGYLDGQPELKKLSDT
                     IYEKILHTIQSFSDEPIGGDILVLTHYDIIAVIYYLIKLVNGQAEVDDVDHLANRRVR
                     SVGEQLAAQFVIGLARMGKNVREKLNSRDSDKIAPSDLINARTVSSVVSSFFATSQLS
                     QFMDQTNPLAEMTNKRRVSALGPGGLTRERAGFEVRDVHYTHYGRLCPIETPEGPNIG
                     LISSLSVYAEINDKGFIQTPYRVVTNGVVTDTVLMLSAEDEENKITVPVSIPLDENMK
                     IAIESVQARTKGDYPLVPAEDVNYMDVSPVQIVSAAAALIPFLEHDDGNRALMGANMQ
                     RQAVPLLTAEAPIVGTGMESKVARDSRSVILAEGDGIVDDVTAEYIKVRYDIDADTDV
                     RLSLLDPDEGLKTYKLIKFKRSNQDTCISQKPLIHIGQRVSKGDVLADSSSTENGELA
                     LGKNVLVAFMPWRGYNFEDAIILSERLVYDDVFTSIHIHEFEANVRDTKRGEEQFTRD
                     IYNVSEDALRNLDENGIVRIGAEVKERDILVGKITPKGESDPTPEEKLLRAIFGDKSS
                     DVKDASMHVPAGMKGIVIKTKLFSRKKKVGLDIKEKIEILEKKYDYKEYDLRKKFLKR
                     LKQLLEGKTSTGIYSDKGKLLVAEDAVYDDSVLERFTAIPFLESIDFVKGVTQSEKVN
                     ENVMLLVKEFRLKLKDLNDERDNEKYKLNVGDELPPGIEELAKVYIAQKRKIQVGDKM
                     AGRHGNKGVVGKILPIEDMPFMENGKPVDIVLNPLGVPSRMNIGQLYETSLGWAGKEL
                     GVKFKTPIFNGATYQEVQQELEKAGLPSHGKVSLYDGRTGEQFDDEVTIGYIYMLKLS
                     HLVDDKIHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWALEAYGAANILREMLTVK
                     SDDVIGRNKTYEAIVKGQNLPEPGTPESFNVLVRELQGLGLEIRIDDRVP"
     misc_feature    256626..258041
                     /gene="rpoB"
                     /locus_tag="Cpha266_0233"
                     /note="RNA polymerase beta subunit; Region:
                     RNA_pol_Rpb2_1; pfam04563"
                     /db_xref="CDD:191028"
     misc_feature    256629..>257159
                     /gene="rpoB"
                     /locus_tag="Cpha266_0233"
                     /note="RNA polymerase beta subunit. RNA polymerases
                     catalyse the DNA dependent polymerization of RNA.
                     Prokaryotes contain a single RNA polymerase compared to
                     three in eukaryotes (not including mitochondrial. and
                     chloroplast polymerases). Each RNA polymerase...; Region:
                     RNA_pol_B_RPB2; cl17585"
                     /db_xref="CDD:248139"
     misc_feature    <257679..>259034
                     /gene="rpoB"
                     /locus_tag="Cpha266_0233"
                     /note="RNA polymerase beta subunit. RNA polymerases
                     catalyse the DNA dependent polymerization of RNA.
                     Prokaryotes contain a single RNA polymerase compared to
                     three in eukaryotes (not including mitochondrial. and
                     chloroplast polymerases). Each RNA polymerase...; Region:
                     RNA_pol_B_RPB2; cd00653"
                     /db_xref="CDD:238353"
     misc_feature    order(258696..258698,258831..258833,258837..258839,
                     258849..258857,258861..258863)
                     /gene="rpoB"
                     /locus_tag="Cpha266_0233"
                     /note="RPB12 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    258783..>259340
                     /gene="rpoB"
                     /locus_tag="Cpha266_0233"
                     /note="RNA polymerase Rpb2, domain 6; Region:
                     RNA_pol_Rpb2_6; pfam00562"
                     /db_xref="CDD:215994"
     misc_feature    <259713..260450
                     /gene="rpoB"
                     /locus_tag="Cpha266_0233"
                     /note="RNA polymerase beta subunit. RNA polymerases
                     catalyse the DNA dependent polymerization of RNA.
                     Prokaryotes contain a single RNA polymerase compared to
                     three in eukaryotes (not including mitochondrial. and
                     chloroplast polymerases). Each RNA polymerase...; Region:
                     RNA_pol_B_RPB2; cd00653"
                     /db_xref="CDD:238353"
     misc_feature    order(259755..259757,259761..259763,259836..259844,
                     259851..259853,259857..259862,260073..260096,
                     260100..260102)
                     /gene="rpoB"
                     /locus_tag="Cpha266_0233"
                     /note="RPB3 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    order(259809..259811,259815..259817,259821..259823,
                     259887..259889,259893..259895,259902..259904,
                     259911..259913,259926..259928,259938..259940,
                     259989..259991,260070..260072,260094..260102,
                     260106..260108,260145..260147,260154..260162,
                     260166..260171,260232..260240,260250..260252,
                     260256..260261,260265..260267,260271..260288,
                     260292..260309,260319..260321,260388..260390,
                     260400..260402,260406..260408,260412..260417,
                     260421..260423,260427..260438,260442..260444,
                     260448..260450)
                     /gene="rpoB"
                     /locus_tag="Cpha266_0233"
                     /note="RPB1 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    order(259833..259835,260076..260078)
                     /gene="rpoB"
                     /locus_tag="Cpha266_0233"
                     /note="RPB11 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    order(259836..259838,259875..259877,259956..259961,
                     259965..259967,260058..260060,260109..260111)
                     /gene="rpoB"
                     /locus_tag="Cpha266_0233"
                     /note="RPB10 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     gene            260535..265013
                     /locus_tag="Cpha266_0234"
                     /db_xref="GeneID:4570801"
     CDS             260535..265013
                     /locus_tag="Cpha266_0234"
                     /EC_number="2.7.7.6"
                     /note="DNA-dependent RNA polymerase catalyzes the
                     transcription of DNA into RNA using the four
                     ribonucleoside triphosphates as substrates. Subunit beta'
                     binds to sigma factor allowing it to bind to the -10
                     region of the promoter"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta'"
                     /protein_id="YP_910725.1"
                     /db_xref="GI:119356081"
                     /db_xref="InterPro:IPR000722"
                     /db_xref="InterPro:IPR006592"
                     /db_xref="InterPro:IPR007066"
                     /db_xref="InterPro:IPR007080"
                     /db_xref="InterPro:IPR007081"
                     /db_xref="InterPro:IPR007083"
                     /db_xref="InterPro:IPR012754"
                     /db_xref="GeneID:4570801"
                     /translation="MIFSQGASPLKGDFSKIKFSIASPESILAHSRGEVLKPETINYR
                     TFKPERDGLMCEKIFGPTKDWECYCGKYKRVRYKGIICDRCGVEVTTKSVRRERMGHI
                     SLAVPVVHTWFFRSVPSKIGALLDLSTKELERIIYYEVYVVINPGEPGAKQGIKKLDR
                     LTEEQYFQIITEYEDNQDLDDHDSDKFVAKMGGEAIRLLLKSIDLNETAIHLRKVLKE
                     SSSEQKRADALKRLKVVEAFRKSYEPQKKTRKKAVGLFPEDELPEPYVFEGNKPEYMV
                     MEVVPVIPPELRPLVPLEGGRFATSDLNDLYRRVIIRNNRLKKLIDIRAPEVILRNEK
                     RMLQEAVDALFDNSRKANAVKTGESNRPLKSLSDALKGKQGRFRQNLLGKRVDYSGRS
                     VIVVGPELKLHECGLPKSMAIELFQPFVIRRLVERGIAKSVKSAKKLIDKKDQVVWDV
                     LEKVIDGRPVLLNRAPTLHRLGIQAFQPVLIEGKAIQIHPLVCTAFNADFDGDQMAVH
                     VPLSQEAQLEAALLMLSSHNLILPQSGKPVTVPSQDMVLGMYYLTKSRPGDPGEGRIF
                     YSDEDVLIAYNEDRIGLHAQIFVHFNGAVDQKFDPLRVLDTIVDPKSEKYTWLKSQLE
                     KKTILLTTVGRVIFNQNVPDSIGFINRVIDKKVAKELIGRLSSDVGNVETAKFLDNIK
                     EVGFHYAMKGGLSVGLSDAIVPDTKVRHIKNAQKDSTKVVKEYNRGTLTDNERYNQIV
                     DVWQKTSNIVAEESYQKLKKDREGFNPLYMMLDSGARGSREQVRQLTGMRGLIARPQK
                     SMSGQPGEIIENPIISNLKEGLTVLEYFISTHGARKGLSDTSLKTADAGYLTRRLHDV
                     AQDVIVTIEDCGTTRGLHVYRNIEEETSGQIKFREKIRGRVAARDIYDTLNNNVIVKA
                     GEIITEELGDLIQETAGVEEAEIRSVLTCESKIGICSKCYGTNLSVHQIVEIGEAVGV
                     IAAQSIGEPGTQLTLRTFHQGGTAQGGISETETKAFYEGQLEFEDLKTVEHSAITEDG
                     VEEIRIIVVQKNGKINIVDPDSGKILKRYVVPHGAHLHCNAKALVKKDQVLFSSEPNS
                     TQIIAELHGRVKFADIEKGVTYKEEVDPQTGFAQHTIINWRSKLRANETREPRVLIID
                     ESGEVRKNYPVPIKSNLYVEDGQKIVPGDIIAKVPRNLDRAGGDITAGLPKVTELFEA
                     RIPSDPAIVSEIDGYVSFGSQRRSSKEIKVKNDFGEEKVYYVQVGKHVLANEGDEVKA
                     GDAMTDGAVSPQDILRIQGPNAVQQYLVNEIQKVYQINAGVEINDKHLEVIVRQMLQK
                     VRVEEPGDTELLPGDLIDRSAFVEANNNVAEKVRVTEKGDAPSRIQEGQLYKTRDITK
                     LNRELRKNSKNLVAFEPALQATSHPVLLGITSAALQTESVISAASFQETTKVLTDAAV
                     AGKIDYLAGLKENVIVGKLIPAGTGLKRYRNLTLTGESVETISHDASDDASTQNGI"
     misc_feature    260565..261677
                     /locus_tag="Cpha266_0234"
                     /note="RNA polymerase Rpb1, domain 1; Region:
                     RNA_pol_Rpb1_1; pfam04997"
                     /db_xref="CDD:218370"
     misc_feature    260580..263246
                     /locus_tag="Cpha266_0234"
                     /note="DNA-directed RNA polymerase, beta' subunit/160 kD
                     subunit [Transcription]; Region: RpoC; COG0086"
                     /db_xref="CDD:223164"
     misc_feature    261393..262184
                     /locus_tag="Cpha266_0234"
                     /note="RNA polymerase I subunit A N-terminus; Region:
                     RPOLA_N; smart00663"
                     /db_xref="CDD:214767"
     misc_feature    262116..262634
                     /locus_tag="Cpha266_0234"
                     /note="RNA polymerase Rpb1, domain 3; Region:
                     RNA_pol_Rpb1_3; pfam04983"
                     /db_xref="CDD:218361"
     misc_feature    262722..262979
                     /locus_tag="Cpha266_0234"
                     /note="RNA polymerase Rpb1, domain 4; Region:
                     RNA_pol_Rpb1_4; pfam05000"
                     /db_xref="CDD:218372"
     misc_feature    263418..>263525
                     /locus_tag="Cpha266_0234"
                     /note="Largest subunit of RNA polymerase (RNAP),
                     C-terminal domain; Region: RNAP_largest_subunit_C;
                     cl11429"
                     /db_xref="CDD:142634"
     misc_feature    263436..263438
                     /locus_tag="Cpha266_0234"
                     /note="Rpb1 - Rpb6 interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:132719"
     misc_feature    <264345..264920
                     /locus_tag="Cpha266_0234"
                     /note="Largest subunit (beta') of Bacterial DNA-dependent
                     RNA polymerase (RNAP), C-terminal domain; Region:
                     RNAP_beta'_C; cd02655"
                     /db_xref="CDD:132721"
     misc_feature    order(264762..264764,264807..264812)
                     /locus_tag="Cpha266_0234"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:132721"
     misc_feature    order(264852..264854,264870..264872,264888..264890,
                     264897..264902,264912..264914)
                     /locus_tag="Cpha266_0234"
                     /note="Rpb1 (beta') - Rpb2 (beta) interaction site
                     [polypeptide binding]; other site"
                     /db_xref="CDD:132721"
     gene            complement(265212..266558)
                     /locus_tag="Cpha266_0235"
                     /db_xref="GeneID:4570802"
     CDS             complement(265212..266558)
                     /locus_tag="Cpha266_0235"
                     /note="TIGRFAM: acetyl-CoA carboxylase, biotin
                     carboxylase;
                     PFAM: phosphoribosylglycinamide synthetase; ATP-dependent
                     carboxylate-amine ligase domain protein, ATP-grasp;
                     Carbamoyl-phosphate synthase L chain, ATP-binding;
                     Carbamoyl-phosphate synthetase large chain domain protein;
                     biotin carboxylase domain protein;
                     KEGG: cch:Cag_0359 acetyl-CoA carboxylase, biotin
                     carboxylase"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA carboxylase, biotin carboxylase"
                     /protein_id="YP_910726.1"
                     /db_xref="GI:119356082"
                     /db_xref="InterPro:IPR000115"
                     /db_xref="InterPro:IPR003135"
                     /db_xref="InterPro:IPR004549"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005482"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR011764"
                     /db_xref="GeneID:4570802"
                     /translation="MFKKILVANRGEIALRIMQTCREMGISTVAVYSTADAESIHVKY
                     ADEAVCIGPALSRESYLNIPRIIAAAEVTNADAIHPGYGFLAENADFAEVCSSVNIKF
                     IGPTAKMINQMGDKNTAKATMIAAGVPVVPGSQGLVSNLAEAVKTAQNTGYPVIIKPT
                     AGGGGKGMRVVHEENQLEKALNTARSEAEQAFGNSGVYIEKFLENPRHVEIQILSDQH
                     GNTIHLGERDCTVQRRHQKLIEETPSPAVDDALRKTMGDAAVAAAAAINYEGAGTIEF
                     LLDKHGKFFFMEMNTRIQVEHPVTEERYDVDIVREQIIIADGQSIAGRTFTPKGHSIE
                     CRINAEDPDHLFRPSPGQLQVFHTPGGHGVRVDSHAYASYVVPSNYDSMIAKLIVTAH
                     TRDEAIARMSRALDEFIVLGVKTTIPFHKQVMHSAVFQSGVFDTSFLESFRYEKSI"
     misc_feature    complement(265239..266558)
                     /locus_tag="Cpha266_0235"
                     /note="acetyl-CoA carboxylase biotin carboxylase subunit;
                     Validated; Region: PRK08591"
                     /db_xref="CDD:236307"
     misc_feature    complement(266235..266555)
                     /locus_tag="Cpha266_0235"
                     /note="Carbamoyl-phosphate synthase L chain, N-terminal
                     domain; Region: CPSase_L_chain; pfam00289"
                     /db_xref="CDD:201133"
     misc_feature    complement(265596..266216)
                     /locus_tag="Cpha266_0235"
                     /note="Carbamoyl-phosphate synthase L chain, ATP binding
                     domain; Region: CPSase_L_D2; pfam02786"
                     /db_xref="CDD:190425"
     misc_feature    complement(265239..265559)
                     /locus_tag="Cpha266_0235"
                     /note="Biotin carboxylase C-terminal domain; Region:
                     Biotin_carb_C; smart00878"
                     /db_xref="CDD:214878"
     gene            complement(266578..267072)
                     /locus_tag="Cpha266_0236"
                     /db_xref="GeneID:4570803"
     CDS             complement(266578..267072)
                     /locus_tag="Cpha266_0236"
                     /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxyl
                     carrier protein;
                     PFAM: biotin/lipoyl attachment domain-containing protein;
                     KEGG: plt:Plut_1959 acetyl-CoA biotin carboxyl carrier"
                     /codon_start=1
                     /transl_table=11
                     /product="biotin carboxyl carrier protein"
                     /protein_id="YP_910727.1"
                     /db_xref="GI:119356083"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR001249"
                     /db_xref="InterPro:IPR001882"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="GeneID:4570803"
                     /translation="MNLNEIKQLIDIVNSSDLQEAIIEEGDFKITLRRHPIAGLSYLQ
                     PAEQQNAPYSVTPPSLSREVASQTPESVAAPAANPKAEPMAGLIDVCSPIVGTFYRSS
                     SPDAPAFVNINDTVNKGDVLCIIEAMKLMNEIEAEMSGTIVEILVENGHPVEYDQPLF
                     RIKP"
     misc_feature    complement(266584..267072)
                     /locus_tag="Cpha266_0236"
                     /note="acetyl-CoA carboxylase biotin carboxyl carrier
                     protein subunit; Validated; Region: PRK06302"
                     /db_xref="CDD:235777"
     misc_feature    complement(266587..266805)
                     /locus_tag="Cpha266_0236"
                     /note="The biotinyl-domain or biotin carboxyl carrier
                     protein (BCCP) domain is present in all biotin-dependent
                     enzymes, such as acetyl-CoA carboxylase, pyruvate
                     carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA
                     carboxylase, geranyl-CoA carboxylase; Region:
                     biotinyl_domain; cd06850"
                     /db_xref="CDD:133459"
     misc_feature    complement(order(266662..266664,266683..266691,
                     266716..266718))
                     /locus_tag="Cpha266_0236"
                     /note="carboxyltransferase (CT) interaction site; other
                     site"
                     /db_xref="CDD:133459"
     misc_feature    complement(266686..266688)
                     /locus_tag="Cpha266_0236"
                     /note="biotinylation site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:133459"
     gene            complement(267125..267691)
                     /locus_tag="Cpha266_0237"
                     /db_xref="GeneID:4570804"
     CDS             complement(267125..267691)
                     /locus_tag="Cpha266_0237"
                     /note="Involved in peptide bond synthesis; alters the
                     affinity of the ribosome for aminoacyl-tRNA"
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor P"
                     /protein_id="YP_910728.1"
                     /db_xref="GI:119356084"
                     /db_xref="InterPro:IPR001059"
                     /db_xref="InterPro:IPR011768"
                     /db_xref="InterPro:IPR013185"
                     /db_xref="InterPro:IPR013852"
                     /db_xref="GeneID:4570804"
                     /translation="MTSISNVSKGSIIRFKGEPHIIESLIHRTPGNLRAFYQANMKNL
                     KTGRNVEFRFSASESVDVIVTERKPYQYLYKDGTDFVMMDSGTFDQINVPEITLGTSS
                     RFLKDGITVVIVFSDDGSILDVEMPTFVEVEVTETSPTTKDDRATSGTKPAIVETGAE
                     VGVPMFIQTGSIIRVDTRTGEYIERVKK"
     misc_feature    complement(267131..267691)
                     /locus_tag="Cpha266_0237"
                     /note="elongation factor P; Validated; Region: PRK00529"
                     /db_xref="CDD:234788"
     misc_feature    complement(267512..267685)
                     /locus_tag="Cpha266_0237"
                     /note="Elongation factor P (EF-P) KOW-like domain; Region:
                     EFP_N; pfam08207"
                     /db_xref="CDD:203876"
     misc_feature    complement(267338..267496)
                     /locus_tag="Cpha266_0237"
                     /note="S1_EF-P_repeat_1: Translation elongation factor P
                     (EF-P), S1-like RNA-binding domain, repeat 1. EF-P
                     stimulates the peptidyltransferase activity in the
                     prokaryotic 70S ribosome. EF-P enhances the synthesis of
                     certain dipeptides with...; Region: S1_EF-P_repeat_1;
                     cd04470"
                     /db_xref="CDD:239916"
     misc_feature    complement(order(267350..267352,267425..267427))
                     /locus_tag="Cpha266_0237"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:239916"
     misc_feature    complement(267137..>267268)
                     /locus_tag="Cpha266_0237"
                     /note="S1_EF-P_repeat_2: Translation elongation factor P
                     (EF-P), S1-like RNA-binding domain, repeat 1. EF-P
                     stimulates the peptidyltransferase activity in the
                     prokaryotic 70S ribosome. EF-P enhances the synthesis of
                     certain dipeptides with...; Region: S1_EF-P_repeat_2;
                     cd05794"
                     /db_xref="CDD:240220"
     misc_feature    complement(order(267146..267151,267164..267166,
                     267215..267217))
                     /locus_tag="Cpha266_0237"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:240220"
     gene            267907..268182
                     /locus_tag="Cpha266_0238"
                     /db_xref="GeneID:4570805"
     CDS             267907..268182
                     /locus_tag="Cpha266_0238"
                     /note="PFAM: histone family protein DNA-binding protein;
                     KEGG: cte:CT0160 DNA-binding protein HU-beta"
                     /codon_start=1
                     /transl_table=11
                     /product="histone family protein DNA-binding protein"
                     /protein_id="YP_910729.1"
                     /db_xref="GI:119356085"
                     /db_xref="InterPro:IPR000119"
                     /db_xref="GeneID:4570805"
                     /translation="MSKAELVEKIASQAGLTKVDAERAVNAFMNVVTESLKEGEDVTL
                     VGFGTFTTGERAERQGRNPQNGETITIAAKKVVKFKPGKALKAGVEG"
     misc_feature    267910..268167
                     /locus_tag="Cpha266_0238"
                     /note="Integration host factor (IHF) and HU are small
                     heterodimeric members of the DNABII protein family that
                     bind and bend DNA, functioning as architectural factors in
                     many cellular processes including transcription,
                     site-specific recombination, and...; Region: HU_IHF;
                     cd00591"
                     /db_xref="CDD:238332"
     misc_feature    order(267910..267918,267982..267984,268027..268029,
                     268033..268035,268039..268044,268051..268053,
                     268063..268065,268069..268074,268078..268080,
                     268087..268098,268126..268128,268138..268140,
                     268144..268146,268153..268155)
                     /locus_tag="Cpha266_0238"
                     /note="IHF - DNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238332"
     misc_feature    order(267910..267915,267922..267924,267931..267933,
                     267943..267945,267985..267987,267994..267999,
                     268006..268011,268021..268035,268042..268047,
                     268060..268062,268126..268131,268141..268143,
                     268147..268149)
                     /locus_tag="Cpha266_0238"
                     /note="IHF dimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238332"
     gene            268272..269273
                     /locus_tag="Cpha266_0239"
                     /db_xref="GeneID:4570806"
     CDS             268272..269273
                     /locus_tag="Cpha266_0239"
                     /note="catalyzes the carboxylation of acetyl-CoA to
                     malonyl-CoA; forms a tetramer composed of two alpha (AccA)
                     and two beta (AccD) subunits; one of the two catalytic
                     subunits that can form the acetyl CoA carboxylase enzyme
                     together with a carrier protein"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA carboxylase carboxyltransferase
                     subunit alpha"
                     /protein_id="YP_910730.1"
                     /db_xref="GI:119356086"
                     /db_xref="InterPro:IPR001095"
                     /db_xref="InterPro:IPR011763"
                     /db_xref="GeneID:4570806"
                     /translation="MANRVVLDFEKPLFELEAKLEEMRVYLRNSSRDQDSSDQDVLNR
                     EIEALEVKVETLRRSIYKNLTRWQKVQLARHAERPFTLDYIYMMTRDFVEMAGDRYFS
                     DDKAIVGGFAILEDIPSGFSQPVMIIGHQKGRDTKSNLYRNFGMAQPEGYRKALRLMK
                     LAEKFNKPVITLIDTPGAFPGIEAEERGQAEAIARNLFEMARLTVPVICVIVGEGASG
                     GAIGLGVGNRILMAENSWYSVISPESCSSILWRSWNYKEQAAEALQPTAEDLLAQGII
                     DRIIPEPMGGAHTDPEAMAGTLKEMLIEELRILMSKESDVLVRERVEKFSGMGVWDE"
     misc_feature    268272..269270
                     /locus_tag="Cpha266_0239"
                     /note="acetyl-CoA carboxylase carboxyltransferase alpha
                     subunit; Provisional; Region: accA; CHL00198"
                     /db_xref="CDD:214393"
     misc_feature    268275..269270
                     /locus_tag="Cpha266_0239"
                     /note="acetyl-CoA carboxylase carboxyltransferase subunit
                     alpha; Validated; Region: PRK05724"
                     /db_xref="CDD:235580"
     gene            complement(269383..270411)
                     /locus_tag="Cpha266_0240"
                     /db_xref="GeneID:4570807"
     CDS             complement(269383..270411)
                     /locus_tag="Cpha266_0240"
                     /note="catalyzes the coenzyme A dependent formation of
                     succinyl-CoA from 2-oxoglutarate and ferredoxin"
                     /codon_start=1
                     /transl_table=11
                     /product="2-oxoglutarate ferredoxin oxidoreductase subunit
                     beta"
                     /protein_id="YP_910731.1"
                     /db_xref="GI:119356087"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="GeneID:4570807"
                     /translation="MTDTRAQLTAKDFTSNQEPKWCPGCGDFAVLQQLKNAMADLGLK
                     TEEVVVVSGIGCSSRLPYYIATYGVHGIHGRALAMASGLKTARPELSVWVGTGDGDAL
                     SIGGNHYIHTVRRNLDLNVILFNNEIYGLTKGQYSPTSKVGLRTVTSPNGVVDHPINT
                     AALTLGAGGTFFARVMDRDGKIMRDIFKRAAEHKGTSLIEIYQNCPIFNDGAFDPFTD
                     KDRKADTTLYLEQGKPLVFGKQNDKGIRLDGFTPVIVDLNNPSVSQNDLWIHDEKDFI
                     KANMLARFFDDPDASEDFLPRPFGIFYVEDRYTYESALSAQIEKAQENGEGTIEELLA
                     GSNTWTIA"
     misc_feature    complement(269389..270405)
                     /locus_tag="Cpha266_0240"
                     /note="2-oxoglutarate ferredoxin oxidoreductase subunit
                     beta; Reviewed; Region: PRK11867"
                     /db_xref="CDD:237006"
     misc_feature    complement(269788..270351)
                     /locus_tag="Cpha266_0240"
                     /note="Thiamine pyrophosphate (TPP family), 2-oxoglutarate
                     ferredoxin oxidoreductase (OGFOR) subfamily, TPP-binding
                     module; OGFOR catalyzes the oxidative decarboxylation of
                     2-oxo-acids, with ferredoxin acting as an electron
                     acceptor. In the TCA cycle, OGFOR...; Region: TPP_OGFOR;
                     cd03375"
                     /db_xref="CDD:239470"
     misc_feature    complement(order(270028..270030,270034..270036,
                     270112..270123,270193..270195))
                     /locus_tag="Cpha266_0240"
                     /note="TPP-binding site [chemical binding]; other site"
                     /db_xref="CDD:239470"
     gene            complement(270415..272298)
                     /locus_tag="Cpha266_0241"
                     /db_xref="GeneID:4570808"
     CDS             complement(270415..272298)
                     /locus_tag="Cpha266_0241"
                     /note="PFAM: pyruvate ferredoxin/flavodoxin
                     oxidoreductase; pyruvate flavodoxin/ferredoxin
                     oxidoreductase domain protein;
                     KEGG: cte:CT0163 2-oxoglutarate ferredoxin oxidoreductase,
                     alpha subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate flavodoxin/ferredoxin oxidoreductase
                     domain-containing protein"
                     /protein_id="YP_910732.1"
                     /db_xref="GI:119356088"
                     /db_xref="InterPro:IPR002869"
                     /db_xref="InterPro:IPR002880"
                     /db_xref="GeneID:4570808"
                     /translation="MSETTILNREDMVTAKTSVSVLFAGDSGDGMQLTGTQFANTVAV
                     YGSDLNTFPNFPSEIRPPAGTVAGVSGFQLQFGTSSVYTPGAKFDVMIVMNAAALKAN
                     LNNLHHGGIIITDTDGFDAKNLKLSGYGEENNPLRDGTLNDYTVFEIPVVSLTRKALA
                     ETGLSTKNIDRCKNMFVLGVLYWLYSLPLETTIETLKTKFAKKLDLAEANIKAVTAGY
                     NFGDETEMFSQHGRFSVAPADKKPGVYRRVTGNEASAIGLAVAAKKAGLELFLGSYPI
                     TPATEILQTLAGLKKWGVKTFQAEDEIAGVLSSIGAAYGGALAATNTSGPGLALKSEG
                     LGLAVILEIPLVIINVMRGGPSTGLPTKPEQSDLLMAMYGRHGDAPMPVIAAKSPVDC
                     FYAAYEAAKIAVEYMTPVLCLTDGYLALSSEPMLVPSPDDLASITPVFSPARNADDPP
                     YLPYKRDDRAVRPWAKPGTPGLEHRIGGLEKQNETGNVSHDPENHELMTKLRAEKVAR
                     VADIIPDLTIDNGPESGDILVLGWGSTYGAIKKAVEQVLEGGCSVAHAHLRYINPFPK
                     NLGEVMGHYKKVLIPENNCGQLLSMIRDKFLIEPVGFSKVQGLPFNEMEIEAKITDIL
                     KEL"
     misc_feature    complement(270439..272247)
                     /locus_tag="Cpha266_0241"
                     /note="2-oxoacid:acceptor oxidoreductase, alpha subunit;
                     Region: OAFO_sf; TIGR03710"
                     /db_xref="CDD:234323"
     misc_feature    complement(271624..272244)
                     /locus_tag="Cpha266_0241"
                     /note="Pyruvate:ferredoxin oxidoreductase and related
                     2-oxoacid:ferredoxin oxidoreductases, gamma subunit
                     [Energy production and conversion]; Region: PorG; COG1014"
                     /db_xref="CDD:223946"
     misc_feature    complement(271051..271551)
                     /locus_tag="Cpha266_0241"
                     /note="Pyrimidine (PYR) binding domain of pyruvate
                     ferredoxin oxidoreductase (PFOR), indolepyruvate
                     ferredoxin oxidoreductase alpha subunit (IOR-alpha), and
                     related proteins; Region: TPP_PYR_PFOR_IOR-alpha_like;
                     cd07034"
                     /db_xref="CDD:132917"
     misc_feature    complement(order(271180..271185,271234..271239,
                     271276..271278,271288..271290,271297..271299,
                     271348..271350,271354..271356,271363..271371,
                     271375..271380,271399..271410,271447..271449,
                     271456..271458,271468..271470,271486..271491))
                     /locus_tag="Cpha266_0241"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132917"
     misc_feature    complement(order(271288..271290,271297..271299,
                     271348..271350,271354..271356,271363..271371,
                     271375..271380,271399..271410,271447..271452,
                     271468..271470,271474..271479,271486..271491))
                     /locus_tag="Cpha266_0241"
                     /note="PYR/PP interface [polypeptide binding]; other site"
                     /db_xref="CDD:132917"
     misc_feature    complement(order(271393..271395,271474..271476))
                     /locus_tag="Cpha266_0241"
                     /note="TPP binding site [chemical binding]; other site"
                     /db_xref="CDD:132917"
     misc_feature    complement(order(271243..271245,271468..271470))
                     /locus_tag="Cpha266_0241"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:132917"
     gene            complement(272505..272774)
                     /locus_tag="Cpha266_0242"
                     /db_xref="GeneID:4570809"
     CDS             complement(272505..272774)
                     /locus_tag="Cpha266_0242"
                     /note="KEGG: plt:Plut_1953 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910733.1"
                     /db_xref="GI:119356089"
                     /db_xref="GeneID:4570809"
                     /translation="MSWGVEDEKRRKGVLELMELSSRIVKENPNHVNEVAKSTTGCWM
                     EQMYGMQRCDFCDLASDCPVREETEWQEYLRVNNIVIVKDNDNIT"
     gene            273033..275699
                     /gene="alaS"
                     /locus_tag="Cpha266_0243"
                     /db_xref="GeneID:4570810"
     CDS             273033..275699
                     /gene="alaS"
                     /locus_tag="Cpha266_0243"
                     /EC_number="6.1.1.7"
                     /note="Catalyzes a two-step reaction, first charging an
                     alanyl molecule by linking its carboxyl group to the
                     alpha-phosphate of ATP, followed by transfer of the
                     aminoacyl-adenylate to its tRNA"
                     /codon_start=1
                     /transl_table=11
                     /product="alanyl-tRNA synthetase"
                     /protein_id="YP_910734.1"
                     /db_xref="GI:119356090"
                     /db_xref="InterPro:IPR002318"
                     /db_xref="InterPro:IPR003156"
                     /db_xref="InterPro:IPR012947"
                     /db_xref="GeneID:4570810"
                     /translation="MNSREIRQSFLDFFDRKGHTIVRSAPVIPLDDPTLLFTNAGMNQ
                     FKDVFLDKGTRPYVRAADTQKCIRASGKHNDLEDVGRDTYHHTFFEMLGNWSFGDYYK
                     KEAISWAWELLTSVWHLPKERLYATVYYDDEESYLLWQEETDIPHDHIIKFDEKDNFW
                     EMGETGPCGPCSEIHIDLTEDGSGKPLVNAGDYRVIELWNLVFIQYNRQADGRLEPLP
                     QKHVDTGMGFERVCAVMQGKASNYDTDVFRPLFDRITEITGVSYNASLDDPSDIAMRV
                     LADHARTLTFALTDGAMPSNEGRGYVLRRILRRALRYSKTLGCSEPLLYRLVETLAAS
                     MGDVFPELRKQQQAVSRIIRAEEESFLATLDRGIEIFNELIAAVRSRGTTVVSGDDAF
                     RLYDTFGFPLDLTRLMAAEAGFEVDEEGFDRCMKEQKTRARQDRRDKQHLKGDEGEWT
                     WFSAERTSVFTGYHSLEELASITGVSIFSDRLLVVLDRTPFYAESGGQCGDRGWIETA
                     AYRLRVSDTRKDGDMIVHLVTEVRDSVSDGAISPADLSFDEGKLACRASVDRSDRQGT
                     ERNHTATHLLHAALRRTLGQHVQQKGSFVSSERLRFDFSHFARLTSEELAIVESEVNE
                     QIRSAEPVVKHQDIPYDEAIARGALAFFGDKYADRVRVVEIAGLSVELCGGTHVDSIG
                     QIGLFKIVSESSVASGVRRIEALTGKAAEVLLWKEYRELQDIRQMLKLKADEEVIGRI
                     AELADSKKELEKQLQVYRTEALSGILQRSLDAAESVGSIRFMTLRLEHVDQDSLRQAV
                     LALREKDPASTGLLCTEEDGKVSLTAFAGERAVGEFGLDAGKLVREAAAFVRGGGGGK
                     PEFATAGGKDPEGIQKAFDSFAASVREKVSAK"
     misc_feature    273033..275687
                     /gene="alaS"
                     /locus_tag="Cpha266_0243"
                     /note="alanyl-tRNA synthetase; Reviewed; Region: alaS;
                     PRK00252"
                     /db_xref="CDD:234701"
     misc_feature    273045..273746
                     /gene="alaS"
                     /locus_tag="Cpha266_0243"
                     /note="Alanyl-tRNA synthetase (AlaRS) class II core
                     catalytic domain. AlaRS is a homodimer. It is responsible
                     for the attachment of alanine to the 3' OH group of ribose
                     of the appropriate tRNA. This domain is primarily
                     responsible for ATP-dependent...; Region: AlaRS_core;
                     cd00673"
                     /db_xref="CDD:238360"
     misc_feature    273093..273107
                     /gene="alaS"
                     /locus_tag="Cpha266_0243"
                     /note="motif 1; other site"
                     /db_xref="CDD:238360"
     misc_feature    order(273174..273176,273180..273182,273234..273236,
                     273297..273299,273303..273305,273309..273317,
                     273621..273626,273636..273638,273693..273698,
                     273708..273713,273720..273722)
                     /gene="alaS"
                     /locus_tag="Cpha266_0243"
                     /note="active site"
                     /db_xref="CDD:238360"
     misc_feature    273231..273239
                     /gene="alaS"
                     /locus_tag="Cpha266_0243"
                     /note="motif 2; other site"
                     /db_xref="CDD:238360"
     misc_feature    273705..273722
                     /gene="alaS"
                     /locus_tag="Cpha266_0243"
                     /note="motif 3; other site"
                     /db_xref="CDD:238360"
     misc_feature    275010..275141
                     /gene="alaS"
                     /locus_tag="Cpha266_0243"
                     /note="Threonyl and Alanyl tRNA synthetase second
                     additional domain; Region: tRNA_SAD; pfam07973"
                     /db_xref="CDD:219676"
     misc_feature    275463..275651
                     /gene="alaS"
                     /locus_tag="Cpha266_0243"
                     /note="DHHA1 domain; Region: DHHA1; pfam02272"
                     /db_xref="CDD:216955"
     gene            275723..277081
                     /locus_tag="Cpha266_0244"
                     /db_xref="GeneID:4568950"
     CDS             275723..277081
                     /locus_tag="Cpha266_0244"
                     /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
                     oxidoreductase; pyridine nucleotide-disulphide
                     oxidoreductase dimerisation region;
                     KEGG: plt:Plut_1951 NADH oxidase, putative"
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent pyridine nucleotide-disulfide
                     oxidoreductase"
                     /protein_id="YP_910735.1"
                     /db_xref="GI:119356091"
                     /db_xref="InterPro:IPR000103"
                     /db_xref="InterPro:IPR001100"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR004099"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="GeneID:4568950"
                     /translation="MKKNVDVLVIGGSAAGIVAASTGKAFYPLKNFLIVRREREAVVP
                     CGIPYIYGTLESINQNIIPNAHIEQAGVELFIDEVVAVDRGAKVATTADGTQITFDKL
                     VFATGSMPKVPAWLKGTGLGNVFTIPKDRDYLENLRMTLEQCTNIVIIGGGFIGVEIA
                     DELRKKGKRITLIEVMPHVLSAAFDDDLSVKVEKILTDNGVMLRTGEKVRELSGEGSV
                     SGVVLENGEILAADAVILATGYAPNVDLARNAGIKINELGAIRVDEYMRTEDKDIFAV
                     GDCAEKFSFITRIVKGLMLAATACSEARIAGMNLYGLSRLRTFSGTISIFSTAIGGTT
                     FAAAGVTEHLALDRGFDVISASAEGIDKHPKSLPGTSSQFVKLIVNRDSGLVLGGAVV
                     GGVSAGELINVIGVIIENKMTIHEVLTLQVGTHPLLTGPPTGYPLIKAAEAVVKKLRS
                     SR"
     sig_peptide     275723..275785
                     /locus_tag="Cpha266_0244"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 0.870) with cleavage site probability 0.605 at
                     residue 21"
     misc_feature    275855..276970
                     /locus_tag="Cpha266_0244"
                     /note="coenzyme A disulfide reductase; Reviewed; Region:
                     PRK09564"
                     /db_xref="CDD:181958"
     misc_feature    276194..276403
                     /locus_tag="Cpha266_0244"
                     /note="Pyridine nucleotide-disulphide oxidoreductase;
                     Region: Pyr_redox; pfam00070"
                     /db_xref="CDD:215691"
     gene            277187..277681
                     /locus_tag="Cpha266_0245"
                     /db_xref="GeneID:4568951"
     CDS             277187..277681
                     /locus_tag="Cpha266_0245"
                     /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
                     protein;
                     KEGG: plt:Plut_1949 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin"
                     /protein_id="YP_910736.1"
                     /db_xref="GI:119356092"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="GeneID:4568951"
                     /translation="MLVFDCFFGRCEKPSCEGCALKLVRSLRLALKSRAMQKDEEFAV
                     ETACSPEKPAMVALQAKTTSHKQDATKKRKRLLAPREEIPWYPTIKPELCNGCGDCKV
                     LCKPGVFELGAPDPSGIHRPKLVVAHPYKCLVLCTRCVPICTSGAIILPPKEDFERFV
                     EYLD"
     misc_feature    277439..277660
                     /locus_tag="Cpha266_0245"
                     /note="Ferredoxin [Energy production and conversion];
                     Region: COG1146"
                     /db_xref="CDD:224069"
     gene            277733..278035
                     /locus_tag="Cpha266_0246"
                     /db_xref="GeneID:4568952"
     CDS             277733..278035
                     /locus_tag="Cpha266_0246"
                     /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
                     protein;
                     KEGG: cte:CT0168 ferredoxin, 4Fe-4S, putative"
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin"
                     /protein_id="YP_910737.1"
                     /db_xref="GI:119356093"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="GeneID:4568952"
                     /translation="MSGLPSPSKKKKRLLAPREEIAWFPVIDTAACNGCGDCEGFCKP
                     GVFALGEPEGVKRARMTVANPWNCIVLCTRCEPVCPSGAITLPRPEDFERFVEYVD"
     misc_feature    277799..278014
                     /locus_tag="Cpha266_0246"
                     /note="Ferredoxin [Energy production and conversion];
                     Region: COG1146"
                     /db_xref="CDD:224069"
     misc_feature    <277820..>277972
                     /locus_tag="Cpha266_0246"
                     /note="The HCP family of iron-sulfur proteins includes
                     hybrid cluster protein (HCP), acetyl-CoA synthase (ACS),
                     and carbon monoxide dehydrogenase (CODH), all of which
                     contain [Fe4-S4] metal clusters at their active sites.
                     These proteins have a conserved...; Region: HCP_like;
                     cl14655"
                     /db_xref="CDD:246686"
     gene            complement(278091..279047)
                     /locus_tag="Cpha266_0247"
                     /db_xref="GeneID:4568953"
     CDS             complement(278091..279047)
                     /locus_tag="Cpha266_0247"
                     /note="PFAM: HipA domain protein;
                     KEGG: pgi:PG0859 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="HipA domain-containing protein"
                     /protein_id="YP_910738.1"
                     /db_xref="GI:119356094"
                     /db_xref="InterPro:IPR012893"
                     /db_xref="InterPro:IPR012894"
                     /db_xref="GeneID:4568953"
                     /translation="MDRRCLYCYEPLASGEGDFHRKCSRKMFGTPLPPELPYDENQLE
                     ELALEVIRSQTAITGVQPKLSLHLEPAGKAHAPQRFTIVGLWGGYILKPPSQRFRQLP
                     EIEDLTMRMAEAARIDTVPHSLIRMRSGALAYLTRRIDRTGNGKLHMEDMCQITGRLT
                     ENKYHGSYEQIAKAIHRYSANPGLDVINFFEVVLFCFLSGNADMHLKNFSLIDIEAKG
                     GYSLAPAYDLVSTGLVMPSDKEDLALTLDGKKTRITLNDFRAAFGVLTIDEVVQERMF
                     RKFRNVLPLWDLLIEKSFLDYENQAAYKELIRKKCHQIRLDA"
     misc_feature    complement(278625..278879)
                     /locus_tag="Cpha266_0247"
                     /note="HipA-like N-terminal domain; Region: HipA_N;
                     pfam07805"
                     /db_xref="CDD:219588"
     misc_feature    complement(278367..278612)
                     /locus_tag="Cpha266_0247"
                     /note="HipA-like C-terminal domain; Region: HipA_C;
                     pfam07804"
                     /db_xref="CDD:219587"
     gene            complement(279052..279375)
                     /locus_tag="Cpha266_0248"
                     /db_xref="GeneID:4568954"
     CDS             complement(279052..279375)
                     /locus_tag="Cpha266_0248"
                     /note="KEGG: pgi:PG0858 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910739.1"
                     /db_xref="GI:119356095"
                     /db_xref="GeneID:4568954"
                     /translation="MQKAEIRYLDRTAGWFIQDEEGFHFLYDQAYLDSKDARPVSLTL
                     PLRAAAYSSRTMFPFFDGLIPEGWLLAVAERNWKLDPRDRMGLLLNCCRDCIGAVSVH
                     PVIME"
     misc_feature    complement(279073..279369)
                     /locus_tag="Cpha266_0248"
                     /note="HipA N-terminal domain; Region: couple_hipA;
                     TIGR03071"
                     /db_xref="CDD:163125"
     gene            complement(279379..279585)
                     /locus_tag="Cpha266_0249"
                     /db_xref="GeneID:4568955"
     CDS             complement(279379..279585)
                     /locus_tag="Cpha266_0249"
                     /note="PFAM: helix-turn-helix domain protein;
                     KEGG: pgi:PG0857 transcriptional regulator, putative"
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="YP_910740.1"
                     /db_xref="GI:119356096"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="GeneID:4568955"
                     /translation="MKDIAEFVRDRRKALGMTQPELAEKAGTGLRFIRDLEQGKKTLR
                     MDKVNQVLALFGFVLAPVSPEREA"
     misc_feature    complement(279418..279573)
                     /locus_tag="Cpha266_0249"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(279472..279474,279547..279549,
                     279559..279561))
                     /locus_tag="Cpha266_0249"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(279475..279477,279550..279552))
                     /locus_tag="Cpha266_0249"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(279469..279474,279484..279486,
                     279493..279495,279526..279531))
                     /locus_tag="Cpha266_0249"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            complement(279920..281137)
                     /locus_tag="Cpha266_0250"
                     /db_xref="GeneID:4568956"
     CDS             complement(279920..281137)
                     /locus_tag="Cpha266_0250"
                     /EC_number="3.1.3.3"
                     /note="KEGG: cte:CT0173 phosphoserine phosphatase;
                     TIGRFAM: phosphoserine phosphatase SerB; HAD-superfamily
                     hydrolase, subfamily IB (PSPase-like);
                     PFAM: amino acid-binding ACT domain protein; Haloacid
                     dehalogenase domain protein hydrolase; Haloacid
                     dehalogenase domain protein hydrolase, type 3"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoserine phosphatase"
                     /protein_id="YP_910741.1"
                     /db_xref="GI:119356097"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="InterPro:IPR004469"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="InterPro:IPR006383"
                     /db_xref="InterPro:IPR013200"
                     /db_xref="GeneID:4568956"
                     /translation="MSELLLINLTGLDKPGLTSKITAILADARVPVLDIGQAVIHNHL
                     SLGMLVEVPKESASSPVLKDLLFCAHTLGIQISFTPVADEEYDRWVGEQGKPRYLLSL
                     LSRKISAEQLKRVSSIVAEHDLNIDTISRLSGRIPLDNGDNHTRACVEFSLRGTLSDE
                     NLFREQLLAITDSLGIDIAFQEDNIFRRNRRMVVFDMDSTLITSEVIDELALEAGVGE
                     EVSAITEQAMRGELDFNESLQRRVAQLKGLDEHVMESIAARLQLTEGAERLFGNLKRL
                     GYKTAILSGGFTYFGHYLQKKLSIDYVYANTLEIENGCLTGRVLGRVVDGARKAELLE
                     LLAEKENISLEQTVAVGDGANDLPMLGKAGLGIAFRAKPIVRERAKQAISTLGLDAIL
                     YLMGFRDRDELSE"
     misc_feature    complement(280898..281122)
                     /locus_tag="Cpha266_0250"
                     /note="CT domains found N-terminal of phosphoserine
                     phosphatase (PSP, SerB); Region: ACT_PSP_1; cd04870"
                     /db_xref="CDD:153142"
     misc_feature    complement(280592..280843)
                     /locus_tag="Cpha266_0250"
                     /note="ACT domains found N-terminal of phosphoserine
                     phosphatase (PSP, SerB); Region: ACT_PSP_2; cd04871"
                     /db_xref="CDD:153143"
     misc_feature    complement(279953..280609)
                     /locus_tag="Cpha266_0250"
                     /note="phosphoserine phosphatase SerB; Region: serB;
                     TIGR00338"
                     /db_xref="CDD:232927"
     misc_feature    complement(<280523..>280561)
                     /locus_tag="Cpha266_0250"
                     /note="Acid Phosphatase; Region: Acid_PPase; cl17256"
                     /db_xref="CDD:247810"
     misc_feature    complement(280031..280396)
                     /locus_tag="Cpha266_0250"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    complement(280286..280288)
                     /locus_tag="Cpha266_0250"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     gene            281769..282989
                     /locus_tag="Cpha266_0251"
                     /pseudo
                     /db_xref="GeneID:4568957"
     gene            complement(283296..283586)
                     /locus_tag="Cpha266_0252"
                     /db_xref="GeneID:4568958"
     CDS             complement(283296..283586)
                     /locus_tag="Cpha266_0252"
                     /note="KEGG: mhu:Mhun_0714 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910742.1"
                     /db_xref="GI:119356098"
                     /db_xref="GeneID:4568958"
                     /translation="MIFSFHPEAKEEFDKAIEYYENIAPGLGYDFALEVHSAIKRSIE
                     HPNAWAVLYEDVRRSLVRRFPYGVLYSKEPAEIFILAVMNLHRNPGYWKKRK"
     misc_feature    complement(283326..283574)
                     /locus_tag="Cpha266_0252"
                     /note="Plasmid stabilisation system protein; Region:
                     Plasmid_stabil; cl17483"
                     /db_xref="CDD:248037"
     gene            complement(283583..283807)
                     /locus_tag="Cpha266_0253"
                     /db_xref="GeneID:4568959"
     CDS             complement(283583..283807)
                     /locus_tag="Cpha266_0253"
                     /note="TIGRFAM: putative addiction module component,
                     TIGR02574 family;
                     KEGG: swo:Swol_1551 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="addiction module proein"
                     /protein_id="YP_910743.1"
                     /db_xref="GI:119356099"
                     /db_xref="InterPro:IPR013406"
                     /db_xref="GeneID:4568959"
                     /translation="MNTKQLIDKAVSLPVEERALVVDSLLRSLNQPESEIDKKWSQEA
                     KRRLAELRSGQVQAIPGDEVFAEVWKKFES"
     misc_feature    complement(283613..283774)
                     /locus_tag="Cpha266_0253"
                     /note="Putative addiction module component; Region:
                     Unstab_antitox; pfam09720"
                     /db_xref="CDD:220360"
     gene            complement(283850..285070)
                     /locus_tag="Cpha266_0254"
                     /db_xref="GeneID:4568960"
     CDS             complement(283850..285070)
                     /locus_tag="Cpha266_0254"
                     /note="PFAM: transposase, IS204/IS1001/IS1096/IS1165
                     family protein;
                     KEGG: cch:Cag_1580 transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase, IS204/IS1001/IS1096/IS1165 family
                     protein"
                     /protein_id="YP_910744.1"
                     /db_xref="GI:119356100"
                     /db_xref="InterPro:IPR002560"
                     /db_xref="GeneID:4568960"
                     /translation="MNDLTLFQMALGLESPWYVSSSSFDVDQKRLDIRIDFKPGSTFC
                     CPQCGREGVKAYDTSEATWRHLNFFQHEAYLTVRVPRISCPECGILKLQSFPWSRRES
                     GFTLLFEAMIMIMAKSMPVKAIAAIVGEHDTRIWRIINHYVEKAREQEDHSAVTMVGV
                     DETSSKRGHNYVSLFVDLAVSKVLFATEGKDAATVKRFSEDLAAHKGDPALITEFCSD
                     MSPAFIKGVADNFTNAQLTFDKFHIMQVINNAVDEVRRQEQKERPELQRSRYIWLKNQ
                     NNLKASQRKRLDELSLPRLNLKTTRAYRMRLTFQEFFEQPQVLVEAFLKKWYFWATHS
                     QLQPMKEAAYTIKRHWSGILRWFTSRINNGVLEGINSLIQAAKARARGYRTTKNLINM
                     IYLISGKLNFGLPT"
     misc_feature    complement(283886..285064)
                     /locus_tag="Cpha266_0254"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3464"
                     /db_xref="CDD:225995"
     misc_feature    complement(283892..284599)
                     /locus_tag="Cpha266_0254"
                     /note="Transposase; Region: DDE_Tnp_ISL3; pfam01610"
                     /db_xref="CDD:216603"
     gene            285748..286614
                     /locus_tag="Cpha266_0255"
                     /db_xref="GeneID:4568961"
     CDS             285748..286614
                     /locus_tag="Cpha266_0255"
                     /note="PFAM: protein of unknown function DUF1568;
                     KEGG: pca:Pcar_1084 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910745.1"
                     /db_xref="GI:119356101"
                     /db_xref="InterPro:IPR011462"
                     /db_xref="GeneID:4568961"
                     /translation="MGSVVLKTETNIYAWALMTNHAHILLKSGQPGLSAFMRKFLIGY
                     SISYNRRHDRHGHLFQNRYKSIVCEEDACFLKLVSYIHLNPLWAGLVRSFEELEHYPW
                     SGHAAVMGRKAYDWQDSDYVLGYFGKRVGSARTAYLECMQQEGKLSRQPELTGGGLIR
                     SAGGWSEVLSMKRRGERQFSDDRILGSGDFAQEVIAEADASVREKVSLAKRRSEVIEM
                     IERCCARHGVSRQSLESGCRRKEFSEIRKELAMMLVFETGLSYAETAPLLGVSASAVC
                     QIIKTGTDSCRM"
     misc_feature    <285781..286023
                     /locus_tag="Cpha266_0255"
                     /note="Transposase IS200 like; Region: Y1_Tnp; cl00848"
                     /db_xref="CDD:242138"
     gene            complement(286831..286971)
                     /locus_tag="Cpha266_0256"
                     /pseudo
                     /db_xref="GeneID:4568962"
     gene            287225..288241
                     /locus_tag="Cpha266_0257"
                     /db_xref="GeneID:4568963"
     CDS             287225..288241
                     /locus_tag="Cpha266_0257"
                     /note="TIGRFAM: integron integrase;
                     PFAM: phage integrase family protein;
                     KEGG: dar:Daro_3427 integron integrase"
                     /codon_start=1
                     /transl_table=11
                     /product="integron integrase"
                     /protein_id="YP_910746.1"
                     /db_xref="GI:119356102"
                     /db_xref="InterPro:IPR002104"
                     /db_xref="InterPro:IPR011946"
                     /db_xref="GeneID:4568963"
                     /translation="MVADSQTVLQSTVNSQSLQHGPKLLELFREAMRVRHYSRRTEET
                     YCSWVKRYVHFHNMRHPKEMREPEINAFLTHLAVEEKVSASTQNQALSALLFLYRHVI
                     GKEIGDLGHLIRARKPSHLPVVLTRDEVKALLVQLAGVKWLMASLMYGAGLRLMECLR
                     LRVQDIDFSSNEILVRDGKGAKDRITMLPESLKKPLADHLKQIKSLHDKDLAEGWGRV
                     LLPGALDRKYPNAPAEWRWQWVFPQEHRWKNAKTGEEGRHHMDESLIQKAVKAAVFHA
                     QLTKRATCHTFRHSFATHLLEGGYDIRTVQELLGHNDVRTTMIYTHVLNRGPSGVRSP
                     VDCL"
     misc_feature    287294..288238
                     /locus_tag="Cpha266_0257"
                     /note="integron integrase; Region: integrase_gron;
                     TIGR02249"
                     /db_xref="CDD:131303"
     misc_feature    287387..288193
                     /locus_tag="Cpha266_0257"
                     /note="IntI (E2) integrases, site-specific tyrosine
                     recombinases, DNA breaking-rejoining enzymes, N- and
                     C-terminal domains. This CD includes integrases which are
                     components of multiresistant integrons and mediate
                     recombination between a proximal attI site and...; Region:
                     INT_IntI; cd01193"
                     /db_xref="CDD:238598"
     misc_feature    order(287684..287686,287759..287761,288077..288079,
                     288086..288088,288155..288157,288182..288184)
                     /locus_tag="Cpha266_0257"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238598"
     gene            288424..288852
                     /locus_tag="Cpha266_0258"
                     /db_xref="GeneID:4568964"
     CDS             288424..288852
                     /locus_tag="Cpha266_0258"
                     /note="KEGG: pca:Pcar_0806 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910747.1"
                     /db_xref="GI:119356103"
                     /db_xref="GeneID:4568964"
                     /translation="MNNELRTKLIATALEWQDRYGVAPQITTPLSEYDAAMLVGMPEH
                     EYSAYMQDITAVNKGSDFIYRNVRYQVKGNRPSGKPGSKVTMVPKATNYEWDKLIWVL
                     YDKFYVIQEAWLWDVAEYKQKFHNIKRLSPSHYREGVQLA"
     gene            289090..289329
                     /locus_tag="Cpha266_0259"
                     /db_xref="GeneID:4568965"
     CDS             289090..289329
                     /locus_tag="Cpha266_0259"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910748.1"
                     /db_xref="GI:119356104"
                     /db_xref="GeneID:4568965"
                     /translation="MVKLDYADYKFTVKEGSPSVSGADDAPVSLCCEPRTSELSIVGS
                     GHLSIHLKKGISCDDAQEIAKNLEQWIEKISYVKG"
     gene            289482..289934
                     /locus_tag="Cpha266_0260"
                     /db_xref="GeneID:4568966"
     CDS             289482..289934
                     /locus_tag="Cpha266_0260"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910749.1"
                     /db_xref="GI:119356105"
                     /db_xref="InterPro:IPR000437"
                     /db_xref="GeneID:4568966"
                     /translation="MKSSLIRFAIILFVFLSGCGTKEEPTAQEIAEAQLKETPAYKDY
                     SADANTAFLIEVKERLKAPSGADFPWDDLPKEVTTKGVKLSDMSPYLRKVIKEARKLK
                     KENAVRVYQKDSYVDADNSFGAKIRQRYLGTFIIYTEFGYTKSFVEFY"
     sig_peptide     289482..289550
                     /locus_tag="Cpha266_0260"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 0.786) with cleavage site probability 0.671 at
                     residue 23"
     gene            289980..290132
                     /locus_tag="Cpha266_0261"
                     /pseudo
                     /db_xref="GeneID:4568967"
     gene            complement(290524..291930)
                     /locus_tag="Cpha266_0262"
                     /db_xref="GeneID:4568968"
     CDS             complement(290524..291930)
                     /locus_tag="Cpha266_0262"
                     /note="PFAM: transposase, IS4 family protein;
                     KEGG: mes:Meso_4308 transposase, IS4"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase, IS4 family protein"
                     /protein_id="YP_910750.1"
                     /db_xref="GI:119356106"
                     /db_xref="InterPro:IPR002559"
                     /db_xref="GeneID:4568968"
                     /translation="MQLPYTNIHTDQPNQQALFPDCFEVSVAPVKGKKVVLDFQGGNA
                     TSDAGVLLLKEVESMTRIVPKLADCIADSRRTSSVMHSIPDLIAQRVYQIACGYEDGN
                     DSNSMRKDPALKMALNRLPESGDDLASQPTFSRLENMVTRPELYRMAVGFLDHFLDSY
                     TEAPRVIVLDFDDTEDVVHGKQQLALFNGYHQETCYQPLHVFEGLTGKLIASILRPGR
                     RPTGKEIVSYVKRIVRHIRSRWPETIIVYRGDSHYGVPEVYSFLAREQNCYSVTGLGG
                     NDVLLRSVKDIIEEVKKHGAGYRRYHTFQYQARSWKETRRVVAKVEMTEKGLNVRFIS
                     TDMQEAKAKTLYEQIYSARGNDELYIKAHKTFMKSDRTSCHRFLANQFRVFLHSAAYV
                     LVHAFQTNLLRGTALATATFETIRLKLLKIGAKVIEMKTRIKVHLPTSYPYKPILNKC
                     FAVLEHLRSVPWPSTAIP"
     misc_feature    complement(290548..291852)
                     /locus_tag="Cpha266_0262"
                     /note="Transposase DDE domain group 1; Region:
                     DDE_Tnp_1_4; pfam13701"
                     /db_xref="CDD:222326"
     gene            292108..292848
                     /locus_tag="Cpha266_0263"
                     /db_xref="GeneID:4568969"
     CDS             292108..292848
                     /locus_tag="Cpha266_0263"
                     /note="KEGG: pol:Bpro_3899 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910751.1"
                     /db_xref="GI:119356107"
                     /db_xref="GeneID:4568969"
                     /translation="MIIQDYSEHIENFENYLKSKLASIDEISGDNNVLFKKILYVSFL
                     DSLSSCVYPGRGNKERFVSMLERFSKWEDRDRVSLPHLGKFVQIISDPLLEQARKYVT
                     PKLKTWQERSCYVISISEDPIIDEILDKSWKTNKETGIHVSLTDFKHISLLYQLRNAL
                     VHQFQSRGDEMGNLRQLDHPYYQRVQIFNGTLEDMKPVRFELVYPTQFLKSLSEKTLE
                     NVVDYLKDGNINPFPHYYAGDYWITELN"
     gene            292938..293210
                     /locus_tag="Cpha266_0264"
                     /db_xref="GeneID:4568590"
     CDS             292938..293210
                     /locus_tag="Cpha266_0264"
                     /note="KEGG: gme:Gmet_2499 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910752.1"
                     /db_xref="GI:119356108"
                     /db_xref="GeneID:4568590"
                     /translation="MPTISMFYGILIRMFFRDAEKHHVPHIHADYQGNVAVYSIPEGT
                     LLAGLLPPNKHKLVVAWIEIHHEDLLADWNLAVNGKKPFPIKGLDQ"
     misc_feature    292962..293159
                     /locus_tag="Cpha266_0264"
                     /note="Domain of unknown function (DUF4160); Region:
                     DUF4160; pfam13711"
                     /db_xref="CDD:222335"
     gene            293207..293464
                     /locus_tag="Cpha266_0265"
                     /db_xref="GeneID:4568591"
     CDS             293207..293464
                     /locus_tag="Cpha266_0265"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910753.1"
                     /db_xref="GI:119356109"
                     /db_xref="GeneID:4568591"
                     /translation="MRIAELHPQPDWVLSIVSEDGRVGRFDVTPYLEYEAFEELRDHG
                     EFIKVINGGYFVEWECGADLSADTIEAQWKVVGKAEQQNTV"
     misc_feature    293213..293419
                     /locus_tag="Cpha266_0265"
                     /note="Protein of unknown function (DUF2442); Region:
                     DUF2442; pfam10387"
                     /db_xref="CDD:220727"
     gene            293727..294203
                     /locus_tag="Cpha266_0266"
                     /db_xref="GeneID:4568592"
     CDS             293727..294203
                     /locus_tag="Cpha266_0266"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910754.1"
                     /db_xref="GI:119356110"
                     /db_xref="GeneID:4568592"
                     /translation="MSDVYAELFSIKFLVMSVIVGTALSIAANILSHSIIQNRSKFRW
                     KAGLPLYVGTMVYLWFVLELLSSSSTDRPFGIAFSINAIYLVVSCFRASLQVTSFSAV
                     TKTAVYLQVAIFVLTLPFTDAFWGPQSADVEASIAFNGIIIAALMFMTKGYREGGV"
     misc_feature    293838..>293954
                     /locus_tag="Cpha266_0266"
                     /note="Glucuronate isomerase; Region: UxaC; cl00829"
                     /db_xref="CDD:242126"
     gene            294586..295170
                     /locus_tag="Cpha266_0267"
                     /db_xref="GeneID:4568593"
     CDS             294586..295170
                     /locus_tag="Cpha266_0267"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910755.1"
                     /db_xref="GI:119356111"
                     /db_xref="GeneID:4568593"
                     /translation="MHGAVYIFENSIAKRVKVGMTINNVADRLCDVNDKWLERKVACQ
                     ICGGRLVNIGGYVPQHVISGNECPGGNALPLEKDLALAVSYLENMKNRLSKLSGSEKG
                     SVTRKIKTLEKRIGLYRHYDGPVGMWQFSIAFYTECAEQVELLSHKILTERLDKVAPF
                     GEVFCCSVSEATEAVEAALSQLGLLHSARKNTCL"
     gene            295418..296188
                     /locus_tag="Cpha266_0268"
                     /db_xref="GeneID:4568594"
     CDS             295418..296188
                     /locus_tag="Cpha266_0268"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910756.1"
                     /db_xref="GI:119356112"
                     /db_xref="InterPro:IPR000437"
                     /db_xref="GeneID:4568594"
                     /translation="MRIITRVAILLLIVGIQGCATYGKISGIPSEGQKSVFKDGRKTL
                     ISIKQNTVALAPNTETVTSGQKADFVIAVHNGTSQDILFSTDDVTATANTNGQLTTLK
                     VFSYDELVAEEKNRRAWAAVAVGLQGAAESMNAANAGYSNAFGTYSGSTYSNYGTKTF
                     SSGSYSSTTYNYAAAQAARNVAQANTEARFARLEADGRENLKNLSSTTLKKETIFPAA
                     WHGGLIKVELPEVAEQLQDIKFVVNVVGEQHEFNLNNS"
     gene            complement(296448..297854)
                     /locus_tag="Cpha266_0269"
                     /db_xref="GeneID:4568595"
     CDS             complement(296448..297854)
                     /locus_tag="Cpha266_0269"
                     /note="PFAM: transposase, IS4 family protein;
                     KEGG: mes:Meso_4308 transposase, IS4"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase, IS4 family protein"
                     /protein_id="YP_910757.1"
                     /db_xref="GI:119356113"
                     /db_xref="InterPro:IPR002559"
                     /db_xref="GeneID:4568595"
                     /translation="MQLPYTNIHTDQPNQQALFPDCFEVSVAPVKGKKVVLDFQGGNA
                     TSDAGVLLLKEVESMTRIVPKLADCIADSRRTSSVMHSIPDLIAQRVYQIACGYEDGN
                     DSNSMRKDPALKMALNRLPESGDDLASQPTFSRLENMVTRPELYRMAVGFLDHFLDSY
                     TEAPRVIVLDFDDTEDVVHGKQQLALFNGYHQETCYQPLHVFEGLTGKLIASILRPGR
                     RPTGKEIVSYVKRIVRHIRSRWPETIIVYRGDSHYGVPEVYSFLAREQNCYSVTGLGG
                     NDVLLRSVKDIIEEVKKHGAGYRRYHTFQYQARSWKETRRVVAKVEMTEKGLNVRFIS
                     TDMQEAKAKTLYEQIYSARGNDELYIKAHKTFMKSDRTSCHRFLANQFRVFLHSAAYV
                     LVHAFQTNLLRGTALATATFETIRLKLLKIGAKVIEMKTRIKVHLPTSYPYKPILNKC
                     FAVLEHLRSVPWPSTAIP"
     misc_feature    complement(296472..297776)
                     /locus_tag="Cpha266_0269"
                     /note="Transposase DDE domain group 1; Region:
                     DDE_Tnp_1_4; pfam13701"
                     /db_xref="CDD:222326"
     gene            298718..298981
                     /locus_tag="Cpha266_0270"
                     /db_xref="GeneID:4568596"
     CDS             298718..298981
                     /locus_tag="Cpha266_0270"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910758.1"
                     /db_xref="GI:119356114"
                     /db_xref="GeneID:4568596"
                     /translation="MEPFIAVISHDNRARLLNNNIALQNIKIVLFQEPSKTGAGKITE
                     RQASGAGRISVVCSVVIGWLVLYYFDGSTLFCYTFSKRLLRCV"
     gene            299402..300049
                     /locus_tag="Cpha266_0271"
                     /db_xref="GeneID:4568597"
     CDS             299402..300049
                     /locus_tag="Cpha266_0271"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910759.1"
                     /db_xref="GI:119356115"
                     /db_xref="GeneID:4568597"
                     /translation="MDEKLKLITSSLAVVAAFIGLIVSVISLVRSSENKQSIVVVTQQ
                     VANVEKQVKDVLIKSKEVVIAFNDVGAIKHIIKDIPSTPYPPYHDRSRIRPSSDIPVY
                     SFPTATISFAQGVHFNKYRITFAWQYHADSNYDPATVEFKVKYPADAHTPSRIETVSK
                     SYQEPLKIWQTATVEINVPKGIPPESLQIFVPQSGDFDFMIKDMHVEALFGEYDL"
     sig_peptide     299402..299497
                     /locus_tag="Cpha266_0271"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 0.796) with cleavage site probability 0.411 at
                     residue 32"
     gene            300217..301065
                     /locus_tag="Cpha266_0272"
                     /db_xref="GeneID:4568598"
     CDS             300217..301065
                     /locus_tag="Cpha266_0272"
                     /note="KEGG: bth:BT0082 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910760.1"
                     /db_xref="GI:119356116"
                     /db_xref="GeneID:4568598"
                     /translation="MLRNPVWCYTSGWCSAMFAEGDLAVISIKKLTSMKVKSSKKSRS
                     DLANSLSAHLKSFGEKYEDIVICPTCLGEFSVKADQEKFSAGHILPEVAGGQEWTFIC
                     RSCNSRFGEKQDKWFGEYLHILNIPTGTFLDAKTKNKYISINGEVVRGDISVRDDGSV
                     EVFVPIDRNPPGKVKSIPKGPKLELSFKPVLIDHENEIEIGYITAAYLIWFHEIGYNW
                     VFQSSLDVVRKQILECDRSLNGAKVIDLDFDKSPVEGVGAVLQSDTLYPCCVVVDKLV
                     VIGKQE"
     misc_feature    300415..300597
                     /locus_tag="Cpha266_0272"
                     /note="HNH endonuclease; Region: HNH_5; pfam14279"
                     /db_xref="CDD:222644"
     gene            301160..302731
                     /locus_tag="Cpha266_0273"
                     /db_xref="GeneID:4568599"
     CDS             301160..302731
                     /locus_tag="Cpha266_0273"
                     /note="PFAM: Integrase, catalytic region;
                     KEGG: bfs:BF1534 putative transposase for insertion
                     sequence element IS21-like"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase catalytic subunit"
                     /protein_id="YP_910761.1"
                     /db_xref="GI:119356117"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="GeneID:4568599"
                     /translation="MRTQLKKLTMYNKVKEFAREGLSIRQISRKTGMDRVTVRKFLRM
                     TDEEFSAFLALQKRRLRKLQPYEQFVKDRVTDYPDCSATQVEDWLKEHHPVFPEVTTR
                     TIYSFVQWIRKAYDLPKPKGTPRAYHPVEQLPYGEQAQVDFGEYWMASADACKVKVHF
                     MIMLLSRSRRKFVSFSQQPITTRFVLEAHEQAFSFFEGIPHTLVYDQDSTIVTDENRG
                     AILYTEAFRKYLLHRSLKIHLCRKSDPESKGKIEAGVKYVKYNFLPGRRFVNLEVLNQ
                     EALLWLERTANAKEHATTRLIPDAEWQVEKQHLRPFEPLPYPISGTVGKEYHVRKDNT
                     ISYRGNFYSLPVGTYAGPGTLVVLEVRQNTLCLYAQEGRLLANHPIESGKGTVVINNN
                     HRRDTSSKLRELQDSLMLLFTNQEHAERFLESIHNRYPRYSRDQFLHVRNAISGCQQK
                     LIDDALAHCVDHHLFSSGEFHDILHHYRKQEEKQSHQAVFNTFRPKTLRSDMDRMLSF
                     VPDSSGITTYENIFS"
     misc_feature    301214..302053
                     /locus_tag="Cpha266_0273"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG4584"
                     /db_xref="CDD:226950"
     misc_feature    301628..301936
                     /locus_tag="Cpha266_0273"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:216050"
     gene            302737..303573
                     /locus_tag="Cpha266_0274"
                     /db_xref="GeneID:4568600"
     CDS             302737..303573
                     /locus_tag="Cpha266_0274"
                     /note="PFAM: IstB domain protein ATP-binding protein;
                     SMART: AAA ATPase;
                     KEGG: bfs:BF1535 insertion sequence IS21-like putative
                     ATP-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="IstB ATP binding domain-containing protein"
                     /protein_id="YP_910762.1"
                     /db_xref="GI:119356118"
                     /db_xref="InterPro:IPR002611"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="GeneID:4568600"
                     /translation="MERTITTIQEHARELNLTGLAGTVDLLLEEARKSEPSYSDFALT
                     LLESELSCRRKAHLERRRKIANLPLLHDLDHYDSGVQNGISQVQLQQLRQLLWLDQNF
                     NLILIGPSGTGKSYLAGGLCHEALKLGYHALFRTMDDLIQTIRFKEITAAAAREYKRL
                     LSAHLLVIDDIMMFPLEKSVAVGLFQLVNQLHEQTSFIITTNKSPKEWAEMLGDEVLA
                     TALLDRLLYKCEVIKLTGKSYRLEHRTTIFEQQQSPEGGGNRRKKQLPLQKGVGNHCK
                     MT"
     misc_feature    302737..303468
                     /locus_tag="Cpha266_0274"
                     /note="DNA replication protein [DNA replication,
                     recombination, and repair]; Region: DnaC; COG1484"
                     /db_xref="CDD:224401"
     misc_feature    303043..303351
                     /locus_tag="Cpha266_0274"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    303058..303081
                     /locus_tag="Cpha266_0274"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(303061..303084,303241..303243,303340..303342)
                     /locus_tag="Cpha266_0274"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    303229..303246
                     /locus_tag="Cpha266_0274"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     gene            304390..305262
                     /locus_tag="Cpha266_0275"
                     /db_xref="GeneID:4568601"
     CDS             304390..305262
                     /locus_tag="Cpha266_0275"
                     /note="PFAM: SEFIR domain protein;
                     KEGG: shm:Shewmr7_1857 SEFIR domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="SEFIR domain-containing protein"
                     /protein_id="YP_910763.1"
                     /db_xref="GI:119356119"
                     /db_xref="InterPro:IPR000157"
                     /db_xref="InterPro:IPR013568"
                     /db_xref="GeneID:4568601"
                     /translation="MQDKRLTYTKSDAADRLYEGYNRLLADSDPEVILPLVQHMASEV
                     FPDFTAMQAFYSFACMEEKRFLKKAEVIELIPKYWSKVPEDMRPDIKYFLENIALAPR
                     VFISYSHDSQQHKAWVLKLATHLSQAGIDIVFDQWDIEPGSDVALFMEQGIEKSDRVV
                     LVITEKYVEKTKRNDSGTGYERMIITGQLAQELDTHKFIPITRQTLGKIKLPVFLGNR
                     LYVDFSDDELFEDSCHRLLRTLHGEPEVARPSVGPNPFLKQRHEAAQQSTHSSSDSQN
                     NSTISASDDEILTE"
     misc_feature    304696..305055
                     /locus_tag="Cpha266_0275"
                     /note="TIR domain; Region: TIR_2; pfam13676"
                     /db_xref="CDD:222311"
     gene            305551..306744
                     /locus_tag="Cpha266_0276"
                     /db_xref="GeneID:4568602"
     CDS             305551..306744
                     /locus_tag="Cpha266_0276"
                     /note="KEGG: xcv:XCVd0072 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910764.1"
                     /db_xref="GI:119356120"
                     /db_xref="GeneID:4568602"
                     /translation="MSEGLTESEKFVNSISERAFLHLWTHPNPIGKKGKELCDCLIVC
                     GNHIVIISVKDIKYKDTGDEAGWKRWTKAAIDKSASQIWGAERWLDSSVEFTRHDGRK
                     VELPPKENRIVHRISVSLGAQRKIPTKSGDLGNGIVHVCDEFSLGAIFGLLDTITDFV
                     SFLTEVEALINRANIVFNGGGIEDLLAIYLLNNHSFPYDEADLIIIEDTVFRGFIDSD
                     DYKAIQESYKDSYFWDKLIEHFVGDLLTDGMFEYGTNQVTDNQLALVQMALQPRGHRA
                     NLVDAFSEFLQKPELKIAARVILAYKNTAFVFHLGPSSDREARVQELGLRCLVVRGRL
                     PDVKIVVGISRDKLGPSEVGYSHDIAYVEIPEWNDDFEEQVTKIQKELGYFENTSCTK
                     RPENA"
     gene            306836..307525
                     /locus_tag="Cpha266_0277"
                     /db_xref="GeneID:4568603"
     CDS             306836..307525
                     /locus_tag="Cpha266_0277"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910765.1"
                     /db_xref="GI:119356121"
                     /db_xref="GeneID:4568603"
                     /translation="MKDIITEFDRPIVFRTVNAEVYESTINSGSIWLRSSDYYVYLED
                     KARCDKSEGANGTKTLLPLCFHPEGGTKQIYYGDGIIGQKISPHYIFSMHGSSVSECV
                     RKDFGEFTFGIKCISRLSAEILYEASKYLNVTGYRFGQVSYQYTALCRSLHSHGAAVG
                     LGGNLPEFLQSINTDVLRKDPVLPFIEQDEWRIVIFTNSLIKNDYNEPLKLIVNPNNF
                     YEYKSSAKLNA"
     gene            307601..308236
                     /locus_tag="Cpha266_0278"
                     /db_xref="GeneID:4568604"
     CDS             307601..308236
                     /locus_tag="Cpha266_0278"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910766.1"
                     /db_xref="GI:119356122"
                     /db_xref="InterPro:IPR000183"
                     /db_xref="GeneID:4568604"
                     /translation="MENQLPRIRDEAAYQQAMREWVVPECLHVPVVAVDEEAIKDHVG
                     DIVEILSPGRALVVAIYPPRERDFRLPIWAYPSANVFFEPIQVWVNPSYTRYRQAYVR
                     AKGADSVSGKVLAHVYNRRMAMLRGYGFVRLVPVSRRANSSSSFTEQWGIKLAAEDFG
                     ARRLKRGLRMQYADLGDLLVMLDISLGGGVQDTCRLGQNLIEIPGRRPPQE"
     gene            308731..308931
                     /locus_tag="Cpha266_0279"
                     /pseudo
                     /db_xref="GeneID:4568605"
     gene            309191..309961
                     /locus_tag="Cpha266_0280"
                     /db_xref="GeneID:4568606"
     CDS             309191..309961
                     /locus_tag="Cpha266_0280"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910767.1"
                     /db_xref="GI:119356123"
                     /db_xref="GeneID:4568606"
                     /translation="MEGRTMTWLKIIGAVVLLWTLTNFFLRYYEYSVFIYLFRFLGNY
                     RQIAHIFIRTDYWGDHREGNRREEYAALRRHEIAERFLIKGGSKAVTGILAELKKTNN
                     EYIRTHLAELIIKIGDTKALPDIEELFNRGAFHSSYGPGGSPIEQFLQSNSPSYRQKR
                     NKEEEESSAKLVQATDMVKDLSDDQMMDILKRLCRAYSVNDESEIKNIEPIAIAIGRK
                     LNQRGGLKAMRELYDKIGNIKGTRSLDMHWNGIGDWQG"
     gene            310485..311354
                     /locus_tag="Cpha266_0281"
                     /db_xref="GeneID:4568607"
     CDS             310485..311354
                     /locus_tag="Cpha266_0281"
                     /note="PFAM: Abortive infection protein;
                     KEGG: nar:Saro_2395 abortive infection protein"
                     /codon_start=1
                     /transl_table=11
                     /product="abortive infection protein"
                     /protein_id="YP_910768.1"
                     /db_xref="GI:119356124"
                     /db_xref="InterPro:IPR003675"
                     /db_xref="GeneID:4568607"
                     /translation="MTTISNSEPGIARSILSSPPARVLVLGFILLVMMGLNTDVMTSY
                     AGEPAKSVLHIMALAIAGISVYLGYAYFIEERDVYELAVPGMGRELGIGLLIGAGLYA
                     LSELILMALGIYRIDGLNPLSYMVPAIAMAQSSGIYEELLFRGVLFRSVETWLGSWAA
                     LVVSSLVFGLTHLMNPHATIEGALFIAVEAGILLAAAYMLTHRLWLSMGFHVAWNYTQ
                     SAIFSGIVSGNEASQGLVRSTIKGPDFLTGGSFGVESSVLALLLCTTTGIVMLVMASK
                     RGNIVPPVWKRAA"
     misc_feature    310845..311135
                     /locus_tag="Cpha266_0281"
                     /note="CAAX protease self-immunity; Region: Abi;
                     pfam02517"
                     /db_xref="CDD:217080"
     gene            312094..312396
                     /locus_tag="Cpha266_0282"
                     /db_xref="GeneID:4568608"
     CDS             312094..312396
                     /locus_tag="Cpha266_0282"
                     /note="KEGG: cte:CT1655 ferredoxin, 2Fe-2S"
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin, 2Fe-2S"
                     /protein_id="YP_910769.1"
                     /db_xref="GI:119356125"
                     /db_xref="GeneID:4568608"
                     /translation="MQKQREMPYVAHVFVCTNDRGGEKKSCADNNSQLTKARLKQAVD
                     EKGWRGKVRISTSGCMGLCSNGSHVMIYPQKVWFSGVLPDDVDEIVSAIERILADD"
     misc_feature    312124..312372
                     /locus_tag="Cpha266_0282"
                     /note="Thioredoxin (TRX)-like [2Fe-2S] Ferredoxin (Fd)
                     family; composed of [2Fe-2S] Fds with a TRX fold (TRX-like
                     Fds) and proteins containing domains similar to TRX-like
                     Fd including formate dehydrogenases, NAD-reducing
                     hydrogenases and the subunit E of NADH:...; Region:
                     TRX_Fd_family; cd02980"
                     /db_xref="CDD:239278"
     misc_feature    order(312127..312129,312133..312135,312259..312267)
                     /locus_tag="Cpha266_0282"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239278"
     misc_feature    order(312139..312141,312172..312174,312268..312270,
                     312280..312282)
                     /locus_tag="Cpha266_0282"
                     /note="[2Fe-2S] cluster binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239278"
     gene            complement(312684..313556)
                     /locus_tag="Cpha266_0283"
                     /db_xref="GeneID:4570773"
     CDS             complement(312684..313556)
                     /locus_tag="Cpha266_0283"
                     /note="KEGG: bps:BPSL0088 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910770.1"
                     /db_xref="GI:119356126"
                     /db_xref="GeneID:4570773"
                     /translation="MNNISINISGRIDPERVTLLRDIKEVADGLAIHFFVVGAFARDL
                     NFEHIHHIPAPRVTEDIDIGVEVADWETFRYLTDSLIDRDILKPTKSAHRFTGNSPAI
                     VVDIIPYGGISNELKKISWPPDHRIIMSMLGFEEAFQSAMAVCLETEPLLEILVPSVP
                     ALTVMKIISWNDAYPNRNRDARDILFILENYHVIVSEYLYEPPAVLLEEEAFDLCLAS
                     VRLLGRKIAQLCSKITKETIVIILDRESEENGEVKMLSQMGSAGSFQTKQFENSLKLL
                     KKLLQGIREETTKV"
     misc_feature    complement(312792..313520)
                     /locus_tag="Cpha266_0283"
                     /note="Predicted nucleotidyltransferase [General function
                     prediction    only]; Region: COG4849"
                     /db_xref="CDD:227186"
     gene            complement(313519..314508)
                     /locus_tag="Cpha266_0284"
                     /db_xref="GeneID:4570774"
     CDS             complement(313519..314508)
                     /locus_tag="Cpha266_0284"
                     /note="KEGG: bps:BPSL0089 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910771.1"
                     /db_xref="GI:119356127"
                     /db_xref="GeneID:4570774"
                     /translation="MEALAVIAPLDYVVEPATYLRDQEYDYLVKGIVFGKKFVWCVNI
                     KTRLTRTGEMQLLIGKDKALHPLLLVTGYVPPEAADRLRSIGIEFIDKAGNMFINQPP
                     LLIFVKGNKPEKEKNTMPGTRLFKGVGLKIVYLLLCRPDLVNSSYRDLSEMTGVALGT
                     VNTTITELLMKDFILDMGKRGKKILNRKKLFERWVEAYPDYLKPKLFLGRFHGDEFWW
                     KNTNLDPASAQWGGEIAASKLTGYLKPGSAALYTDKKFLTDLVITNRLKKDPQGNVEI
                     FERFWPMDYGFGDLDTTHPIIIYADLLAIGDQRTTETAKMIYEQYLDQYFRQD"
     misc_feature    complement(313540..313962)
                     /locus_tag="Cpha266_0284"
                     /note="Uncharacterized protein conserved in bacteria
                     (DUF2186); Region: DUF2186; pfam09952"
                     /db_xref="CDD:220489"
     gene            315008..315379
                     /locus_tag="Cpha266_0285"
                     /db_xref="GeneID:4570775"
     CDS             315008..315379
                     /locus_tag="Cpha266_0285"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910772.1"
                     /db_xref="GI:119356128"
                     /db_xref="GeneID:4570775"
                     /translation="MIRKITITGFLLLAVAFNANAQDIDRINQLEKEVREINIRLSKL
                     ESLLSNPGKPHEHVTPGEGWKSIMNWRKLTTDMDYSDVQKTLGEPQRVDGGQVAHWYY
                     QNGGNVTFMGGKVYQWSEPRH"
     sig_peptide     315008..315073
                     /locus_tag="Cpha266_0285"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 1.000) with cleavage site probability 1.000 at
                     residue 22"
     misc_feature    <315071..>315367
                     /locus_tag="Cpha266_0285"
                     /note="ribokinase/pfkB superfamily: Kinases that accept a
                     wide variety of substrates, including carbohydrates and
                     aromatic small molecules, all are phosphorylated at a
                     hydroxyl group. The superfamily includes ribokinase,
                     fructokinase, ketohexokinase; Region:
                     ribokinase_pfkB_like; cl00192"
                     /db_xref="CDD:241672"
     gene            315451..315627
                     /locus_tag="Cpha266_0286"
                     /db_xref="GeneID:4570776"
     CDS             315451..315627
                     /locus_tag="Cpha266_0286"
                     /note="KEGG: cch:Cag_1360 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910773.1"
                     /db_xref="GI:119356129"
                     /db_xref="GeneID:4570776"
                     /translation="MMVTATANNPEETRYVTTATIGEKFYTVVWTWRANARRIISFRR
                     ARDVEERAYRQIHG"
     misc_feature    <315457..315600
                     /locus_tag="Cpha266_0286"
                     /note="Protein of unknown function (DUF497); Region:
                     DUF497; cl01108"
                     /db_xref="CDD:242305"
     gene            315590..315913
                     /locus_tag="Cpha266_0287"
                     /db_xref="GeneID:4570777"
     CDS             315590..315913
                     /locus_tag="Cpha266_0287"
                     /note="KEGG: cte:CT0461 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910774.1"
                     /db_xref="GI:119356130"
                     /db_xref="InterPro:IPR010916"
                     /db_xref="GeneID:4570777"
                     /translation="MSRKERIVRYTDKELESMQVHGQDKSDWKSAAAISGKEIEAAVA
                     GDEDETGMHIDWSSISAEPPRPKAVLNMRVDYDVLEFFRSQGKGYQKKINAVLRSYVE
                     QKQRH"
     misc_feature    <315776..315892
                     /locus_tag="Cpha266_0287"
                     /note="Domain of unknown function (DUF4415); Region:
                     DUF4415; pfam14384"
                     /db_xref="CDD:222723"
     gene            315976..316242
                     /locus_tag="Cpha266_0288"
                     /db_xref="GeneID:4570778"
     CDS             315976..316242
                     /locus_tag="Cpha266_0288"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910775.1"
                     /db_xref="GI:119356131"
                     /db_xref="GeneID:4570778"
                     /translation="MLVVFHAATAFFLKSIPDVIWSGLLASFLTLVGVLLSNRGYTQR
                     LRMQLDHDAAEKTKERTATLRRETYLRAAEELVRVNAYLASPSI"
     gene            316311..316595
                     /locus_tag="Cpha266_0289"
                     /db_xref="GeneID:4570779"
     CDS             316311..316595
                     /locus_tag="Cpha266_0289"
                     /note="KEGG: cch:Cag_0520 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910776.1"
                     /db_xref="GI:119356132"
                     /db_xref="GeneID:4570779"
                     /translation="MKRINWNTEKSLVLKASRGICFEDVIFFVERGEILDDYLHPNQE
                     VYPGQRIMVIGMTNYAYLVPYVENEEELFLKTIIPSRKATQQYFGEKHES"
     misc_feature    316362..316547
                     /locus_tag="Cpha266_0289"
                     /note="Domain of unknown function (DUF4258); Region:
                     DUF4258; pfam14076"
                     /db_xref="CDD:206246"
     gene            316573..316872
                     /locus_tag="Cpha266_0290"
                     /db_xref="GeneID:4570780"
     CDS             316573..316872
                     /locus_tag="Cpha266_0290"
                     /note="KEGG: lbl:LBL_0502 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910777.1"
                     /db_xref="GI:119356133"
                     /db_xref="GeneID:4570780"
                     /translation="MEKNMKAKLTKEEKEILDSFEKGEWVPVADLSKRRKELAEYAGN
                     SLKKDKRLNIRISERDLTELQRKAIKEGLPYQTYVASIIHKFINGTLVDGAAKDG"
     misc_feature    316579..316839
                     /locus_tag="Cpha266_0290"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG5304"
                     /db_xref="CDD:227620"
     gene            317163..317612
                     /locus_tag="Cpha266_0291"
                     /db_xref="GeneID:4570781"
     CDS             317163..317612
                     /locus_tag="Cpha266_0291"
                     /note="TIGRFAM: nucleotidyltransferase substrate binding
                     protein, HI0074 family;
                     KEGG: lpf:lpl2847 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotidyltransferase substrate binding
                     protein"
                     /protein_id="YP_910778.1"
                     /db_xref="GI:119356134"
                     /db_xref="InterPro:IPR010235"
                     /db_xref="GeneID:4570781"
                     /translation="MATIRKFALSNQDISWIQRYRYYVQAFGQLDRAVELARQRPLTE
                     LEQQGLIQSFEYTHELAWNTLKDFLENKGVQPLYGSKDTTREAFKRGLIEDGEIWMQM
                     INSRNLTSHTYNQEIADEIAEAIRIHYHAAYRTLVDTLEPLTSERPE"
     misc_feature    317214..317585
                     /locus_tag="Cpha266_0291"
                     /note="Nucleotidyltransferase substrate binding protein
                     like; Region: NTase_sub_bind; pfam08780"
                     /db_xref="CDD:220014"
     gene            317609..317935
                     /locus_tag="Cpha266_0292"
                     /db_xref="GeneID:4570782"
     CDS             317609..317935
                     /locus_tag="Cpha266_0292"
                     /note="PFAM: DNA polymerase, beta domain protein region;
                     KEGG: net:Neut_0173 DNA polymerase, beta domain protein
                     region"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase subunit beta"
                     /protein_id="YP_910779.1"
                     /db_xref="GI:119356135"
                     /db_xref="InterPro:IPR002934"
                     /db_xref="GeneID:4570782"
                     /translation="MKYGLDDTTIARIHGVIARYGQVDKAILYGSRAKGNYRAGSDID
                     LTLVGGHDLNLTVLYRIMDDIDDLLLPYTFDISLLHSISDRDVLDHIKMVGKVFYEKT
                     QTSQFF"
     misc_feature    317633..317881
                     /locus_tag="Cpha266_0292"
                     /note="Nucleotidyltransferase (NT) domain of
                     Staphylococcus aureus kanamycin nucleotidyltransferase,
                     and similar proteins; Region: NT_KNTase_like; cd05403"
                     /db_xref="CDD:143393"
     misc_feature    order(317693..317701,317708..317710,317729..317734,
                     317738..317740,317825..317827,317831..317833)
                     /locus_tag="Cpha266_0292"
                     /note="active site"
                     /db_xref="CDD:143393"
     misc_feature    order(317693..317701,317708..317710,317729..317734,
                     317738..317740)
                     /locus_tag="Cpha266_0292"
                     /note="NTP binding site [chemical binding]; other site"
                     /db_xref="CDD:143393"
     misc_feature    order(317732..317734,317738..317740,317831..317833)
                     /locus_tag="Cpha266_0292"
                     /note="metal binding triad [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143393"
     misc_feature    order(317825..317827,317831..317833)
                     /locus_tag="Cpha266_0292"
                     /note="antibiotic binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:143393"
     gene            317966..318145
                     /locus_tag="Cpha266_0293"
                     /pseudo
                     /db_xref="GeneID:4570783"
     gene            complement(318232..319209)
                     /locus_tag="Cpha266_0294"
                     /db_xref="GeneID:4570784"
     CDS             complement(318232..319209)
                     /locus_tag="Cpha266_0294"
                     /note="KEGG: ana:alr0722 unknown protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910780.1"
                     /db_xref="GI:119356136"
                     /db_xref="InterPro:IPR002345"
                     /db_xref="GeneID:4570784"
                     /translation="MKRKIHLSHLLVALLLSLWLPMYGCSTPHSATEDISQQPTAGIS
                     GMAQIDGNSWLVVHDALSFENGPRMSIITLSVDAAPVLHPVTIDSWPDAGGQASDLES
                     LCPVPSHPNEYLMAESGTWKEKGGRLFHLRLNALTRQAAILGVMKLPVLADNNPQQVG
                     DQYEALACVRGADGRLLLLLGERGGSQRFPEGVIRWGVLDIERHELQFTEKGLEGVKV
                     NAPGKWKNELTNRDISDMYISPEGEIWVSAAEDNGDNGPFTSVIYSPGRISGNFSLPV
                     IANRHSGVWRTIGSLKIEALSGPAESVAGSRMSIGSDDENYGGIWRPVE"
     sig_peptide     complement(319117..319209)
                     /locus_tag="Cpha266_0294"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 1.000) with cleavage site probability 0.975 at
                     residue 31"
     gene            complement(319399..319950)
                     /locus_tag="Cpha266_0295"
                     /db_xref="GeneID:4570785"
     CDS             complement(319399..319950)
                     /locus_tag="Cpha266_0295"
                     /note="KEGG: cte:CT1658 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910781.1"
                     /db_xref="GI:119356137"
                     /db_xref="InterPro:IPR000437"
                     /db_xref="GeneID:4570785"
                     /translation="MRPAHIIRILPLCAFLLISGCSGNSSKQSESSSGNASVQQQASK
                     IIEPGDLITAKDAETMLGEPVKPAEKTDNQVVGQKLCLYNPINTGSSEFLQVGLTQDA
                     FMPPQGISSASIYKSLKDNFEGMRTDVKGVGDEAFIATGGIYILTDGYYIQIGAGNSS
                     NETVRNKLIEAGKIAVAKLNTLK"
     sig_peptide     complement(319867..319950)
                     /locus_tag="Cpha266_0295"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 0.968) with cleavage site probability 0.728 at
                     residue 28"
     gene            320763..323612
                     /locus_tag="Cpha266_0296"
                     /db_xref="GeneID:4570786"
     CDS             320763..323612
                     /locus_tag="Cpha266_0296"
                     /note="TIGRFAM: ATPase, P-type (transporting), HAD
                     superfamily, subfamily IC;
                     PFAM: cation transporting ATPase domain protein domain
                     protein; Haloacid dehalogenase domain protein hydrolase;
                     cation transporting ATPase domain protein; E1-E2
                     ATPase-associated domain protein;
                     KEGG: gvi:glr4215 cation-transporting ATPase PacL homolog"
                     /codon_start=1
                     /transl_table=11
                     /product="P-type HAD superfamily ATPase"
                     /protein_id="YP_910782.1"
                     /db_xref="GI:119356138"
                     /db_xref="InterPro:IPR000695"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="InterPro:IPR006068"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="GeneID:4570786"
                     /translation="MPTEIPSRPDTRVLDGKLWHTLPLETALAQLGLSHGGLTTAEAN
                     SRRETFGPNELEEKGGRTVWHILWEQVSSVMIVILLIAGVLALLFKGGGGPPIDAIAI
                     FSIVILFVVQGVMQEYRAQKAIAALKQMSSPTVKVVRDGQVQEMSARDLVPGDLVKLE
                     TGSVVPADCRIVESVNLRIQEAALTGESEPIEKFSGVLEGEDLSLGDRKNMGYMGTFA
                     SYGRGEALVVETGMRTELGKIASMIQNVKHEETPLQKKLDKLGKTLALIALVVAVVVA
                     LTGVYIEGKTWAEVLIIAIAISVAIVPEGLPAVQTFSLAIGAQRMVKRKALIRKLPAV
                     EALGSVTVICSDKTGTLTQNKMTVTELETLDHRVELDTQARQYDIEHGQPELAALVAC
                     GGLCCDAVLNPDGETGVGDPTEVALAVAAHRYNLSRIALESVLPRVAEIPFDSGRKLM
                     TTIHKLPEGGALPSTISAMAAGLNGSPYVVFTKGAADNMLAICDRVFSVGQVRPLTDD
                     DRARIHAANSKMASDGIRVLGVGYHGLPDLSEYEQPGKVERELVFLGLVGMIDPARPE
                     AKDAVAKCKTAGIRTIMITGDHPDTARYIAADLGITSHDGRVITGVELEKMSDTDLKK
                     ALKDANTNCFARVSPEHKLRIVGALQELGNIVAMTGDGVNDAPALKRADIGVAMGITG
                     TDVSKEAADMVLLDDNFATIVAAIEEGRVVYDNLRRFVMFSISGNIAKVIIVAVSPLI
                     GLAAMLKPIQILFSNLLTDGLLGLGMGMEAAEKNTMQRPPYSPQESIISRVVGRHIAI
                     IGPVIGLLLLVVGYLQWQQLGLPNVLQIKNEAERNALFTDPKVLMWGTLMFTALAMMQ
                     VGRAFSSRSFLDPFWKQPLRTNKVLVGMILAVVTLQLFVVYTPGVQTFFSAVSLSGTN
                     LGLCIAFAMVVLTIMELLKALERRNAAAKQPGGKK"
     misc_feature    320817..323576
                     /locus_tag="Cpha266_0296"
                     /note="Cation transport ATPase [Inorganic ion transport
                     and metabolism]; Region: MgtA; COG0474"
                     /db_xref="CDD:223550"
     misc_feature    320817..320987
                     /locus_tag="Cpha266_0296"
                     /note="Cation transporter/ATPase, N-terminus; Region:
                     Cation_ATPase_N; pfam00690"
                     /db_xref="CDD:201397"
     misc_feature    321063..321770
                     /locus_tag="Cpha266_0296"
                     /note="E1-E2 ATPase; Region: E1-E2_ATPase; pfam00122"
                     /db_xref="CDD:215733"
     misc_feature    321945..322250
                     /locus_tag="Cpha266_0296"
                     /note="Putative hydrolase of sodium-potassium ATPase alpha
                     subunit; Region: Hydrolase_like2; pfam13246"
                     /db_xref="CDD:222006"
     misc_feature    322455..322796
                     /locus_tag="Cpha266_0296"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    322515..322517
                     /locus_tag="Cpha266_0296"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     misc_feature    322998..323567
                     /locus_tag="Cpha266_0296"
                     /note="Cation transporting ATPase, C-terminus; Region:
                     Cation_ATPase_C; pfam00689"
                     /db_xref="CDD:216063"
     gene            complement(324655..327423)
                     /locus_tag="Cpha266_0297"
                     /db_xref="GeneID:4570787"
     CDS             complement(324655..327423)
                     /locus_tag="Cpha266_0297"
                     /note="PFAM: TPR repeat-containing protein;
                     Tetratricopeptide TPR_2 repeat protein;
                     SMART: Tetratricopeptide domain protein;
                     KEGG: cch:Cag_0486 TPR repeat"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910783.1"
                     /db_xref="GI:119356139"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="GeneID:4570787"
                     /translation="MSDHSSIDNQPAGGFAAISKYNPHLWSADQLRAIFVARKNELAD
                     LQHTLSSTPSGTVGQHILLVGARGMGKSTLMRRLALAVEDDPALSAAWLPLRFPEEQY
                     TVATLGQFWANVLDSLADALQHLGQSVSELDAAAERIAAMPPAEQAAACLATIDRCAD
                     KRGQRLLLLVDNTDLLLRNIGSDAQWALRSTLQSNPRLLWVGGSYQSLEAESSYHDAF
                     LDFFRIIHLRPLRLDEMRQALLALAETFGGSVARQQMERQLAAQPERLPTLRQLSGGN
                     PRTTVMLYEILANGQKGNVRSDLEALLDNMTPLYKARMDALADLPRKLLAHILEHWAP
                     ISIGDLAAASQVANTSISPQLKRLELEGLIEKTGLQGTTRSGYQASERFFNIWYLMRL
                     SPRRQRSRLAWLVEFMRLWFSSDELRTLAQQRLSDGRTAFRSSHEQEYDRALADALPD
                     QTPERHALRWSLLKQLKENRSQLAELFDLEGADADFKGADDYLRRLAELSARLHQNPH
                     AATEEEKKRWVNDVLGSIGFNLAQKESLAEAAADLNRDEYDKLEKLLHEERRNLENRF
                     GAAAVQTVRTAVLSQDFFPDMPDSHLAYEQIRACFAEKPEALRFGCELFYNNHNDEWC
                     YKAQKLAQETWPQDAGIAYQCAWLLHIELGRYDEAETAYRRTIELDEKNTYPWNGLGN
                     LLKDHLGRYEEAEVAYRRAIELDEKYAYPWNGLGNLLSDQLGRPEEAEAAYRQAIALD
                     EKDASPWNGLGDLLADQLDRPVEAEAAYRQAIALDEKDPYPLTNLARLLARLERKEDA
                     ETFYRDVVRSNTDDQQLLLQAHLFLGNRQLAIDALQALASAAQSGDQLAFFQLKEQIW
                     ECHELGLGERLADLMAESDAAGFLVPFVQALYTLAGATNKLRDLPLESRQMADEIVRL
                     ARLRQKRT"
     misc_feature    complement(<327028..327321)
                     /locus_tag="Cpha266_0297"
                     /note="AAA ATPase domain; Region: AAA_16; pfam13191"
                     /db_xref="CDD:221970"
     misc_feature    complement(<327187..327252)
                     /locus_tag="Cpha266_0297"
                     /note="ATPases associated with a variety of cellular
                     activities; Region: AAA; smart00382"
                     /db_xref="CDD:214640"
     misc_feature    complement(326323..326445)
                     /locus_tag="Cpha266_0297"
                     /note="MarR family; Region: MarR_2; cl17246"
                     /db_xref="CDD:247800"
     misc_feature    complement(325306..325515)
                     /locus_tag="Cpha266_0297"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:222112"
     misc_feature    complement(325198..325500)
                     /locus_tag="Cpha266_0297"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(325255..325260,325270..325275,
                     325282..325287,325363..325365,325369..325371,
                     325378..325383,325387..325392,325477..325482,
                     325489..325494,325498..325500))
                     /locus_tag="Cpha266_0297"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(325216..325218,325225..325227,
                     325237..325239,325276..325278,325321..325323,
                     325330..325332,325342..325344,325381..325383,
                     325426..325428,325435..325437,325447..325449,
                     325483..325485))
                     /locus_tag="Cpha266_0297"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(325096..325305)
                     /locus_tag="Cpha266_0297"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:222112"
     misc_feature    complement(<325072..325290)
                     /locus_tag="Cpha266_0297"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(325072..325077,325153..325155,
                     325159..325161,325168..325173,325177..325182,
                     325270..325275,325282..325287))
                     /locus_tag="Cpha266_0297"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(325111..325113,325120..325122,
                     325132..325134,325171..325173,325216..325218,
                     325225..325227,325237..325239,325276..325278))
                     /locus_tag="Cpha266_0297"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     gene            complement(327416..328633)
                     /locus_tag="Cpha266_0298"
                     /db_xref="GeneID:4570788"
     CDS             complement(327416..328633)
                     /locus_tag="Cpha266_0298"
                     /note="KEGG: cch:Cag_0485 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910784.1"
                     /db_xref="GI:119356140"
                     /db_xref="GeneID:4570788"
                     /translation="MKLGNPATGDDFFGRTQELSDLWRYLESDHIRFPGVRRLGKTSI
                     LRRLESEAADHGLLARWLDVSNIDSAPGFISLLDQAFPEKSIRSFLSDRAQQAGSWFN
                     RIRKIDATLPDAVGGGGFGIEFGGETVPEWEKDAGSLHSRLCNQPLLILLDEFPWMLE
                     KLIQRDRQEAEQLLSWLRIWRQSQGSCRFVFTGSIGLQSLLERHGLGETMNDCYPYPL
                     GPYKLSEARGLWQYFAPIADKTPWEIADPVIDYALGRVGWLSPYFLSLLLDESMRAAR
                     ERRQECPADATGEARIEIEDVDDAYENLLAERSRFHHWEKRLKSALEPADLDLCLSLL
                     SHLSRHADGLTLPQLSSRLARREPEPDLRTRRIQDLLVRLTDEGYTSPPDSNKRIQFL
                     SFPLRDWWNRNHV"
     misc_feature    complement(328100..328600)
                     /locus_tag="Cpha266_0298"
                     /note="AAA ATPase domain; Region: AAA_16; pfam13191"
                     /db_xref="CDD:221970"
     gene            329006..331756
                     /locus_tag="Cpha266_0299"
                     /db_xref="GeneID:4570789"
     CDS             329006..331756
                     /locus_tag="Cpha266_0299"
                     /note="KEGG: fnu:FN1445 DNA helicase"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA helicase"
                     /protein_id="YP_910785.1"
                     /db_xref="GI:119356141"
                     /db_xref="GeneID:4570789"
                     /translation="MNSRQNLVIIKGKDRTDQILRIGEATEQRMIVTFSNGKPYFYAR
                     ENVAWLSNPGRITIDHCQVLVEGDLLFDIEEVLRFETWVKIFRRNGESRCCLFSDFSV
                     QRMSSSDGRSTDVLAYFRELAETTGLMTNDNKSMMAMKYRNLGVVSGRSILSSFLQAR
                     PPGSGTVPSDLIFPFGCNMSQKMAVQRAIEHPVSLIQGPPGTGKTQTILNLIGNMLLR
                     RKRVAVVSSNNSATANVLEKLQKYELDFVAASLGSAENKQVFIEGQSSDVVQMPTFQA
                     DQEASVLQEISLLNTSLDNAFAEKNGLAVIIQQIDALKLEMAHFEKYCDETNGGDLRV
                     IDRAMNAELSARKLLHAWLASEKELKRYAKAGVASPSNRRVGFLKKIGFLLRFGTAGS
                     AFFEVSVRERIPLLQKAYYLRKLADMEQRRKTLEGSLAGFHFDERLERLTELSMQLLK
                     HRLAQHYNNRERRIFALEDLRNQPEKFLEEYPVILSTTFSIITSLKSGYLFDCVIVDE
                     ASQVDLLSGVLAMGCAEKLVIVGDSMQLPNVLTAQDEKQAKEVALQYDLPDYARFERH
                     NLLSAVRTAFPDIPETLLLEHYRCHPKIIQFCNQKFYGGELLVMTRDQGEADVLKAYM
                     TVEGRHARGTINQRQVDEITQNVLPELASIHPADIGIVSPFRAQADRMLLSVGSNEIG
                     IDTVHKYQGREKRAIIITTVSNKSNEFVDNPNLLNVAVSRAKEKLRLVVSMEMADGNS
                     NVADLVRYIRYNNCEVIPGRVRSVFDLLYQDYTAARLAVLKKWKRVSIYDSENLVYSE
                     IDAVLQEKAYRGLGIVFQFPLSMLVRNRENLTTEESSYAAHPWTKTDFLVYRRVDKSP
                     VLVIEVDGYAFHREGTRQAERDALKDAVLEKCGLPILRLSTIGSDERNRIRKKLEDVV
                     AS"
     misc_feature    329537..>329788
                     /locus_tag="Cpha266_0299"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    329597..329620
                     /locus_tag="Cpha266_0299"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(329600..329620,329624..329626)
                     /locus_tag="Cpha266_0299"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    329780..329788
                     /locus_tag="Cpha266_0299"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    <330056..331207
                     /locus_tag="Cpha266_0299"
                     /note="Superfamily I DNA and RNA helicases and helicase
                     subunits [DNA replication, recombination, and repair];
                     Region: COG1112"
                     /db_xref="CDD:224037"
     misc_feature    330692..331186
                     /locus_tag="Cpha266_0299"
                     /note="AAA domain; Region: AAA_12; pfam13087"
                     /db_xref="CDD:221913"
     misc_feature    <331538..331735
                     /locus_tag="Cpha266_0299"
                     /note="Protein of unknown function (DUF2726); Region:
                     DUF2726; pfam10881"
                     /db_xref="CDD:220896"
     gene            complement(331874..333415)
                     /gene="guaA"
                     /locus_tag="Cpha266_0300"
                     /db_xref="GeneID:4570790"
     CDS             complement(331874..333415)
                     /gene="guaA"
                     /locus_tag="Cpha266_0300"
                     /EC_number="6.3.5.2"
                     /note="contains glutamine-hydrolyzing domain and glutamine
                     amidotransferase; GMP-binding domain; functions to produce
                     GMP from XMP in the IMP pathway"
                     /codon_start=1
                     /transl_table=11
                     /product="GMP synthase"
                     /protein_id="YP_910786.1"
                     /db_xref="GI:119356142"
                     /db_xref="InterPro:IPR000991"
                     /db_xref="InterPro:IPR001674"
                     /db_xref="InterPro:IPR004739"
                     /db_xref="InterPro:IPR006220"
                     /db_xref="InterPro:IPR011702"
                     /db_xref="InterPro:IPR012998"
                     /db_xref="GeneID:4570790"
                     /translation="MQSVTVLDFGSQYTQLIARRIRELGIYSEILPYNASPETIREHD
                     PKAIILSGGPTSVYGDSALLPDGGVFMLGVPVLGICYGLQAIAKHFGGEVAGSSKQEF
                     GRAKMLVSHNEESESPLFRNIPDSDVWMSHGDKVVRLPEGFRVTASSENSEMCALESY
                     GSKAALKVYGLQFHPEVQHTLYGKQLLSNFLIDIAGIKPDWSPKSFIGHQIEEIRARA
                     GKDKVICGISGGVDSTVAAVLVSQAIGKQLHCVFVDNGLLRKNEAVKVMNFLKPLGLS
                     VTLADASDLFLKRLDKVASPEKKRKIIGRTFIHVFEQHLNEEKYLVQGTLYPDVIESV
                     SVKGPSETIKSHHNVGGLPKRMKLKLIEPLRELFKDEVRAVGRELGIAEDILMRHPFP
                     GPGLAVRVLGSVSRPRLDILREADEIFIEELKTSGLYQHVWQAFSVLLPVQSVGVMGD
                     KRTYENVLALRAVESTDGMTADWAQLPHDFLARVSNRIINEVRGINRVAYDISSKPPA
                     TIEWE"
     misc_feature    complement(331877..333415)
                     /gene="guaA"
                     /locus_tag="Cpha266_0300"
                     /note="GMP synthase; Reviewed; Region: guaA; PRK00074"
                     /db_xref="CDD:234614"
     misc_feature    complement(332843..333406)
                     /gene="guaA"
                     /locus_tag="Cpha266_0300"
                     /note="Type 1 glutamine amidotransferase (GATase1) domain
                     found in GMP synthetase; Region: GATase1_GMP_Synthase;
                     cd01742"
                     /db_xref="CDD:153213"
     misc_feature    complement(order(332894..332896,333023..333025,
                     333173..333178,333254..333262,333380..333385))
                     /gene="guaA"
                     /locus_tag="Cpha266_0300"
                     /note="AMP/PPi binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:153213"
     misc_feature    complement(order(333173..333175,333257..333259))
                     /gene="guaA"
                     /locus_tag="Cpha266_0300"
                     /note="candidate oxyanion hole; other site"
                     /db_xref="CDD:153213"
     misc_feature    complement(order(332888..332890,332894..332896,
                     333176..333178))
                     /gene="guaA"
                     /locus_tag="Cpha266_0300"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:153213"
     misc_feature    complement(order(332900..332902,333020..333022,
                     333164..333166))
                     /gene="guaA"
                     /locus_tag="Cpha266_0300"
                     /note="potential glutamine specificity residues [chemical
                     binding]; other site"
                     /db_xref="CDD:153213"
     misc_feature    complement(331880..332752)
                     /gene="guaA"
                     /locus_tag="Cpha266_0300"
                     /note="The C-terminal domain of GMP synthetase. It
                     contains two subdomains; the ATP pyrophosphatase domain
                     which closes to the N-termial and the dimerization domain
                     at C-terminal end. The ATP-PPase is a twisted,
                     five-stranded parallel beta-sheet sandwiched...; Region:
                     GMP_synthase_C; cd01997"
                     /db_xref="CDD:238955"
     misc_feature    complement(order(332210..332254,332270..332344,
                     332357..332386,332411..332458,332474..332476,
                     332477..332578,332606..332638,332642..332674,
                     332678..332752))
                     /gene="guaA"
                     /locus_tag="Cpha266_0300"
                     /note="ATP Binding subdomain [chemical binding]; other
                     site"
                     /db_xref="CDD:238955"
     misc_feature    complement(order(332309..332311,332657..332659,
                     332663..332665,332717..332728,332732..332740))
                     /gene="guaA"
                     /locus_tag="Cpha266_0300"
                     /note="Ligand Binding sites [chemical binding]; other
                     site"
                     /db_xref="CDD:238955"
     misc_feature    complement(order(331880..331948,331952..331978,
                     331997..332044,332054..332086,332093..332122,
                     332147..332185))
                     /gene="guaA"
                     /locus_tag="Cpha266_0300"
                     /note="Dimerization subdomain; other site"
                     /db_xref="CDD:238955"
     gene            complement(333447..335729)
                     /locus_tag="Cpha266_0301"
                     /db_xref="GeneID:4570791"
     CDS             complement(333447..335729)
                     /locus_tag="Cpha266_0301"
                     /note="TIGRFAM: penicillin-binding protein, 1A family;
                     PFAM: glycosyl transferase, family 51; penicillin-binding
                     protein, transpeptidase;
                     KEGG: plt:Plut_1945 penicillin-binding protein 1A"
                     /codon_start=1
                     /transl_table=11
                     /product="1A family penicillin-binding protein"
                     /protein_id="YP_910787.1"
                     /db_xref="GI:119356143"
                     /db_xref="InterPro:IPR001264"
                     /db_xref="InterPro:IPR001460"
                     /db_xref="InterPro:IPR011816"
                     /db_xref="GeneID:4570791"
                     /translation="MITLRTTVTVNTTFFKKSFITLAALVFFLLTSVSAFALNPFKGL
                     PSLEELENPNPDLASLVYSEDGVLLHKFFVKNRTFIPLKSIPRSARYALIATEDVTFY
                     QHWGVDLRRLALVMGENIIKGRQRWHGASTITQQLAKNLYLTQERTVSRKVKELITAV
                     ELEKTYTKDEILALYLNTVYFGSGAYGIEAAARTYFSKPASQLTLPESATLIATLKNP
                     TGYNPVKNPSGAISRRNLILSLMEKEKFITPEQAATAKRSRLLLHYTPVSHHGIAPYF
                     TEYIRQTVKPASMLGDINLHRDGLTIQTTLDSRMQKYAEQAAVDHLASLQASFDRSWR
                     WPESLKNQMIKESPRFKELLEDGVSAQQALVQLRADRIWLNNLLREKTRIQVALVAID
                     PANGHIKAWVGGNSLSSEDYKYQFDHVWQAKRQPGSTFKPFVYLTAIDKGIPANFRVL
                     DQPLALKSGNGIWSPRNSDGSSGGMTTLRSALTRSLNQVSVRLAYEQLTVPEIISYAK
                     RMGISSVMPQNYSIALGTGEVSPLELAGAFSTFANNGIWTEPVSILKVSDKHHRSMSE
                     STPNRRFAIDSTSNFVMVSMMRDVINRGTASSIRGRYAMTMDAAGKTGTTQSLRDAWF
                     AGFTPQLVAVVWTGFDDERIKFTSMEYGQGARAALPIWAGFMKRCYSDPSLKLTNRYF
                     HIPNTVIAVPISGQASVASAPANNSVYIEYYTPKGFNYYKSNPVQSTPGDQGDSGVPT
                     EGDLEPAPQPAETPAQEGAF"
     sig_peptide     complement(335616..335729)
                     /locus_tag="Cpha266_0301"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 1.000) with cleavage site probability 0.992 at
                     residue 38"
     misc_feature    complement(335007..335537)
                     /locus_tag="Cpha266_0301"
                     /note="Transglycosylase; Region: Transgly; pfam00912"
                     /db_xref="CDD:201501"
     misc_feature    complement(333729..335504)
                     /locus_tag="Cpha266_0301"
                     /note="penicillin-binding protein, 1A family; Region:
                     PBP_1a_fam; TIGR02074"
                     /db_xref="CDD:233710"
     misc_feature    complement(<334701..>334829)
                     /locus_tag="Cpha266_0301"
                     /note="N-terminal Mad Homology 1 (MH1) domain; Region:
                     MH1; cl00055"
                     /db_xref="CDD:241576"
     misc_feature    complement(order(334707..334709,334800..334805))
                     /locus_tag="Cpha266_0301"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:199811"
     misc_feature    complement(333729..334571)
                     /locus_tag="Cpha266_0301"
                     /note="Penicillin binding protein transpeptidase domain;
                     Region: Transpeptidase; cl17760"
                     /db_xref="CDD:248314"
     gene            complement(335760..336683)
                     /locus_tag="Cpha266_0302"
                     /db_xref="GeneID:4570792"
     CDS             complement(335760..336683)
                     /locus_tag="Cpha266_0302"
                     /note="PFAM: alpha/beta hydrolase fold;
                     KEGG: plt:Plut_1944 proline iminopeptidase, putative"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="YP_910788.1"
                     /db_xref="GI:119356144"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR003089"
                     /db_xref="InterPro:IPR008262"
                     /db_xref="GeneID:4570792"
                     /translation="MSYLASSRCKLYYEDSAEANPAHLDKPAVLFVNGWAISSRYWKP
                     LVQALSGSFRCIIYDQSGTGKTLIKGHNPSFTIQGFADEAGELIEHLGLNKSRNLHIV
                     GHSMGGMVATELSLRYKTALVSSAIIACGIFEETAFTSFGLFFLGGLIDVSMNFRNVF
                     QSEPFRSMFIKRAATKEIAKEYGDIIIEDFTQSDKDATNAAGKFSIDPEALRAYTRHV
                     IEIASPVLCCVGMADHTIPPEGTITLFETRKARSSAPTTLVQFMNLGHLPMLEDTDNF
                     AEALIKHFDSARKFHENNSTEPARCKQYQIS"
     misc_feature    complement(335823..336683)
                     /locus_tag="Cpha266_0302"
                     /note="Predicted hydrolases or acyltransferases
                     (alpha/beta hydrolase superfamily) [General function
                     prediction only]; Region: MhpC; COG0596"
                     /db_xref="CDD:223669"
     misc_feature    complement(<336291..>336467)
                     /locus_tag="Cpha266_0302"
                     /note="homoserine O-acetyltransferase; Provisional;
                     Region: metX; cl17114"
                     /db_xref="CDD:247710"
     gene            336916..337584
                     /locus_tag="Cpha266_0303"
                     /db_xref="GeneID:4570595"
     CDS             336916..337584
                     /locus_tag="Cpha266_0303"
                     /note="KEGG: plt:Plut_1943 DedA protein"
                     /codon_start=1
                     /transl_table=11
                     /product="DedA protein"
                     /protein_id="YP_910789.1"
                     /db_xref="GI:119356145"
                     /db_xref="GeneID:4570595"
                     /translation="MDNSFTGILSTIIDFILHIDTHLQALASEYGIWLYGILFLIIFC
                     ETGLVVTPFLPGDSLLFAAGSLASMPGSELDQHLLFLIFFVAAVLGDTLNYTIGHKLG
                     PKVFGYEKTRFFNPDYLDKTNAFFKKYGGKTIIIARFIPIIRTFAPFVAGIGAMSYKK
                     FILFNIIGALLWVGLFNYSGYFFGQLPFVQKNFKLLILFIIIISVLPPVFEYLKHRFR
                     RSGQ"
     misc_feature    336949..337563
                     /locus_tag="Cpha266_0303"
                     /note="SNARE associated Golgi protein; Region:
                     SNARE_assoc; cl00429"
                     /db_xref="CDD:241858"
     misc_feature    336970..337494
                     /locus_tag="Cpha266_0303"
                     /note="Uncharacterized membrane-associated protein
                     [Function unknown]; Region: DedA; COG0586"
                     /db_xref="CDD:223659"
     gene            337928..338001
                     /locus_tag="Cpha266_R0007"
                     /note="tRNA-Pro1"
                     /db_xref="GeneID:4570596"
     tRNA            337928..338001
                     /locus_tag="Cpha266_R0007"
                     /product="tRNA-Pro"
                     /db_xref="GeneID:4570596"
     gene            338068..338544
                     /locus_tag="Cpha266_0304"
                     /db_xref="GeneID:4570597"
     CDS             338068..338544
                     /locus_tag="Cpha266_0304"
                     /note="PFAM: transcription activator, effector binding;
                     KEGG: cte:CT0179 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription activator, effector binding"
                     /protein_id="YP_910790.1"
                     /db_xref="GI:119356146"
                     /db_xref="InterPro:IPR010499"
                     /db_xref="GeneID:4570597"
                     /translation="MDFECAFVPELLELTPIPAVTIKCTTTVAAIPALFDSGYRRILE
                     YLKRESAGTAGPPFAIYTTLDSDDIDVEFGFPVTRSVAGSGSLTESRTPSGKAVSILF
                     IGPYEDVEPAYDALLKWVADNNLTAGSVAYEVYLSDPKDTLPEMQQTRIHLLLEQS"
     misc_feature    338092..338484
                     /locus_tag="Cpha266_0304"
                     /note="Transcriptional regulator, effector-binding
                     domain/component [Transcription / Signal transduction
                     mechanisms]; Region: COG4978"
                     /db_xref="CDD:227312"
     gene            338629..340107
                     /locus_tag="Cpha266_0305"
                     /db_xref="GeneID:4570598"
     CDS             338629..340107
                     /locus_tag="Cpha266_0305"
                     /note="PFAM: amine oxidase; FAD dependent oxidoreductase;
                     KEGG: cte:CT0180 lycopene cyclase, putative"
                     /codon_start=1
                     /transl_table=11
                     /product="amine oxidase"
                     /protein_id="YP_910791.1"
                     /db_xref="GI:119356147"
                     /db_xref="InterPro:IPR000759"
                     /db_xref="InterPro:IPR001613"
                     /db_xref="InterPro:IPR002937"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="InterPro:IPR008151"
                     /db_xref="GeneID:4570598"
                     /translation="MDMENYNVVVIGAGIGGLAAGALLARKGLQVTVLEAQDYPGGCA
                     ATFSMQGYRFDAGATIGCGFHPGAPMDMLGRELGISWPVTPEPVAWQYRHRGITLNLT
                     TSRSEIINRFPRSEAFWKEQSLLAALLWRLAEGGLSWPVKGPRDLALLARKGVAELPG
                     TAVLLKFAAKTAREWLASHDLDTDAEFVRFLDAQLLVSVQTTTMHANALNAAIALDLP
                     VSGASRIAGGIGRVSEQLAGSIAESGGAVLYGQEVTRIDSVRREVIGVETRDGGAFAA
                     DFTIANLTPDSLEKLVDMEGEPFSREEIGAKWSAFVLYLGMDAAFFGGVLPTHLQIVA
                     GSGELAECGSIFVSASSPVETDRAPEGLCAVTISTHTAPEPWFEAKKRGQSAYLEMKE
                     RYTEKVLDLFSEQIPGVREAIKSITASTPVTWERYTGRANGHVGGYPQTSLFNVRGPA
                     TRFDNLFLVGDSIFPGQSLPGVVTGARRSVELLLQRMAKGTR"
     misc_feature    338704..340080
                     /locus_tag="Cpha266_0305"
                     /note="C-3',4' desaturase CrtD; Region: desat_CrtD;
                     TIGR02733"
                     /db_xref="CDD:233987"
     misc_feature    <338704..338826
                     /locus_tag="Cpha266_0305"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; pfam13450"
                     /db_xref="CDD:205628"
     misc_feature    <339316..>339522
                     /locus_tag="Cpha266_0305"
                     /note="hydroxyglutarate oxidase; Provisional; Region:
                     PRK11728"
                     /db_xref="CDD:183292"
     gene            340193..341449
                     /locus_tag="Cpha266_0306"
                     /db_xref="GeneID:4570599"
     CDS             340193..341449
                     /locus_tag="Cpha266_0306"
                     /note="KEGG: cch:Cag_1575 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910792.1"
                     /db_xref="GI:119356148"
                     /db_xref="GeneID:4570599"
                     /translation="MNTLEKLQILSGAARYDASCSSSGSKREGSSSGLGNTSSSGICH
                     SWSDDGRCISLLKILLSNDCRYDCAYCVNRISNPVQRASFTAREVVDLTMEFYRRNYI
                     EGLFLSSAVMQSPDHTMERMVSVAETLRIDEKFGGYIHLKIIPGSSSELVRKAGLYAD
                     RISVNIELPSETALQRLAPQKQKAGILEPMAFIGREIKGSLLERQRGRNATPRFAPAG
                     QSTQMIIGASPESDFQILKLSQGLYKKMNLKRVYYSAFIPVNEDSRLPVLASPPLLRE
                     HRLYQADWLLRFYGFTAEEILSDEAPNLDETFDPKTAWALRNPGFFPVEINRADYSVL
                     LRVPGIGVTSARRIVAARRFASITPEGMKKIGVVMKRAKYFITCSGRPFENTDRQPAL
                     LKSRLLLAGGVAPEPPKQLVLPGLFA"
     misc_feature    340202..341386
                     /locus_tag="Cpha266_0306"
                     /note="putative DNA modification/repair radical SAM
                     protein; Region: rSAM_link_UDG; TIGR03916"
                     /db_xref="CDD:188431"
     gene            341454..342191
                     /locus_tag="Cpha266_0307"
                     /db_xref="GeneID:4570600"
     CDS             341454..342191
                     /locus_tag="Cpha266_0307"
                     /note="KEGG: cte:CT0182 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910793.1"
                     /db_xref="GI:119356149"
                     /db_xref="GeneID:4570600"
                     /translation="MNSYLYDGTPEGLLSAAFRIIADVSDPEKATLAERRDTLFEEGE
                     FIGTDAVAAEKLFKRLRLEAPDAAYIFYYFTLAEKEGLETSLLRYLALALRHGDRVNG
                     NLIDPAVRDVVSVSRKAQRELHRMKGLVRFEKLRDGAYLARMEPDHNILQPLAVHFSR
                     RLRAEDWFIYDVRRRFAARWHCGNLQFGTIEQFTAPALSEEEMRIQALWQAFFKTIAI
                     SDRKNPGLQKSNMPMKYWKYLTEKQGE"
     misc_feature    341463..342179
                     /locus_tag="Cpha266_0307"
                     /note="probable DNA metabolism protein; Region:
                     SAM_7_link_chp; TIGR03915"
                     /db_xref="CDD:234394"
     gene            complement(342385..343239)
                     /locus_tag="Cpha266_0308"
                     /db_xref="GeneID:4570601"
     CDS             complement(342385..343239)
                     /locus_tag="Cpha266_0308"
                     /note="PFAM: beta-lactamase domain protein;
                     KEGG: cte:CT0187 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase domain-containing protein"
                     /protein_id="YP_910794.1"
                     /db_xref="GI:119356150"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="GeneID:4570601"
                     /translation="MQQRSTTITILADNCAAPGLKTEHGLSFFIEKEDITILFDTACD
                     NTLLYNAGALGVDLSQTELLVLSHGHYDHTGGVAEVLFLAPNANIYLHPAAFQERYSI
                     RNGTAKPTSMPDHARSAIINLPQQQIHRVSKPTMLCSGIGITGPIPRLTSYENPGGPF
                     FLDTTGKQPDPIDDDLSLWIESENGLIIVTGCCHAGLINTIRSIVEHTGEKRIAALIG
                     GFHLSAASTERLEKTVKELKEYDIRQIVPCHCTGKNATEYLAQFLGCPVEAGYAGLKL
                     EFQNPPQV"
     misc_feature    complement(342406..343218)
                     /locus_tag="Cpha266_0308"
                     /note="Metal-dependent hydrolases of the beta-lactamase
                     superfamily II [General function prediction only]; Region:
                     COG1237"
                     /db_xref="CDD:224158"
     gene            complement(343261..343833)
                     /locus_tag="Cpha266_0309"
                     /db_xref="GeneID:4570602"
     CDS             complement(343261..343833)
                     /locus_tag="Cpha266_0309"
                     /note="KEGG: cch:Cag_1755 outer surface protein, putative"
                     /codon_start=1
                     /transl_table=11
                     /product="outer surface protein, putative"
                     /protein_id="YP_910795.1"
                     /db_xref="GI:119356151"
                     /db_xref="GeneID:4570602"
                     /translation="MNRIKGVLGGMFTLFCTVSFAQAATPYASASAGVAILGTSKTET
                     MPETSMSYDPGYALTGAIGLEKGKIRFEGEVGYQKNGLKNTADTDVSIMTYMANGYVD
                     FKLPLSPVTPYVTAGAGVAGVKADGFGFDDDSSTVLAGQVGAGAGFSVAPFVKIDLKY
                     RYFMASDAEFDHEKFSIDSHNVMLGIRVGL"
     sig_peptide     complement(343762..343833)
                     /locus_tag="Cpha266_0309"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 1.000) with cleavage site probability 0.808 at
                     residue 24"
     misc_feature    complement(343270..>343584)
                     /locus_tag="Cpha266_0309"
                     /note="Opacity protein and related surface antigens [Cell
                     envelope biogenesis, outer membrane]; Region: COG3637"
                     /db_xref="CDD:226163"
     gene            344055..344348
                     /locus_tag="Cpha266_0310"
                     /db_xref="GeneID:4570603"
     CDS             344055..344348
                     /locus_tag="Cpha266_0310"
                     /note="KEGG: cte:CT0188 C-type cytochrome, putative"
                     /codon_start=1
                     /transl_table=11
                     /product="C-type cytochrome, putative"
                     /protein_id="YP_910796.1"
                     /db_xref="GI:119356152"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="GeneID:4570603"
                     /translation="MMLCLSVAVSVPVFADKAPSSLQGKKLFNSSSLGGAANTKTCNA
                     CHPGGRGLESAGGNPELSKVINTCIAGPLNGSKLEPNSIEMQSLLLYIKSLKQ"
     sig_peptide     344055..344102
                     /locus_tag="Cpha266_0310"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 0.866) with cleavage site probability 0.858 at
                     residue 16"
     misc_feature    <344235..>344345
                     /locus_tag="Cpha266_0310"
                     /note="Cytochrome c [Energy production and conversion];
                     Region: COG3258"
                     /db_xref="CDD:225797"
     gene            344364..345188
                     /locus_tag="Cpha266_0311"
                     /db_xref="GeneID:4570604"
     CDS             344364..345188
                     /locus_tag="Cpha266_0311"
                     /note="PFAM: NAD-dependent epimerase/dehydratase;
                     6-phosphogluconate dehydrogenase, NAD-binding;
                     KEGG: plt:Plut_1936 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent epimerase/dehydratase"
                     /protein_id="YP_910797.1"
                     /db_xref="GI:119356153"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR006115"
                     /db_xref="GeneID:4570604"
                     /translation="MQKETISILGCGWLGMPLAKALIAQDYPVKGSTTNEDNLEAMRD
                     AGIEPYLVWLDPEVNGEDITDFLQSDILIVNIPPERRDDIVEYHIEQFSSLIDALGQS
                     PVRSVLFVSSTSVYPALQREVTEEDSVEPEALSGQALLHVEEMLMQETGFQTTVVRFG
                     GLIGYDRNPEKNLARMTELKDPDQPMNLIHRDDCVRIIMEIIRLQQWGEVFNACCPVH
                     PLKRDYYRRAAEVSGIPLPSLCSSEAPSPYKLVNSDKLQGALNYTFIYPDPVAQLG"
     sig_peptide     344364..344438
                     /locus_tag="Cpha266_0311"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 0.704) with cleavage site probability 0.349 at
                     residue 25"
     misc_feature    344379..345143
                     /locus_tag="Cpha266_0311"
                     /note="atypical (a) SDRs, subgroup 4; Region: SDR_a4;
                     cd05266"
                     /db_xref="CDD:187576"
     misc_feature    344391..345164
                     /locus_tag="Cpha266_0311"
                     /note="Nucleoside-diphosphate-sugar epimerases [Cell
                     envelope biogenesis, outer membrane / Carbohydrate
                     transport and metabolism]; Region: WcaG; COG0451"
                     /db_xref="CDD:223528"
     misc_feature    order(344391..344393,344397..344405,344460..344468,
                     344586..344594,344691..344699,344766..344768,
                     344778..344780,344838..344849)
                     /locus_tag="Cpha266_0311"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:187576"
     gene            345213..346583
                     /locus_tag="Cpha266_0312"
                     /db_xref="GeneID:4570605"
     CDS             345213..346583
                     /locus_tag="Cpha266_0312"
                     /EC_number="6.3.5.9"
                     /EC_number="6.3.5.-"
                     /note="TIGRFAM: cobyrinic acid a,c-diamide synthase;
                     PFAM: Cobyrinic acid a,c-diamide synthase; CobB/CobQ
                     domain protein glutamine amidotransferase;
                     KEGG: plt:Plut_1935 cobyrinic acid a,c-diamide synthase
                     CbiA"
                     /codon_start=1
                     /transl_table=11
                     /product="cobyrinate a,c-diamide synthase /
                     hydrogenobyrinic acid a,c-diamide synthase"
                     /protein_id="YP_910798.1"
                     /db_xref="GI:119356154"
                     /db_xref="InterPro:IPR002586"
                     /db_xref="InterPro:IPR004484"
                     /db_xref="InterPro:IPR011698"
                     /db_xref="GeneID:4570605"
                     /translation="MEKLDLCKKKPAFMLAAPSSGSGKTTLTLALLRILARRGYRVQP
                     FKCGPDYLDTRLHSLAASYGSMVSDGINLDTFMASESHVKELFSRYSCGSDASVVEGV
                     MGLFDGAEKARGSSAEIAKLLGIPVIMVVNAQSMAYSAAPLLYGYRTFDPDVHLVGVI
                     FNQVNTPSHYRYLEEAAFDAGVDPLGYVPRHEPIVISERHLGLNTSSSYDRQGAIEAM
                     ADHIEKSVAVDRLLELVGRDRESFSGSTSLDFHQRERGEKVIAVARDEAFNFTYLENL
                     DVLSQFGRIEFFSPMEDGRLPACDLLYLAGGYPELYAETLSSNSEMRRAIAAYCLGGG
                     AAYAECGGMMYLGAAMTLGDGLRYPMCGVLDLDTTMQDSRLTLGYRKVRLDTGYTKEL
                     RGHEFHYSRIERSGELHTIASITNARDEATETLLFRRQNTFASYLHLYWGETRDFPAF
                     LLNRES"
     misc_feature    345243..346574
                     /locus_tag="Cpha266_0312"
                     /note="cobyrinic acid a,c-diamide synthase; Validated;
                     Region: PRK01077"
                     /db_xref="CDD:234896"
     misc_feature    345990..346568
                     /locus_tag="Cpha266_0312"
                     /note="Type 1 glutamine amidotransferase (GATase1) domain
                     found in Cobyrinic Acid a,c-Diamide Synthase; Region:
                     GATase1_CobB; cd03130"
                     /db_xref="CDD:153224"
     misc_feature    order(346230..346232,346530..346532,346536..346538)
                     /locus_tag="Cpha266_0312"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:153224"
     gene            346590..347165
                     /locus_tag="Cpha266_0313"
                     /db_xref="GeneID:4570606"
     CDS             346590..347165
                     /locus_tag="Cpha266_0313"
                     /note="KEGG: plt:Plut_1934 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910799.1"
                     /db_xref="GI:119356155"
                     /db_xref="GeneID:4570606"
                     /translation="MNSSGYIITGGPGSGKSTLLEAMRDAGYCCFSEVSRQLIRQQSL
                     LADGVLPWNNLPAFARLAFDAMMRQHDQAIDHDGICFFDRGIPDVFGYLEEGGHPVPA
                     CYIDAHERCRYEKNVIVLPPWKEIFTNDSERPQSFQQSVRLYRSICSVYERLGYTLHE
                     LPKSSVNERVRYLLKHFTELQAPARQQFYLH"
     misc_feature    346605..347111
                     /locus_tag="Cpha266_0313"
                     /note="Predicted ATPase [General function prediction
                     only]; Region: COG3911"
                     /db_xref="CDD:226426"
     misc_feature    346605..347096
                     /locus_tag="Cpha266_0313"
                     /note="AAA domain; Region: AAA_28; pfam13521"
                     /db_xref="CDD:222194"
     gene            347331..347825
                     /locus_tag="Cpha266_0314"
                     /db_xref="GeneID:4570607"
     CDS             347331..347825
                     /locus_tag="Cpha266_0314"
                     /note="PFAM: ferric-uptake regulator;
                     KEGG: plt:Plut_1474 putative ferric uptake regulator, FUR
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="ferric uptake regulator family protein"
                     /protein_id="YP_910800.1"
                     /db_xref="GI:119356156"
                     /db_xref="InterPro:IPR002481"
                     /db_xref="GeneID:4570607"
                     /translation="MADISLQTKKETSDKTRQAESLFKSFMKEQGLRCTTERIAVLRE
                     LYRSNTHLDADEIFIRLKKKQVGISRATVYHTLNLLFKFHLVSKIDLGHKHTHYEKSH
                     GVTNHLHIICEKCGNVVEVSESGLSELLDRVCRENGFELGSFSLQVFGKCVGNCDENC
                     PKQK"
     misc_feature    347442..347786
                     /locus_tag="Cpha266_0314"
                     /note="Ferric uptake regulator(Fur) and related
                     metalloregulatory proteins; typically iron-dependent,
                     DNA-binding repressors and activators; Region: Fur_like;
                     cd07153"
                     /db_xref="CDD:133478"
     misc_feature    order(347481..347483,347625..347627,347649..347651,
                     347655..347657,347688..347690)
                     /locus_tag="Cpha266_0314"
                     /note="metal binding site 2 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:133478"
     misc_feature    347535..347579
                     /locus_tag="Cpha266_0314"
                     /note="putative DNA binding helix; other site"
                     /db_xref="CDD:133478"
     misc_feature    order(347646..347648,347652..347654,347709..347711,
                     347760..347762)
                     /locus_tag="Cpha266_0314"
                     /note="metal binding site 1 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:133478"
     misc_feature    order(347661..347669,347715..347720,347745..347753,
                     347757..347783)
                     /locus_tag="Cpha266_0314"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:133478"
     misc_feature    order(347664..347666,347673..347675,347784..347786)
                     /locus_tag="Cpha266_0314"
                     /note="structural Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:133478"
     gene            complement(347869..348480)
                     /locus_tag="Cpha266_0315"
                     /db_xref="GeneID:4570608"
     CDS             complement(347869..348480)
                     /locus_tag="Cpha266_0315"
                     /note="KEGG: pca:Pcar_0880 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910801.1"
                     /db_xref="GI:119356157"
                     /db_xref="GeneID:4570608"
                     /translation="MQQRFSKNQEQKLSNWRRRLNTQKKSEVLFEHWLFMHTAAVLFA
                     GKPGELLILKRGLFGLLPEETLESIDSFCSSLALQFNVLLENEHSIKVIFYNEVAVDR
                     RIGCIPKKILHCNLRYPFGLRSESFLKELGRRWLESGTTPHEIGIVLGYPLKDVWGFM
                     GISSDPCSGSCGWRIYGNPLPSLKKRTLYNHARTRAETYLRAA"
     misc_feature    complement(347893..348381)
                     /locus_tag="Cpha266_0315"
                     /note="Protein of unknown function (DUF3793); Region:
                     DUF3793; pfam12672"
                     /db_xref="CDD:221701"
     gene            348685..349698
                     /locus_tag="Cpha266_0316"
                     /db_xref="GeneID:4570609"
     CDS             348685..349698
                     /locus_tag="Cpha266_0316"
                     /note="KEGG: plt:Plut_0619 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910802.1"
                     /db_xref="GI:119356158"
                     /db_xref="GeneID:4570609"
                     /translation="MNVLLKSTALVGISLVCSSGLFAAEESRQSAALEPALFKGLSFS
                     GLLEVEGAYGESDGESSSDLSLATVELGLEAKVTDWLSARILLLYEQNGDDRILVDEA
                     SIRVQRDNSPFFVQAGRFTQSFGNFATGMISDPITLELGETKHHASLQAGYEGEIVSA
                     SFSFFKGDVQKEGMDEVNSFVGALSIGGEVNERFRYELGGSYCSNMADTDGLQDDFEP
                     DLYRTADYVGGYSVYGLLGFGSVEVRAEYLAAAESFVDGERSGLKPAAYNVEVGCDLP
                     ESLHLALRYAGAEDFNVEKQYGATLACDLSEKATLALEYLHNSNDDETSSDAVTVQLA
                     MSF"
     sig_peptide     348685..348756
                     /locus_tag="Cpha266_0316"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 1.000) with cleavage site probability 1.000 at
                     residue 24"
     gene            349728..350033
                     /locus_tag="Cpha266_0317"
                     /db_xref="GeneID:4570610"
     CDS             349728..350033
                     /locus_tag="Cpha266_0317"
                     /note="PFAM: FeoA family protein;
                     KEGG: cte:CT1744 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="FeoA family protein"
                     /protein_id="YP_910803.1"
                     /db_xref="GI:119356159"
                     /db_xref="InterPro:IPR007167"
                     /db_xref="GeneID:4570610"
                     /translation="MMVPLGFLLQGESAEIVGFRSGREKEHRGFRHGSGAGHGRAHRC
                     AEITKEQRLVEMGFCPGEVIEVLQSKAGGLLLLKLRDSRLALDKQIAMDIIVRRVTA"
     gene            350030..350257
                     /locus_tag="Cpha266_0318"
                     /db_xref="GeneID:4570611"
     CDS             350030..350257
                     /locus_tag="Cpha266_0318"
                     /note="PFAM: FeoA family protein;
                     KEGG: cte:CT1743 ferrous iron transport protein A"
                     /codon_start=1
                     /transl_table=11
                     /product="FeoA family protein"
                     /protein_id="YP_910804.1"
                     /db_xref="GI:119356160"
                     /db_xref="InterPro:IPR007167"
                     /db_xref="GeneID:4570611"
                     /translation="MNLSELKKGQAGRVVKLSAVPQLRRRLLDMGVLVGEMIRVVGVA
                     PLGDPVEVTVKNYKLSLRKKEVEGVIVEEVS"
     misc_feature    350030..350221
                     /locus_tag="Cpha266_0318"
                     /note="FeoA domain; Region: FeoA; pfam04023"
                     /db_xref="CDD:217849"
     gene            350257..350436
                     /locus_tag="Cpha266_0319"
                     /db_xref="GeneID:4570612"
     CDS             350257..350436
                     /locus_tag="Cpha266_0319"
                     /note="KEGG: cte:CT1742 ferrous iron transport protein B"
                     /codon_start=1
                     /transl_table=11
                     /product="Fe2+ transport system protein B-like"
                     /protein_id="YP_910805.1"
                     /db_xref="GI:119356161"
                     /db_xref="GeneID:4570612"
                     /translation="MQVTETAGELVKPEKIIGKPSVIAVVGNPNSGKTTLFNALTGMN
                     QRVGNWPGVINPAIK"
     misc_feature    350326..>350415
                     /locus_tag="Cpha266_0319"
                     /note="Rat sarcoma (Ras)-like superfamily of small
                     guanosine triphosphatases (GTPases); Region:
                     Ras_like_GTPase; cl17170"
                     /db_xref="CDD:247724"
     misc_feature    350335..350358
                     /locus_tag="Cpha266_0319"
                     /note="G1 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    350341..350361
                     /locus_tag="Cpha266_0319"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206648"
     gene            350470..351522
                     /locus_tag="Cpha266_0320"
                     /db_xref="GeneID:4570518"
     CDS             350470..351522
                     /locus_tag="Cpha266_0320"
                     /note="KEGG: hch:HCH_03259 transposase and inactivated
                     derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase and inactivated derivatives"
                     /protein_id="YP_910806.1"
                     /db_xref="GI:119356162"
                     /db_xref="GeneID:4570518"
                     /translation="MMKNDARSYTSDQQKLLRIKAVDMVFREGFTQRATAKALGVSRQ
                     HVVKWCKAFSSGSYEALELGRRGRRPGEQMLLQPWQCAVIFNTIRDKTPDQLKMPFVL
                     WERIGVRELIKKKFGITLALRTVGEYLKRWGMTPQRPIERAYERSSQAVENWLNNDYP
                     AIQKKAEEEGATILWGDETGVQNTSNVGRSYSPSGKTPVIRQSEKKIKTNMISAITNR
                     GKVRFMIYPGKMNQQMFIRFLERVIATIPGKVLFIVDNLKVHHGKKVAEWVTEHIGRI
                     ELFYIPSYSPDLNPDEYLNRDLKKNVNSRAIPRTEVELKMNLLSFMRKLQKLPDRVMS
                     YFNSSPIKYAARAEAV"
     misc_feature    350503..350652
                     /locus_tag="Cpha266_0320"
                     /note="Homeodomain-like domain; Region: HTH_23; pfam13384"
                     /db_xref="CDD:222091"
     misc_feature    350521..350868
                     /locus_tag="Cpha266_0320"
                     /note="Winged helix-turn helix; Region: HTH_29; pfam13551"
                     /db_xref="CDD:222216"
     misc_feature    350773..350931
                     /locus_tag="Cpha266_0320"
                     /note="Winged helix-turn helix; Region: HTH_33; pfam13592"
                     /db_xref="CDD:222248"
     misc_feature    350983..351414
                     /locus_tag="Cpha266_0320"
                     /note="DDE superfamily endonuclease; Region: DDE_3;
                     pfam13358"
                     /db_xref="CDD:222070"
     misc_feature    351100..351495
                     /locus_tag="Cpha266_0320"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3335"
                     /db_xref="CDD:225872"
     gene            351497..353752
                     /locus_tag="Cpha266_0321"
                     /db_xref="GeneID:4570519"
     CDS             351497..353752
                     /locus_tag="Cpha266_0321"
                     /note="TIGRFAM: ferrous iron transport protein B;
                     PFAM: Ferrous iron transport protein B domain protein;
                     Ferrous iron transport B domain protein; nucleoside
                     recognition domain protein;
                     KEGG: cte:CT1742 ferrous iron transport protein B"
                     /codon_start=1
                     /transl_table=11
                     /product="ferrous iron transport protein B"
                     /protein_id="YP_910807.1"
                     /db_xref="GI:119356163"
                     /db_xref="InterPro:IPR003373"
                     /db_xref="InterPro:IPR011619"
                     /db_xref="InterPro:IPR011640"
                     /db_xref="InterPro:IPR011642"
                     /db_xref="GeneID:4570519"
                     /translation="MLLVPKRCNVFDCRINTVDKKTGFFTHNGRHYELVDLPGIYSLS
                     ALSQDEEIAREFILEGQADLIINIVDASNPDRNLYLTSRLLEMKVPVLIALNMMDAAK
                     GRGIAFDIARLSSRIGCRIVPLVASRKDGVAELKDAIEEEICLKSFKGCRVTYPACIE
                     KSIRELSTDIRRFAEDAHYDPDWFALKLLEGDHLLESLIPVSEKDRVVGYRSEIADTL
                     GDDPDILVADAHYRFINELSSESIRRTSEKGESLSDRIDRVVLNRFAGIPIFLAVMYL
                     MFLFTINLGGAFIDFFDIAAGALFVDGFGELLHLSGSPEWLTAILATGLGGALQTIAT
                     FIPPIGFMFIALSLLEDSGYMARAAYVMDRGMRAIGLPGRAFIPLLVGFGCNIPAIMS
                     ARTMSDERDRILTIMMVPFMSCGARLPVYVLFAAAFFPSGGQNLVFLLYLIGVAVAVL
                     TGFILKSTLLKGDISPFIMEMPAYHIPTVKGVFMRVWDRLNSFLVRAGRVLVPVIMVL
                     GLMNSLGTDGTFGNEDSENSMLAVTGKAIAPVFVPMGISEDNWPATVGLFTGIFAKEA
                     VVGTLNSLYAGMGRTAAAVEGVSEESDLNLMERFGEAFRTIPENISAITGSLLDPLGI
                     SVGDVSDRAGVAEEQGVEVTIFGTMAALFDGTAGAFAYLLFVLLYFPCVAAIAAVYRE
                     TNLAWTLFAGAWTTGLAYILAVIAYQAPTYSSHPVSSAVWIAAMVGILAAAVVVMYLL
                     GSRGFRKKTGV"
     misc_feature    351545..353749
                     /locus_tag="Cpha266_0321"
                     /note="ferrous iron transport protein B; Reviewed; Region:
                     feoB; PRK09554"
                     /db_xref="CDD:236563"
     misc_feature    351545..351919
                     /locus_tag="Cpha266_0321"
                     /note="Ferrous iron transport protein B (FeoB) family;
                     Region: FeoB; cd01879"
                     /db_xref="CDD:206667"
     misc_feature    351545..351556
                     /locus_tag="Cpha266_0321"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206667"
     misc_feature    351545..351547
                     /locus_tag="Cpha266_0321"
                     /note="G2 box; other site"
                     /db_xref="CDD:206667"
     misc_feature    351602..351613
                     /locus_tag="Cpha266_0321"
                     /note="G3 box; other site"
                     /db_xref="CDD:206667"
     misc_feature    order(351611..351667,351677..351682)
                     /locus_tag="Cpha266_0321"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206667"
     misc_feature    order(351782..351787,351791..351793,351869..351877)
                     /locus_tag="Cpha266_0321"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206667"
     misc_feature    351782..351793
                     /locus_tag="Cpha266_0321"
                     /note="G4 box; other site"
                     /db_xref="CDD:206667"
     misc_feature    351869..351877
                     /locus_tag="Cpha266_0321"
                     /note="G5 box; other site"
                     /db_xref="CDD:206667"
     misc_feature    352490..352780
                     /locus_tag="Cpha266_0321"
                     /note="Nucleoside recognition; Region: Gate; pfam07670"
                     /db_xref="CDD:219507"
     misc_feature    352805..352963
                     /locus_tag="Cpha266_0321"
                     /note="Ferrous iron transport protein B C terminus;
                     Region: FeoB_C; pfam07664"
                     /db_xref="CDD:203715"
     gene            353759..354046
                     /locus_tag="Cpha266_0322"
                     /db_xref="GeneID:4570520"
     CDS             353759..354046
                     /locus_tag="Cpha266_0322"
                     /note="KEGG: cte:CT1741 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910808.1"
                     /db_xref="GI:119356164"
                     /db_xref="GeneID:4570520"
                     /translation="MIFMGRRHVRLPAQIQNKRFSMTLTDLKGFIQERRRVSLSEIAG
                     YFKADMAMIESMLDHWIRKGRVQVKQADAFSASCCGKCGGHKQVWYTWVDG"
     misc_feature    353825..354028
                     /locus_tag="Cpha266_0322"
                     /note="FeoC like transcriptional regulator; Region: FeoC;
                     pfam09012"
                     /db_xref="CDD:220089"
     gene            354158..354511
                     /locus_tag="Cpha266_0323"
                     /db_xref="GeneID:4570521"
     CDS             354158..354511
                     /locus_tag="Cpha266_0323"
                     /note="KEGG: cte:CT1739 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910809.1"
                     /db_xref="GI:119356165"
                     /db_xref="GeneID:4570521"
                     /translation="MNGNEKKRGRCSARCVVNKCSCGAFHLHYRYAVVIIGKQTLFQI
                     MEDCYRWEELNVGMSEGWCTKPFVVMLGIVTITVPQVDFEEFSKAIQDAVSLELDLPG
                     IAGGLLSFPGSSASK"
     gene            354556..355062
                     /locus_tag="Cpha266_0324"
                     /db_xref="GeneID:4570522"
     CDS             354556..355062
                     /locus_tag="Cpha266_0324"
                     /note="TIGRFAM: flavodoxin;
                     PFAM: flavodoxin/nitric oxide synthase;
                     KEGG: syn:sll0248 flavodoxin"
                     /codon_start=1
                     /transl_table=11
                     /product="flavodoxin"
                     /protein_id="YP_910810.1"
                     /db_xref="GI:119356166"
                     /db_xref="InterPro:IPR001094"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR010086"
                     /db_xref="GeneID:4570522"
                     /translation="MKRIGLFWGSQTGNTELAATLIVEAIGSDIVQSYDIRGVDSGTF
                     GSYDSLILGTSTWGAGELQDDWDSFLPQFDAIDFIGKKVALFGLGDQLGYGDYFLDGM
                     GILYENLIGRGAKVTGSWSVDGYEHSYSRAIQYGAFVGLALDADNQNHLTPVRIKQWV
                     DQILPILL"
     misc_feature    354556..355050
                     /locus_tag="Cpha266_0324"
                     /note="flavodoxin FldA; Validated; Region: PRK09267"
                     /db_xref="CDD:236439"
     gene            355270..356934
                     /locus_tag="Cpha266_0325"
                     /db_xref="GeneID:4570523"
     CDS             355270..356934
                     /locus_tag="Cpha266_0325"
                     /note="PFAM: transposase, IS4 family protein;
                     KEGG: tte:TTE2518 transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase, IS4 family protein"
                     /protein_id="YP_910811.1"
                     /db_xref="GI:119356167"
                     /db_xref="InterPro:IPR002559"
                     /db_xref="GeneID:4570523"
                     /translation="MFVRVKSTPNSPRQSVQIVASERIGDKVKQRIVRYVGIAMNDEE
                     LVKMKELAEFIKAGLEAESAPTLFRPDELARMAIEGRKTADLSSDQPLTVDLKLLREE
                     SRVVVGIHEIYGKLFDELGFDRVLGNPARRVQAAKTIKHLVLARIANPASKRKSVIDL
                     ERDFGVKLDLSAVYRTLDYVDEQSIELIQKKAWEAATGLFGEKIDVVFYDCTTLYFES
                     FTDDELRDKGLSKENKHSEVQVLLAMMVSKHGFPLGYRLYNGATWEGHTLKDAIEQIK
                     GMAEVDRVVFVADSGLLSKENLALIEQSEKQYIVAARLKNQPETIKEQILDKAGYQQG
                     EQIRFKEIPLPENRRLLVSYSEKRARKDAFDRQKALDKLQKKLNKSKNPESFLKNTSY
                     RKYVKIEQLSQQTVIIDEEKISYTAQWDGLHGVITNITDITASDAFEHYRGLWQIEET
                     FRLTKHDLKVRPIYHWTPRRIEAHVAMCFMALVCIRHLSYRVQLQYQALSPEIIRNEL
                     VHVQQSILMHKTNGCRYGIPSKPTLHAQKIYQVMGEKLSATPFLIQ"
     misc_feature    <355876..356817
                     /locus_tag="Cpha266_0325"
                     /note="Transposase [DNA replication, recombination, and
                     repair]; Region: COG5421"
                     /db_xref="CDD:227708"
     gene            357017..357337
                     /locus_tag="Cpha266_0326"
                     /pseudo
                     /db_xref="GeneID:4570524"
     gene            357376..357720
                     /locus_tag="Cpha266_0327"
                     /pseudo
                     /db_xref="GeneID:4570525"
     gene            357832..359403
                     /locus_tag="Cpha266_0328"
                     /db_xref="GeneID:4570526"
     CDS             357832..359403
                     /locus_tag="Cpha266_0328"
                     /note="PFAM: Integrase, catalytic region;
                     KEGG: bfs:BF1534 putative transposase for insertion
                     sequence element IS21-like"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase catalytic subunit"
                     /protein_id="YP_910812.1"
                     /db_xref="GI:119356168"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="GeneID:4570526"
                     /translation="MRTQLKKLTMYNKVKEFAREGLSIRQISRKTGMDRVTVRKFLRM
                     TDEEFSAFLALQKRRLRKLQPYEQFVKDRVTDYPDCSATQVEDWLKEHHPVFPEVTTR
                     TIYSFVQWIRKAYDLPKPKGTPRAYHPVEQLPYGEQAQVDFGEYWMASADACKVKVHF
                     MIMLLSRSRRKFVSFSQQPITTRFVLEAHEQAFSFFEGIPHTLVYDQDSTIVTDENRG
                     AILYTEAFRKYLLHRSLKIHLCRKSDPESKGKIEAGVKYVKYNFLPGRRFVNLEVLNQ
                     EALLWLERTANAKEHATTRLIPDAEWQVEKQHLRPFEPLPYPISGTVGKEYHVRKDNT
                     ISYRGNFYSLPVGTYAGPGTLVVLEVRQNTLCLYAQEGRLLANHPIESGKGTVVINNN
                     HRRDTSSKLRELQDSLMLLFTNQEHAERFLESIHNRYPRYSRDQFLHVRNAISGCQQK
                     LIDDALAHCVDHHLFSSGEFHDILHHYRKQEEKQSHQAVFNTFRPKTLRSDMDRMLSF
                     VPDSSGITTYENIFS"
     misc_feature    357886..358725
                     /locus_tag="Cpha266_0328"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG4584"
                     /db_xref="CDD:226950"
     misc_feature    358300..358608
                     /locus_tag="Cpha266_0328"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:216050"
     gene            359409..360245
                     /locus_tag="Cpha266_0329"
                     /db_xref="GeneID:4570527"
     CDS             359409..360245
                     /locus_tag="Cpha266_0329"
                     /note="PFAM: IstB domain protein ATP-binding protein;
                     SMART: AAA ATPase;
                     KEGG: bfs:BF1535 insertion sequence IS21-like putative
                     ATP-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="IstB ATP binding domain-containing protein"
                     /protein_id="YP_910813.1"
                     /db_xref="GI:119356169"
                     /db_xref="InterPro:IPR002611"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="GeneID:4570527"
                     /translation="MERTITTIQEHARELNLTGLAGTVDLLLEEARKSEPSYSDFALT
                     LLESELSCRRKAHLERRRKIANLPLLHDLDHYDSGVQNGISQVQLQQLRQLLWLDQNF
                     NLILIGPSGTGKSYLAGGLCHEALKLGYHALFRTMDDLIQTIRFKEITAAAAREYKRL
                     LSAHLLVIDDIMMFPLEKSVAVGLFQLVNQLHEQTSFIITTNKSPKEWAEMLGDEVLA
                     TALLDRLLYKCEVIKLTGKSYRLEHRTTIFEQQQSPEGGGNRRKKQLPLQKGVGNHCK
                     MT"
     misc_feature    359409..360140
                     /locus_tag="Cpha266_0329"
                     /note="DNA replication protein [DNA replication,
                     recombination, and repair]; Region: DnaC; COG1484"
                     /db_xref="CDD:224401"
     misc_feature    359715..360023
                     /locus_tag="Cpha266_0329"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    359730..359753
                     /locus_tag="Cpha266_0329"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(359733..359756,359913..359915,360012..360014)
                     /locus_tag="Cpha266_0329"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    359901..359918
                     /locus_tag="Cpha266_0329"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     gene            360264..360512
                     /locus_tag="Cpha266_0330"
                     /pseudo
                     /db_xref="GeneID:4570528"
     gene            360566..361108
                     /locus_tag="Cpha266_0331"
                     /db_xref="GeneID:4570529"
     CDS             360566..361108
                     /locus_tag="Cpha266_0331"
                     /note="KEGG: ana:all8069 transposase unknown protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910814.1"
                     /db_xref="GI:119356170"
                     /db_xref="GeneID:4570529"
                     /translation="MKTSILNRNGITPEIAGLITRLVTLIPWPARRQAMGDVVLTILD
                     GKPRVAENEFGWNRSAVALGIKEYESGIVCVNDLTERHKPKSEEKYPELLASIRKIME
                     PHSQAEPRLRTTLLYTNMTAQSVYNALLAEGWSEESLPAVRTISNILNRQKYRLRTVQ
                     KTKVEKKQQKQMPSSTTSGK"
     misc_feature    360845..>361036
                     /locus_tag="Cpha266_0331"
                     /note="Rhodopirellula transposase DDE domain; Region:
                     DDE_Tnp_ISAZ013; pfam07592"
                     /db_xref="CDD:148936"
     gene            361105..361797
                     /locus_tag="Cpha266_0332"
                     /db_xref="GeneID:4570530"
     CDS             361105..361797
                     /locus_tag="Cpha266_0332"
                     /note="PFAM: Rhodopirellula transposase family protein;
                     KEGG: ana:all8069 transposase unknown protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_910815.1"
                     /db_xref="GI:119356171"
                     /db_xref="InterPro:IPR011518"
                     /db_xref="GeneID:4570530"
                     /translation="MNAWADEDPETVRLSIDTKATVLVGQYSRGGKSRGTEAVKAWDH
                     DMRPREKLVPGGILEPVSGKSFLFFGSSNKTSDFLVDGLELWWEERKSSLSHVKQLVI
                     NMDNGPECNGRRSQFLYRMTVFADMSGLDIRLIYYPPYHSKYNSIERYWAGLEKSWNG
                     YLLESVTTVINRAKSFTWRGIAATAMLIDTVYQKGIKLCGKEKKQMEKRLMRSKDLQW
                     WDISIRPEMVFL"
     misc_feature    <361108..361779
                     /locus_tag="Cpha266_0332"
                     /note="Rhodopirellula transposase DDE domain; Region:
                     DDE_Tnp_ISAZ013; pfam07592"
                     /db_xref="CDD:148936"
     gene            complement(361923..362387)
                     /locus_tag="Cpha266_0333"
                     /db_xref="GeneID:4570531"
     CDS             complement(361923..362387)
                     /locus_tag="Cpha266_0333"
                     /note="KEGG: plt:Plut_1933 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910816.1"
                     /db_xref="GI:119356172"
                     /db_xref="GeneID:4570531"
                     /translation="MNVHHILLDDNNPEHRELSICRTGTINRINLNDSKYQVYASFCI
                     DAHNYAALFHYGIIEAMNELHFISESGNGLDSWDEAFLHHSALSALLPIIRRCCESID
                     PQKKETILLGWQNQPVGVAWLRMIDPVKTAGFLRDFDTFIVESEGFDLEFIL"
     gene            362562..365126
                     /locus_tag="Cpha266_0334"
                     /db_xref="GeneID:4570532"
     CDS             362562..365126
                     /locus_tag="Cpha266_0334"
                     /note="PFAM: UvrB/UvrC protein; AAA ATPase, central domain
                     protein; Clp N terminal domain protein; ATPase associated
                     with various cellular activities, AAA_5; ATPase AAA-2
                     domain protein;
                     SMART: AAA ATPase;
                     KEGG: cte:CT0191 ATP-dependent Clp protease, ATP-binding
                     subunit ClpC"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="YP_910817.1"
                     /db_xref="GI:119356173"
                     /db_xref="InterPro:IPR001270"
                     /db_xref="InterPro:IPR001943"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR004176"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="InterPro:IPR013093"
                     /db_xref="GeneID:4570532"
                     /translation="MEGNFSNRVQDVIRLSREEALRLGHDYIGTEHLLLGLIREGEGI
                     AARILKNLKIDLYRLKQKIEDSTHPKVPATQMGNVPLTKQAEKVLKITYLEAKICKSN
                     IIGTEHLLLSILKGEDNIASQILEQFGVSYDMVRDELLSITSGGTESDEPPAEGYASS
                     GGSERSAKKADPKRGERTKTPVLDNFGRDITRLALDDKLDPIIGREKEIERVAQVLSR
                     RKKNNPVLIGEPGVGKTAIAEGLALKIVQRKVSRVLYDKRVVALDLAALVAGTKYRGQ
                     FEERMKALMNELERSRDVILFIDELHTIIGAGGASGSLDASNIFKPALARGELQCIGA
                     TTLDEYRQYIEKDGALDRRFQKIMVEPATVDETILILNNIKSKYEVHHHVRYSEDAIE
                     KAVKLSERYITDRFLPDKAIDVMDEAGARVHLSNIHVPDEILELEKSIEAIKTEKNQV
                     VKMQNFEEAAKLRDKEKHLLESLDHAKQEWEDRAAESVYDVTETDITSVIAMMTGIPV
                     ARVAQSESKKLLSMEADLMKEVIGQDEAIKKITKAIQRTRAGLKDPSRPIGSFIFLGP
                     TGVGKTELAKALTRYIFDTEDALIRADMSEYMEKFSVSRLVGAPPGYVGYEEGGQLTE
                     KVRRKPYSVVLIDEIEKAHPDVFNILLQVLDEGVLTDGLGRKVDFRNTIIIMTSNIGA
                     KDIKSFGAGSGMGFTAPDDASGSYKAMKSTIEDALKRVFNPEFLNRIDDIVVFHPLEK
                     QHIFKIIDITAGKLFKRLREMGIEVEIDEKAKEFLVDKGYDQKYGARPLKRALQKYVE
                     DPLAEEMLKGRFIEGSTIRILFDEDEGELRFIDGEPATKKRKRDEKLDKEVPDPNS"
     misc_feature    362574..365051
                     /locus_tag="Cpha266_0334"
                     /note="ATP-binding subunits of Clp protease and DnaK/DnaJ
                     chaperones [Posttranslational modification, protein
                     turnover, chaperones]; Region: clpA; COG0542"
                     /db_xref="CDD:223616"
     misc_feature    362607..362756
                     /locus_tag="Cpha266_0334"
                     /note="Clp amino terminal domain; Region: Clp_N;
                     pfam02861"
                     /db_xref="CDD:217254"
     misc_feature    362844..362987
                     /locus_tag="Cpha266_0334"
                     /note="Clp amino terminal domain; Region: Clp_N;
                     pfam02861"
                     /db_xref="CDD:217254"
     misc_feature    363168..363644
                     /locus_tag="Cpha266_0334"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    363243..363266
                     /locus_tag="Cpha266_0334"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(363246..363269,363456..363458,363567..363569)
                     /locus_tag="Cpha266_0334"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    363444..363461
                     /locus_tag="Cpha266_0334"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    363618..363620
                     /locus_tag="Cpha266_0334"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    363870..363968
                     /locus_tag="Cpha266_0334"
                     /note="UvrB/uvrC motif; Region: UVR; pfam02151"
                     /db_xref="CDD:145355"
     misc_feature    364152..364598
                     /locus_tag="Cpha266_0334"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    364254..364277
                     /locus_tag="Cpha266_0334"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(364257..364280,364470..364472,364596..364598)
                     /locus_tag="Cpha266_0334"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    364458..364475
                     /locus_tag="Cpha266_0334"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    364773..365015
                     /locus_tag="Cpha266_0334"
                     /note="C-terminal, D2-small domain, of ClpB protein;
                     Region: ClpB_D2-small; pfam10431"
                     /db_xref="CDD:204486"
     gene            complement(365166..366539)
                     /locus_tag="Cpha266_0335"
                     /db_xref="GeneID:4570533"
     CDS             complement(365166..366539)
                     /locus_tag="Cpha266_0335"
                     /EC_number="4.2.1.20"
                     /note="catalyzes the formation of L-tryptophan from indole
                     and L-serine"
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan synthase subunit beta"
                     /protein_id="YP_910818.1"
                     /db_xref="GI:119356174"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="InterPro:IPR006316"
                     /db_xref="InterPro:IPR006653"
                     /db_xref="GeneID:4570533"
                     /translation="MGTDLTKIILDEHEMPRQWYNIQADLPVPLPPPVGMDGTPISPD
                     DLAQVFPMNLIEQEMSTERWIDIPEEVLSILKLWRPSPLYRAKRLEKALGTPAKIFYK
                     NEGVSPAGSHKPNTAVPQAWYNKQFGIKYLTTETGAGQWGSALAMSCKLIGIECKVFM
                     VRISFDQKPFRKIMMKTWGAECIASPSRETAIGRRILEEMPDTPGSLGIAISEAIEQA
                     VEREDTRYALGSVLNHVMLHQSIIGLEAQKQFEKIGLYPDVVIGCAGGGSNFAGISFP
                     FICDKIHGKDIQIIATEPEACPTLTKGPYIYDSGDVALMTPLLAMHSLGHGFIPPAIH
                     AGGLRYHGMAPLVSHVKQLGLIEATALPQTECYEAALLFAHTEGFIPAPETSHAIAQT
                     IREAKKAKEEGKERVILMNWSGHGLMDLQGYDAFLSGKLSDYALPDELLQQSLAAVRN
                     HPKPPGA"
     misc_feature    complement(365271..366392)
                     /locus_tag="Cpha266_0335"
                     /note="Tryptophan synthase-beta:  Trptophan synthase is a
                     bifunctional enzyme that catalyses the last two steps in
                     the biosynthesis of L-tryptophan via its alpha and beta
                     reactions. In the alpha reaction, indole 3-glycerol
                     phosphate is cleaved reversibly to...; Region:
                     Trp-synth_B; cd06446"
                     /db_xref="CDD:107207"
     misc_feature    complement(365370..366320)
                     /locus_tag="Cpha266_0335"
                     /note="Pyridoxal-phosphate dependent enzyme; Region: PALP;
                     pfam00291"
                     /db_xref="CDD:215840"
     misc_feature    complement(order(365301..365303,365388..365390,
                     365733..365747,365850..365852,366120..366122,
                     366201..366206))
                     /locus_tag="Cpha266_0335"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:107207"
     misc_feature    complement(366201..366203)
                     /locus_tag="Cpha266_0335"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:107207"
     gene            complement(366885..366973)
                     /locus_tag="Cpha266_R0008"
                     /note="tRNA-Leu5"
                     /db_xref="GeneID:4570534"
     tRNA            complement(366885..366973)
                     /locus_tag="Cpha266_R0008"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:4570534"
     gene            complement(367091..368158)
                     /locus_tag="Cpha266_0336"
                     /db_xref="GeneID:4570535"
     CDS             complement(367091..368158)
                     /locus_tag="Cpha266_0336"
                     /note="TIGRFAM: thiamine-monophosphate kinase;
                     PFAM: AIR synthase related protein domain protein;
                     KEGG: plt:Plut_1928 thiamine-monophosphate kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine-monophosphate kinase"
                     /protein_id="YP_910819.1"
                     /db_xref="GI:119356175"
                     /db_xref="InterPro:IPR006283"
                     /db_xref="InterPro:IPR010918"
                     /db_xref="GeneID:4570535"
                     /translation="MPYKAISDLGEFGLIDRISSLVGPTLDASPNLLTGIGDDCAVYQ
                     PTAGMLEVTTTDLLVEKVHFDLLTTPLKHLGSKSISVNVSDICAMNATPQYALIGIAV
                     PPSFSVEMIEELYKGMSHAARIYGVAIAGGDTSVSRSGLFISVTMTGEVSGERLTRRS
                     GAKPGEMICVTGTLGGAAAGLRLLMREKNIMLEHIEHHEPYNKSLMVDLEEYADAIKE
                     QLLPAARIDIIRFFHSRNINPTAMIDISDGLSSDLRHLCNSSGTGAVIHEGRIPVHSG
                     ARRIADELRDDALGWSLTGGEDYQLLFTLPKERFPDIAEHDDISIIGEITEKDAGISL
                     VDIYGMSIDLEKLPGYDHFRS"
     misc_feature    complement(367100..368140)
                     /locus_tag="Cpha266_0336"
                     /note="thiamine monophosphate kinase; Provisional; Region:
                     PRK05731"
                     /db_xref="CDD:235583"
     misc_feature    complement(367181..368131)
                     /locus_tag="Cpha266_0336"
                     /note="ThiL (Thiamine-monophosphate kinase) plays a dual
                     role in de novo biosynthesis and in salvage of exogenous
                     thiamine. Thiamine salvage occurs in two steps, with
                     thiamine kinase catalyzing the formation of thiamine
                     phosphate, and ThiL catalyzing the...; Region: ThiL;
                     cd02194"
                     /db_xref="CDD:100030"
     misc_feature    complement(order(367418..367423,367427..367429,
                     367682..367684,367760..367768,367814..367816,
                     367865..367867,367904..367906,368042..368050,
                     368114..368116))
                     /locus_tag="Cpha266_0336"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:100030"
     misc_feature    complement(order(367721..367723,367727..367729,
                     367751..367762,367769..367771,367814..367816,
                     367982..367984,367988..367996,368039..368041,
                     368105..368107))
                     /locus_tag="Cpha266_0336"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100030"
     gene            368262..369212
                     /locus_tag="Cpha266_0337"
                     /db_xref="GeneID:4570536"
     CDS             368262..369212
                     /locus_tag="Cpha266_0337"
                     /note="KEGG: cch:Cag_1212 cell division transporter
                     substrate-binding protein FtsY;
                     TIGRFAM: signal recognition particle-docking protein FtsY;
                     PFAM: GTP-binding signal recognition particle SRP54, G-
                     domain; GTP-binding signal recognition particle SRP54,
                     helical bundle;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="signal recognition particle-docking protein
                     FtsY"
                     /protein_id="YP_910820.1"
                     /db_xref="GI:119356176"
                     /db_xref="InterPro:IPR000897"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004390"
                     /db_xref="InterPro:IPR013822"
                     /db_xref="GeneID:4570536"
                     /translation="MGFFDKFKLSRLKEGLSKTSETFREKLSLITQGKTEIDEEFLEE
                     LEHILVGADVGVETTLSIVDAITERAKRESYRSAEELNRMLMEEIQQMLLDSGEHYPI
                     DFDAPLSAKPYVILVVGVNGAGKTTSVAKLAYNYEKAGKKVIIAAADTFRAAAYEQLK
                     IWADRAGVPLIGQGQGADPASVVYDAVSSAVSRNSDVVLVDTAGRLHNKSHLMEELAK
                     IMRVAKKKIPEAPHEVLLVLDGTTGQNAVSQAREFTRFVNVTGLVLTKLDGTSKGGIV
                     LSISRELNLPVKYIGVGEKIDDLQLFDRARFVEALLGRQE"
     misc_feature    368268..369200
                     /locus_tag="Cpha266_0337"
                     /note="signal recognition particle-docking protein FtsY;
                     Provisional; Region: PRK10416"
                     /db_xref="CDD:236686"
     misc_feature    368295..368528
                     /locus_tag="Cpha266_0337"
                     /note="SRP54-type protein, helical bundle domain; Region:
                     SRP54_N; pfam02881"
                     /db_xref="CDD:217266"
     misc_feature    368598..369134
                     /locus_tag="Cpha266_0337"
                     /note="The signal recognition particle (SRP) mediates the
                     transport to or across the plasma membrane in bacteria and
                     the endoplasmic reticulum in eukaryotes. SRP recognizes
                     N-terminal sighnal sequences of newly synthesized
                     polypeptides at the ribosome. The...; Region: SRP;
                     cd03115"
                     /db_xref="CDD:239389"
     misc_feature    368616..368639
                     /locus_tag="Cpha266_0337"
                     /note="P loop; other site"
                     /db_xref="CDD:239389"
     misc_feature    order(368706..368708,368871..368873,369054..369056,
                     369063..369068)
                     /locus_tag="Cpha266_0337"
                     /note="GTP binding site [chemical binding]; other site"
                     /db_xref="CDD:239389"
     gene            complement(369215..369784)
                     /locus_tag="Cpha266_0338"
                     /db_xref="GeneID:4569510"
     CDS             complement(369215..369784)
                     /locus_tag="Cpha266_0338"
                     /note="KEGG: cch:Cag_1211 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910821.1"
                     /db_xref="GI:119356177"
                     /db_xref="GeneID:4569510"
                     /translation="MPPDQFTIFGDNYPRGSYILFLKVSKPIRLSFGKFQGGRLLDVP
                     KGEYLYIGSALGSGKADKPLAQRLVRHASRSGNNKPQPIQKTLRLLFEPEASCKKAGT
                     TLHKKMHWHIDYLLDCPETEITHIVVVQSPLRLEPLLCNFISSLDTVEPLAKRLGAQD
                     TKNSTHLLKIADSEQLLLIIKNKIPELIA"
     misc_feature    complement(369281..369742)
                     /locus_tag="Cpha266_0338"
                     /note="GIY-YIG domain of hypothetical proteins from
                     archaea and their bacterial homologs; Region:
                     GIY-YIG_COG1833; cd10441"
                     /db_xref="CDD:198388"
     misc_feature    complement(order(369629..369637,369731..369739))
                     /locus_tag="Cpha266_0338"
                     /note="GIY-YIG motif/motif A; other site"
                     /db_xref="CDD:198388"
     misc_feature    complement(order(369305..369307,369377..369379,
                     369572..369574,369584..369586,369629..369631,
                     369635..369637,369731..369733))
                     /locus_tag="Cpha266_0338"
                     /note="putative active site [active]"
                     /db_xref="CDD:198388"
     misc_feature    complement(369377..369379)
                     /locus_tag="Cpha266_0338"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:198388"
     gene            369907..370557
                     /locus_tag="Cpha266_0339"
                     /db_xref="GeneID:4569511"
     CDS             369907..370557
                     /locus_tag="Cpha266_0339"
                     /EC_number="2.1.1.77"
                     /note="KEGG: cte:CT0202 protein-L-isoaspartate
                     (D-aspartate) O-methyltransferase;
                     TIGRFAM: protein-L-isoaspartate O-methyltransferase;
                     PFAM: protein-L-isoaspartate(D-aspartate)
                     O-methyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="protein-L-isoaspartate O-methyltransferase"
                     /protein_id="YP_910822.1"
                     /db_xref="GI:119356178"
                     /db_xref="InterPro:IPR000682"
                     /db_xref="GeneID:4569511"
                     /translation="MDSNSRLMTFRRREMVEKLKLSGIADNRVLAAFLSVERHRFFDK
                     ESQEYAYADGAYPIGYGQTISQPYTVACMTSLLVERSPSGKVLEIGTGSGYQAAILYA
                     LGYRVYTIERVVELSEKAEKLFSALGFSIMCRSGDGTLGWPEEAPFDGIMVTAGAPHC
                     PETLLHQLALDGSLVVPIGAHGLQKMTVFQRKKDRFEKEVFSDFAFVPLIGREGWG"
     misc_feature    369922..370551
                     /locus_tag="Cpha266_0339"
                     /note="protein-L-isoaspartate O-methyltransferase;
                     Reviewed; Region: pcm; PRK00312"
                     /db_xref="CDD:178974"
     misc_feature    370159..370410
                     /locus_tag="Cpha266_0339"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(370171..370191,370237..370239,370312..370320,
                     370366..370368)
                     /locus_tag="Cpha266_0339"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            370590..372692
                     /locus_tag="Cpha266_0340"
                     /db_xref="GeneID:4569512"
     CDS             370590..372692
                     /locus_tag="Cpha266_0340"
                     /note="PFAM: PpiC-type peptidyl-prolyl cis-trans
                     isomerase;
                     KEGG: plt:Plut_1922 peptidyl-prolyl cis-trans isomerase,
                     PpiC-type"
                     /codon_start=1
                     /transl_table=11
                     /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
                     /protein_id="YP_910823.1"
                     /db_xref="GI:119356179"
                     /db_xref="InterPro:IPR000297"
                     /db_xref="GeneID:4569512"
                     /translation="MAVMTSLRDKTHIILYALLAAFLALIVFEWGMNFSGFSGKKRDI
                     AGKVNGKDISAAQYEEVYNEISGNFRRTNPGAEITPVTELEFRQQAWNIVVDQTLLEE
                     QFAKFGITVQDQEVVESLDSPEPPMIIRQNFSDSTGSIDRKKLDVARRDPKNKDLWLQ
                     LEKMVQRELKVNKLIRALQPMVRVTGRELDDIVRRNFGRFSASFVPVPLSFAGTDTSF
                     PVKEDEIQKYYNEHKELLKQLPSRSADYVFFPLTPSSKDSSSVRSELESLRSEFSAAV
                     NDTDYVKVQSDRPNGVNVLYNRANFSLPAGSIVFSPANLKAGAIVGPVADRGEYRLLK
                     IKEVRTAQPIARASHILLRFNPGNKEEVEKVRERMVMIFKNLQAGVPFETLAGKYSED
                     PGSAVQGGDLGWFTRESMLPEFSAAVFSGTPGAVVKPVQTKFGLHIIKVTGFDQTAVI
                     ASEIVRTIRPSTETVDSARRLAMAFQMQAKDKGLEKSASTEKLVVGKTGDFGKHTLIA
                     DIGFSDKITAFAFNGKEGALSDVIETEKGFYVMKLTGVNDTGYRRLDADLKKRITAEL
                     VRLKKEPVLEKKLSLNAKQSGATLDKIAAAYPGTVVVTADDIRWVDGFIPGYGFDQPL
                     VEAMSAMTEGKLSGPVKTNDGYAIVLLSKKNMPAERDVEAAKTAFTPKIIQDKLNRLF
                     TEYFATIKKNAVIEDLRP"
     misc_feature    370689..371024
                     /locus_tag="Cpha266_0340"
                     /note="SurA N-terminal domain; Region: SurA_N_3; cl07813"
                     /db_xref="CDD:244798"
     misc_feature    371247..371618
                     /locus_tag="Cpha266_0340"
                     /note="PPIC-type PPIASE domain; Region: Rotamase_2;
                     pfam13145"
                     /db_xref="CDD:221934"
     misc_feature    371634..371918
                     /locus_tag="Cpha266_0340"
                     /note="PPIC-type PPIASE domain; Region: Rotamase;
                     pfam00639"
                     /db_xref="CDD:216038"
     misc_feature    <372009..372257
                     /locus_tag="Cpha266_0340"
                     /note="PPIC-type PPIASE domain; Region: Rotamase_2;
                     pfam13145"
                     /db_xref="CDD:221934"
     misc_feature    372264..372587
                     /locus_tag="Cpha266_0340"
                     /note="PPIC-type PPIASE domain; Region: Rotamase_2;
                     pfam13145"
                     /db_xref="CDD:221934"
     gene            complement(372862..374670)
                     /locus_tag="Cpha266_0341"
                     /db_xref="GeneID:4569513"
     CDS             complement(372862..374670)
                     /locus_tag="Cpha266_0341"
                     /EC_number="2.7.3.9"
                     /note="TIGRFAM: phosphoenolpyruvate-protein
                     phosphotransferase;
                     PFAM: PEP-utilizing enzyme; PEP-utilising enzyme, mobile
                     region; PEP-utilising enzyme domain protein;
                     KEGG: plt:Plut_1914 phosphoenolpyruvate-protein
                     phosphotransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate--protein phosphotransferase"
                     /protein_id="YP_910824.1"
                     /db_xref="GI:119356180"
                     /db_xref="InterPro:IPR000121"
                     /db_xref="InterPro:IPR006318"
                     /db_xref="InterPro:IPR008279"
                     /db_xref="InterPro:IPR008731"
                     /db_xref="GeneID:4569513"
                     /translation="MPEQKKNTLKGVLPSKKQSRSNRSDGGNIKPHEATFNGIGTSRG
                     IAIGECYAYEKEQYEHEITSLDNDNIEAEIERFIEAVHRSEKELKKIERVTTRKLGKG
                     YANIFQAQIMMLQDPMLIDSISLRIRSEMIPAHLVIEEEFGHYHEKFKSSDDVVFQER
                     ADDFFDIKNRILRNLHVRKMLSWIPEGTIVVSDHFCPGDIILLSRSNVKGFLSDSGGK
                     TSHISLICKSLNIPMVAGLGNFSQNAVSGTQMIIDGSSGTVIIHPEEKTIQLYQEKQK
                     AEKQSNADASLTATLPASTKCGVRINFFSNIDFKEELLGLKETGSEGIGLFRSENLFI
                     DGTKVPGESEQYHYYREMSETVAPQPFVVRLFDIGGDKLIYSPIREPNPNLGWRGIRI
                     LIDVPEILENQLRAVIRANALGNINILIPMITSLDEIMTICAMVDRLHAEVIEQTGVA
                     GEKPELGAMIEVPAAVEIIDEITKCVDFISLGTNDLTQYTLAVDRNNVIVQDLFEKFH
                     PAIIRQLHRVIATAQKNHCRVALCGDMGSDPLALPFLIGCGLRKFSVVSADIANLKRF
                     VSRYSVAETEALALECIKLDSAQKIKACLETFQAEH"
     misc_feature    complement(374188..374565)
                     /locus_tag="Cpha266_0341"
                     /note="PEP-utilising enzyme, N-terminal; Region:
                     PEP-utilisers_N; pfam05524"
                     /db_xref="CDD:218623"
     misc_feature    complement(372865..374559)
                     /locus_tag="Cpha266_0341"
                     /note="Phosphoenolpyruvate-protein kinase (PTS system EI
                     component in bacteria) [Carbohydrate transport and
                     metabolism]; Region: PtsA; COG1080"
                     /db_xref="CDD:224006"
     misc_feature    complement(373903..374121)
                     /locus_tag="Cpha266_0341"
                     /note="PEP-utilising enzyme, mobile domain; Region:
                     PEP-utilizers; pfam00391"
                     /db_xref="CDD:201201"
     misc_feature    complement(372964..373803)
                     /locus_tag="Cpha266_0341"
                     /note="PEP-utilising enzyme, TIM barrel domain; Region:
                     PEP-utilizers_C; pfam02896"
                     /db_xref="CDD:217274"
     gene            complement(374682..376214)
                     /locus_tag="Cpha266_0342"
                     /db_xref="GeneID:4569514"
     CDS             complement(374682..376214)
                     /locus_tag="Cpha266_0342"
                     /note="KEGG: cch:Cag_1608 DnaB helicase;
                     TIGRFAM: replicative DNA helicase;
                     PFAM: DnaB domain protein helicase, N-terminal domain
                     protein; DnaB domain protein helicase, C-terminal domain
                     protein;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="replicative DNA helicase"
                     /protein_id="YP_910825.1"
                     /db_xref="GI:119356181"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR007692"
                     /db_xref="InterPro:IPR007693"
                     /db_xref="InterPro:IPR007694"
                     /db_xref="GeneID:4569514"
                     /translation="MIKPKADILDFSKDIDFNLEGRVPPYSTEIEQEVLACVLLEDDP
                     VEQVIQIFGDSAEEVFFERRHRLIFKSMMQLYNKRQAIDLITVSEELLKMNELDNIGG
                     RHYLAELSGKVISAANVEYYARLAKEKYLYRRMISISAKVSGAAYSSSMDIFDLVEHA
                     SQQFFNISQAGIKKKASPIKDLVKNGIRMLETLRASQSSITGVGSGFSDLDQFTAGFQ
                     SSDMIIIAARPSAGKTAFALALARNAAVDFNTPVLFFSLEMAEVQLAVRLMCAEAYVE
                     SQLVRTGRITPEMMSKIINSMDKLNEAKLFIDDTPGISIMELTAKTRRMKQEHNIGMV
                     VVDYLQLVTPVKDGKTNREQEIAQISRSLKALAKELNIPVIALAQLNRSVEQRSGDRR
                     PQLSDLRESGSIEQDADVVMFLSRPEMYNIQTFSDGSSTKNMVEVVIGKQRNGPIGDI
                     RILFLKQYGRFQSAATSYLSNTDEQNGGSANERNLPPEAPALQKTQMSANTFINADDA
                     PF"
     misc_feature    complement(374820..376148)
                     /locus_tag="Cpha266_0342"
                     /note="replicative DNA helicase; Region: DnaB; TIGR00665"
                     /db_xref="CDD:233080"
     misc_feature    complement(375831..376148)
                     /locus_tag="Cpha266_0342"
                     /note="DnaB-like helicase N terminal domain; Region: DnaB;
                     pfam00772"
                     /db_xref="CDD:216111"
     misc_feature    complement(374847..375590)
                     /locus_tag="Cpha266_0342"
                     /note="DnaB helicase C terminal domain. The hexameric
                     helicase DnaB unwinds the DNA duplex at the  chromosome
                     replication fork. Although the mechanism by which DnaB
                     both couples ATP hydrolysis to translocation along DNA and
                     denatures the duplex is unknown, a...; Region: DnaB_C;
                     cd00984"
                     /db_xref="CDD:238484"
     misc_feature    complement(375513..375533)
                     /locus_tag="Cpha266_0342"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238484"
     misc_feature    complement(order(374853..374855,374886..374888,
                     374967..374969,375078..375080,375204..375206,
                     375513..375518))
                     /locus_tag="Cpha266_0342"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238484"
     misc_feature    complement(375204..375215)
                     /locus_tag="Cpha266_0342"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238484"
     misc_feature    complement(order(374913..374918,374967..374972,
                     375057..375083,375156..375164,375186..375191))
                     /locus_tag="Cpha266_0342"
                     /note="DNA binding loops [nucleotide binding]"
                     /db_xref="CDD:238484"
     gene            complement(376201..376872)
                     /locus_tag="Cpha266_0343"
                     /db_xref="GeneID:4569515"
     CDS             complement(376201..376872)
                     /locus_tag="Cpha266_0343"
                     /note="TIGRFAM: phage SPO1 DNA polymerase-related protein;
                     PFAM: Uracil-DNA glycosylase superfamily;
                     KEGG: cte:CT0206 DNA polymerase bacteriophage-type"
                     /codon_start=1
                     /transl_table=11
                     /product="phage SPO1 DNA polymerase-related protein"
                     /protein_id="YP_910826.1"
                     /db_xref="GI:119356182"
                     /db_xref="InterPro:IPR005122"
                     /db_xref="InterPro:IPR005273"
                     /db_xref="GeneID:4569515"
                     /translation="MHPFLFSDHDDTLPSVQSEAGAPFRDLIGLSLAVKSCTKCRLSA
                     SRKNVVFGEGDPRAALVVIGEAPGADEDSQGRPFVGRSGQLLDKILQAVQFKREEVFI
                     CNILKCRPPQNRNPLADEIECCMPWLLLQLELLNPKLILLLGKVAANTILQNSLSMGA
                     MRGRIVKWKAYDCMVTYHPAALLRNPGWKKACWEDVQMMRQHYDKLCSAEAHSRTMVT
                     NNDQA"
     misc_feature    complement(376273..376764)
                     /locus_tag="Cpha266_0343"
                     /note="Family 4 Uracil-DNA glycosylase (UDG), found
                     exclusively in thermophilic organisms; Region:
                     UDG_F4_TTUDGA_like; cd10030"
                     /db_xref="CDD:198428"
     misc_feature    complement(order(376492..376494,376501..376506,
                     376549..376557,376735..376737,376744..376749,
                     376753..376758,376762..376764))
                     /locus_tag="Cpha266_0343"
                     /note="Fe-S cluster binding site [ion binding]; other
                     site"
                     /db_xref="CDD:198428"
     misc_feature    complement(order(376339..376341,376561..376563,
                     376639..376644,376660..376662,376675..376683))
                     /locus_tag="Cpha266_0343"
                     /note="active site"
                     /db_xref="CDD:198428"
     gene            complement(376893..378125)
                     /locus_tag="Cpha266_0344"
                     /db_xref="GeneID:4569516"
     CDS             complement(376893..378125)
                     /locus_tag="Cpha266_0344"
                     /EC_number="4.1.1.36"
                     /EC_number="6.3.2.5"
                     /note="TIGRFAM: phosphopantothenoylcysteine
                     decarboxylase/phosphopantothenate--cysteine ligase;
                     PFAM: flavoprotein; DNA/pantothenate metabolism
                     flavoprotein domain protein;
                     KEGG: cte:CT0207 pantothenate metabolism flavoprotein"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional phosphopantothenoylcysteine
                     decarboxylase/phosphopantothenate synthase"
                     /protein_id="YP_910827.1"
                     /db_xref="GI:119356183"
                     /db_xref="InterPro:IPR003382"
                     /db_xref="InterPro:IPR005252"
                     /db_xref="InterPro:IPR007085"
                     /db_xref="GeneID:4569516"
                     /translation="MLRGKNIIIAICGGIAAYKIPVLVRLLKKGGANVKVVLTASAAR
                     FVSELTLATVSQEQVYCSLFPPVERENVDYTRHISLGEWADIFVVAPATANTIAKLAA
                     GLCDDMLSACFLTLRPNKPVLLFPAMDGEMFTSSSVQRNLAMLLADGARIINPDSGEL
                     ASGQCGLGRMPEPEAIAALIEEELLKSCNKHSSLQGKSVVITAGPTREKIDDVRFISN
                     YSSGKMGFAIARAAAERGAKVTLLAGPVSLITPPLVERVDVESAKEMYDAARQLFETC
                     DVFVSAAAVADYRPDSPFQGKLKKNGEELSLTLRKNPDILAEFSKQKSPSQIAVGFAL
                     ECEDGLKNAIKKRIEKKLDLIALNFYDGKSSGFEVETNMLTLIGSDDTATVLPLLSKP
                     DAANRLLEAVEKLIQPDS"
     misc_feature    complement(376902..378125)
                     /locus_tag="Cpha266_0344"
                     /note="bifunctional phosphopantothenoylcysteine
                     decarboxylase/phosphopantothenate synthase; Validated;
                     Region: PRK05579"
                     /db_xref="CDD:235513"
     misc_feature    complement(377712..378074)
                     /locus_tag="Cpha266_0344"
                     /note="Flavoprotein; Region: Flavoprotein; pfam02441"
                     /db_xref="CDD:217035"
     misc_feature    complement(376995..377546)
                     /locus_tag="Cpha266_0344"
                     /note="DNA / pantothenate metabolism flavoprotein; Region:
                     DFP; pfam04127"
                     /db_xref="CDD:217913"
     gene            complement(378181..382719)
                     /locus_tag="Cpha266_0345"
                     /db_xref="GeneID:4569517"
     CDS             complement(378181..382719)
                     /locus_tag="Cpha266_0345"
                     /note="KEGG: plt:Plut_1902 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910828.1"
                     /db_xref="GI:119356184"
                     /db_xref="GeneID:4569517"
                     /translation="MEKSKKVFIGFLALLSAGVLLLSIVAAIVLNSGFLDRFAKDLAV
                     KLFNEEFYGHLELQKVKLNFPNKVTILSPRIYEPDEDLPALSADKVTLRFNFLTILKP
                     KIDKLSFRKIKVDSLLINVIERENGKRNIDLIFTSRKPDSTDAPIESFFSKVVTLRNS
                     SLNYSRTLPNETPLALTVQNISLDLNSLRLKIKKKEFGGTIEALALDIPQHSFRLKQG
                     SGQFFVSEKRADIIALKATSDKSNAELSLSLDKFNIFDPDQKKLLLAGKSFLDIQALN
                     IHTRDLNMIYPDIALPEGVYSLKGDARSQSNTIEIIKGVLAHNKSHLAVKGKLLNVQN
                     KNAFGYQLEIDSSKIDPDFFQAFFSDKNQKELIARIGAISFIGKAHGNLKELSTDVHI
                     LTKAGNASIKGEAAGEPGKQIKGKGAFSLEKTLPHLFTGTTTAKSMLNATGNFDGIVN
                     GSELAELHIESDLKDSFWQQQALKQGTLSLDYSRELVRAKAILQNGMESIDVSGQISW
                     KGGSADYQAEGKVARLNLAKSLASNDFVTDLNGVFALKGSGFDPASLNAALTARFSPS
                     SINNFRLRDKSELSAAVEQHAASSTVTLKSDFLDLAVQGNQSFKELLGAIELAGSGIS
                     GEIRTQSLWSSRPAGPRSDAFLSLKKPFTVSYRILVKDMEPLSPLLPFRDLALQGSAE
                     GQFFYENGRCALTSSLDLGSLAYGKAVALKKLSATAAMECSGNGIPKAAIKGKAASLV
                     FSGQTSNNLVFDATYSTGRLTASIDAGRFENDREFSTAFSLQRTGSAYDLGFTKLAIG
                     KGKNRWQTQGGSHIKIEKMAVQFNRFTIANGNQHLVLNGELSNSRPGSFQCNLSHLDL
                     AALGELSEKRLPSGMSGTIDASLTISGNPNTKTSTLSINGKSVGFDKIPLGNVQSNIR
                     HAGNKLSFDYKSFITEPVNKGNTTPSVNTIAGSGTMPLVLAYYPFELRIPQEQKIQAS
                     FRSDNLSARFLKVVLPFVEDAAGIMPTTLTVEGTTSRPEIYLLSRLRDTQIKLEATQV
                     TYLLNGDIQVTPRQLELRDLRIADLQNGTGSLNGLLKIENLKPKTITLGANLSKLLLF
                     HKKDTRDEKPFGTIIGSTRNLLLNGDISSPVVEGDITINSADFTMYRPGANESAKYIG
                     VEKFIEFVPRYPSQQSMVAQTDLDSDPVGFNYSLIDILQLKDLKIRSAEQLKFRVIFD
                     RTRGEELEAAISGMQLMVNKSQQRYRLFGSVALSDGKYRFSNTNFDLEDGGKIVWNNV
                     GIHEGIMQNLYGTKYISALSPETGDRDNVKLLLAISGTISEPNVEMGYYLNDQMQPFS
                     SKNLIGGKPSQIDPNAELNVISMLLTSQWYAPQGSSGLSKNLAVSSVGLSTGSGLISS
                     QLSRLVQNVAGFESFNVNLGMNSKGEISGIDLYMAVNVPGTNGKVRIIGEGSSHDVKN
                     KPLFNYYGTSQKVEYRVSPKVYIEAYRSYGQTENEAANTNLQSPTETWGASISYRERF
                     HTWDSFWKRIIPSSNKKK"
     sig_peptide     complement(382639..382719)
                     /locus_tag="Cpha266_0345"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 0.998) with cleavage site probability 0.410 at
                     residue 27"
     misc_feature    complement(378238..379578)
                     /locus_tag="Cpha266_0345"
                     /note="Family of unknown function (DUF490); Region:
                     DUF490; pfam04357"
                     /db_xref="CDD:218042"
     gene            complement(382706..383263)
                     /locus_tag="Cpha266_0346"
                     /db_xref="GeneID:4569518"
     CDS             complement(382706..383263)
                     /locus_tag="Cpha266_0346"
                     /note="TIGRFAM: cytidyltransferase-related domain; rfaE
                     bifunctional protein;
                     PFAM: cytidylyltransferase;
                     KEGG: plt:Plut_1901 RfaE bifunctional protein, domain II"
                     /codon_start=1
                     /transl_table=11
                     /product="rfaE bifunctional protein"
                     /protein_id="YP_910829.1"
                     /db_xref="GI:119356185"
                     /db_xref="InterPro:IPR004820"
                     /db_xref="InterPro:IPR004821"
                     /db_xref="InterPro:IPR011914"
                     /db_xref="GeneID:4569518"
                     /translation="MLVLQLHVIFLQLADRYLMNSKLLTRAKAKEQVIAWQSSGKKVV
                     FSNGCFDILHAGHVQYLSRARQLGDILLIGLNSDASIQRIKGPLRPVCAEQDRAAVLS
                     ALQMVDAITLFDEDTPEALIEALLPDILVKGADWDIERIAGAKAVLQSGGKVLTLPIL
                     EGRSTTGIIEKVIQIYGKHTPRGKE"
     misc_feature    complement(382748..383170)
                     /locus_tag="Cpha266_0346"
                     /note="rfaE bifunctional protein, domain II; Region:
                     rfaE_dom_II; TIGR02199"
                     /db_xref="CDD:131254"
     misc_feature    complement(382751..383125)
                     /locus_tag="Cpha266_0346"
                     /note="Cytidylyltransferase; Region: CTP_transf_2;
                     pfam01467"
                     /db_xref="CDD:216517"
     misc_feature    complement(383093..383104)
                     /locus_tag="Cpha266_0346"
                     /note="active site"
                     /db_xref="CDD:173912"
     misc_feature    complement(383093..383104)
                     /locus_tag="Cpha266_0346"
                     /note="HIGH motif; other site"
                     /db_xref="CDD:173912"
     misc_feature    complement(order(383093..383095,383102..383104))
                     /locus_tag="Cpha266_0346"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:173912"
     gene            383525..384421
                     /locus_tag="Cpha266_0347"
                     /db_xref="GeneID:4569519"
     CDS             383525..384421
                     /locus_tag="Cpha266_0347"
                     /note="PFAM: lipid A biosynthesis acyltransferase;
                     KEGG: cch:Cag_1483 acyltransferase, HtrB/MsbB family"
                     /codon_start=1
                     /transl_table=11
                     /product="lipid A biosynthesis acyltransferase"
                     /protein_id="YP_910830.1"
                     /db_xref="GI:119356186"
                     /db_xref="InterPro:IPR004960"
                     /db_xref="GeneID:4569519"
                     /translation="MTDPSITNKQSSDRRIYKLFMLFSVLVRKMNRKTALFMADRLGD
                     LMFDILKIRKPLVEGNLSITFPEKSANEIRSIARRVYRNQARNFIEVLRLPLIASRED
                     AEELFDINASQLSDILQRSGVVLVSAHFGNWELLGFCAGIMVTPLTIVVKRLRNDDVD
                     RCINTWRTMKGNTVVKKSRALREGLKTLRNKGIVSFLADQSDPEGTFVTDFLGRPSSV
                     FLGPAYLALKTRVPLFVCMAYRKEDGRHTVDIEQIPTEDLKDSREDFEELARRYTRAI
                     DKAIRVRPEEWFWLHDRWKRTF"
     misc_feature    383600..384412
                     /locus_tag="Cpha266_0347"
                     /note="Bacterial lipid A biosynthesis acyltransferase;
                     Region: Lip_A_acyltrans; pfam03279"
                     /db_xref="CDD:112109"
     misc_feature    383888..384409
                     /locus_tag="Cpha266_0347"
                     /note="Lysophospholipid Acyltransferases (LPLATs) of
                     Glycerophospholipid Biosynthesis: LABLAT-like; Region:
                     LPLAT_LABLAT-like; cd07984"
                     /db_xref="CDD:153246"
     misc_feature    order(383909..383911,383918..383920,383924..383926,
                     383975..383986,384122..384127)
                     /locus_tag="Cpha266_0347"
                     /note="putative acyl-acceptor binding pocket; other site"
                     /db_xref="CDD:153246"
     gene            complement(384737..386182)
                     /locus_tag="Cpha266_0348"
                     /db_xref="GeneID:4569520"
     CDS             complement(384737..386182)
                     /locus_tag="Cpha266_0348"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910831.1"
                     /db_xref="GI:119356187"
                     /db_xref="GeneID:4569520"
                     /translation="MQINSSDRTQSISSIWHHRLIRFFSSTTTQYIAAGLSLILIFNT
                     YYLLIDMKVFGHDEVHYYTDFTFKLKEEGRWANYFLHKLLRHIPLQTHVILFLSSLWG
                     VFYYISKNLTKESWYSIIIASVLLIETPNAYQSLWPATVLPTTISLLLLAWMAQKDIS
                     YKVIYLVGGVLLFGMMQNYYFLLPLLFLGHYKFDKTSINSTIPLVTTHLLFWITGAVS
                     GLVVASLIVYIHTGQAGIIPAEWRLIMPAHDISTLLRNIIYVFQNLTEQLVVFWKNSA
                     SNGFLYPLLLIIFTFARLKNSFSNLYISIILSAVFLSFFIFSIPLAPIIQTRSLVAFS
                     SSLILLFFIESKQLLFPRWLSVFLLLWTGLNLSISGRSYLYEHKTQSEFVLNKIEAAF
                     SHHPANYTAVAVFGHVDNKYKEAFLFNNPERLRPIILTLGANHFIDGRVDTQQKSLLT
                     EAVNIDTTSANNKIKLFVTKKNVAVILLEKN"
     gene            complement(386294..386677)
                     /locus_tag="Cpha266_0349"
                     /db_xref="GeneID:4569521"
     CDS             complement(386294..386677)
                     /locus_tag="Cpha266_0349"
                     /note="PFAM: GtrA family protein;
                     KEGG: pma:Pro0382 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="GtrA family protein"
                     /protein_id="YP_910832.1"
                     /db_xref="GI:119356188"
                     /db_xref="InterPro:IPR007267"
                     /db_xref="GeneID:4569521"
                     /translation="MITISSEIIRYLITGIFNTLVGYGTFFVFYRFVNLSPELSNAIG
                     YGIGLISAFILNRLFVFKRTIFSFGAFLRFVLSFIISFILNLAILYYFHRSLHVIPEI
                     AQIAAMIAYTIIFYLLNKYFVWKHK"
     misc_feature    complement(386303..386665)
                     /locus_tag="Cpha266_0349"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG2246"
                     /db_xref="CDD:225155"
     misc_feature    complement(386306..386650)
                     /locus_tag="Cpha266_0349"
                     /note="GtrA-like protein; Region: GtrA; pfam04138"
                     /db_xref="CDD:217921"
     gene            complement(386658..387659)
                     /locus_tag="Cpha266_0350"
                     /db_xref="GeneID:4569522"
     CDS             complement(386658..387659)
                     /locus_tag="Cpha266_0350"
                     /note="PFAM: glycosyl transferase, family 2;
                     KEGG: pma:Pro0380 glycosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family protein"
                     /protein_id="YP_910833.1"
                     /db_xref="GI:119356189"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="GeneID:4569522"
                     /translation="MQLLSLVIPCYNEEAVIDETIKRLKTFCSERNDLDVELILVDDG
                     SRDRTRMLLKSYASDDTRIKVIVFARNFGHQIAVTAGIDAARGDAVVLIDADLQDPPE
                     VIHKMIAKWREGYDVIYGTRAVRIGESAFKQFSARFFYRFLNKLSDIPIPLDTGDFRL
                     MSRDVVDTLKAMPENDRFVRGMVSWVGFKQTALPYTRQERFAGESKYPLKKMLRFAND
                     GILSFSTKPLQISISLGLLSAALAFAGIIYALLVRIFTYNWVEGWAGIMIAVLFLGGI
                     QLISVGILGEYIGRIYNEVKKRPLYVVEEYVGFNSEDLKMSRSPVIRHFSYHDNHIK"
     misc_feature    complement(386727..387650)
                     /locus_tag="Cpha266_0350"
                     /note="undecaprenyl phosphate
                     4-deoxy-4-formamido-L-arabinose transferase; Provisional;
                     Region: PRK10714"
                     /db_xref="CDD:182669"
     misc_feature    complement(387096..387644)
                     /locus_tag="Cpha266_0350"
                     /note="Bacterial DPM1_like enzymes are related to
                     eukaryotic DPM1; Region: DPM1_like_bac; cd04187"
                     /db_xref="CDD:133030"
     misc_feature    complement(order(387372..387374,387627..387629,
                     387633..387635))
                     /locus_tag="Cpha266_0350"
                     /note="Ligand binding site; other site"
                     /db_xref="CDD:133030"
     misc_feature    complement(order(387372..387377,387531..387533))
                     /locus_tag="Cpha266_0350"
                     /note="Putative Catalytic site; other site"
                     /db_xref="CDD:133030"
     misc_feature    complement(387372..387380)
                     /locus_tag="Cpha266_0350"
                     /note="DXD motif; other site"
                     /db_xref="CDD:133030"
     gene            complement(387683..390667)
                     /locus_tag="Cpha266_0351"
                     /db_xref="GeneID:4569523"
     CDS             complement(387683..390667)
                     /locus_tag="Cpha266_0351"
                     /note="PFAM: glycosyl transferase, family 2; glycosyl
                     transferase, group 1;
                     KEGG: xom:XOO_1639 glycosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family protein"
                     /protein_id="YP_910834.1"
                     /db_xref="GI:119356190"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="GeneID:4569523"
                     /translation="MINKSLFLKPARIIEPIGWLGHIPFSFWIVEAAKPQVIVELGTH
                     SGNSYFSFCQSVKYNSLPTLCYAIYSCLNNEQTELYNADIIDSLLTYNNEHYQAFSNV
                     TGNTYYNALSFFEDASIDILHINSEGTYTSVVNLFNAWIPKLSSSGIVLFDNINASEN
                     NTEVYKLWGYVKNIYPNLTIEHSNGLGVIFTGNMYNDNINEFIKTIETEANRNIIGTL
                     FEKIGNTIEMDFQIRRLLNSLKEADTMIDMLNQTISNRETVINKLIQTIEKNDETIKS
                     FSKKHDFVKVKPLRKLKKSIRKRAHTLSKLFFKVEDKNHLSVNTHNSNAEWFLKEYKN
                     IACSDNKHCFHYKFGIIDHLAENNSFFKESKPTASIIIPVYGNISYTIKCIESLLNLP
                     DSTSFEIIIIDDHSPDNSYETLNKISQIKLIRNDCNKGFIHSCNSGASLATGEYLIFL
                     NNDTEVLNAWLDSLIAPFIIHDNVGLVGSQIIYPDGRLQEAGGVILSDGSGLNYGRLS
                     DPNKPEYNFLREVDYCSGCSIAIKKSLFDSIGGFDTLFIPAYYEDTDIAFTVRKMGYK
                     VLYQPASKVIHHEGITSGTDLKKGVKKFQNTNKIKFYNKWETQLKSHNILPDNYSLAK
                     CKYYKDTILFIDACTPTPDKDSGSVDAFFHQYIFTKLNFKVTFIPDNLIFLDGYTQVL
                     QQLGIECLYKPHITSIENFLKTRGAEFKYVVLSRVGIAVKHINAIKKYCPNSILIFNL
                     VDIHYIREARQARTLNSIELLHKAKKTKATELSIMKRSDVNIIISESEVKHLSKIDPE
                     LKLFNLPLILDMHQRTNNFENRKNIMFIGGFQHSPNVDAVLYFSREIWPLVKTRLVDA
                     HFIIIGSEMPNEIINLHNQNGILSIGYIEDLSPFFNSCKFSIAPLRYGAGQKGKLARS
                     GSYGLPSVATSIAVEGMGLKHEKHILIADKPDDFANSIERLYHDSILWEKLSKNIYDY
                     TNSEYSITKGISRISNLIHALN"
     misc_feature    complement(390203..390553)
                     /locus_tag="Cpha266_0351"
                     /note="Methyltransferase domain; Region: Methyltransf_24;
                     pfam13578"
                     /db_xref="CDD:222236"
     misc_feature    complement(388892..389572)
                     /locus_tag="Cpha266_0351"
                     /note="Glycosyltransferase like family 2; Region:
                     Glyco_tranf_2_3; pfam13641"
                     /db_xref="CDD:222281"
     misc_feature    complement(388931..389560)
                     /locus_tag="Cpha266_0351"
                     /note="Subfamily of Glycosyltransferase Family GT2 of
                     unknown function; Region: GT_2_like_c; cd04186"
                     /db_xref="CDD:133029"
     misc_feature    complement(order(389309..389314,389456..389458))
                     /locus_tag="Cpha266_0351"
                     /note="Probable Catalytic site; other site"
                     /db_xref="CDD:133029"
     misc_feature    complement(order(389003..389005,389009..389011,
                     389309..389311))
                     /locus_tag="Cpha266_0351"
                     /note="metal-binding site"
                     /db_xref="CDD:133029"
     misc_feature    complement(387794..388204)
                     /locus_tag="Cpha266_0351"
                     /note="Glycosyl transferases group 1; Region:
                     Glyco_trans_1_4; pfam13692"
                     /db_xref="CDD:222322"
     gene            complement(391265..392671)
                     /locus_tag="Cpha266_0352"
                     /db_xref="GeneID:4569524"
     CDS             complement(391265..392671)
                     /locus_tag="Cpha266_0352"
                     /note="PFAM: transposase, IS4 family protein;
                     KEGG: mes:Meso_4308 transposase, IS4"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase, IS4 family protein"
                     /protein_id="YP_910835.1"
                     /db_xref="GI:119356191"
                     /db_xref="InterPro:IPR002559"
                     /db_xref="GeneID:4569524"
                     /translation="MQLPYTNIHTDQPNQQALFPDCFEVSVAPVKGKKVVLDFQGGNA
                     TSDAGVLLLKEVESMTRIVPKLADCIADSRRTSSVMHSIPDLIAQRVYQIACGYEDGN
                     DSNSMRKDPALKMALNRLPESGDDLASQPTFSRLENMVTRPELYRMAVGFLDHFLDSY
                     TEAPRVIVLDFDDTEDVVHGKQQLALFNGYHQETCYQPLHVFEGLTGKLIASILRPGR
                     RPTGKEIVSYVKRIVRHIRSRWPETIIVYRGDSHYGVPEVYSFLAREQNCYSVTGLGG
                     NDVLLRSVKDIIEEVKKHGAGYRRYHTFQYQARSWKETRRVVAKVEMTEKGLNVRFIS
                     TDMQEAKAKTLYEQIYSARGNDELYIKAHKTFMKSDRTSCHRFLANQFRVFLHSAAYV
                     LVHAFQTNLLRGTALATATFETIRLKLLKIGAKVIEMKTRIKVHLPTSYPYKPILNKC
                     FAVLEHLRSVPWPSTAIP"
     misc_feature    complement(391289..392593)
                     /locus_tag="Cpha266_0352"
                     /note="Transposase DDE domain group 1; Region:
                     DDE_Tnp_1_4; pfam13701"
                     /db_xref="CDD:222326"
     gene            392896..394815
                     /locus_tag="Cpha266_0353"
                     /db_xref="GeneID:4569525"
     CDS             392896..394815
                     /locus_tag="Cpha266_0353"
                     /note="PFAM: ABC transporter, transmembrane region; ABC
                     transporter related;
                     SMART: AAA ATPase;
                     KEGG: cch:Cag_1482 ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_910836.1"
                     /db_xref="GI:119356192"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="GeneID:4569525"
                     /translation="MNLLLRMLRYLAPSKGKIALVVVVSIITSFLSVISIYSILPLLN
                     AVFETGPVTRTEATHTESDGKSRQEESMQKATPLKPAIGNGFVNFDELKKNALVTFQH
                     AFHAETKERSLLNICLFLIAAFAVKNIFVYLNGQLIFRIQTKTAKKLRDDVFRSIIEM
                     HLDYFNKNRVGNLMNYVYNDVENVNASISSTLVNFLQNPFSIFVYMVVLFALSWQLTL
                     FAAFTSLLIFFLIQLVGKNVKGLALTFQTRMGDMNSVLQEKFNGIKVIKATAFEDVEL
                     ERFKEFTRDFRTLGIKIQQMRNVISPLNETLLVAAIAGVLWFGGLQVFKGVMTANELI
                     VFAFTLYSTMGPIKMLGNANTSIQIGLISVERLFEVLDAEAVVVNGTRSITGFSHTIR
                     FEDVCFRYLKEPDAPNVLDHVTFEIKKGEMVALVGQSGSGKSTAVDLLLRFYDVDSGR
                     ITIDGVDIRDYDFKQLRRMIGVVSQEVILFNDSIDANIAYGVRDEIGHGRVEQAARLA
                     NAHQFISEKPDGYNTLIGDRGIQLSGGQRQRLAIARAMVKNPELLIFDEATSALDNES
                     EKVVQQAIDHALANRTALVVAHRLSTVKNADRIIVMERGQVAESGNHEELLQADGLYR
                     KLYEIQFAGKTERAS"
     misc_feature    393229..394794
                     /locus_tag="Cpha266_0353"
                     /note="ABC-type multidrug transport system, ATPase and
                     permease components [Defense mechanisms]; Region: MdlB;
                     COG1132"
                     /db_xref="CDD:224055"
     misc_feature    393229..393927
                     /locus_tag="Cpha266_0353"
                     /note="ABC transporter transmembrane region; Region:
                     ABC_membrane; pfam00664"
                     /db_xref="CDD:216049"
     misc_feature    394066..394776
                     /locus_tag="Cpha266_0353"
                     /note="ATP-binding cassette domain of the bacterial lipid
                     flippase and related proteins, subfamily C; Region:
                     ABCC_MsbA; cd03251"
                     /db_xref="CDD:213218"
     misc_feature    394174..394197
                     /locus_tag="Cpha266_0353"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213218"
     misc_feature    order(394183..394188,394192..394200,394318..394320,
                     394561..394566,394657..394659)
                     /locus_tag="Cpha266_0353"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213218"
     misc_feature    394309..394320
                     /locus_tag="Cpha266_0353"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213218"
     misc_feature    394489..394518
                     /locus_tag="Cpha266_0353"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213218"
     misc_feature    394549..394566
                     /locus_tag="Cpha266_0353"
                     /note="Walker B; other site"
                     /db_xref="CDD:213218"
     misc_feature    394573..394584
                     /locus_tag="Cpha266_0353"
                     /note="D-loop; other site"
                     /db_xref="CDD:213218"
     misc_feature    394645..394665
                     /locus_tag="Cpha266_0353"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213218"
     gene            complement(394874..396850)
                     /locus_tag="Cpha266_0354"
                     /db_xref="GeneID:4569526"
     CDS             complement(394874..396850)
                     /locus_tag="Cpha266_0354"
                     /note="PFAM: glycosyl transferase, family 2;
                     KEGG: bcn:Bcen_0396 glycosyl transferase, family 2"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family protein"
                     /protein_id="YP_910837.1"
                     /db_xref="GI:119356193"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="GeneID:4569526"
                     /translation="MIRADQKAQNDFGAGECLDTELITRNNDLQALLSEQERRIYDLL
                     QQYHKNESELRSVYNTPIGKIVRYYKTIKQKKKTQKNAEKNDYNIWLNKYDLLTEKRR
                     KNIIAEIATKRESPLISVFMRLNKRSLSSLEQSVQSVKAQLYPHWELCIIAEASQHTE
                     AETAIRKFVENDARITRHVKKETNTISEASNAALELAGGEFFALLESGDTIHPLALYH
                     VAQEVMRYPEAGLLYSDEDSLDNNNKRVNPFFKPDFNYDLFLCQNMVGNLAVFKTSLA
                     RQTGGFKRELDGAQDYDLALRFYEKLKPEQIRHIPRVLYHKRISRSGTIAATETQISG
                     NQEAALLAVNHHLKRTGIEATVEKAPEYPECNRIRYTIPNTPPSVDIIIPTKDMANLL
                     KICVLSILAKTTYNNYSITIIDNGSKEQNTLDLLKQWKNDSRIRIIRDDETPFNYSKL
                     NNRAVHSSSADFICLMNNDIEIITPEWLNEMMGHAIQPGVGAVGARLWYPNATLQHAG
                     VITGMYTGTGHAHKKYPKGNPGYFGRACLQQEYSAVTGACLLINRINYLHVAGLNEQE
                     LTVAFNDIELCLKLKKKGLRNIWTPYAEMFHHESLTRGRNDTPEKKELAGKELAYMQN
                     TWGIDKNHDPAYNPNLSITSDDFSLSWPPRILDR"
     misc_feature    complement(395894..396505)
                     /locus_tag="Cpha266_0354"
                     /note="Myxococcus xanthus RfbC like proteins are required
                     for O-antigen biosynthesis; Region: GT2_RfbC_Mx_like;
                     cd04184"
                     /db_xref="CDD:133027"
     misc_feature    complement(order(395978..395980,396227..396232,
                     396389..396391))
                     /locus_tag="Cpha266_0354"
                     /note="Probable Catalytic site; other site"
                     /db_xref="CDD:133027"
     misc_feature    complement(order(395972..395974,395978..395980,
                     396227..396229))
                     /locus_tag="Cpha266_0354"
                     /note="metal-binding site"
                     /db_xref="CDD:133027"
     misc_feature    complement(395060..395722)
                     /locus_tag="Cpha266_0354"
                     /note="Glycosyltransferase like family 2; Region:
                     Glyco_tranf_2_3; pfam13641"
                     /db_xref="CDD:222281"
     misc_feature    complement(395054..395710)
                     /locus_tag="Cpha266_0354"
                     /note="Subfamily of Glycosyltransferase Family GT2 of
                     unknown function; Region: GT_2_like_c; cd04186"
                     /db_xref="CDD:133029"
     misc_feature    complement(order(395444..395449,395606..395608))
                     /locus_tag="Cpha266_0354"
                     /note="Probable Catalytic site; other site"
                     /db_xref="CDD:133029"
     misc_feature    complement(order(395126..395128,395132..395134,
                     395444..395446))
                     /locus_tag="Cpha266_0354"
                     /note="metal-binding site"
                     /db_xref="CDD:133029"
     gene            complement(396890..398017)
                     /locus_tag="Cpha266_0355"
                     /db_xref="GeneID:4569527"
     CDS             complement(396890..398017)
                     /locus_tag="Cpha266_0355"
                     /note="PFAM: glycosyl transferase, group 1;
                     KEGG: gbe:GbCGDNIH1_0248 glycosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="group 1 glycosyl transferase"
                     /protein_id="YP_910838.1"
                     /db_xref="GI:119356194"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="GeneID:4569527"
                     /translation="MKIVYIARSAIPSRDANSIHVMKMCQAFADNGHEVIFLLPDRSS
                     GCEPGINDIYAYYGVKRNFQIRKFEYQHLKVKFVSQIRQMQKSLHELDPDLVYGRCFL
                     GCTIACLSGYKTIYESHLPLWRSGNIKKLWFSLVTRNRNFKRLVVISEALKTLYSNEN
                     IISQDKLFVAHDGADKVIDFQSKAELSGEKERLHVGYSGHLYQGKGVEVIAGVAPLMT
                     EVNFHIIGGKENDIAYWKSVIKSDNVFFYGFKNQTELPKYLNSFDICLLPNQKVVLPC
                     GKRDEKRNISDFTSPLKMFEYMAHKKAIISSDLPVLREVLNESNALLVQCDDFQQWAD
                     AITALQDKNKREAIAQQAYEDFMTSYTWKIRAEQVLSNVIK"
     misc_feature    complement(396905..398017)
                     /locus_tag="Cpha266_0355"
                     /note="Glycosyltransferase [Cell envelope biogenesis,
                     outer membrane]; Region: RfaG; COG0438"
                     /db_xref="CDD:223515"
     misc_feature    complement(396908..398014)
                     /locus_tag="Cpha266_0355"
                     /note="This family is most closely related to the GT1
                     family of glycosyltransferases and named after YqgM in
                     Bacillus licheniformis about which little is known.
                     Glycosyltransferases catalyze the transfer of sugar
                     moieties from activated donor molecules to...; Region:
                     GT1_YqgM_like; cd03801"
                     /db_xref="CDD:99974"
     gene            complement(398040..398993)
                     /locus_tag="Cpha266_0356"
                     /db_xref="GeneID:4569528"
     CDS             complement(398040..398993)
                     /locus_tag="Cpha266_0356"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910839.1"
                     /db_xref="GI:119356195"
                     /db_xref="GeneID:4569528"
                     /translation="MIINRLLQFFHLFILYRFGSAIGDQLCMTAIIENLFTEHRLKSV
                     VFSSYPEFFENNPNVCKNYSFKRMPKFFRNILLSLLRIAEGENIANFCFPKKKDGGLE
                     CFMRKSKAKISLIEAHSCYFKKKLILLQATPKIYFSDEELAVFSRKFSDLPDRFGIVQ
                     PVGKTTYTPNKEWGFANFQKVIDSAPHFPWLQTGMINELLLDHVIDFRGKTESLRELA
                     YIVSRADFILCLEGLLNHLAASVGTRSFCLFSGFHPVEIANYATTIPVVLDPQPDCSP
                     CWRLEKCPQKSKYCTEGILPEQVIKVITTAPSLNNQPAIKL"
     misc_feature    complement(398085..398936)
                     /locus_tag="Cpha266_0356"
                     /note="ADP-heptose:LPS heptosyltransferase [Cell envelope
                     biogenesis, outer membrane]; Region: RfaF; COG0859"
                     /db_xref="CDD:223928"
     misc_feature    complement(<398547..>398909)
                     /locus_tag="Cpha266_0356"
                     /note="Phosphoenolpyruvate carboxylase; Region: PEPcase;
                     cl17418"
                     /db_xref="CDD:247972"
     misc_feature    complement(398082..>398558)
                     /locus_tag="Cpha266_0356"
                     /note="Glycosyltransferases catalyze the transfer of sugar
                     moieties from activated donor molecules to specific
                     acceptor molecules, forming glycosidic bonds. The acceptor
                     molecule can be a lipid, a protein, a heterocyclic
                     compound, or another carbohydrate...; Region:
                     Glycosyltransferase_GTB_type; cl10013"
                     /db_xref="CDD:245227"
     gene            complement(399139..400308)
                     /locus_tag="Cpha266_0357"
                     /db_xref="GeneID:4569335"
     CDS             complement(399139..400308)
                     /locus_tag="Cpha266_0357"
                     /note="PFAM: glycosyl transferase, group 1;
                     KEGG: cpe:CPE2219 probable mannosyltransferase B"
                     /codon_start=1
                     /transl_table=11
                     /product="group 1 glycosyl transferase"
                     /protein_id="YP_910840.1"
                     /db_xref="GI:119356196"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="GeneID:4569335"
                     /translation="MALRNQSKQLHQKSNALNNRKKSTMNITYDVVKTAGYSGNLTYT
                     KDLISALALHFPDNRYRLLTQLNKKKDVEAFFGKNNSFEYRNILLNERMLGEKGRPFF
                     QAINLSVLREAANHTDMYHATNPTHFPDGIKNGVVTLHDLIALLPESWASVDSRTFYH
                     KKISSILQQAKLVFTVSEFTRSDAQHYFPKYADKYVATPLAANPAFRQISTNRNFLLQ
                     YGIADPLKPYLLYVGEIQPRKNIEGLLRAFEALPSALQHELQIIIVGHAKRKENLTLF
                     HDAINDMKSRAPVYHLRNVPLVDLVKLYNAAHAFVYLSFYEGFGLPIIEAMSCGCPVL
                     TSKTTSLGEVAADAALTIDPRDHEEITEALKQLLEEGETRKKLIEKGLLRAQEFS"
     misc_feature    complement(399142..400233)
                     /locus_tag="Cpha266_0357"
                     /note="This family is most closely related to the GT1
                     family of glycosyltransferases. mtfB (mannosyltransferase
                     B) in E. coli has been shown to direct the growth of the
                     O9-specific polysaccharide chain. It transfers two
                     mannoses into the position 3 of the...; Region:
                     GT1_mtfB_like; cd03809"
                     /db_xref="CDD:99981"
     misc_feature    complement(399148..400203)
                     /locus_tag="Cpha266_0357"
                     /note="Glycosyltransferase [Cell envelope biogenesis,
                     outer membrane]; Region: RfaG; COG0438"
                     /db_xref="CDD:223515"
     gene            complement(400322..401470)
                     /locus_tag="Cpha266_0358"
                     /db_xref="GeneID:4569336"
     CDS             complement(400322..401470)
                     /locus_tag="Cpha266_0358"
                     /note="PFAM: glycosyl transferase, group 1;
                     KEGG: mma:MM0650 mannosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="group 1 glycosyl transferase"
                     /protein_id="YP_910841.1"
                     /db_xref="GI:119356197"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="GeneID:4569336"
                     /translation="MNIGIDFTHDLGYSGIGTYCRSLTEAMAQREPENIYNILTLHHK
                     IPEVQQHFSNLRAIVYSAPFPNPMLLGGKCNKMIRKYHQTIWKKKAANYDLVHFTHQG
                     YFVPGIENAAVTIHDLIKLYNKSYTAIETTHPLFLTTKKMINDAATIFVPSEFVRNEL
                     RNYFAGCEKKVKVTYEGIKPVYRQTPPDPAVLKKYDLLDNGRFFLYVGRYESRKNLDR
                     LILAYAQLPDTLKKDTLLVLICPTEKKSTKELQKKIAGAGLEKNVLHLVHVPDNDLVH
                     LYNAALALLFVSFSEGFGLPLVEAMNCGCPAIIANSSSLPEISGSSSLLVDPYDTESI
                     RQAMLAISEDSLLRNDLSKKCIVRAQRFSWQTTAQETLKGYHAMLNKP"
     misc_feature    complement(400328..401470)
                     /locus_tag="Cpha266_0358"
                     /note="Glycosyltransferase [Cell envelope biogenesis,
                     outer membrane]; Region: RfaG; COG0438"
                     /db_xref="CDD:223515"
     misc_feature    complement(400352..401467)
                     /locus_tag="Cpha266_0358"
                     /note="This family is most closely related to the GT1
                     family of glycosyltransferases. mtfB (mannosyltransferase
                     B) in E. coli has been shown to direct the growth of the
                     O9-specific polysaccharide chain. It transfers two
                     mannoses into the position 3 of the...; Region:
                     GT1_mtfB_like; cd03809"
                     /db_xref="CDD:99981"
     gene            complement(401533..402627)
                     /locus_tag="Cpha266_0359"
                     /db_xref="GeneID:4569337"
     CDS             complement(401533..402627)
                     /locus_tag="Cpha266_0359"
                     /note="PFAM: glycosyl transferase, group 1;
                     KEGG: cte:CT0224 glycosyl transferase"
                     /codon_start=1
                     /transl_table=11
                     /product="group 1 glycosyl transferase"
                     /protein_id="YP_910842.1"
                     /db_xref="GI:119356198"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="GeneID:4569337"
                     /translation="MNILFVNSIGRDKFGGGEKWMINAAKELAKRGHNVVLGSKKNSR
                     TLHYAKANGVKTTIFEIRSDISPLSTLKVAAFLKRHAIDVLICNLNKDVRVAGLAAQI
                     VQTPIVLARHGMLLCDNKWKHKVTLTKLVDGIITNSNTIKESYKNYGWFGDNFVKVIY
                     NGIIIPEKIVAHDFSARFPGKKIIYSAGRLSEQKGFTYLIETAAILKQTRNDLVFAIS
                     GEGKLEIDLKKQVAHAGLADSFIFMGFTDNIYPYLKGCDLFVLASLFEGMPNVVMEAM
                     AMKKAVIATDVNGARELMVDGKTGIIVPPKQPAALACAIDKIIDNPDMLEEFGKAGYE
                     RVTHEFTMTAMGNKLEKHLQEKIVAKQRLK"
     misc_feature    complement(401548..402627)
                     /locus_tag="Cpha266_0359"
                     /note="Glycosyltransferase [Cell envelope biogenesis,
                     outer membrane]; Region: RfaG; COG0438"
                     /db_xref="CDD:223515"
     misc_feature    complement(401608..402624)
                     /locus_tag="Cpha266_0359"
                     /note="This family is most closely related to the GT1
                     family of glycosyltransferases. WabH in Klebsiella
                     pneumoniae has been shown to transfer a GlcNAc residue
                     from UDP-GlcNAc onto the acceptor GalUA residue in the
                     cellular outer core; Region: GT1_WabH_like; cd03811"
                     /db_xref="CDD:99982"
     misc_feature    complement(order(401815..401817,401881..401883,
                     402061..402069,402580..402582))
                     /locus_tag="Cpha266_0359"
                     /note="putative ADP-binding pocket [chemical binding];
                     other site"
                     /db_xref="CDD:99982"
     gene            complement(402684..403793)
                     /locus_tag="Cpha266_0360"
                     /db_xref="GeneID:4569338"
     CDS             complement(402684..403793)
                     /locus_tag="Cpha266_0360"
                     /note="PFAM: glycosyl transferase, family 9;
                     KEGG: cte:CT0221 heptosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family protein"
                     /protein_id="YP_910843.1"
                     /db_xref="GI:119356199"
                     /db_xref="InterPro:IPR002201"
                     /db_xref="GeneID:4569338"
                     /translation="MKIPFMNSSRTLGKKNKLFRKLFTRTLQLIVHKREPLRQFTGPL
                     NSIVILAQEKIGDSILLTPLLSNLRHYFPDLEIHLICFSEASVNFFRNDPHITAIHSV
                     KKNIVRYYKDVLSREFDLLFNTKDSPSTNFLIQTLLIRARFKAGHAHPYHEGIFNHLI
                     TIEYHTRMAVKNCSILPLLSIRVEEKKYRPYLPPAPVSSAIKRFSEKINNDVLTGLNI
                     SAGGPLRCWTEAKWSALIKGFPDMQFVIFSAPGDTHIKLRLEQHDNVTVSPPTANIYE
                     VGLLVKHLRLLVTPDTSLVHVASCYNIPVIGLYTSAPQDLSRFGPYLVDFEIITSSTS
                     QVSDIEVEAVTSVMQNKLQQQLDMTADRTTGNNRQ"
     misc_feature    complement(402732..403658)
                     /locus_tag="Cpha266_0360"
                     /note="ADP-heptose:LPS heptosyltransferase [Cell envelope
                     biogenesis, outer membrane]; Region: RfaF; COG0859"
                     /db_xref="CDD:223928"
     misc_feature    complement(402807..403658)
                     /locus_tag="Cpha266_0360"
                     /note="Lipopolysaccharide heptosyltransferase is involved
                     in the biosynthesis of lipooligosaccharide (LOS).
                     Lipopolysaccharide (LPS) is a major component of the outer
                     membrane of gram-negative bacteria. LPS
                     heptosyltransferase transfers heptose molecules from...;
                     Region: GT1_LPS_heptosyltransferase; cd03789"
                     /db_xref="CDD:99964"
     misc_feature    complement(order(402903..402905,402912..402917,
                     402924..402926,402960..402965,403053..403055,
                     403143..403148))
                     /locus_tag="Cpha266_0360"
                     /note="putative active site [active]"
                     /db_xref="CDD:99964"
     gene            404366..405319
                     /locus_tag="Cpha266_0361"
                     /db_xref="GeneID:4569339"
     CDS             404366..405319
                     /locus_tag="Cpha266_0361"
                     /note="PFAM: Abortive infection protein;
                     KEGG: plt:Plut_1789 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="abortive infection protein"
                     /protein_id="YP_910844.1"
                     /db_xref="GI:119356200"
                     /db_xref="InterPro:IPR003675"
                     /db_xref="GeneID:4569339"
                     /translation="MKAQKSLHAEPSLVRRPSFIMNTLILFGIMMLYQVMGSLLLLKI
                     TAIDLSLLFSLDDQARTISLMRIMQVASQLLLLALPVLLLAKRHTGGEHLFSAKTLAF
                     LGIRRNGSQALALWAVLGVFCLQPLMQTIAELQQLFLWPALGEAGKQVVENQKAMDRI
                     IAALAVMRSLPEAVAVVAVLAVTPAMCEEVLFRGYIQENYRQSIDPRGAVILTGFVFA
                     VFHLSAANFVPLTILGCYIGYVYLNAGTLFVPFAVHLFNNLAALALLSMGSGSGSADA
                     GASFSGVVGFWWWWLVVAGSLGLFFLCMVMFRAASFSQRRQ"
     misc_feature    404924..405139
                     /locus_tag="Cpha266_0361"
                     /note="CAAX protease self-immunity; Region: Abi;
                     pfam02517"
                     /db_xref="CDD:217080"
     gene            405339..406193
                     /locus_tag="Cpha266_0362"
                     /db_xref="GeneID:4569340"
     CDS             405339..406193
                     /locus_tag="Cpha266_0362"
                     /note="PFAM: phosphatidate cytidylyltransferase;
                     KEGG: plt:Plut_1788 phosphatidate cytidylyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidate cytidylyltransferase"
                     /protein_id="YP_910845.1"
                     /db_xref="GI:119356201"
                     /db_xref="InterPro:IPR000374"
                     /db_xref="GeneID:4569340"
                     /translation="MHGIAVPITEIMGTLLSINLLQRIVVAVLGIPLLLWINREGGIL
                     FFLLVLLLSLLATVEFYRLAEHKAHPSPLWLVLPWTVLIQVNFYIGIADTAELLLLMV
                     LFLFVLELFDKEGSPLLNLGSLLTGLLYVNLCFGSLLRLRLSLHDGRGEAFVLLLLVC
                     VWSADIFAYFGGSTLGGKLIHRKLFERLSPHKTWEGFLSGFFGSLAASMVFARFVPDV
                     SDSAALITGALIGLGSPAGDLIESMFKRDAGVKDSSGLIPGHGGVLDRFDTVMFVSPF
                     IYLIITYL"
     misc_feature    <405741..406190
                     /locus_tag="Cpha266_0362"
                     /note="Cytidylyltransferase family; Region: CTP_transf_1;
                     pfam01148"
                     /db_xref="CDD:216329"
     misc_feature    <405783..406184
                     /locus_tag="Cpha266_0362"
                     /note="CDP-diglyceride synthetase [Lipid metabolism];
                     Region: CdsA; COG0575"
                     /db_xref="CDD:223648"
     gene            407105..407575
                     /locus_tag="Cpha266_0363"
                     /db_xref="GeneID:4569341"
     CDS             407105..407575
                     /locus_tag="Cpha266_0363"
                     /note="TIGRFAM: PTS system, fructose subfamily, IIA
                     subunit;
                     PFAM: phosphoenolpyruvate-dependent sugar
                     phosphotransferase system, EIIA 2;
                     KEGG: cch:Cag_1468 putative PTS IIA-like
                     nitrogen-regulatory protein PtsN"
                     /codon_start=1
                     /transl_table=11
                     /product="putative PTS IIA-like nitrogen-regulatory
                     protein PtsN"
                     /protein_id="YP_910846.1"
                     /db_xref="GI:119356202"
                     /db_xref="InterPro:IPR002178"
                     /db_xref="InterPro:IPR004715"
                     /db_xref="GeneID:4569341"
                     /translation="MKIESLLSESFIALNLDLASKSQVIDAMLDLVATHPSVCDKEKL
                     RQDVLKREREMSTGIGKAIALPHAKTSAVKHPVLALATLHKEINFDSIDNEPVRIIFL
                     LATPEEMLAEHLKLLGRITRLAGRMDFREQLLLLKTPAAVLDLFREEEKDFPQI"
     misc_feature    407123..407542
                     /locus_tag="Cpha266_0363"
                     /note="PTS_IIA, PTS system, fructose/mannitol specific IIA
                     subunit. The bacterial phosphoenolpyruvate: sugar
                     phosphotransferase system (PTS) is a multi-protein system
                     involved in the regulation of a variety of metabolic and
                     transcriptional processes. This...; Region: PTS_IIA_fru;
                     cd00211"
                     /db_xref="CDD:238129"
     misc_feature    order(407255..407257,407303..407305)
                     /locus_tag="Cpha266_0363"
                     /note="active site"
                     /db_xref="CDD:238129"
     misc_feature    407303..407305
                     /locus_tag="Cpha266_0363"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238129"
     gene            407766..409055
                     /gene="hisS"
                     /locus_tag="Cpha266_0364"
                     /db_xref="GeneID:4569342"
     CDS             407766..409055
                     /gene="hisS"
                     /locus_tag="Cpha266_0364"
                     /EC_number="6.1.1.21"
                     /note="catalyzes a two-step reaction, first charging a
                     histidine molecule by linking its carboxyl group to the
                     alpha-phosphate of ATP, followed by transfer of the
                     aminoacyl-adenylate to its tRNA; class II aminoacyl-tRNA
                     synthetase; forms homodimers; some organisms have a
                     paralogous gene, hisZ, that is similar to hisS and
                     produces a protein that performs the first step in
                     histidine biosynthesis along with HisG"
                     /codon_start=1
                     /transl_table=11
                     /product="histidyl-tRNA synthetase"
                     /protein_id="YP_910847.1"
                     /db_xref="GI:119356203"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR004516"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="GeneID:4569342"
                     /translation="MSQYQVVKGARDIFPDEIVRWHYVEDVVHRLASLYGYSEIRTPV
                     FEYTELFQRSIGTTTDIVGKEMFSFLPDPQGRSITLRPEMTAGVMRAVLQKNLLSTAP
                     IHKLFYLSELFRKERPQAGRQRQFSQFGAELLGVSSPAAVAEVITFMMQVFETLGIRG
                     LKLRINTLGDSSDRARYREILRAYLAPFYDRLDLASRERFEKNPLRILDSKNPDMQEI
                     IEGAPTLHDSLSHEALEDFEKVRFYLDSRSIAYDIDYRLVRGLDYYCHTAFEVTSPEL
                     GAQDAIGGGGRYDGLAKELGSSGDVPASGFAAGMERVLITMEKQGLFAALRPSGPKVY
                     VVAQQHALLDHALQVAYRLRREGISTEVDLAGRSMKAQMRDANRMRACFALFIGEDEV
                     VSGSYALKNLVTADQTAQSIETIIEMLNQYSGAEQGS"
     misc_feature    407766..409028
                     /gene="hisS"
                     /locus_tag="Cpha266_0364"
                     /note="histidyl-tRNA synthetase; Reviewed; Region: hisS;
                     PRK00037"
                     /db_xref="CDD:234586"
     misc_feature    407814..408719
                     /gene="hisS"
                     /locus_tag="Cpha266_0364"
                     /note="Class II Histidinyl-tRNA synthetase (HisRS)-like
                     catalytic core domain. HisRS is a homodimer. It is
                     responsible for the attachment of histidine to the 3' OH
                     group of ribose of the appropriate tRNA. This domain is
                     primarily responsible for...; Region: HisRS-like_core;
                     cd00773"
                     /db_xref="CDD:238396"
     misc_feature    order(407829..407831,407865..407867,407880..407900,
                     407970..407975,408012..408014,408018..408020,
                     408033..408038,408045..408050,408135..408140,
                     408159..408161,408183..408185,408195..408197,
                     408204..408206,408621..408623,408678..408683)
                     /gene="hisS"
                     /locus_tag="Cpha266_0364"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238396"
     misc_feature    407874..407900
                     /gene="hisS"
                     /locus_tag="Cpha266_0364"
                     /note="motif 1; other site"
                     /db_xref="CDD:238396"
     misc_feature    order(408012..408014,408018..408020,408105..408107,
                     408111..408113,408132..408134,408141..408143,
                     408147..408149,408159..408161,408540..408542,
                     408546..408548,408552..408557,408606..408608,
                     408621..408623,408681..408683,408690..408692,
                     408699..408701)
                     /gene="hisS"
                     /locus_tag="Cpha266_0364"
                     /note="active site"
                     /db_xref="CDD:238396"
     misc_feature    408102..408116
                     /gene="hisS"
                     /locus_tag="Cpha266_0364"
                     /note="motif 2; other site"
                     /db_xref="CDD:238396"
     misc_feature    order(408678..408692,408699..408701)
                     /gene="hisS"
                     /locus_tag="Cpha266_0364"
                     /note="motif 3; other site"
                     /db_xref="CDD:238396"
     misc_feature    408753..409022
                     /gene="hisS"
                     /locus_tag="Cpha266_0364"
                     /note="HisRS Histidyl-anticodon binding domain. HisRS
                     belongs to class II aminoacyl-tRNA synthetases (aaRS).
                     This alignment contains the anticodon binding domain,
                     which is responsible for specificity in tRNA-binding, so
                     that the activated amino acid is...; Region:
                     HisRS_anticodon; cd00859"
                     /db_xref="CDD:238436"
     misc_feature    order(408777..408782,408885..408887,408903..408905,
                     408927..408929,408957..408959,408963..408965)
                     /gene="hisS"
                     /locus_tag="Cpha266_0364"
                     /note="anticodon binding site; other site"
                     /db_xref="CDD:238436"
     gene            409052..409312
                     /locus_tag="Cpha266_0365"
                     /db_xref="GeneID:4569343"
     CDS             409052..409312
                     /locus_tag="Cpha266_0365"
                     /note="PFAM: glutaredoxin 2;
                     KEGG: cte:CT0237 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="glutaredoxin"
                     /protein_id="YP_910848.1"
                     /db_xref="GI:119356204"
                     /db_xref="InterPro:IPR008554"
                     /db_xref="GeneID:4569343"
                     /translation="MTESLHTVTIYGAKGCCLCDDALERVLDVQGSVPFLLEKTDISG
                     SPELQQQYGEAIPVVCIDGVEVFRYRVNKTRLLQILRGQGGV"
     misc_feature    409070..409291
                     /locus_tag="Cpha266_0365"
                     /note="Glutaredoxin-like domain (DUF836); Region: DUF836;
                     pfam05768"
                     /db_xref="CDD:218740"
     gene            409463..409666
                     /locus_tag="Cpha266_0366"
                     /db_xref="GeneID:4569344"
     CDS             409463..409666
                     /locus_tag="Cpha266_0366"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910849.1"
                     /db_xref="GI:119356205"
                     /db_xref="GeneID:4569344"
                     /translation="MLKFILFVIVVFLVLRMVMRFFTMAVFRKERDANAVRSHMSQNI
                     EEADYEVLDSRLAEKEEDGQKGV"
     gene            409789..410310
                     /locus_tag="Cpha266_0367"
                     /db_xref="GeneID:4569345"
     CDS             409789..410310
                     /locus_tag="Cpha266_0367"
                     /note="PFAM: protein of unknown function DUF150;
                     KEGG: plt:Plut_1781 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910850.1"
                     /db_xref="GI:119356206"
                     /db_xref="InterPro:IPR003728"
                     /db_xref="GeneID:4569345"
                     /translation="MEEKIRRCVLQVLEATAGTKGEGVYLVSLSIKGSGKGTSIEVLV
                     DTDTGIRIDQCAFLSRRIRECLEVEEESDGMSGDDFNLDVASPGLGKAIILQRQYARH
                     VGRLFRVTFREEDGSMTEISGHLREILFPEEENASLVIEPLGKKKAGKKVSSENRTLR
                     LDRVIRAVPEAEL"
     misc_feature    409789..410307
                     /locus_tag="Cpha266_0367"
                     /note="ribosome maturation protein RimP; Reviewed; Region:
                     PRK00092"
                     /db_xref="CDD:234627"
     misc_feature    409789..410307
                     /locus_tag="Cpha266_0367"
                     /note="hypothetical protein; Provisional; Region:
                     PRK14641"
                     /db_xref="CDD:173104"
     gene            410366..411922
                     /gene="nusA"
                     /locus_tag="Cpha266_0368"
                     /db_xref="GeneID:4569346"
     CDS             410366..411922
                     /gene="nusA"
                     /locus_tag="Cpha266_0368"
                     /note="modifies transcription through interactions with
                     RNA polymerase affecting elongation, readthrough,
                     termination, and antitermination"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription elongation factor NusA"
                     /protein_id="YP_910851.1"
                     /db_xref="GI:119356207"
                     /db_xref="InterPro:IPR003029"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="InterPro:IPR010213"
                     /db_xref="InterPro:IPR013735"
                     /db_xref="GeneID:4569346"
                     /translation="MVRKQVKTEGQDRKAQIASAFGEIEQSKIFLDKRTESAAVKMDI
                     ADLLKDIIQKQLRKDYDPEVEANIFINPERGDFEVYILKKVVSEVDLESIEISIDEVR
                     KIDDSLELGDYYEEGPIKLEDYLSRKSIQIIKQSVQKKVRDLERLVVYEECLEKVGEV
                     VAGEVYQVRSNEVIFTYNTSKDHRVELVLPRAEMIKKDNPRRNPRMKLYVKRIEREKV
                     KVRLDDGGVVERDKPDGGMKVIVSRIDDRFLYKLFEHEVPEILDGLIVIKGIARVPGE
                     RAKVAVESTSARIDPVGASVGYRGKRIQSIVKELNNENIDVIYYTDEPQIYIARALQP
                     AKIDPLTVHADIKTRKARVMLKPDQIKYAIGKNGNNIHLAEKLTGYEIDVYRDVMDKS
                     MEDPTDIDIIEFREEFGDDMIYQLLDGGLDTAKKVLKAGVERIEEVLLGPSAPEEITF
                     FSKGRTRSPIKPRERKVTEEEKRYWKKIAENIFKTVKEQFTDADLHDLFDDGDEDSDD
                     QQAAESPADE"
     misc_feature    410501..410803
                     /gene="nusA"
                     /locus_tag="Cpha266_0368"
                     /note="NusA N-terminal domain; Region: NusA_N; pfam08529"
                     /db_xref="CDD:219884"
     misc_feature    410507..411526
                     /gene="nusA"
                     /locus_tag="Cpha266_0368"
                     /note="transcription termination factor NusA; Region:
                     NusA; TIGR01953"
                     /db_xref="CDD:233654"
     misc_feature    410828..411013
                     /gene="nusA"
                     /locus_tag="Cpha266_0368"
                     /note="S1_NusA: N-utilizing substance A protein (NusA),
                     S1-like RNA-binding domain. S1-like RNA-binding domains
                     are found in a wide variety of RNA-associated proteins.
                     NusA is a transcription elongation factor containing an
                     N-terminal catalytic domain and three...; Region: S1_NusA;
                     cd04455"
                     /db_xref="CDD:239902"
     misc_feature    order(410861..410863,410885..410887,410927..410929,
                     410933..410935)
                     /gene="nusA"
                     /locus_tag="Cpha266_0368"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:239902"
     misc_feature    order(410867..410869,410879..410881,410921..410923,
                     410927..410929)
                     /gene="nusA"
                     /locus_tag="Cpha266_0368"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239902"
     misc_feature    411185..411376
                     /gene="nusA"
                     /locus_tag="Cpha266_0368"
                     /note="NusA-like KH domain; Region: KH_5; pfam13184"
                     /db_xref="CDD:205365"
     misc_feature    411335..411520
                     /gene="nusA"
                     /locus_tag="Cpha266_0368"
                     /note="NusA_K homology RNA-binding domain (KH). NusA is an
                     essential multifunctional transcription elongation factor
                     that is universally conserved among prokaryotes and
                     archaea. NusA anti-termination function plays an important
                     role in the expression of...; Region: NusA_KH; cd02134"
                     /db_xref="CDD:239049"
     misc_feature    411458..411469
                     /gene="nusA"
                     /locus_tag="Cpha266_0368"
                     /note="G-X-X-G motif; other site"
                     /db_xref="CDD:239049"
     gene            411989..414964
                     /gene="infB"
                     /locus_tag="Cpha266_0369"
                     /db_xref="GeneID:4569347"
     CDS             411989..414964
                     /gene="infB"
                     /locus_tag="Cpha266_0369"
                     /note="Protects formylmethionyl-tRNA from spontaneous
                     hydrolysis and promotes its binding to the 30S ribosomal
                     subunits during initiation of protein synthesis. Also
                     involved in the hydrolysis of GTP during the formation of
                     the 70S ribosomal complex"
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-2"
                     /protein_id="YP_910852.1"
                     /db_xref="GI:119356208"
                     /db_xref="InterPro:IPR000178"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR002917"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006847"
                     /db_xref="InterPro:IPR013684"
                     /db_xref="GeneID:4569347"
                     /translation="MALEDMEKRYRISDLSRELQVSPQEVLQFIRMNGGKVGSTSSMV
                     NEEMRGMIFGNFSVEKKMVDEAMKIRAEKQRRLTRLEEQSRKTYEKEQQLRDSMHVAP
                     LVPVAPLHVAQDVIVEVAAPPSAQADHTVQAEPAVQTESAVQTESAVQTESAVQTEPA
                     VQTEPAVQTEPEVQTEPAAQTEPEVQTEPAAQTEPAAQTEPAAQTESAVQTEADLSDV
                     GEVSIVPENVEVIDVPELPMVPVMPVKEEPSVNDQLVSFDIPQNIGGLTVVGTLDMMN
                     PFDRSESGKMKARKKNFKEQADALKSEFDTPAGEEKLVDDKLVVKKKPVKAAGDGDTA
                     PAADDALAGKKKPGKKKKKPDVDEKVISANIRTTISGMDDSAGSVSRQKFRKMRRMER
                     EKEHEAAEAFRESQRAIVRVTEYASPHELAELMGVTAKEIIQKCFALGKFVTINQRLD
                     KESLELIALEFGFEAEFISEIEATAVVAEVDDAEDLLIRPPVVTIMGHVDHGKTSLLD
                     YIRNSNVVAGESGGITQHIGAYEVTVEGNRKITFLDTPGHEAFTAMRARGAQVTDIVI
                     LVVAADDSVMPQTIEAINHAKAAGVPIVVAINKIDKPAANPEKIKTQLSEAGVLVEDW
                     GGEYQCQEISAKQGIGIEELMGKLLTEAEIRELKGNFSEDVLASGIIIESELDKGKGV
                     ISTVLVQRGYLRVGDPFVAGNTMGRVRALMDERSKRIHEAGPSQPVRVLGFEALPQSG
                     DVLTVMASDRDARELAQKRQVIRREHEFRRSTRVKLDSIARQIREGLMKELSVIIKAD
                     TDGSIQALADGLMKIHNEEVKVQIIHQGVGQITETDVLLAAASDAIIIGFRVRPNVNA
                     KKLAEKEDLDVRFYSVIYHVLEDVEKALEGMLSPELHEESLGSLEIRQVFRVPKVGNV
                     GGCYALEGKVFRDSKVRLLRDGVQVYDGQLDTLRRFKDDVKEVDAGYECGLSLKNYDD
                     IKVGDIVEAYKIVEKKRKL"
     misc_feature    <412346..>412669
                     /gene="infB"
                     /locus_tag="Cpha266_0369"
                     /note="cell division protein DamX; Validated; Region:
                     PRK10905"
                     /db_xref="CDD:236792"
     misc_feature    413243..413380
                     /gene="infB"
                     /locus_tag="Cpha266_0369"
                     /note="Translation initiation factor IF-2, N-terminal
                     region; Region: IF2_N; pfam04760"
                     /db_xref="CDD:218250"
     misc_feature    413246..414961
                     /gene="infB"
                     /locus_tag="Cpha266_0369"
                     /note="translation initiation factor IF-2; Region: IF-2;
                     TIGR00487"
                     /db_xref="CDD:232995"
     misc_feature    413459..413950
                     /gene="infB"
                     /locus_tag="Cpha266_0369"
                     /note="Initiation Factor 2 (IF2)/ eukaryotic Initiation
                     Factor 5B (eIF5B) family; Region: IF2_eIF5B; cd01887"
                     /db_xref="CDD:206674"
     misc_feature    413477..413500
                     /gene="infB"
                     /locus_tag="Cpha266_0369"
                     /note="G1 box; other site"
                     /db_xref="CDD:206674"
     misc_feature    order(413480..413482,413486..413488,413498..413503,
                     413510..413512,413519..413524,413570..413575,
                     413630..413635,413702..413707,413810..413812,
                     413822..413824)
                     /gene="infB"
                     /locus_tag="Cpha266_0369"
                     /note="putative GEF interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:206674"
     misc_feature    order(413483..413503,413633..413635,413780..413785,
                     413789..413794,413888..413896)
                     /gene="infB"
                     /locus_tag="Cpha266_0369"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206674"
     misc_feature    413552..413572
                     /gene="infB"
                     /locus_tag="Cpha266_0369"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206674"
     misc_feature    413558..413560
                     /gene="infB"
                     /locus_tag="Cpha266_0369"
                     /note="G2 box; other site"
                     /db_xref="CDD:206674"
     misc_feature    413618..413629
                     /gene="infB"
                     /locus_tag="Cpha266_0369"
                     /note="G3 box; other site"
                     /db_xref="CDD:206674"
     misc_feature    413624..413680
                     /gene="infB"
                     /locus_tag="Cpha266_0369"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206674"
     misc_feature    413780..413791
                     /gene="infB"
                     /locus_tag="Cpha266_0369"
                     /note="G4 box; other site"
                     /db_xref="CDD:206674"
     misc_feature    413888..413896
                     /gene="infB"
                     /locus_tag="Cpha266_0369"
                     /note="G5 box; other site"
                     /db_xref="CDD:206674"
     misc_feature    413987..414268
                     /gene="infB"
                     /locus_tag="Cpha266_0369"
                     /note="This family represents the domain II of bacterial
                     Initiation Factor 2 (IF2) and its eukaryotic mitochondrial
                     homologue mtIF2. IF2, the largest initiation factor is an
                     essential GTP binding protein. In E. coli three natural
                     forms of IF2 exist in the cell; Region: IF2_mtIF2_II;
                     cd03702"
                     /db_xref="CDD:239673"
     misc_feature    414308..414634
                     /gene="infB"
                     /locus_tag="Cpha266_0369"
                     /note="Translation-initiation factor 2; Region: IF-2;
                     pfam11987"
                     /db_xref="CDD:221359"
     misc_feature    414680..414931
                     /gene="infB"
                     /locus_tag="Cpha266_0369"
                     /note="mtIF2_IVc: this family represents the C2 subdomain
                     of domain IV of mitochondrial translation initiation
                     factor 2 (mtIF2) which adopts a beta-barrel fold
                     displaying a high degree of structural similarity with
                     domain II of the translation elongation factor...; Region:
                     mtIF2_IVc; cd03692"
                     /db_xref="CDD:239663"
     gene            414983..415333
                     /locus_tag="Cpha266_0370"
                     /db_xref="GeneID:4569348"
     CDS             414983..415333
                     /locus_tag="Cpha266_0370"
                     /note="PFAM: ribosome-binding factor A;
                     KEGG: plt:Plut_1778 ribosome-binding factor A"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome-binding factor A"
                     /protein_id="YP_910853.1"
                     /db_xref="GI:119356209"
                     /db_xref="InterPro:IPR000238"
                     /db_xref="GeneID:4569348"
                     /translation="MSIRTEKVASLLQQELGMILEKEFPRGGPILTVVEVKVTADLGI
                     AKVYVSVIGSAKEQADTIEYLQQEKKNIRKILSSKIRHHFRRIPELEFYQDRLYEKAD
                     RIEQLLKEVRKEQE"
     misc_feature    414992..415306
                     /locus_tag="Cpha266_0370"
                     /note="Ribosome-binding factor A; Region: RBFA; pfam02033"
                     /db_xref="CDD:216854"
     gene            415342..416100
                     /locus_tag="Cpha266_0371"
                     /db_xref="GeneID:4569349"
     CDS             415342..416100
                     /locus_tag="Cpha266_0371"
                     /EC_number="4.2.1.70"
                     /note="KEGG: cch:Cag_1460 tRNA pseudouridine synthase B;
                     TIGRFAM: tRNA pseudouridine synthase B;
                     PFAM: pseudouridylate synthase TruB domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA pseudouridine synthase B"
                     /protein_id="YP_910854.1"
                     /db_xref="GI:119356210"
                     /db_xref="InterPro:IPR002501"
                     /db_xref="InterPro:IPR004510"
                     /db_xref="GeneID:4569349"
                     /translation="MDQEGLKSVAGTLHTPEVHEDSGCFHLVDKPVDWTSFDVVAKIR
                     NTYKLIGQKRKVGHCGTLDPKASGLLILATGRKTKEIASLELLDKVYEGSFKLGVVTD
                     SHDRETPEYNQCATGHLEREQIIEAAASFVGTRQQQPPMYSAAWHNGKRLYELARKGD
                     VVHDRKAKEIIIRRFEITAVELPLVRFILEVSKGAYIRVIAHELGALLGVGAYLASLK
                     RVAIGPYELGSACSVPETIEAILKKRESVLFIEK"
     misc_feature    415414..416022
                     /locus_tag="Cpha266_0371"
                     /note="tRNA pseudouridine(55) synthase; Region: TruB;
                     TIGR00431"
                     /db_xref="CDD:129523"
     misc_feature    415420..416061
                     /locus_tag="Cpha266_0371"
                     /note="Pseudouridine synthases catalyze the isomerization
                     of specific uridines in an RNA molecule to pseudouridines
                     (5-ribosyluracil, psi); Region: PseudoU_synth; cl00130"
                     /db_xref="CDD:241628"
     misc_feature    order(415519..415530,415933..415935)
                     /locus_tag="Cpha266_0371"
                     /note="active site"
                     /db_xref="CDD:211324"
     gene            416110..417075
                     /locus_tag="Cpha266_0372"
                     /db_xref="GeneID:4569350"
     CDS             416110..417075
                     /locus_tag="Cpha266_0372"
                     /EC_number="2.7.1.26"
                     /EC_number="2.7.7.2"
                     /note="TIGRFAM: riboflavin biosynthesis protein RibF;
                     PFAM: Riboflavin kinase / FAD synthetase;
                     KEGG: plt:Plut_1776 riboflavin kinase / FAD synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="riboflavin kinase/FMN adenylyltransferase"
                     /protein_id="YP_910855.1"
                     /db_xref="GI:119356211"
                     /db_xref="InterPro:IPR002606"
                     /db_xref="GeneID:4569350"
                     /translation="MLVVEYQNNDVVAYPSGEPVIFSPVPSAVTIGSFDGVHRGHRSI
                     IARMNAIARSRQLRSVVVTFEPHPRRVLSASASPSPLVLSTLDEKVALLTSLDVDLLF
                     VIRFTDAFAARSSEDFIVGVLVKLLCAKSIIVGYDHGFGRNRTGSSETLLHLGKEFGF
                     DVEAITEVKIGNEHFSSTRIRKLLESGNLSDANQFLGYSYIVSGTVVGGDQRGRTIGF
                     PTVNIKPSDPQKLLPHSGVYLAMIELDGISYKAMMNIGVRPTVSQGNEKTVEAHIPGF
                     SGELYGAFLSFRLLVYIREEKKFATIDELKEQLEKDKKTVELYNE"
     misc_feature    416170..417015
                     /locus_tag="Cpha266_0372"
                     /note="bifunctional riboflavin kinase/FMN
                     adenylyltransferase; Reviewed; Region: PRK05627"
                     /db_xref="CDD:235536"
     misc_feature    416188..416736
                     /locus_tag="Cpha266_0372"
                     /note="FAD synthetase, N-terminal domain of the
                     bifunctional enzyme; Region: FAD_synthetase_N; cd02064"
                     /db_xref="CDD:185679"
     misc_feature    order(416203..416214,416221..416223,416230..416232,
                     416518..416520,416608..416610,416632..416640)
                     /locus_tag="Cpha266_0372"
                     /note="active site"
                     /db_xref="CDD:185679"
     misc_feature    416692..417015
                     /locus_tag="Cpha266_0372"
                     /note="Riboflavin kinase; Region: Flavokinase; pfam01687"
                     /db_xref="CDD:190069"
     gene            417123..417392
                     /gene="rpsO"
                     /locus_tag="Cpha266_0373"
                     /db_xref="GeneID:4569351"
     CDS             417123..417392
                     /gene="rpsO"
                     /locus_tag="Cpha266_0373"
                     /note="primary rRNA binding protein; helps nucleate
                     assembly of 30S; binds directly to the 16S rRNA and an
                     intersubunit bridge to the 23S rRNA; autoregulates
                     translation through interactions with the mRNA leader
                     sequence"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S15"
                     /protein_id="YP_910856.1"
                     /db_xref="GI:119356212"
                     /db_xref="InterPro:IPR000589"
                     /db_xref="InterPro:IPR005290"
                     /db_xref="GeneID:4569351"
                     /translation="MSLTQEDKAGIISQFGGVQQNTGKAEVQVALFSRRITDLTGHLQ
                     QHPKDKHSRRGLLMLVGKRKKVLNYLKNVDIERYRTVIAELDLRK"
     misc_feature    417144..417380
                     /gene="rpsO"
                     /locus_tag="Cpha266_0373"
                     /note="Ribosomal protein S15 (prokaryotic)_S13
                     (eukaryotic) binds the central domain of 16S rRNA and is
                     required for assembly of the small ribosomal subunit and
                     for intersubunit association, thus representing a key
                     element in the assembly of the whole ribosome; Region:
                     Ribosomal_S15p_S13e; cd00353"
                     /db_xref="CDD:238213"
     misc_feature    order(417144..417146,417195..417197,417204..417206,
                     417225..417227,417237..417239,417246..417248,
                     417258..417260,417264..417269,417273..417278,
                     417315..417317,417327..417329)
                     /gene="rpsO"
                     /locus_tag="Cpha266_0373"
                     /note="16S/18S rRNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238213"
     misc_feature    order(417210..417212,417219..417224,417231..417233,
                     417240..417242,417360..417362,417372..417374)
                     /gene="rpsO"
                     /locus_tag="Cpha266_0373"
                     /note="S13e-L30e interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:238213"
     misc_feature    order(417300..417302,417312..417314,417375..417380)
                     /gene="rpsO"
                     /locus_tag="Cpha266_0373"
                     /note="25S rRNA binding site [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238213"
     gene            417471..418373
                     /locus_tag="Cpha266_0374"
                     /db_xref="GeneID:4569352"
     CDS             417471..418373
                     /locus_tag="Cpha266_0374"
                     /note="PFAM: YicC N-terminal domain protein; domain of
                     unknown function DUF1732;
                     KEGG: plt:Plut_1774 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910857.1"
                     /db_xref="GI:119356213"
                     /db_xref="InterPro:IPR005229"
                     /db_xref="InterPro:IPR013527"
                     /db_xref="InterPro:IPR013551"
                     /db_xref="GeneID:4569352"
                     /translation="MQRYIMLESMTGYGSAEAVDNGVRVFVELRSVNNRFAEVSVKLP
                     RQLLAFELEVRELVRSTFQRGKISASIQVQADQEVDFPLRVNPLKVKACRELLDDVRM
                     AAGIDAPVSLEHVLRFSEIFETGNTVLDNTEWLWSFVKKLLQDAMHKLKEMRRKEGEE
                     LSLDFTARIAQIERTLAEISSASQGNLQAARKKLASKAELIAGQDIAYSRDRLEMELV
                     LAADKLDITEEFTRFSSHNKFFLEELNNDESGTGRKLNFLLQEQLREANTIASKSQSA
                     EISQKIVHVKEELEKIREQLQNIE"
     misc_feature    417486..418370
                     /locus_tag="Cpha266_0374"
                     /note="hypothetical protein; Provisional; Region:
                     PRK11820"
                     /db_xref="CDD:236993"
     misc_feature    417489..417962
                     /locus_tag="Cpha266_0374"
                     /note="YicC-like family, N-terminal region; Region:
                     YicC_N; pfam03755"
                     /db_xref="CDD:217714"
     misc_feature    418110..418370
                     /locus_tag="Cpha266_0374"
                     /note="Domain of unknown function (DUF1732); Region:
                     DUF1732; pfam08340"
                     /db_xref="CDD:149411"
     gene            418378..418962
                     /gene="gmk"
                     /locus_tag="Cpha266_0375"
                     /db_xref="GeneID:4569353"
     CDS             418378..418962
                     /gene="gmk"
                     /locus_tag="Cpha266_0375"
                     /EC_number="2.7.4.8"
                     /note="Essential for recycling GMP and indirectly, cGMP"
                     /codon_start=1
                     /transl_table=11
                     /product="guanylate kinase"
                     /protein_id="YP_910858.1"
                     /db_xref="GI:119356214"
                     /db_xref="InterPro:IPR008144"
                     /db_xref="InterPro:IPR008145"
                     /db_xref="GeneID:4569353"
                     /translation="MTISRGPTGKLVVFSAPSGTGKSTIAKIVLERIPSLAFSVSATT
                     RPMRAGEEEGVHYYFLDKKKFEEKIRDGGFIEHEYFFNNYYGTLLDKTVDAVNSGHHL
                     LFDLDVKGALNLKTLFPLNSLLIFIRPPDMATLRERLLKRESEDADALNVRLERAELE
                     LGYVDQFDEVIVNDCLDRAADAVTAKVSEFLSNT"
     misc_feature    418402..418959
                     /gene="gmk"
                     /locus_tag="Cpha266_0375"
                     /note="Guanylate kinase [Nucleotide transport and
                     metabolism]; Region: Gmk; COG0194"
                     /db_xref="CDD:223272"
     misc_feature    418408..418770
                     /gene="gmk"
                     /locus_tag="Cpha266_0375"
                     /note="Guanosine monophosphate kinase (GMPK, EC 2.7.4.8),
                     also known as guanylate kinase (GKase), catalyzes the
                     reversible phosphoryl transfer from adenosine triphosphate
                     (ATP) to guanosine monophosphate (GMP) to yield adenosine
                     diphosphate (ADP) and guanosine...; Region: GMPK; cd00071"
                     /db_xref="CDD:238026"
     misc_feature    order(418423..418425,418441..418443,418489..418491,
                     418510..418512,418519..418521,418546..418548,
                     418615..418617,418630..418632)
                     /gene="gmk"
                     /locus_tag="Cpha266_0375"
                     /note="catalytic site [active]"
                     /db_xref="CDD:238026"
     misc_feature    order(418423..418425,418441..418443)
                     /gene="gmk"
                     /locus_tag="Cpha266_0375"
                     /note="G-X2-G-X-G-K; other site"
                     /db_xref="CDD:238026"
     gene            418974..419324
                     /locus_tag="Cpha266_0376"
                     /db_xref="GeneID:4569354"
     CDS             418974..419324
                     /locus_tag="Cpha266_0376"
                     /note="KEGG: plt:Plut_1772 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910859.1"
                     /db_xref="GI:119356215"
                     /db_xref="GeneID:4569354"
                     /translation="MSVNPVDLNKLRSAHANLYETVVAISKRAKKIHEEERAELEEKL
                     LPYKEMIRNPGSESESDKVFPEQIAISLEFESREKASQKAVAGYLQHRYDYTLGKIAE
                     PKVTPIEDDETDGD"
     gene            419302..419799
                     /locus_tag="Cpha266_0377"
                     /db_xref="GeneID:4568970"
     CDS             419302..419799
                     /locus_tag="Cpha266_0377"
                     /note="PFAM: Glyoxalase/bleomycin resistance
                     protein/dioxygenase;
                     KEGG: cte:CT0249 glutathione S-transferase, fosfomycin
                     resistance protein, putative"
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase/bleomycin resistance
                     protein/dioxygenase"
                     /protein_id="YP_910860.1"
                     /db_xref="GI:119356216"
                     /db_xref="InterPro:IPR004360"
                     /db_xref="InterPro:IPR004361"
                     /db_xref="InterPro:IPR011588"
                     /db_xref="GeneID:4568970"
                     /translation="MMKLTGINQITLRVNDLGRAEEFYADILGFRIDHRVGVNICYLR
                     LNSDMLVLVKSETPSVPESRDFRVDHFGFRLASDAEVDEAADYLDAKGVHLITRPAHR
                     QEGRAFFVMDPDGNLVEFYSMHNGGIDKECRGCDPISPDALAAGNRSKIREENDQKKP
                     RRSRK"
     misc_feature    419317..419661
                     /locus_tag="Cpha266_0377"
                     /note="Glyoxalase/Bleomycin resistance protein/Dioxygenase
                     superfamily; Region: Glyoxalase; pfam00903"
                     /db_xref="CDD:216182"
     misc_feature    419326..419661
                     /locus_tag="Cpha266_0377"
                     /note="This domain superfamily is found in a variety of
                     structurally related metalloproteins, including the type I
                     extradiol dioxygenases, glyoxalase I and a group of
                     antibiotic resistance proteins; Region: Glo_EDI_BRP_like;
                     cd06587"
                     /db_xref="CDD:211348"
     misc_feature    order(419326..419328,419338..419340,419419..419421,
                     419452..419454,419458..419460,419509..419511,
                     419626..419628,419650..419652,419656..419658)
                     /locus_tag="Cpha266_0377"
                     /note="active site"
                     /db_xref="CDD:211348"
     misc_feature    order(419326..419328,419509..419511,419656..419658)
                     /locus_tag="Cpha266_0377"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:211348"
     gene            complement(419788..420531)
                     /locus_tag="Cpha266_0378"
                     /db_xref="GeneID:4568971"
     CDS             complement(419788..420531)
                     /locus_tag="Cpha266_0378"
                     /EC_number="2.7.7.23"
                     /note="PFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
                     synthase; Nucleotidyl transferase;
                     KEGG: cte:CT0251 UDP-N-acetylglucosamine
                     pyrophosphorylase"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine pyrophosphorylase"
                     /protein_id="YP_910861.1"
                     /db_xref="GI:119356217"
                     /db_xref="InterPro:IPR001228"
                     /db_xref="InterPro:IPR005835"
                     /db_xref="GeneID:4568971"
                     /translation="MSLAVIIMAAGKGTRMQSELPKVLHKANGRPVIEYVLDTALHLK
                     PETIILIVGHQADKVIAATRQYPVICALQEPQNGTGHAVMQAEKALKTFSGDVLILSG
                     DVPLVKRSTLLQLIALHHNEQASATVLTARLDNPSGYGRIIRNKTGGEVMKIIEQRDA
                     SPEELSVDEINSGIYVFKAPVLFQALREITTENAQQEYYLTDVFDICFRNGNKVCACR
                     TENADEIRGINTPEQLRETEQLLCALSLS"
     misc_feature    complement(419830..420519)
                     /locus_tag="Cpha266_0378"
                     /note="N-terminal domain of bacterial GlmU; Region:
                     GT2_GlmU_N_bac; cd02540"
                     /db_xref="CDD:133020"
     misc_feature    complement(order(420223..420225,420229..420231,
                     420286..420288,420295..420297,420379..420381,
                     420502..420510))
                     /locus_tag="Cpha266_0378"
                     /note="Substrate binding site; other site"
                     /db_xref="CDD:133020"
     misc_feature    complement(order(419845..419847,420223..420225))
                     /locus_tag="Cpha266_0378"
                     /note="Mg++ binding site; other site"
                     /db_xref="CDD:133020"
     gene            complement(420548..420943)
                     /locus_tag="Cpha266_0379"
                     /db_xref="GeneID:4568972"
     CDS             complement(420548..420943)
                     /locus_tag="Cpha266_0379"
                     /EC_number="4.1.1.11"
                     /note="Converts L-aspartate to beta-alanine and provides
                     the major route of beta-alanine production in bacteria.
                     Beta-alanine is essential for the biosynthesis of
                     pantothenate (vitamin B5)"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate alpha-decarboxylase"
                     /protein_id="YP_910862.1"
                     /db_xref="GI:119356218"
                     /db_xref="InterPro:IPR003190"
                     /db_xref="GeneID:4568972"
                     /translation="MKLHLLKSKIHNARVTSGDLEYEGSITIDQELLLLAEMIPNEKV
                     LVVNNNNGERFETYIINGEPGSRVIQLNGAAARCALPGDEIIIMTFAVMDEKKARTFQ
                     PMVLIVDHLNNPKRRHRIGQEDEQLSSSI"
     misc_feature    complement(420608..420940)
                     /locus_tag="Cpha266_0379"
                     /note="Aspartate alpha-decarboxylase or L-aspartate
                     1-decarboxylase, a pyruvoyl group-dependent  decarboxylase
                     in beta-alanine production; Region: Asp_decarbox; cd06919"
                     /db_xref="CDD:132994"
     misc_feature    complement(order(420641..420643,420668..420676,
                     420686..420688,420710..420715,420719..420724,
                     420770..420784,420788..420790,420797..420799,
                     420803..420805,420815..420820,420827..420829,
                     420833..420835,420875..420886,420908..420913,
                     420917..420919,420923..420940))
                     /locus_tag="Cpha266_0379"
                     /note="tetramerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:132994"
     misc_feature    complement(order(420770..420772,420869..420874,
                     420911..420913,420917..420919))
                     /locus_tag="Cpha266_0379"
                     /note="active site"
                     /db_xref="CDD:132994"
     gene            complement(420965..421459)
                     /locus_tag="Cpha266_0380"
                     /db_xref="GeneID:4568973"
     CDS             complement(420965..421459)
                     /locus_tag="Cpha266_0380"
                     /note="KEGG: plt:Plut_1768 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910863.1"
                     /db_xref="GI:119356219"
                     /db_xref="GeneID:4568973"
                     /translation="MSGCGAPQSERRKPETGFIGEGHPQQESWDIHLNLTDAGIPKAS
                     IKAGYAAEFNKNSKKEYHLQKGVTVTFFNSEKEPSTILKAQEAVVHDNLDIEARGNIV
                     ITTDNTTTIKTESIKRTAKDKMIRSNDYVTITRPGETLTGYGFESDQALKKYRIFRAS
                     GESH"
     misc_feature    complement(420989..421372)
                     /locus_tag="Cpha266_0380"
                     /note="Lipopolysaccharide-assembly, LptC-related; Region:
                     LptC; pfam06835"
                     /db_xref="CDD:219198"
     gene            complement(421522..422085)
                     /locus_tag="Cpha266_0381"
                     /db_xref="GeneID:4568974"
     CDS             complement(421522..422085)
                     /locus_tag="Cpha266_0381"
                     /note="PFAM: outer membrane chaperone Skp (OmpH);
                     KEGG: plt:Plut_1767 outer membrane protein OmpH"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane chaperone Skp (OmpH)"
                     /protein_id="YP_910864.1"
                     /db_xref="GI:119356220"
                     /db_xref="InterPro:IPR005632"
                     /db_xref="GeneID:4568974"
                     /translation="MTTLIMKPMYNRKGFMSVVRKIVMASLLGLMLGAPATVHAETVG
                     VVDFGKILLQMPERKQAETTLQAMATPFQNELERMSQDLQKGLVAYEQQKASMAKPAR
                     EVKEKELNTKAQAIQKYKLEKFGQEGLVAKKEQELLIPIRQKIVASVQTIAQKEGFTL
                     VLDKGAMIYGTPASDLTFKVMNQLNLK"
     sig_peptide     complement(421963..422085)
                     /locus_tag="Cpha266_0381"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 1.000) with cleavage site probability 0.999 at
                     residue 41"
     misc_feature    complement(421534..422031)
                     /locus_tag="Cpha266_0381"
                     /note="periplasmic chaperone; Provisional; Region:
                     PRK10780"
                     /db_xref="CDD:182724"
     misc_feature    complement(421531..421959)
                     /locus_tag="Cpha266_0381"
                     /note="Outer membrane protein (OmpH-like); Region: OmpH;
                     smart00935"
                     /db_xref="CDD:214922"
     gene            422399..423127
                     /locus_tag="Cpha266_0382"
                     /db_xref="GeneID:4568975"
     CDS             422399..423127
                     /locus_tag="Cpha266_0382"
                     /note="TIGRFAM: methyltransferase FkbM family;
                     KEGG: ava:Ava_1042 methyltransferase FkbM"
                     /codon_start=1
                     /transl_table=11
                     /product="FkbM family methyltransferase"
                     /protein_id="YP_910865.1"
                     /db_xref="GI:119356221"
                     /db_xref="InterPro:IPR006342"
                     /db_xref="GeneID:4568975"
                     /translation="MGFFIRAKLYFRQLIGQEPRTNVEIACECRHIHEWCICPVGIDS
                     ASSVFSLGVGNDIGFDTGLIKDFNCSVYAFDPTPRWVEWIGSMSLPEKFKFYPYAIGG
                     TDGTMKLFPRIHKGRRSSKMLTLLNEGLHDDESIAVTMKRLSTLTAELSVPSIAILKI
                     DIEAAEYEVIDDFLADHVPVYQLLVEFHHRFASVPVKKTTDALAKLYKAGYRIFYVSE
                     KAREYSFIHEATYDGYRRQAGKSS"
     misc_feature    422555..422962
                     /locus_tag="Cpha266_0382"
                     /note="methyltransferase, FkbM family; Region: fkbM_fam;
                     TIGR01444"
                     /db_xref="CDD:233415"
     gene            complement(423140..424285)
                     /locus_tag="Cpha266_0383"
                     /db_xref="GeneID:4568976"
     CDS             complement(423140..424285)
                     /locus_tag="Cpha266_0383"
                     /note="TIGRFAM: DNA protecting protein DprA;
                     PFAM: SMF family protein;
                     KEGG: cch:Cag_1447 smf protein"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA protecting protein DprA"
                     /protein_id="YP_910866.1"
                     /db_xref="GI:119356222"
                     /db_xref="InterPro:IPR003488"
                     /db_xref="GeneID:4568976"
                     /translation="MSATPGCDSRILLLTLSQIPGIGPARINAIVSNLGSDISVLDAT
                     EGTFQHIPGIGVPLAKEIVSFLGNRQKRLAALEAADEQMLRLERYNAKLLTITDTEYP
                     RLLREITDPPPYLFVRGNLPGNHEPGIAIVGTRRASAYGKQAAAKFSGELALQGFPIV
                     SGLAYGIDMVAHTASIGSGGKTIAVVATGVDTIYTDPRGKVWPGIVENGAIISEEWIG
                     SNLVPAKFPKRNRIISGITLGTLVVESDRNGGSLITASFALEQNREVFAVPGSIFSHT
                     SRGTNMLIQLGQAKAALCVDDIISEVAPQSSRENIPRQNPIALDMHLSAEELNVLAIM
                     GKESVHIDTIASKTGLDVSTLLVRLFELEMKRAVIQHPGQFFQNRHS"
     misc_feature    complement(423149..424264)
                     /locus_tag="Cpha266_0383"
                     /note="Predicted Rossmann fold nucleotide-binding protein
                     involved in DNA uptake [DNA replication, recombination,
                     and repair / Intracellular trafficking and secretion];
                     Region: Smf; COG0758"
                     /db_xref="CDD:223829"
     misc_feature    complement(423380..424030)
                     /locus_tag="Cpha266_0383"
                     /note="DNA protecting protein DprA; Region: dprA;
                     TIGR00732"
                     /db_xref="CDD:129815"
     gene            complement(424300..425298)
                     /locus_tag="Cpha266_0384"
                     /db_xref="GeneID:4568977"
     CDS             complement(424300..425298)
                     /locus_tag="Cpha266_0384"
                     /note="PFAM: Polyprenyl synthetase;
                     KEGG: plt:Plut_1765 geranyltranstransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="polyprenyl synthetase"
                     /protein_id="YP_910867.1"
                     /db_xref="GI:119356223"
                     /db_xref="InterPro:IPR000092"
                     /db_xref="GeneID:4568977"
                     /translation="MNMSITQELVEKKYRLYHNLINEALASCFSAEAPVTLYAPAKYI
                     LDGKGKRIRPFLTLLASEAVCGSSEHALKVALAVEILHNFTLMHDDIMDQAELRHGRP
                     TVHKQWNANVAILSGDMMIAYAYELALQSPSSRQIELVHILNDANITICEGQALDIEL
                     EEKKHATIADYLDMIAKKSGRLISAALEAGGVAGNATDEQLNNLVTFGEKIGRAFQIQ
                     DDFLDIMADDGKSGKIAGGDVINGKKTYLLLRSIELTSGDDHRLLQSIIENNGISAER
                     VPEIRSIYQRCGVLDETRLLIRRDTENALSAVDKLPHAEGREYLKGFANILVKRDF"
     misc_feature    complement(424303..425250)
                     /locus_tag="Cpha266_0384"
                     /note="Geranylgeranyl pyrophosphate synthase [Coenzyme
                     metabolism]; Region: IspA; COG0142"
                     /db_xref="CDD:223220"
     misc_feature    complement(424309..425205)
                     /locus_tag="Cpha266_0384"
                     /note="Trans-Isoprenyl Diphosphate Synthases,
                     head-to-tail; Region: Trans_IPPS_HT; cd00685"
                     /db_xref="CDD:173833"
     misc_feature    complement(order(424570..424572,424585..424587,
                     424600..424602,424630..424632,424639..424644,
                     424753..424755,424762..424767,424828..424830,
                     424837..424839,425002..425007,425020..425025,
                     425029..425037,425041..425049,425056..425058))
                     /locus_tag="Cpha266_0384"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173833"
     misc_feature    complement(425020..425049)
                     /locus_tag="Cpha266_0384"
                     /note="chain length determination region; other site"
                     /db_xref="CDD:173833"
     misc_feature    complement(order(424570..424572,424585..424587,
                     424600..424602,424630..424632,424639..424644,
                     424765..424767,424828..424830,425002..425007,
                     425020..425022,425029..425034))
                     /locus_tag="Cpha266_0384"
                     /note="substrate-Mg2+ binding site; other site"
                     /db_xref="CDD:173833"
     misc_feature    complement(order(424639..424644,424765..424767,
                     425002..425007,425020..425022,425029..425034))
                     /locus_tag="Cpha266_0384"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:173833"
     misc_feature    complement(order(424765..424767,424828..424830,
                     425002..425007,425020..425022,425029..425034))
                     /locus_tag="Cpha266_0384"
                     /note="aspartate-rich region 1; other site"
                     /db_xref="CDD:173833"
     misc_feature    complement(order(424564..424578,424585..424602,
                     424618..424623,424972..425016))
                     /locus_tag="Cpha266_0384"
                     /note="active site lid residues [active]"
                     /db_xref="CDD:173833"
     misc_feature    complement(order(424570..424572,424585..424587,
                     424600..424602,424630..424632,424639..424644))
                     /locus_tag="Cpha266_0384"
                     /note="aspartate-rich region 2; other site"
                     /db_xref="CDD:173833"
     gene            complement(425301..426392)
                     /locus_tag="Cpha266_0385"
                     /db_xref="GeneID:4568978"
     CDS             complement(425301..426392)
                     /locus_tag="Cpha266_0385"
                     /EC_number="5.3.3.2"
                     /note="catalyzes the isomerization of isopentenyl
                     pyrophosphate to dimethylallyl diphosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="isopentenyl pyrophosphate isomerase"
                     /protein_id="YP_910868.1"
                     /db_xref="GI:119356224"
                     /db_xref="InterPro:IPR000262"
                     /db_xref="InterPro:IPR011179"
                     /db_xref="GeneID:4568978"
                     /translation="MNEKLSTPSNITIERKLNHVEICLHGNVSFEGTTTGLERYAIEH
                     QAVPEINYADINLSATLLGRTIGAPLMISSMTGGYHEAATLNRQFAQAAEHFRIPLGV
                     GSMRQALENNEHRESFAVVRKAAPSVPVFANIGAPEVAAGLESSQIETMLDLIQADGL
                     IVHLNAAQELFQPEGNTNFHGFLDQLASLTAKTPVPVIAKEVGSGISAEAARLLIDAG
                     VKVIDVAGAGGTSWQKVEEVRYIKRFGNENRFSPEALNELLNWGIPTATCLEEIGRLK
                     KNHPQYQPIEIIASGGIQSGIDVAKTILLGASVAASAGRLLKALHEGKLLQTIEMWLN
                     DLKAVMFLTGSLSLEQLQKKRMTLKHLPT"
     misc_feature    complement(425316..426374)
                     /locus_tag="Cpha266_0385"
                     /note="isopentenyl pyrophosphate isomerase; Provisional;
                     Region: PRK05437"
                     /db_xref="CDD:235465"
     misc_feature    complement(425334..426350)
                     /locus_tag="Cpha266_0385"
                     /note="Isopentenyl-diphosphate:dimethylallyl diphosphate
                     isomerase type 2 (IDI-2) FMN-binding domain. Two types of
                     IDIs have been characterized at present. The long known
                     IDI-1 is only dependent on divalent metals for activity,
                     whereas IDI-2 requires a metal; Region: IDI-2_FMN;
                     cd02811"
                     /db_xref="CDD:239205"
     misc_feature    complement(order(425391..425393,425400..425402,
                     425499..425504,425580..425582,425604..425606,
                     425766..425768,425778..425783,425790..425792,
                     425901..425903,426246..426248,426255..426266))
                     /locus_tag="Cpha266_0385"
                     /note="homotetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239205"
     misc_feature    complement(order(425451..425453,425517..425525,
                     425793..425795,425904..425906,425994..425996,
                     426081..426083,426159..426170))
                     /locus_tag="Cpha266_0385"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:239205"
     misc_feature    complement(order(426138..426143,426162..426164))
                     /locus_tag="Cpha266_0385"
                     /note="homodimer contacts [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239205"
     misc_feature    complement(order(425451..425456,425523..425525,
                     425793..425795,425904..425906,425994..425996,
                     426081..426083))
                     /locus_tag="Cpha266_0385"
                     /note="putative active site [active]"
                     /db_xref="CDD:239205"
     misc_feature    complement(order(425904..425906,425988..425990,
                     425994..425996))
                     /locus_tag="Cpha266_0385"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:239205"
     gene            426500..427768
                     /locus_tag="Cpha266_0386"
                     /db_xref="GeneID:4568979"
     CDS             426500..427768
                     /locus_tag="Cpha266_0386"
                     /note="PFAM: protein of unknown function DUF214;
                     KEGG: plt:Plut_1763 putative ABC transporter, integral
                     membrane protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910869.1"
                     /db_xref="GI:119356225"
                     /db_xref="InterPro:IPR003838"
                     /db_xref="GeneID:4568979"
                     /translation="MLKTLFDIALRHLLGRRRQTLTTIFGVAVSTMVLITTISLTRGL
                     LDSFIDTIVNVAPHITIKGEKLNPVPVNIINRAGETRVSMVEDNIRKQEKEEVRNYRQ
                     ILGMFSSSLYEKEVTASSPYVESQVMAVKGNRNQPILLKGVIIDRENEISGIAGKIQQ
                     GDLSVFRNSSNALLVGRTVARDMHLELNDEVVIIPASGKSRQCKVAGIFFSGVNAVDN
                     SVFVSLKLGQIIEGLPANKVSGIALKVRDPLNNTPLAREMERITGYKCPTWQEENASI
                     LSLFARIGYIVFSLVAFVGVVSGFGVANILVTTVFEKSRDIAIMKSFGFSALHLVAMF
                     VLEGFLVGLAGALLGGVLAIGSINLFASIPVENSQGPLTKTGFSMSLNPIYFFYVIGV
                     TVFISTISAILPSARAAKLEPVKVLRDSSL"
     misc_feature    426515..427756
                     /locus_tag="Cpha266_0386"
                     /note="ABC-type transport system, involved in lipoprotein
                     release, permease component [Cell envelope biogenesis,
                     outer membrane]; Region: LolE; COG4591"
                     /db_xref="CDD:226957"
     misc_feature    426524..427282
                     /locus_tag="Cpha266_0386"
                     /note="MacB-like periplasmic core domain; Region:
                     MacB_PCD; pfam12704"
                     /db_xref="CDD:221725"
     misc_feature    427409..427738
                     /locus_tag="Cpha266_0386"
                     /note="FtsX-like permease family; Region: FtsX; pfam02687"
                     /db_xref="CDD:217187"
     gene            complement(427866..429725)
                     /locus_tag="Cpha266_0387"
                     /db_xref="GeneID:4568980"
     CDS             complement(427866..429725)
                     /locus_tag="Cpha266_0387"
                     /note="PFAM: ABC transporter, transmembrane region; ABC
                     transporter related;
                     SMART: AAA ATPase;
                     KEGG: cch:Cag_0453 ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_910870.1"
                     /db_xref="GI:119356226"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="GeneID:4568980"
                     /translation="MNRQKEQTTDTSAQEQTSKRSVSAKSFRTQKDETLEKGKKGSAD
                     WYIASRLIAYIKPYKALVAASAGITLAGSILGPLRPYLTKIAIDDYIAHGDMKGLATI
                     SLLLAAVVLLDGIKQFIATWLTQIIGQKAVFSIRMDVFRHLQQLPARFFDRNPIGRLL
                     TRTTNDIESLNEMLSSGIITILGDIMQLLFIVGLMLWIDWQLALVVLAILPLMLYATM
                     MFKKRVRIAFQDVRTHLARLNTFLQEHIAGMTIVQLFNHQKSEYTKHSDINADHRDAN
                     IRTVFYFSVYYPFIEVLSSLTAGMVIWYSAVRVLNADLTLGVVVSFVQYIWLFFRPLQ
                     HLSDRFNVIQTAIASSDRVFRLLEEKGGEGDAGAEPEPFVFRSRITFSNVWFAYDTDN
                     WILKDLSMEVRRGEKIAIVGATGSGKTTIINILSRLYPYAKGSIRIDNVELPDIASRS
                     LRKMIGVVMQDVFLFSGTIRENLAFGNPDLPDEAIFEAARIVGADRFIDQLPGGYAYR
                     VQENGAGLSAGQKQLIAFVRALLYDPQILVLDEATSSVDTETEMLIDAATAKLMQNRT
                     SIIIAHRLSTVQKADRIIVLHKGVIKESGSHQELLKEKGLYYKLYLLQHPEGR"
     misc_feature    complement(427932..429578)
                     /locus_tag="Cpha266_0387"
                     /note="ABC-type multidrug transport system, ATPase and
                     permease components [Defense mechanisms]; Region: MdlB;
                     COG1132"
                     /db_xref="CDD:224055"
     misc_feature    complement(428727..429542)
                     /locus_tag="Cpha266_0387"
                     /note="ABC transporter transmembrane region; Region:
                     ABC_membrane; pfam00664"
                     /db_xref="CDD:216049"
     misc_feature    complement(427932..428597)
                     /locus_tag="Cpha266_0387"
                     /note="ATP-binding cassette domain of glucan transporter
                     and related proteins, subfamily C; Region:
                     ABCC_Glucan_exporter_like; cd03254"
                     /db_xref="CDD:213221"
     misc_feature    complement(428469..428492)
                     /locus_tag="Cpha266_0387"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213221"
     misc_feature    complement(order(428010..428012,428103..428108,
                     428346..428348,428466..428474,428478..428483))
                     /locus_tag="Cpha266_0387"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213221"
     misc_feature    complement(428346..428357)
                     /locus_tag="Cpha266_0387"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213221"
     misc_feature    complement(428151..428180)
                     /locus_tag="Cpha266_0387"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213221"
     misc_feature    complement(428103..428120)
                     /locus_tag="Cpha266_0387"
                     /note="Walker B; other site"
                     /db_xref="CDD:213221"
     misc_feature    complement(428085..428096)
                     /locus_tag="Cpha266_0387"
                     /note="D-loop; other site"
                     /db_xref="CDD:213221"
     misc_feature    complement(428004..428024)
                     /locus_tag="Cpha266_0387"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213221"
     gene            complement(429732..431144)
                     /locus_tag="Cpha266_0388"
                     /db_xref="GeneID:4568981"
     CDS             complement(429732..431144)
                     /locus_tag="Cpha266_0388"
                     /note="PFAM: phosphoglucomutase/phosphomannomutase C
                     terminal; phosphoglucomutase/phosphomannomutase
                     alpha/beta/alpha domain I;
                     phosphoglucomutase/phosphomannomutase alpha/beta/alpha
                     domain II; phosphoglucomutase/phosphomannomutase
                     alpha/beta/alpha domain III;
                     KEGG: plt:Plut_1760 phosphoglucomutase/phosphomannomutase
                     family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglucomutase/phosphomannomutase
                     alpha/beta/subunit"
                     /protein_id="YP_910871.1"
                     /db_xref="GI:119356227"
                     /db_xref="InterPro:IPR005841"
                     /db_xref="InterPro:IPR005843"
                     /db_xref="InterPro:IPR005844"
                     /db_xref="InterPro:IPR005845"
                     /db_xref="InterPro:IPR005846"
                     /db_xref="GeneID:4568981"
                     /translation="MSLMISVSGIRGIVGESLTPQNLTAFAMAFASWIRNKRDPSTLI
                     SSPKRPLIVIGRDTRPTGSCISNLVSNALALSGCDVIDIGIATTPTVELATVTEKADG
                     GLIVTASHNPVEWNALKMLNDRGEFLSAPDVEELLAIVEKAHVHAARWDDIGTVTSTS
                     RHDDLHIDKIMNLSFINTEAVRKQHFRVMIDCVEGAGFSIVPRLCRMLGMDELTLVAC
                     EGSGLFPRNPEPVEENLADTISAMKQARCDFGLIVDPDVDRLALICEDGSLFGEEYTL
                     VACADFYLNINNGPVTNNLSSSRALADIARQHGVACFSAKVGEANVIELMKEVGAVIG
                     GEGNGGVILPDLHYGRDALVGIALFVQAFTSWRMKNRGGTISSFRREFPEYVMSKQKI
                     KLGSMSPRILENLFNEIARRYPLAKTNMTDGLKLDFDDCWVHLRPSNTEPIIRIYAEA
                     HTKKRAEEIALELMNELQKD"
     misc_feature    complement(429744..431141)
                     /locus_tag="Cpha266_0388"
                     /note="phosphoglucosamine mutase; Region: Arch_GlmM;
                     TIGR03990"
                     /db_xref="CDD:234431"
     misc_feature    complement(429765..431135)
                     /locus_tag="Cpha266_0388"
                     /note="The alpha-D-phosphohexomutase superfamily includes
                     several related enzymes that catalyze a reversible
                     intramolecular phosphoryl transfer on their sugar
                     substrates. Members of this family include the
                     phosphoglucomutases (PGM1 and PGM2),
                     phosphoglucosamine...; Region: phosphohexomutase; cl03757"
                     /db_xref="CDD:243519"
     misc_feature    complement(order(429810..429812,429825..429833,
                     429837..429839,430125..430127,430131..430133,
                     430137..430139,430188..430196,430257..430259,
                     430368..430373,430377..430379,430383..430385,
                     430788..430790,430812..430820,431112..431114,
                     431121..431123,431127..431129))
                     /locus_tag="Cpha266_0388"
                     /note="active site"
                     /db_xref="CDD:100086"
     misc_feature    complement(order(429810..429812,429825..429833,
                     429837..429839,430125..430127,430131..430133,
                     430137..430139,430188..430190,430194..430196,
                     430257..430259,430368..430370,430818..430820,
                     431121..431123))
                     /locus_tag="Cpha266_0388"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100086"
     misc_feature    complement(order(430371..430373,430377..430379,
                     430383..430385,430818..430820))
                     /locus_tag="Cpha266_0388"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:100086"
     gene            431461..431736
                     /gene="rpsT"
                     /locus_tag="Cpha266_0389"
                     /db_xref="GeneID:4568982"
     CDS             431461..431736
                     /gene="rpsT"
                     /locus_tag="Cpha266_0389"
                     /note="binds directly to the 16S rRNA and is involved in
                     post-translational inhibition of arginine and ornithine
                     decarboxylase"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S20"
                     /protein_id="YP_910872.1"
                     /db_xref="GI:119356228"
                     /db_xref="InterPro:IPR002583"
                     /db_xref="GeneID:4568982"
                     /translation="MPLHKSAEKRLRQSEKRNVRNRARKKELKVLLKNMQKLIDTSAD
                     KNVVEEAYRSAVQKLDRLGVKRYLHPNKASRKKAQLTKMLNNYVKVD"
     misc_feature    431461..431727
                     /gene="rpsT"
                     /locus_tag="Cpha266_0389"
                     /note="30S ribosomal protein S20; Reviewed; Region: rpsT;
                     PRK00239"
                     /db_xref="CDD:178943"
     gene            431842..432444
                     /gene="ruvA"
                     /locus_tag="Cpha266_0390"
                     /db_xref="GeneID:4568983"
     CDS             431842..432444
                     /gene="ruvA"
                     /locus_tag="Cpha266_0390"
                     /note="plays an essential role in ATP-dependent branch
                     migration of the Holliday junction"
                     /codon_start=1
                     /transl_table=11
                     /product="Holliday junction DNA helicase RuvA"
                     /protein_id="YP_910873.1"
                     /db_xref="GI:119356229"
                     /db_xref="InterPro:IPR000085"
                     /db_xref="InterPro:IPR003583"
                     /db_xref="InterPro:IPR011114"
                     /db_xref="InterPro:IPR013849"
                     /db_xref="InterPro:IPR013850"
                     /db_xref="GeneID:4568983"
                     /translation="MFAYFKGSLVTALPEEAVIDVSGVAYRMLISATTFRQLPDEGSQ
                     VLLYAHLSVREDALQLYGFFKEEERQLFRLLLLTSGVGPKLALAVLSGLQVPEVHEAI
                     MANEPERLYGVSGVGKKTAARIILELRDKILKLPLVTPAAGKAAMPSHHVKDDAVHAL
                     VTLGFSRLLAQKAVSALLEEKPEQSVEEVIKYALATIHNS"
     misc_feature    431842..432435
                     /gene="ruvA"
                     /locus_tag="Cpha266_0390"
                     /note="Holliday junction DNA helicase RuvA; Reviewed;
                     Region: ruvA; PRK00116"
                     /db_xref="CDD:234645"
     misc_feature    431842..432027
                     /gene="ruvA"
                     /locus_tag="Cpha266_0390"
                     /note="RuvA N terminal domain; Region: RuvA_N; pfam01330"
                     /db_xref="CDD:216437"
     misc_feature    432295..432429
                     /gene="ruvA"
                     /locus_tag="Cpha266_0390"
                     /note="RuvA, C-terminal domain; Region: RuvA_C; pfam07499"
                     /db_xref="CDD:219432"
     gene            432457..433743
                     /locus_tag="Cpha266_0391"
                     /db_xref="GeneID:4568984"
     CDS             432457..433743
                     /locus_tag="Cpha266_0391"
                     /note="TIGRFAM: FolC bifunctional protein;
                     PFAM: Mur ligase, middle domain protein;
                     KEGG: cch:Cag_0458 folylpolyglutamate synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional folylpolyglutamate synthase/
                     dihydrofolate synthase"
                     /protein_id="YP_910874.1"
                     /db_xref="GI:119356230"
                     /db_xref="InterPro:IPR001645"
                     /db_xref="InterPro:IPR013221"
                     /db_xref="GeneID:4568984"
                     /translation="MNYQEALDFLYPLHRFGIKPGLERVFGLLAVLGSPHRRLGTIVH
                     VSGTNGKGTTAAAIAAIFQAAGKKTALYTSPHLVDFTERMRINGGCIPHELVATYCSL
                     IKSRVEESHTTFFEATTAIAFAWFASEHVEVTIVETGMGGRLDATNVVHADYVAITSI
                     GQDHTAWLGSTPALIAAEKAAIIKKGSQVFSAVTDSEAAMPVRTAAECCEAPLSVLGI
                     DAHCHVDSEEIGRLELSVRTAKHQYERLTVPLTGAFHASNISLAVMVAETAGIDESSI
                     RNGLANLLQTGYRARLEKIAANPDVLLDVSHNANGIEETVNTLARFRNRYRNLFVLIG
                     LASDKNATAIVKHLKRLSCRLVAVSIPSERSIPALELGGIGEAEDIPTMVFSSPLDGL
                     GYLSGIAEAEDLVLVTGSFYLAGEVLSNGGWNKEMS"
     misc_feature    432457..433713
                     /locus_tag="Cpha266_0391"
                     /note="Folylpolyglutamate synthase [Coenzyme metabolism];
                     Region: FolC; COG0285"
                     /db_xref="CDD:223362"
     gene            433743..434036
                     /locus_tag="Cpha266_0392"
                     /db_xref="GeneID:4568985"
     CDS             433743..434036
                     /locus_tag="Cpha266_0392"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910875.1"
                     /db_xref="GI:119356231"
                     /db_xref="GeneID:4568985"
                     /translation="MSALLSFFPEKNYIFIITTEVLHDLWVILPGRFFPCIGPDSITD
                     THPQLSSFSVFMIYTEYSAVATSGFPFALVMRASSFRDFLPSDFFDTNVIITF"
     gene            434054..435343
                     /gene="rho"
                     /locus_tag="Cpha266_0393"
                     /db_xref="GeneID:4568986"
     CDS             434054..435343
                     /gene="rho"
                     /locus_tag="Cpha266_0393"
                     /note="An RNA-DNA helicase that actively releases nascent
                     mRNAs from paused transcription complexes"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination factor Rho"
                     /protein_id="YP_910876.1"
                     /db_xref="GI:119356232"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004665"
                     /db_xref="InterPro:IPR011112"
                     /db_xref="InterPro:IPR011113"
                     /db_xref="InterPro:IPR011129"
                     /db_xref="InterPro:IPR013223"
                     /db_xref="GeneID:4568986"
                     /translation="MSNNSLAKGLDINVLQKKKVFELHALAKEIGVTAAGLRKEELIF
                     KIIEAQSRNNADSESGNVMINTGVLQVIPEGYGFLRSANYNYLSSPDDIYVSPSQIKR
                     FNMRTGDTVSGQVRAPKEGERFFALLKINTIDGNDPEITRERPYFENLTPLFPHDRIK
                     LEIKQSEYCGRIMDIFTPIGKGQRGLIVAQPKTGKTMLLQMIANAIIQNHPEIYLIVL
                     LIDERPEEVTDMARSVEAEVVSSTFDEDPERHVQVADMVLEKAKRLVEVGRDVVILLD
                     SITRLARAHNTIIPHSGKILSGGIDANALTKPKRFFGAARNIEEGGSLTIIATALVDT
                     GSRMDDVIFEEFKGTGNMELLLDRRLSERRIFPAIDILRSGTRKEELLFSREELSRTW
                     LLRKYLADKNPIECMEFMREKMADTKDNKEFFKYMNA"
     misc_feature    434081..435337
                     /gene="rho"
                     /locus_tag="Cpha266_0393"
                     /note="transcription termination factor Rho; Provisional;
                     Region: rho; PRK09376"
                     /db_xref="CDD:236490"
     misc_feature    434096..434215
                     /gene="rho"
                     /locus_tag="Cpha266_0393"
                     /note="Rho termination factor, N-terminal domain; Region:
                     Rho_N; smart00959"
                     /db_xref="CDD:198027"
     misc_feature    434249..434449
                     /gene="rho"
                     /locus_tag="Cpha266_0393"
                     /note="Rho_CSD: Rho protein cold-shock domain (CSD). Rho
                     protein is a transcription termination factor in most
                     bacteria. In bacteria, there are two distinct mechanisms
                     for mRNA transcription termination. In intrinsic
                     termination, RNA polymerase and nascent mRNA...; Region:
                     Rho_CSD; cd04459"
                     /db_xref="CDD:239906"
     misc_feature    order(434261..434263,434267..434269,434279..434281,
                     434285..434287,434291..434293,434327..434329,
                     434333..434335,434408..434410,434417..434425)
                     /gene="rho"
                     /locus_tag="Cpha266_0393"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:239906"
     misc_feature    434552..435298
                     /gene="rho"
                     /locus_tag="Cpha266_0393"
                     /note="Transcription termination factor rho is a bacterial
                     ATP-dependent RNA/DNA helicase. It is a homohexamer. Each
                     monomer consists of an N-terminal domain of the OB fold,
                     which is responsible for binding to cysteine rich
                     nucleotides. This alignment is of the...; Region:
                     rho_factor; cd01128"
                     /db_xref="CDD:238548"
     misc_feature    order(434603..434605,434936..434938,434969..434971,
                     434978..434983,434990..434992,434999..435001,
                     435008..435010,435083..435088,435092..435106,
                     435110..435112,435182..435187,435227..435229,
                     435239..435241)
                     /gene="rho"
                     /locus_tag="Cpha266_0393"
                     /note="multimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238548"
     misc_feature    434618..434641
                     /gene="rho"
                     /locus_tag="Cpha266_0393"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238548"
     misc_feature    order(434627..434629,434633..434644,435149..435151)
                     /gene="rho"
                     /locus_tag="Cpha266_0393"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238548"
     misc_feature    434867..434881
                     /gene="rho"
                     /locus_tag="Cpha266_0393"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238548"
     gene            436026..436098
                     /locus_tag="Cpha266_R0009"
                     /note="tRNA-Lys1"
                     /db_xref="GeneID:4568987"
     tRNA            436026..436098
                     /locus_tag="Cpha266_R0009"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:4568987"
     gene            436115..436196
                     /locus_tag="Cpha266_R0010"
                     /note="tRNA-Leu1"
                     /db_xref="GeneID:4568648"
     tRNA            436115..436196
                     /locus_tag="Cpha266_R0010"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:4568648"
     gene            436605..437195
                     /locus_tag="Cpha266_0394"
                     /db_xref="GeneID:4568649"
     CDS             436605..437195
                     /locus_tag="Cpha266_0394"
                     /note="KEGG: cte:CT2144 outer surface protein, putative"
                     /codon_start=1
                     /transl_table=11
                     /product="outer surface protein, putative"
                     /protein_id="YP_910877.1"
                     /db_xref="GI:119356233"
                     /db_xref="GeneID:4568649"
                     /translation="MKKVLMSLFVAGMCAAPAYAAGPYVSASAGLGLLGNSDFKGVVE
                     VKDVIEYNSGLVLNGAIGYDADMFRGEFAVGYQSNGVDTLGGVSIDNLDVSILSFMAN
                     AYVDFEMKDSALTPYLMAGLGLASVDFSDDGGDDFEAESVFAWQIGAGIGVKAADNLT
                     VDLGYRYFVPSDVEIDDVDKITLASSNIMLGLRYGF"
     sig_peptide     436605..436667
                     /locus_tag="Cpha266_0394"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 1.000) with cleavage site probability 0.998 at
                     residue 21"
     misc_feature    <436740..437192
                     /locus_tag="Cpha266_0394"
                     /note="Opacity protein and related surface antigens [Cell
                     envelope biogenesis, outer membrane]; Region: COG3637"
                     /db_xref="CDD:226163"
     gene            438083..438742
                     /locus_tag="Cpha266_0395"
                     /db_xref="GeneID:4568650"
     CDS             438083..438742
                     /locus_tag="Cpha266_0395"
                     /note="PFAM: UvrB/UvrC protein; protein of unknown
                     function DUF151;
                     KEGG: plt:Plut_1753 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910878.1"
                     /db_xref="GI:119356234"
                     /db_xref="InterPro:IPR001943"
                     /db_xref="InterPro:IPR003729"
                     /db_xref="GeneID:4568650"
                     /translation="MRGFVLFPLFKTTLFDFMGKLQVDILGLSASPHTNGAYALILYE
                     LEGKRKLPIIIGGFEAQAIALKLENIKPPRPFTHDLFKSVADAFSLHVKEIFIDELHN
                     ETFYAKIICELGGELHEIDARPSDAIAIAVRFNAPVFVTEEIMNEAGIREEQKESEEE
                     GEEDNTSSFIQEEPQPGGMPAQSAALLELQGRLDDAISRENYEEAARIRDEINRIKNQ
                     G"
     misc_feature    438149..438532
                     /locus_tag="Cpha266_0395"
                     /note="Bifunctional nuclease; Region: DNase-RNase;
                     pfam02577"
                     /db_xref="CDD:217117"
     misc_feature    438644..438736
                     /locus_tag="Cpha266_0395"
                     /note="UvrB/uvrC motif; Region: UVR; pfam02151"
                     /db_xref="CDD:145355"
     gene            complement(438858..439589)
                     /locus_tag="Cpha266_0396"
                     /db_xref="GeneID:4568651"
     CDS             complement(438858..439589)
                     /locus_tag="Cpha266_0396"
                     /note="KEGG: plt:Plut_1752 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910879.1"
                     /db_xref="GI:119356235"
                     /db_xref="InterPro:IPR008268"
                     /db_xref="GeneID:4568651"
                     /translation="MKKSLSLLAVLAVVGFASTPVQAADHYVSGMAGISWMQDSSIDL
                     PLNLNEVFGVGIDLGYSSGFTAVGAVGCDYGSTRLEAEVGYQTNDIDSITGSFDGDSA
                     SLALSGNAKVLSLMANGFYDFDLGGVELYAMAGIGVAQVSINDLTLADTNDLGISADD
                     IDDANEYLSRRLGAPVDLNALGLNVNETTLAYQVGAGLAVPIGDGIMLDARYRYFATT
                     DFTMPLDLNTNISSHSALLGLRVNL"
     sig_peptide     complement(439518..439589)
                     /locus_tag="Cpha266_0396"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 1.000) with cleavage site probability 1.000 at
                     residue 24"
     misc_feature    complement(438906..439445)
                     /locus_tag="Cpha266_0396"
                     /note="Outer membrane protein beta-barrel domain; Region:
                     OMP_b-brl; pfam13505"
                     /db_xref="CDD:222182"
     gene            complement(439729..442221)
                     /locus_tag="Cpha266_0397"
                     /db_xref="GeneID:4568652"
     CDS             complement(439729..442221)
                     /locus_tag="Cpha266_0397"
                     /note="PFAM: surface antigen (D15); surface antigen
                     variable number repeat protein;
                     Polypeptide-transport-associated domain protein,
                     ShlB-type;
                     KEGG: cte:CT0266 bacterial surface antigen family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="surface antigen (D15)"
                     /protein_id="YP_910880.1"
                     /db_xref="GI:119356236"
                     /db_xref="InterPro:IPR000184"
                     /db_xref="InterPro:IPR010827"
                     /db_xref="InterPro:IPR013686"
                     /db_xref="GeneID:4568652"
                     /translation="MKKMQKLITLVLVALAVNATGQTAEAKSKPVKQSVTATQAKTPA
                     EKKDLYTISAISFTGLQSLNEQELIASLPIKIGNNIAVPGAELSATMQYLWNLQVFKN
                     ITLEKSNPGTKNVALHFIVEEQPLLEEVVFKGNEKFDLDKLQKTADIQTGKKLSEQEL
                     LTAANKIEKLYADKGYLTAGAEYKLEAIGKNKVKAVFTITEGRKVVIEKIRFHGNNAF
                     SQGKLRGVFKETTQNSWWRKIFGAPKLDKDKFATDKDLLVDFYRENGYRDAKVVSDSI
                     SYTPDNKGLFLDITIEEGPKYHIGTITWTGNSKDFATTEILEKTFGIKTGDLYNAKLI
                     QERLNFSQDNSDVSSIYLDRGYLSYRANLDEVVVNPDTVNLLISIREGEQYQLNLVNI
                     TGNTKTKDHVIRRELYTIPGEMFSRKNVIRSIRELNMLNYFDAEKLAPEIQPNEENNT
                     VDLTYSVSEKQSDTFNASIGYGGSSGFTGTLGVTFNNFSLQDIFDADAYRPLPHGDGQ
                     KLSFQWQFGSDNYRTLALSFTEPWAFGGPTTVGFSAFKTHRTYDYTGTDSSIENKTID
                     QYGTILTIGRRLTWPDDYFAVGLKLKYLHNKGGFVSFINETGINVPDEADEYSITGTI
                     SRNSIDSPIYPRRGSKNTLTAQLAGGPLPGTIDFYKFTGNSTWFFPLSRKLVLNMSAQ
                     AGYLSTFNKSDYIPYTEYFYMGGSGMSSLPTVPMRGYDDRSFGALLETDSDLYGGTIY
                     TKFTTELRYPITLSPSVSVYGLAFFDAGNLWQDSESVDFSDLKKSVGVGLRVYLPIIG
                     MVGLDYGYGMDTVPGDMEKGWGFMFTFGTSTE"
     sig_peptide     complement(442156..442221)
                     /locus_tag="Cpha266_0397"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 1.000) with cleavage site probability 0.722 at
                     residue 22"
     misc_feature    complement(439741..442074)
                     /locus_tag="Cpha266_0397"
                     /note="outer membrane protein assembly complex, YaeT
                     protein; Region: OM_YaeT; TIGR03303"
                     /db_xref="CDD:234165"
     misc_feature    complement(<441679..441837)
                     /locus_tag="Cpha266_0397"
                     /note="POTRA domain, ShlB-type; Region: POTRA_2;
                     pfam08479"
                     /db_xref="CDD:117056"
     misc_feature    complement(441340..441609)
                     /locus_tag="Cpha266_0397"
                     /note="Surface antigen variable number repeat; Region:
                     Surf_Ag_VNR; pfam07244"
                     /db_xref="CDD:219346"
     misc_feature    complement(441076..441333)
                     /locus_tag="Cpha266_0397"
                     /note="Surface antigen variable number repeat; Region:
                     Surf_Ag_VNR; pfam07244"
                     /db_xref="CDD:219346"
     misc_feature    complement(440842..441054)
                     /locus_tag="Cpha266_0397"
                     /note="Surface antigen variable number repeat; Region:
                     Surf_Ag_VNR; pfam07244"
                     /db_xref="CDD:219346"
     misc_feature    complement(439738..440709)
                     /locus_tag="Cpha266_0397"
                     /note="Surface antigen; Region: Bac_surface_Ag; pfam01103"
                     /db_xref="CDD:216300"
     gene            complement(442245..443093)
                     /locus_tag="Cpha266_0398"
                     /db_xref="GeneID:4568653"
     CDS             complement(442245..443093)
                     /locus_tag="Cpha266_0398"
                     /EC_number="2.5.1.31"
                     /note="KEGG: plt:Plut_1750
                     di-trans-poly-cis-decaprenylcistransferase;
                     TIGRFAM: undecaprenyl diphosphate synthase;
                     PFAM: Di-trans-poly-cis-decaprenylcistransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="undecaprenyl pyrophosphate synthetase"
                     /protein_id="YP_910881.1"
                     /db_xref="GI:119356237"
                     /db_xref="InterPro:IPR001441"
                     /db_xref="GeneID:4568653"
                     /translation="MARIRTMDLSPTFRSPWFTTVSDTEDKKIQADLKASCELPLHIA
                     IIMDGNGRWAKLKGKTRIEGHIAGVDSVRDIVEASRQLGISYLTLFTFSTENWNRPEK
                     EISALMRLLIKVLRKEARALHDNNIRLNVIGNTALLPEKVRTVLDETVVLTGHNNGLV
                     MSIALSYSGKWDIVEACRSLAVEVKAGRVSPEMIDEHLFQSCLSTASIPDPELLIRTS
                     GEFRISNFMLWQSAYSEIYFTKTYWPDFRRAQFYAALRDYQNRERRFGQTSEQIQKKN
                     TANSKI"
     misc_feature    complement(442314..442976)
                     /locus_tag="Cpha266_0398"
                     /note="Cis (Z)-Isoprenyl Diphosphate Synthases (cis-IPPS);
                     homodimers which catalyze the successive 1'-4 condensation
                     of the isopentenyl diphosphate (IPP) molecule to
                     trans,trans-farnesyl diphosphate (FPP) or to cis,trans-FPP
                     to form long-chain polyprenyl...; Region: CIS_IPPS;
                     cd00475"
                     /db_xref="CDD:238265"
     misc_feature    complement(442293..442958)
                     /locus_tag="Cpha266_0398"
                     /note="Putative undecaprenyl diphosphate synthase; Region:
                     Prenyltransf; pfam01255"
                     /db_xref="CDD:216392"
     misc_feature    complement(442950..442952)
                     /locus_tag="Cpha266_0398"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238265"
     misc_feature    complement(442938..442949)
                     /locus_tag="Cpha266_0398"
                     /note="putative FPP diphosphate  binding site; other site"
                     /db_xref="CDD:238265"
     misc_feature    complement(order(442605..442607,442611..442613,
                     442656..442658,442677..442679,442758..442766,
                     442770..442775,442815..442829))
                     /locus_tag="Cpha266_0398"
                     /note="putative FPP binding hydrophobic cleft; other site"
                     /db_xref="CDD:238265"
     misc_feature    complement(order(442386..442388,442398..442400,
                     442407..442409,442419..442421,442428..442433,
                     442512..442514,442539..442541,442548..442550,
                     442560..442562,442584..442586))
                     /locus_tag="Cpha266_0398"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238265"
     misc_feature    complement(order(442428..442430,442446..442448))
                     /locus_tag="Cpha266_0398"
                     /note="putative IPP diphosphate binding site; other site"
                     /db_xref="CDD:238265"
     gene            443441..444871
                     /gene="gatA"
                     /locus_tag="Cpha266_0399"
                     /db_xref="GeneID:4568654"
     CDS             443441..444871
                     /gene="gatA"
                     /locus_tag="Cpha266_0399"
                     /EC_number="6.3.5.-"
                     /note="allows the formation of correctly charged
                     Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation
                     of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms
                     which lack either or both of asparaginyl-tRNA or
                     glutaminyl-tRNA synthetases; reaction takes place in the
                     presence of glutamine and ATP through an activated
                     phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartyl/glutamyl-tRNA amidotransferase subunit
                     A"
                     /protein_id="YP_910882.1"
                     /db_xref="GI:119356238"
                     /db_xref="InterPro:IPR000120"
                     /db_xref="InterPro:IPR004412"
                     /db_xref="GeneID:4568654"
                     /translation="MHFSSYQDLRSSLLAGQTTCEEVTKSYLERIDRHCDDNIFLAVF
                     HEQALSRARSLDRRFSEGGTPGLLFGMPMAIKDNISIKGARLTCASRILENYESVYDA
                     TVIERLLNEDAVFIGKTNMDEFAMGSSNENSAFGPVANPFDKTRVPGGSSGGSAAAVA
                     AGLALVALGSDTGGSVRQPAGFCDIVGLKPTYGRISRYGLVAFASSFDQIGVLARNSD
                     DAALVLGVMAGADERDATSSRHAVSNYAEEMAAVSPDGLKIGVPKEFFHESLNPDVAR
                     LVKAKLEELREKGAELVDITLPASDYAIAAYYILVTAEASSNLARFDGARYGYRSPNC
                     DNLSAMYVNSRTEGFGKEVKRRIMLGTYVLSAGYYDTYYKKAQQVRRVFQDRYREALE
                     KVDVIAGPTSPFPPFGIGDKMDDPLEMYLADVFTVPASIVGMPAISVPIGYDSLNLPV
                     GMHLICNFFEEGKLLGIAGLMQHSIV"
     misc_feature    443441..444844
                     /gene="gatA"
                     /locus_tag="Cpha266_0399"
                     /note="Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit
                     and related amidases [Translation, ribosomal structure and
                     biogenesis]; Region: GatA; COG0154"
                     /db_xref="CDD:223232"
     misc_feature    443477..444856
                     /gene="gatA"
                     /locus_tag="Cpha266_0399"
                     /note="aspartyl/glutamyl-tRNA amidotransferase subunit A;
                     Reviewed; Region: gatA; PRK00012"
                     /db_xref="CDD:234572"
     gene            444915..445814
                     /locus_tag="Cpha266_0400"
                     /db_xref="GeneID:4568655"
     CDS             444915..445814
                     /locus_tag="Cpha266_0400"
                     /EC_number="6.2.1.5"
                     /note="TIGRFAM: succinyl-CoA synthetase, alpha subunit;
                     PFAM: CoA-binding domain protein; ATP-citrate
                     lyase/succinyl-CoA ligase;
                     KEGG: plt:Plut_1748 succinyl-CoA ligase, alpha subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="succinyl-CoA synthetase subunit alpha"
                     /protein_id="YP_910883.1"
                     /db_xref="GI:119356239"
                     /db_xref="InterPro:IPR003781"
                     /db_xref="InterPro:IPR005810"
                     /db_xref="InterPro:IPR005811"
                     /db_xref="GeneID:4568655"
                     /translation="MSVLVNKDTRLVVQGITGGEGTFHTSQILEYGTNVVAGVTPGKG
                     GTIYHGNERDHFCRPVPVFNTVKDAVDKAEANATVIFVPAPFAADAIMEAADAGLKVI
                     ICITEGIPVNDMMKAYAFVKEKGAVLVGPNCPGVITPGEAKVGIMPGFIHMKGTIGVV
                     SRSGTLTYEAVHQLTAVGLGQSTCIGIGGDPIIGTRFIDAIKLFAKDDETEGLVMIGE
                     IGGSAEEEAAEYIKRYFKKPVVGFIAGRTAPPGRRMGHAGAIVSGGKGTAEDKIHAME
                     AAGIHMVDNPGDIGTAMLKALGR"
     misc_feature    444915..445811
                     /locus_tag="Cpha266_0400"
                     /note="succinyl-CoA synthetase subunit alpha; Validated;
                     Region: PRK05678"
                     /db_xref="CDD:180194"
     misc_feature    444924..445241
                     /locus_tag="Cpha266_0400"
                     /note="CoA binding domain; Region: CoA_binding;
                     smart00881"
                     /db_xref="CDD:214881"
     misc_feature    445392..445754
                     /locus_tag="Cpha266_0400"
                     /note="CoA-ligase; Region: Ligase_CoA; pfam00549"
                     /db_xref="CDD:215988"
     gene            complement(445899..446879)
                     /locus_tag="Cpha266_0401"
                     /db_xref="GeneID:4568656"
     CDS             complement(445899..446879)
                     /locus_tag="Cpha266_0401"
                     /EC_number="5.3.1.13"
                     /note="KEGG: cch:Cag_0467 KpsF/GutQ;
                     TIGRFAM: KpsF/GutQ family protein;
                     PFAM: CBS domain containing protein; sugar isomerase
                     (SIS)"
                     /codon_start=1
                     /transl_table=11
                     /product="KpsF/GutQ family protein"
                     /protein_id="YP_910884.1"
                     /db_xref="GI:119356240"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR001347"
                     /db_xref="InterPro:IPR004800"
                     /db_xref="GeneID:4568656"
                     /translation="MISQPETAAIIDSGKNILEQEAQAIHRIADRLDDNFARAIALIL
                     SCKGKIIVSGMGKSGIIGQKIAATMASTGTTALFLHPADAAHGDLGIVCSGDIVICLS
                     KSGTTEELNYIIPALKKTGASIIALTGNSRSYLAKSADIVLDTGIEQEACPYDLAPTT
                     STTAMLAMGDALSMTLMQAKNFTPVDFALTHPKGSLGRRLTMKVSDIMASGDTMPVVN
                     EDAAVTDLILEMTSKRYGVSAIINKKGVLTGIFTDGDLRRLVQKGDDFLNLTARSVMT
                     ANPKTVGAERLATECLEILETYRITQLIVCDIDQRPAGIIHIHDLISLGL"
     misc_feature    complement(445902..446843)
                     /locus_tag="Cpha266_0401"
                     /note="D-arabinose 5-phosphate isomerase; Provisional;
                     Region: PRK10892"
                     /db_xref="CDD:182814"
     misc_feature    complement(446355..446738)
                     /locus_tag="Cpha266_0401"
                     /note="KpsF-like protein. KpsF is an arabinose-5-phosphate
                     isomerase which contains SIS (Sugar ISomerase) domains.
                     SIS domains are found in many phosphosugar isomerases and
                     phosphosugar binding proteins. KpsF catalyzes the
                     reversible reaction of ribulose...; Region: SIS_Kpsf;
                     cd05014"
                     /db_xref="CDD:240145"
     misc_feature    complement(order(446574..446576,446706..446708))
                     /locus_tag="Cpha266_0401"
                     /note="putative active site [active]"
                     /db_xref="CDD:240145"
     misc_feature    complement(445914..446249)
                     /locus_tag="Cpha266_0401"
                     /note="This cd contains two tandem repeats of the
                     cystathionine beta-synthase (CBS pair) domains associated
                     with KpsF/GutQ domains in the API [A5P (D-arabinose
                     5-phosphate) isomerase] protein.  These APIs catalyze the
                     conversion of the pentose pathway...; Region:
                     CBS_pair_KpsF_GutQ_assoc; cd04604"
                     /db_xref="CDD:239977"
     gene            447003..447350
                     /locus_tag="Cpha266_0402"
                     /db_xref="GeneID:4568657"
     CDS             447003..447350
                     /locus_tag="Cpha266_0402"
                     /note="KEGG: cte:CT0272 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910885.1"
                     /db_xref="GI:119356241"
                     /db_xref="GeneID:4568657"
                     /translation="MSWVILFSFSLAFFFVLMFLLNRFVSYMKKEQNLEIESFKDSLI
                     DKDNPVGLRGEELEKLKQQQSEAQRHLREVIAKIPVIQKDGRFQLDEEALRQRKEAEN
                     RNGTSGSVTKDRA"
     gene            447357..448871
                     /locus_tag="Cpha266_0403"
                     /db_xref="GeneID:4568658"
     CDS             447357..448871
                     /locus_tag="Cpha266_0403"
                     /note="PFAM: polysaccharide biosynthesis protein;
                     KEGG: plt:Plut_1745 polysaccharide biosynthesis protein"
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide biosynthesis protein"
                     /protein_id="YP_910886.1"
                     /db_xref="GI:119356242"
                     /db_xref="InterPro:IPR002797"
                     /db_xref="InterPro:IPR010916"
                     /db_xref="GeneID:4568658"
                     /translation="MLSKLKLLARDTVIYGASTILSRSLNYLLVPLYANKLSTFDNGV
                     QTLVYANIALANVLFSYGLETAYLKSASDSLREGKDGKGFFSTAFFSLLVTATLFSLI
                     IVFFSADISVLLGMTPAEYAFVRYAAIILWIDTILVIPFAELRLKRKAVQFAIARVTG
                     VVAVVIAAMILVIPFHAGLQGAFIANIIGSAVSGLMVFPVFMQLRPFFSFHQFRELIQ
                     IGLPYVPAGIAGLLIHLIDRNILIRISSSDIERIYGEGYVASDILGIYGRVVAFGIIL
                     QLFIQVFRFAWQPFFLQHASDPDAKRLFRYVLSISTLFTMVLALASTFFVPDLVRYHY
                     ADRFYLLPPRYWIGLSVLPWIFLSYVFDMISTNLTAGLLITGNTRSLPMVTFSGALVT
                     SLVCWALVPVNGMEGAAYAIVAGTFVMCLVMAYYSLKFYPNRYDWLKLSLLLAVGGVF
                     AGIGLWFETIAAGMVLIVLVKIALLVLFFLLVVFAFNEEVRLVAEKIAHKLKKR"
     misc_feature    447357..448715
                     /locus_tag="Cpha266_0403"
                     /note="Membrane protein involved in the export of
                     O-antigen and teichoic acid [General function prediction
                     only]; Region: RfbX; COG2244"
                     /db_xref="CDD:225153"
     misc_feature    447378..448634
                     /locus_tag="Cpha266_0403"
                     /note="Multidrug and toxic compound extrusion family and
                     similar proteins; Region: MATE_like; cl09326"
                     /db_xref="CDD:245055"
     gene            complement(448922..449428)
                     /locus_tag="Cpha266_0404"
                     /db_xref="GeneID:4568659"
     CDS             complement(448922..449428)
                     /locus_tag="Cpha266_0404"
                     /note="KEGG: plt:Plut_1743 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910887.1"
                     /db_xref="GI:119356243"
                     /db_xref="GeneID:4568659"
                     /translation="MDFLASKRFVTTSLVILVLLNLTLLGILWMQNFSGKQAPVQVKI
                     TRQYNRQIYFTAPLALSEKQAISFQELRREHFRRVRPEMQAISLLKEQLVKEAIRDNP
                     DSLKIVKLAESIGKHQTSVERQLAEHFHELSEVCTPSQRDSLQKILTHMGKRQMHIRK
                     DTIENLTR"
     misc_feature    complement(449003..>449281)
                     /locus_tag="Cpha266_0404"
                     /note="Heavy-metal resistance; Region: Metal_resist;
                     pfam13801"
                     /db_xref="CDD:222389"
     gene            complement(449575..450156)
                     /locus_tag="Cpha266_0405"
                     /db_xref="GeneID:4568660"
     CDS             complement(449575..450156)
                     /locus_tag="Cpha266_0405"
                     /note="KEGG: cch:Cag_0471 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910888.1"
                     /db_xref="GI:119356244"
                     /db_xref="GeneID:4568660"
                     /translation="MNKKTVTMITAMLLGFSSIASATDYSSYSDAKLSEMRGTMRTAS
                     QEERQAYQTECQKRTALTSPDQRSNRAGITRHKTKGSSPMILKEQLGLSDTQSRQLQE
                     MRQKHAGLATKERSRLAELQRQLMDASMTSNPDKQRIAVLAQQIGKEQSDLAIMRSAS
                     IQEVASVLTPKQREKMKTFMLQISPRKQGGMKM"
     sig_peptide     complement(450088..450156)
                     /locus_tag="Cpha266_0405"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 1.000) with cleavage site probability 0.980 at
                     residue 23"
     misc_feature    complement(449617..449892)
                     /locus_tag="Cpha266_0405"
                     /note="CpxP component of the bacterial Cpx-two-component
                     system and related proteins; Region: CpxP_like; cd09916"
                     /db_xref="CDD:197366"
     misc_feature    complement(order(449617..449619,449626..449631,
                     449662..449664,449671..449673,449680..449685,
                     449692..449694,449704..449706,449716..449718,
                     449728..449730,449737..449739,449749..449751,
                     449755..449757,449767..449772,449779..449781,
                     449791..449793))
                     /locus_tag="Cpha266_0405"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:197366"
     gene            complement(450212..450766)
                     /locus_tag="Cpha266_0406"
                     /db_xref="GeneID:4568661"
     CDS             complement(450212..450766)
                     /locus_tag="Cpha266_0406"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910889.1"
                     /db_xref="GI:119356245"
                     /db_xref="GeneID:4568661"
                     /translation="MKKRALAASLAATIMTFGNSAGAADYRDSYAVEQNRYRNESRQE
                     QSDERFTRDERQRNGYQDRQRQAPVIHDDFRTVKAALELDDRQLDRFVAIRENYREHT
                     GSVYREIALLKEIRQNEEMRKQRNFRTIAKLNRKISALQDELNRYRIRSIRNYRDVCN
                     NQQRERFDRFAAHNNPTFALMFRF"
     sig_peptide     complement(450695..450766)
                     /locus_tag="Cpha266_0406"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 1.000) with cleavage site probability 0.976 at
                     residue 24"
     gene            complement(450871..451251)
                     /locus_tag="Cpha266_0407"
                     /db_xref="GeneID:4568662"
     CDS             complement(450871..451251)
                     /locus_tag="Cpha266_0407"
                     /note="KEGG: cte:CT0277 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910890.1"
                     /db_xref="GI:119356246"
                     /db_xref="GeneID:4568662"
                     /translation="MKHNIDTKEEEVRKIMQLLDEMQPLKVSPLFRVHLMEKVEAVSN
                     NRRSETFHSFNPRLAFAALLVVINISSAMLFFSSTEQQAKETASNATETVNDDYTSPA
                     LAYYTETGTEFSGSELNDNQNSNR"
     gene            complement(451326..451934)
                     /locus_tag="Cpha266_0408"
                     /db_xref="GeneID:4568663"
     CDS             complement(451326..451934)
                     /locus_tag="Cpha266_0408"
                     /note="PFAM: sigma-70 region 2 domain protein; sigma-70
                     region 4 domain protein; Sigma-70, region 4 type 2;
                     KEGG: cte:CT0278 RNA polymerase sigma-70 factor, ECF
                     subfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="ECF subfamily RNA polymerase sigma-24 factor"
                     /protein_id="YP_910891.1"
                     /db_xref="GI:119356247"
                     /db_xref="InterPro:IPR000838"
                     /db_xref="InterPro:IPR007627"
                     /db_xref="InterPro:IPR007630"
                     /db_xref="InterPro:IPR013249"
                     /db_xref="GeneID:4568663"
                     /translation="MEKRGEAAVTIPATHEALLDSRATSKDDQFRKLVLEHQEMVLNT
                     CFRFVFNREDAEDLAQDVFVEVYRSLDQFREESKLSTWIYRIAVTKSLDYLRRLKRKK
                     RFSSLKRVIGIEDPSEDLPDTAGSNPLQSLAGKENANLLLDALNALPENQKTAFLLSK
                     QDGYSNQEIADILQSSVSAVESLIHRAKKNLHDKLYKHFKQT"
     misc_feature    complement(451362..451889)
                     /locus_tag="Cpha266_0408"
                     /note="DNA-directed RNA polymerase specialized sigma
                     subunit, sigma24 homolog [Transcription]; Region: RpoE;
                     COG1595"
                     /db_xref="CDD:224511"
     misc_feature    complement(<451674..451838)
                     /locus_tag="Cpha266_0408"
                     /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
                     /db_xref="CDD:218138"
     misc_feature    complement(451362..451490)
                     /locus_tag="Cpha266_0408"
                     /note="Sigma70, region (SR) 4 refers to the most
                     C-terminal of four conserved domains found in Escherichia
                     coli (Ec) sigma70, the main housekeeping sigma, and
                     related sigma-factors (SFs). A SF is a dissociable subunit
                     of RNA polymerase, it directs bacterial or...; Region:
                     Sigma70_r4; cd06171"
                     /db_xref="CDD:100119"
     misc_feature    complement(order(451371..451373,451377..451382,
                     451386..451394,451398..451403,451407..451409,
                     451437..451442,451458..451460,451488..451490))
                     /locus_tag="Cpha266_0408"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:100119"
     gene            complement(452118..452512)
                     /locus_tag="Cpha266_0409"
                     /pseudo
                     /db_xref="GeneID:4568664"
     gene            complement(452555..453937)
                     /locus_tag="Cpha266_0410"
                     /db_xref="GeneID:4568665"
     CDS             complement(452555..453937)
                     /locus_tag="Cpha266_0410"
                     /EC_number="5.4.2.8"
                     /note="PFAM: phosphoglucomutase/phosphomannomutase C
                     terminal; phosphoglucomutase/phosphomannomutase
                     alpha/beta/alpha domain I;
                     phosphoglucomutase/phosphomannomutase alpha/beta/alpha
                     domain II; phosphoglucomutase/phosphomannomutase
                     alpha/beta/alpha domain III;
                     KEGG: plt:Plut_1740 phosphoglucomutase"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphomannomutase"
                     /protein_id="YP_910892.1"
                     /db_xref="GI:119356248"
                     /db_xref="InterPro:IPR005841"
                     /db_xref="InterPro:IPR005843"
                     /db_xref="InterPro:IPR005844"
                     /db_xref="InterPro:IPR005845"
                     /db_xref="InterPro:IPR005846"
                     /db_xref="GeneID:4568665"
                     /translation="MQVKFGTDGWRAIIAKDYTYENLKLAALASARYFQSQPGRSKGV
                     CIGYDTRFMSKEFAEYTAEVLSSAGIRVFLSDSFVSTPAVSLYTKAKQLAGGIVITAS
                     HNPPNYNGFKVKAAYGGPANPEAIAEIESNLLEIDPKTEIKPDMKLIESVDMKSFYMN
                     YLKTHVDLQLIRESRIKIAHNAMYGAGQDIITRLFDESMVNCYHCTINPGFGGINPEP
                     MPQYIEEFVDFFKEVETDVAIINDGDADRVGMLDEKARFVDSHKLFAIILKYLVEERH
                     QTGEVAKTFALTDVINKICRKNNLVLHELPVGFKYVSKLMSTNDILIGGEESGGIGIT
                     SFLPERDGVYIGLLILEIMTRKEKSLSGLVEELYDEYGYFAFTRNDLHVSEAKKQAII
                     AKAAAGNLETVAGYKVLGFSDLDGYKYHFEGGWLLIRPSGTEPVLRLYCEADTDEKVS
                     KVLAFAAKLA"
     misc_feature    complement(452561..453937)
                     /locus_tag="Cpha266_0410"
                     /note="Phosphomannomutase [Carbohydrate transport and
                     metabolism]; Region: {ManB}; COG1109"
                     /db_xref="CDD:224034"
     misc_feature    complement(452558..453931)
                     /locus_tag="Cpha266_0410"
                     /note="This PGM-like (phosphoglucomutase-like) protein of
                     unknown function belongs to the alpha-D-phosphohexomutase
                     superfamily and is found in both archaea and bacteria. The
                     alpha-D-phosphohexomutases include several related enzymes
                     that catalyze a reversible...; Region: PGM_like2; cd05800"
                     /db_xref="CDD:100093"
     misc_feature    complement(order(452624..452626,452639..452647,
                     452651..452653,452948..452950,452954..452956,
                     452960..452962,453011..453019,453080..453082,
                     453197..453202,453206..453208,453212..453214,
                     453602..453604,453626..453634,453905..453907,
                     453914..453916,453920..453922))
                     /locus_tag="Cpha266_0410"
                     /note="active site"
                     /db_xref="CDD:100093"
     misc_feature    complement(order(452624..452626,452639..452647,
                     452651..452653,452948..452950,452954..452956,
                     452960..452962,453011..453013,453017..453019,
                     453080..453082,453197..453199,453632..453634,
                     453914..453916))
                     /locus_tag="Cpha266_0410"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100093"
     misc_feature    complement(order(453200..453202,453206..453208,
                     453212..453214,453632..453634))
                     /locus_tag="Cpha266_0410"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:100093"
     gene            454044..455186
                     /locus_tag="Cpha266_0411"
                     /db_xref="GeneID:4568666"
     CDS             454044..455186
                     /locus_tag="Cpha266_0411"
                     /EC_number="2.4.1.182"
                     /note="KEGG: plt:Plut_1739 glycosyl transferase, family
                     19;
                     TIGRFAM: lipid-A-disaccharide synthase;
                     PFAM: glycosyl transferase, family 19"
                     /codon_start=1
                     /transl_table=11
                     /product="lipid-A-disaccharide synthase"
                     /protein_id="YP_910893.1"
                     /db_xref="GI:119356249"
                     /db_xref="InterPro:IPR003835"
                     /db_xref="GeneID:4568666"
                     /translation="MPKKLFVLAGEVSGDLHAAGVVAELLKARPDVRVFGIGGEKLRA
                     LGAELFYDTRRMSIMGFLEVLKHAGFLQRVIREMKELVRQEKPDLAFLVDYPGMNLLM
                     ARFFHEEGVPVIYYISPQVWAWKEGRVKAIGRYVDRLLVIFDFEVEFFRRHGIRAEFV
                     GHPVIEELSAVSLPPRELFFRRHHILPGQRLVGMLPGSRRQEIALVFPEMLKAARMLA
                     ADYDVVFLLGRSPQMDEKHFSLVSAFDDIRIVECTAYEVMRFSELELVTSGTATLESL
                     CFGVPMIVLYKTAWLNYAVGRLLVRLTSISLANIVTKGLGSKDQVVPELLQHEATASG
                     IYMIARRLLDHPQLLAEMRQELLDAREKLASASPSQIISEILQEYL"
     misc_feature    454047..455174
                     /locus_tag="Cpha266_0411"
                     /note="lipid-A-disaccharide synthase; Reviewed; Region:
                     lpxB; PRK00025"
                     /db_xref="CDD:234580"
     misc_feature    454050..455051
                     /locus_tag="Cpha266_0411"
                     /note="ipid-A-disaccharide synthase; Provisional; Region:
                     PRK14089"
                     /db_xref="CDD:237606"
     gene            455202..455474
                     /locus_tag="Cpha266_0412"
                     /db_xref="GeneID:4570966"
     CDS             455202..455474
                     /locus_tag="Cpha266_0412"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910894.1"
                     /db_xref="GI:119356250"
                     /db_xref="InterPro:IPR000437"
                     /db_xref="GeneID:4570966"
                     /translation="MEKAADLLLGNPVLLLIAVIAAVMVLFSCLRNMFRLALFAAALF
                     VLYIAYLSLTGGDAPAAVREIQETIAASFSHVSTMIKSFFDLLKSR"
     gene            complement(455497..457476)
                     /locus_tag="Cpha266_0413"
                     /db_xref="GeneID:4570967"
     CDS             complement(455497..457476)
                     /locus_tag="Cpha266_0413"
                     /note="these proteins belong to a family of
                     oxidoreductases related to the NADPH-dependent glutamate
                     synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="putative NADPH-dependent glutamate synthase
                     small subunit"
                     /protein_id="YP_910895.1"
                     /db_xref="GI:119356251"
                     /db_xref="InterPro:IPR000103"
                     /db_xref="InterPro:IPR000759"
                     /db_xref="InterPro:IPR001041"
                     /db_xref="InterPro:IPR001100"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="GeneID:4570967"
                     /translation="MNALTLTINGLKTTVQPGTSILDAAASCGITIPTLCFQQSLDVQ
                     GACWICIVEIKGKNRFVPACSTKVSAGMVIETETEELHMMRRRTLERLIEQHCGDCLG
                     QCELACPAGCNIPGFISEIAAHHDDEAIAIIKNTIPLPGILGRVCPAPCEDACRRHGV
                     DDPVSICALKRYAADRDMEASERYIPAIAEKSGKHVAVIGAGPAGLTAAYYLLALGHE
                     VTIYDEHPAAGGMMRYGIPRFRLPESVIDKDVEPLEQMGATFRFNTRFGKDISTASLQ
                     SAFDAIFLAVGAQQAAAMHIPGEHETGVLSGIEFLRQANEGVAEHPGANVVVVGGGNT
                     AVDAARTALRLGATTVTILYRRTKEEMPANQQEINEAIAEGITLHVLALPVSMRRMNG
                     FTEITAIAMRQGEPDESGRKKPVPINGSEFTIAANTVISATGQQVDCSIAMAAGIGTS
                     PEGTFDVNQATLQSNIAGIFSAGDCVTGPDLAITAVSEGRRAAHSIHLFLQGKPVVGK
                     PQQFNSSYGPRDQAPEAFYSKANPFEKIALPEISLLERSGTFREVVLGLSPEDAAQEA
                     LRCLQCRCNAIDNCRLRELAALYLPSGSCKLEEKLDFEIISGTDIRIEREKCVDCGIC
                     VRTLEQYGTEHEPDYQKLSTSCPTGALSEAMLNKK"
     misc_feature    complement(455521..457476)
                     /locus_tag="Cpha266_0413"
                     /note="putative NADPH-dependent glutamate synthase small
                     subunit; Provisional; Region: PRK12814"
                     /db_xref="CDD:139246"
     misc_feature    complement(457252..457467)
                     /locus_tag="Cpha266_0413"
                     /note="2Fe-2S iron-sulfur cluster binding domain.
                     Iron-sulfur proteins play an important role in electron
                     transfer processes and in various enzymatic reactions. The
                     family includes plant and algal ferredoxins, which act as
                     electron carriers in photosynthesis...; Region: fer2;
                     cd00207"
                     /db_xref="CDD:238126"
     misc_feature    complement(order(457285..457290,457327..457338,
                     457342..457344,457369..457371,457378..457383))
                     /locus_tag="Cpha266_0413"
                     /note="catalytic loop [active]"
                     /db_xref="CDD:238126"
     misc_feature    complement(order(457285..457287,457327..457329,
                     457336..457338,457369..457371))
                     /locus_tag="Cpha266_0413"
                     /note="iron binding site [ion binding]; other site"
                     /db_xref="CDD:238126"
     gene            complement(457509..458495)
                     /gene="ispH"
                     /locus_tag="Cpha266_0414"
                     /gene_synonym="lytB"
                     /db_xref="GeneID:4570968"
     CDS             complement(457509..458495)
                     /gene="ispH"
                     /locus_tag="Cpha266_0414"
                     /gene_synonym="lytB"
                     /EC_number="1.17.1.2"
                     /note="catalyzes the conversion of
                     1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate into
                     isopentenyl diphosphate (IPP) and dimethylallyl
                     diphosphate (DMAPP); functions in the nonmevalonate
                     isoprenoid biosynthesis pathway"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxy-3-methylbut-2-enyl diphosphate
                     reductase"
                     /protein_id="YP_910896.1"
                     /db_xref="GI:119356252"
                     /db_xref="InterPro:IPR003451"
                     /db_xref="GeneID:4570968"
                     /translation="MKINLDRTSSGFCIGVQGTIHVAEEKLNNPDKLFSLGDVVHNEA
                     EVNRLEHLGLTTIDESGFHELKNAQLLIRAHGEPPSTYRIAEKNNLVITDTTCPVVSR
                     LQRTARLLHELGYQIIIYGKPSHPEVIGINGHCKNSAVIIKHPDLSDPSETGQIDLKR
                     KTALISQTTMDVPGFYELKANIRNLFAADSEEIRNENDHLWMAIRDIDLTASLTGIRD
                     MPRYVYKDTICRQVSSRNQMLHDFAIANSCVIFVAGKKSSNGQVLFGICKAANPCTYF
                     IEDIDEIDDAWLTGSDGRTVESVGICGATSTPMWLLEKVAAHLQRRYNHDPA"
     misc_feature    complement(457530..458495)
                     /gene="ispH"
                     /locus_tag="Cpha266_0414"
                     /gene_synonym="lytB"
                     /note="4-hydroxy-3-methylbut-2-enyl diphosphate reductase;
                     Reviewed; Region: ispH; PRK01045"
                     /db_xref="CDD:234893"
     misc_feature    complement(457551..458468)
                     /gene="ispH"
                     /locus_tag="Cpha266_0414"
                     /gene_synonym="lytB"
                     /note="LytB protein; Region: LYTB; cl00507"
                     /db_xref="CDD:241911"
     gene            complement(458654..459472)
                     /locus_tag="Cpha266_0415"
                     /db_xref="GeneID:4570969"
     CDS             complement(458654..459472)
                     /locus_tag="Cpha266_0415"
                     /EC_number="5.1.1.3"
                     /note="converts L-glutamate to D-glutamate, a component of
                     peptidoglycan"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate racemase"
                     /protein_id="YP_910897.1"
                     /db_xref="GI:119356253"
                     /db_xref="InterPro:IPR001920"
                     /db_xref="InterPro:IPR004391"
                     /db_xref="GeneID:4570969"
                     /translation="MQHHKATPESPIGIFDSGVGGLTVVRAIQAEMPAERIIYFGDTA
                     RVPYGTKSPATIRKYAHEDTAILMSHLPKIIIVACNTVSALALDVVEKTAGSIPVIGV
                     LKAGADLAVQVTRNKHVGVIGTQATVSSNAYADAITLLDANIEVVSKACPLFVPLAEE
                     GFTEHAATRLIASDYLAAFDGHDIDTLVLGCTHYPILRHVITETLHRDIRIIDSAEAV
                     AGRTRKLLADAKLLSTEKHAPPPHLLVSDLPQKFSMLYKLFMESDLPDVELVEV"
     misc_feature    complement(458669..459457)
                     /locus_tag="Cpha266_0415"
                     /note="glutamate racemase; Provisional; Region: PRK00865"
                     /db_xref="CDD:234851"
     gene            complement(459501..460592)
                     /locus_tag="Cpha266_0416"
                     /gene_synonym="ychF"
                     /db_xref="GeneID:4570970"
     CDS             complement(459501..460592)
                     /locus_tag="Cpha266_0416"
                     /gene_synonym="ychF"
                     /note="translation-associated GTPase; the crystal
                     structure of the Haemophilus influenzae YchF protein
                     showed similarity to the yeast structure (PDB: 1NI3);
                     fluorescence spectroscopy revealed nucleic acid binding;
                     the yeast protein YBR025c interacts with the translation
                     elongation factor eEF1"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-dependent nucleic acid-binding protein EngD"
                     /protein_id="YP_910898.1"
                     /db_xref="GI:119356254"
                     /db_xref="InterPro:IPR000583"
                     /db_xref="InterPro:IPR002917"
                     /db_xref="InterPro:IPR004396"
                     /db_xref="InterPro:IPR005289"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR013029"
                     /db_xref="GeneID:4570970"
                     /translation="MSLRCGIVGLPNVGKSTLFNAITAKQAEAANYPFCTIEPNVGTV
                     LVPDERMQQIANVVKTPTLVPATLEIVDIAGLVKGASKGEGLGNQFLSHIREVDAIVH
                     VVRCFDDSNIIHVEGKIDPADDIATIETELMLADLDSMEKRIERLRKNSRKEKDLLQL
                     VDLAEKIIAGLAEGIPARSVIETPEEQETAKQFFLLTSKPILFAANVAEEDLQNGNDY
                     TRTVAEIAEKAGSKMLIISAKAEADIAELPEEERPMFLESLGLSMSGLDRLIRTAHEL
                     LGLQTYFTAGEKEVHAWTIRKGAAAPEAAGAIHSDFEKGFIRAEVMFYKDLLELGSEQ
                     KVKEAGKLRSEGREYIVRDGDIIVFRFNV"
     misc_feature    complement(459504..460592)
                     /locus_tag="Cpha266_0416"
                     /gene_synonym="ychF"
                     /note="GTP-binding protein YchF; Reviewed; Region:
                     PRK09601"
                     /db_xref="CDD:236583"
     misc_feature    complement(459762..460580)
                     /locus_tag="Cpha266_0416"
                     /gene_synonym="ychF"
                     /note="YchF GTPase; Region: YchF; cd01900"
                     /db_xref="CDD:206687"
     misc_feature    complement(460545..460568)
                     /locus_tag="Cpha266_0416"
                     /gene_synonym="ychF"
                     /note="G1 box; other site"
                     /db_xref="CDD:206687"
     misc_feature    complement(order(459876..459884,459966..459968,
                     459972..459977,460542..460553,460557..460559))
                     /locus_tag="Cpha266_0416"
                     /gene_synonym="ychF"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206687"
     misc_feature    complement(460476..460499)
                     /locus_tag="Cpha266_0416"
                     /gene_synonym="ychF"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206687"
     misc_feature    complement(460485..460487)
                     /locus_tag="Cpha266_0416"
                     /gene_synonym="ychF"
                     /note="G2 box; other site"
                     /db_xref="CDD:206687"
     misc_feature    complement(order(460305..460334,460353..460382))
                     /locus_tag="Cpha266_0416"
                     /gene_synonym="ychF"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206687"
     misc_feature    complement(460368..460379)
                     /locus_tag="Cpha266_0416"
                     /gene_synonym="ychF"
                     /note="G3 box; other site"
                     /db_xref="CDD:206687"
     misc_feature    complement(459966..459977)
                     /locus_tag="Cpha266_0416"
                     /gene_synonym="ychF"
                     /note="G4 box; other site"
                     /db_xref="CDD:206687"
     misc_feature    complement(459876..459884)
                     /locus_tag="Cpha266_0416"
                     /gene_synonym="ychF"
                     /note="G5 box; other site"
                     /db_xref="CDD:206687"
     misc_feature    complement(459510..459758)
                     /locus_tag="Cpha266_0416"
                     /gene_synonym="ychF"
                     /note="TGS_YchF_C: This subfamily represents TGS
                     domain-containing YchF GTP-binding protein, a universally
                     conserved GTPase whose function is unknown. The N-terminal
                     domain of the YchF protein belongs to the Obg-like family
                     of GTPases, and some members of the...; Region:
                     TGS_YchF_C; cd04867"
                     /db_xref="CDD:133440"
     gene            460716..461429
                     /gene="cmk"
                     /locus_tag="Cpha266_0417"
                     /db_xref="GeneID:4570971"
     CDS             460716..461429
                     /gene="cmk"
                     /locus_tag="Cpha266_0417"
                     /EC_number="2.7.4.14"
                     /note="Catalyzes the formation of (d)CDP from ATP and
                     (d)CMP"
                     /codon_start=1
                     /transl_table=11
                     /product="cytidylate kinase"
                     /protein_id="YP_910899.1"
                     /db_xref="GI:119356255"
                     /db_xref="InterPro:IPR003136"
                     /db_xref="InterPro:IPR011769"
                     /db_xref="InterPro:IPR011994"
                     /db_xref="GeneID:4570971"
                     /translation="MKQRNQEKRIIIAIDGPAASGKSTTARKVADRLGYTYIDTGAMY
                     RSVTLKAIESGLMDTLRSSPERVVDLLAGLSVCFSGDRIMLDGRDVTLAIRENRVSRE
                     VSFISSLKPVRDTMRQMQQDMGRGRGVVMDGRDIGTVVFPDAELKVFLTADVRQRAMR
                     RYAELAVKSGDPSELPCLEDLEREILDRDRADAEREHAPLKKHPDARELDTSSLTIDV
                     QTDMVCSMAEDILKKKQNG"
     misc_feature    460734..461414
                     /gene="cmk"
                     /locus_tag="Cpha266_0417"
                     /note="cytidylate kinase; Provisional; Region: cmk;
                     PRK00023"
                     /db_xref="CDD:234579"
     misc_feature    460746..461351
                     /gene="cmk"
                     /locus_tag="Cpha266_0417"
                     /note="Cytidine monophosphate kinase (CMPK) catalyzes the
                     reversible phosphorylation of cytidine monophosphate (CMP)
                     to produce cytidine diphosphate (CDP), using ATP as the
                     preferred phosphoryl donor; Region: CMPK; cd02020"
                     /db_xref="CDD:238978"
     misc_feature    order(461052..461054,461115..461120,461298..461300)
                     /gene="cmk"
                     /locus_tag="Cpha266_0417"
                     /note="CMP-binding site; other site"
                     /db_xref="CDD:238978"
     misc_feature    order(461277..461279,461289..461291)
                     /gene="cmk"
                     /locus_tag="Cpha266_0417"
                     /note="The sites determining sugar specificity; other
                     site"
                     /db_xref="CDD:238978"
     gene            461536..463311
                     /gene="rpsA"
                     /locus_tag="Cpha266_0418"
                     /db_xref="GeneID:4570972"
     CDS             461536..463311
                     /gene="rpsA"
                     /locus_tag="Cpha266_0418"
                     /note="in Escherichia coli this protein is involved in
                     binding to the leader sequence of mRNAs and is itself
                     bound to the 30S subunit; autoregulates expression via a
                     C-terminal domain; in most gram negative organisms this
                     protein is composed of 6 repeats of the S1 domain while in
                     gram positive there are 4 repeats; the S1 nucleic
                     acid-binding domain is found associated with other
                     proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S1"
                     /protein_id="YP_910900.1"
                     /db_xref="GI:119356256"
                     /db_xref="InterPro:IPR000110"
                     /db_xref="InterPro:IPR003029"
                     /db_xref="GeneID:4570972"
                     /translation="MAETLTLEKKVQERLARKKVKYFAHYEPAELEQMEMLYTSTLCE
                     ITEDEIVKGRIVSISNKDVTIDVGFKSEGIVSLLEFRDDDDVAVGDEVEVYLENIEDK
                     MGQLILSKKKADVLRIWDKIYDSIENDTIINGKIINRVKGGMTVSLSGVEAFLPGSQI
                     DVKPVRDFDALVGQTMDFRVVKINPVTQNIVVSHKVILEEAYAARREEMLANIKVGMV
                     LEGTVKNITDFGIFVDLGGLDGLVHITDITWGRINHPSEVVDLDQPIKVVVVGFDENT
                     KRVSLGMKQLEAHPWENIEIKYPVGSKARGRIVSITDYGAFVEIEKGIEGLVHISEMS
                     WTQHIKHPSQFVSLNQEVECVILNIDKDHTKLSLSMKRVNEDPWIALSEKYIEASLHK
                     GTVSNITDFGVFVELEPGVDGLVHISDLSWTKKIRHPSELVKKNQELDVKVLKFDVNA
                     RRIALGHKQINPDPWDDFEQKYAVGAETPARISQIIEKGVIVILPGDVDGFVPVSHLL
                     QGGVKDIHSSFALGDELPLRVIEFDKENKRIILSALEYFKDKSKEEIEAYLQAHPNEK
                     KEIEDATAELEPQVKSAEKKSGEAK"
     misc_feature    461593..463296
                     /gene="rpsA"
                     /locus_tag="Cpha266_0418"
                     /note="30S ribosomal protein S1; Reviewed; Region: rpsA;
                     PRK06299"
                     /db_xref="CDD:235775"
     misc_feature    461680..461868
                     /gene="rpsA"
                     /locus_tag="Cpha266_0418"
                     /note="S1_RPS1_repeat_ec1_hs1: Ribosomal protein S1 (RPS1)
                     domain. RPS1 is a component of the small ribosomal subunit
                     thought to be involved in the recognition and binding of
                     mRNA's during translation initiation. The bacterial RPS1
                     domain architecture...; Region: S1_RPS1_repeat_ec1_hs1;
                     cd05687"
                     /db_xref="CDD:240192"
     misc_feature    order(461701..461703,461725..461727,461755..461757,
                     461761..461763)
                     /gene="rpsA"
                     /locus_tag="Cpha266_0418"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:240192"
     misc_feature    461920..462120
                     /gene="rpsA"
                     /locus_tag="Cpha266_0418"
                     /note="S1_RPS1_repeat_ec2_hs2: Ribosomal protein S1 (RPS1)
                     domain. RPS1 is a component of the small ribosomal subunit
                     thought to be involved in the recognition and binding of
                     mRNA's during translation initiation. The bacterial RPS1
                     domain architecture...; Region: S1_RPS1_repeat_ec2_hs2;
                     cd04465"
                     /db_xref="CDD:239911"
     misc_feature    order(461944..461946,461968..461970,461995..461997,
                     462001..462003)
                     /gene="rpsA"
                     /locus_tag="Cpha266_0418"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:239911"
     misc_feature    462178..462381
                     /gene="rpsA"
                     /locus_tag="Cpha266_0418"
                     /note="S1_RPS1_repeat_ec3: Ribosomal protein S1 (RPS1)
                     domain. RPS1 is a component of the small ribosomal subunit
                     thought to be involved in the recognition and binding of
                     mRNA's during translation initiation. The bacterial RPS1
                     domain architecture consists...; Region:
                     S1_RPS1_repeat_ec3; cd05688"
                     /db_xref="CDD:240193"
     misc_feature    order(462205..462207,462229..462231,462256..462258,
                     462262..462264)
                     /gene="rpsA"
                     /locus_tag="Cpha266_0418"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:240193"
     misc_feature    462427..462639
                     /gene="rpsA"
                     /locus_tag="Cpha266_0418"
                     /note="S1_like: Ribosomal protein S1-like RNA-binding
                     domain. Found in a wide variety of RNA-associated
                     proteins. Originally identified in S1 ribosomal protein.
                     This superfamily also contains the Cold Shock Domain
                     (CSD), which is a homolog of the S1 domain; Region:
                     S1_like; cl09927"
                     /db_xref="CDD:245202"
     misc_feature    order(462460..462462,462484..462486,462514..462516,
                     462520..462522)
                     /gene="rpsA"
                     /locus_tag="Cpha266_0418"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:238094"
     misc_feature    462709..462903
                     /gene="rpsA"
                     /locus_tag="Cpha266_0418"
                     /note="S1_RPS1_repeat_ec5: Ribosomal protein S1 (RPS1)
                     domain. RPS1 is a component of the small ribosomal subunit
                     thought to be involved in the recognition and binding of
                     mRNA's during translation initiation. The bacterial RPS1
                     domain architecture consists...; Region:
                     S1_RPS1_repeat_ec5; cd05690"
                     /db_xref="CDD:240195"
     misc_feature    order(462721..462723,462745..462747,462775..462777,
                     462781..462783)
                     /gene="rpsA"
                     /locus_tag="Cpha266_0418"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:240195"
     misc_feature    462973..463161
                     /gene="rpsA"
                     /locus_tag="Cpha266_0418"
                     /note="S1_like: Ribosomal protein S1-like RNA-binding
                     domain. Found in a wide variety of RNA-associated
                     proteins. Originally identified in S1 ribosomal protein.
                     This superfamily also contains the Cold Shock Domain
                     (CSD), which is a homolog of the S1 domain; Region:
                     S1_like; cd00164"
                     /db_xref="CDD:238094"
     misc_feature    order(462982..462984,463006..463008,463036..463038,
                     463042..463044)
                     /gene="rpsA"
                     /locus_tag="Cpha266_0418"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:238094"
     gene            complement(463386..464303)
                     /gene="era"
                     /locus_tag="Cpha266_0419"
                     /gene_synonym="bex; rbaA; sdgE; yqfH"
                     /db_xref="GeneID:4570973"
     CDS             complement(463386..464303)
                     /gene="era"
                     /locus_tag="Cpha266_0419"
                     /gene_synonym="bex; rbaA; sdgE; yqfH"
                     /note="Era; Escherichia coli Ras-like protein; Bex;
                     Bacillus Era-complementing segment; essential protein in
                     Escherichia coli that is involved in many cellular
                     processes; GTPase; binds the cell membrane through
                     apparent C-terminal domain; mutants are arrested during
                     the cell cycle; Streptococcus pneumoniae Era binds to RNA
                     and Escherichia coli Era binds 16S rRNA and 30S ribosome"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein Era"
                     /protein_id="YP_910901.1"
                     /db_xref="GI:119356257"
                     /db_xref="InterPro:IPR002917"
                     /db_xref="InterPro:IPR004044"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR005662"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="GeneID:4570973"
                     /translation="MDASSFSCGFAVIIGAPNAGKSTLLNKLLDYKLSIVTPKPQTTR
                     KRITGIYHKDQCQIIFLDTPGIMKPQQKLHESMLEITRATLKDADVVLALLPYSRQSG
                     SVDLEFTEDLFSSWLNPSGKPVIAVLNKSDLVSAEAKRTCESVIQNSFHPKAVLSISA
                     QLGNNIEGLISALKPFLPLKEPLYPEETLSTDPERLFVTEIIREKIFLLYGNEIPYAS
                     EVIIDEFKEQHENDPSRKDLIRCSIIVERDSQKQILIGSKGAALKKLGQAARLDIEEL
                     LGRPVFLELFIKVRNDWRKKNNLLKSYGY"
     misc_feature    complement(463389..464294)
                     /gene="era"
                     /locus_tag="Cpha266_0419"
                     /gene_synonym="bex; rbaA; sdgE; yqfH"
                     /note="GTPase Era; Reviewed; Region: era; PRK00089"
                     /db_xref="CDD:234624"
     misc_feature    complement(463773..464288)
                     /gene="era"
                     /locus_tag="Cpha266_0419"
                     /gene_synonym="bex; rbaA; sdgE; yqfH"
                     /note="E. coli Ras-like protein (Era) is a multifunctional
                     GTPase; Region: Era; cd04163"
                     /db_xref="CDD:206726"
     misc_feature    complement(464238..464261)
                     /gene="era"
                     /locus_tag="Cpha266_0419"
                     /gene_synonym="bex; rbaA; sdgE; yqfH"
                     /note="G1 box; other site"
                     /db_xref="CDD:206726"
     misc_feature    complement(order(463824..463829,463908..463910,
                     463914..463919,464109..464111,464175..464183,
                     464193..464195,464235..464255))
                     /gene="era"
                     /locus_tag="Cpha266_0419"
                     /gene_synonym="bex; rbaA; sdgE; yqfH"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206726"
     misc_feature    complement(order(464166..464210,464214..464216))
                     /gene="era"
                     /locus_tag="Cpha266_0419"
                     /gene_synonym="bex; rbaA; sdgE; yqfH"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206726"
     misc_feature    complement(464175..464177)
                     /gene="era"
                     /locus_tag="Cpha266_0419"
                     /gene_synonym="bex; rbaA; sdgE; yqfH"
                     /note="G2 box; other site"
                     /db_xref="CDD:206726"
     misc_feature    complement(order(464043..464048,464106..464123))
                     /gene="era"
                     /locus_tag="Cpha266_0419"
                     /gene_synonym="bex; rbaA; sdgE; yqfH"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206726"
     misc_feature    complement(464109..464120)
                     /gene="era"
                     /locus_tag="Cpha266_0419"
                     /gene_synonym="bex; rbaA; sdgE; yqfH"
                     /note="G3 box; other site"
                     /db_xref="CDD:206726"
     misc_feature    complement(463908..463919)
                     /gene="era"
                     /locus_tag="Cpha266_0419"
                     /gene_synonym="bex; rbaA; sdgE; yqfH"
                     /note="G4 box; other site"
                     /db_xref="CDD:206726"
     misc_feature    complement(463821..463829)
                     /gene="era"
                     /locus_tag="Cpha266_0419"
                     /gene_synonym="bex; rbaA; sdgE; yqfH"
                     /note="G5 box; other site"
                     /db_xref="CDD:206726"
     gene            464415..465641
                     /locus_tag="Cpha266_0420"
                     /db_xref="GeneID:4570974"
     CDS             464415..465641
                     /locus_tag="Cpha266_0420"
                     /note="PFAM: cell cycle protein;
                     KEGG: plt:Plut_1730 rod shape-determining protein RodA"
                     /codon_start=1
                     /transl_table=11
                     /product="cell cycle protein"
                     /protein_id="YP_910902.1"
                     /db_xref="GI:119356258"
                     /db_xref="InterPro:IPR001182"
                     /db_xref="GeneID:4570974"
                     /translation="MTDKQSNVDFWLLVPMIGLIVFGLMAIFSATHGAGETTLFYRQF
                     AWGVIGAVVMLFVYFNDYRVIRDNAYLLYLISIFLLVVVLLFGTKIAGQTSWVKIGFF
                     SFQPSEIAKMATILALARFLSDDETDITFTPHLLIALGIPLFPALLIMLQPDMGTTLT
                     SLSFIIPMFIMSGFDLYIVIPYLLPIILMLSGFFNVFYIVGLAVLLFLALWLQKKKFK
                     MHQLLVTAAGLGAALFTNRFAAELLKPHQLKRIQTFLDPMSDPRGAGYNVIQAKIAIS
                     SGGFFGKGYLEGTQTQLRFIPAQWTDFIFCVIAEELGFVGSFVLLLLFLVLILRLLWI
                     ISSIKNKFVELTLAGFVSLLLIHVIINIGMTIGLIPVIGVPLPFVSYGGSSLLGNMIM
                     VALALNFVHNKRSIGY"
     sig_peptide     464415..464516
                     /locus_tag="Cpha266_0420"
                     /product="hypothetical protein"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probabilty 0.781) with cleavage site probability 0.765 at
                     residue 34"
     misc_feature    464439..465608
                     /locus_tag="Cpha266_0420"
                     /note="rod shape-determining protein RodA; Region:
                     rodA_shape; TIGR02210"
                     /db_xref="CDD:233780"
     gene            complement(465769..466218)
                     /locus_tag="Cpha266_0421"
                     /db_xref="GeneID:4570975"
     CDS             complement(465769..466218)
                     /locus_tag="Cpha266_0421"
                     /note="KEGG: cte:CT0291 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910903.1"
                     /db_xref="GI:119356259"
                     /db_xref="GeneID:4570975"
                     /translation="MAKTEMGSPDKYDLFAEKIDQFKLLVEEKKNLQEQIMLLQEEFN
                     EKIKPFENQLSTVVRKLELELARVEGKTSEKPAPLKYSRGRLGISIKELLGNSPDRAF
                     KPKEIADALSTKGTTVSLWLNKYGSSDQEIERIPSENGGKRFLYKIK"
     gene            466369..467709
                     /locus_tag="Cpha266_0422"
                     /db_xref="GeneID:4570976"
     CDS             466369..467709
                     /locus_tag="Cpha266_0422"
                     /note="KEGG: plt:Plut_1728 MiaB-like tRNA modifying
                     enzyme;
                     TIGRFAM: RNA modification enzyme, MiaB family;
                     PFAM: Radical SAM domain protein; Protein of unknown
                     function UPF0004-like;
                     SMART: Elongator protein 3/MiaB/NifB"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA modification protein"
                     /protein_id="YP_910904.1"
                     /db_xref="GI:119356260"
                     /db_xref="InterPro:IPR005839"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR013848"
                     /db_xref="GeneID:4570976"
                     /translation="MPKITAITLGCKLNYAESSAILDLLSKKGWEISSYEKNEDLIII
                     NTCAVTKQAEQKCRQKIRKIIRDNPGSRIVVTGCYAQLSPEVLCKIDGVNAILGSSDK
                     YALPLYEVIGNIESSLPLISVSEIKKEKTIFPGYSLPATFASERTRAFLKIQDGCDYG
                     CAYCTIPFARGRSRSFSPDDIIAQASALVASGYREIVLTGVNIGDYRYRGVRLAALLR
                     MLEKVPVARIRISSIEPDILDDALIAVVAASEIIAPHFHLPLQSGSDAVLRAMCRRYD
                     TAGYRQRILRAVEAIADCSVSSDVMVGYPGESADDYRNMYRFLEGLPISSLHVFSCSV
                     RPGTQLAEQVATKKREVVDPDECRQRSSELIKLGNLKKSRFMEGYVGMECMVLFEESQ
                     KGANGTRKYSGYTRNYLRVTVTVSESSVHLAGSILPVFIEGIDDDLNLMGRLLF"
     misc_feature    466369..467703
                     /locus_tag="Cpha266_0422"
                     /note="2-methylthioadenine synthetase [Translation,
                     ribosomal structure and biogenesis]; Region: MiaB;
                     COG0621"
                     /db_xref="CDD:223694"
     misc_feature    466375..466662
                     /locus_tag="Cpha266_0422"
                     /note="Uncharacterized protein family UPF0004; Region:
                     UPF0004; pfam00919"
                     /db_xref="CDD:216191"
     misc_feature    466819..467394
                     /locus_tag="Cpha266_0422"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    order(466837..466839,466843..466845,466849..466851,
                     466855..466863,466963..466965,466978..466983,
                     467059..467064,467143..467145,467269..467271,
                     467359..467364)
                     /locus_tag="Cpha266_0422"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     gene            467760..468293
                     /locus_tag="Cpha266_0423"
                     /db_xref="GeneID:4570977"
     CDS             467760..468293
                     /locus_tag="Cpha266_0423"
                     /EC_number="2.4.2.7"
                     /note="catalyzes a salvage reaction resulting in the
                     formation of AMP which is metabolically less costly than a
                     de novo synthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="adenine phosphoribosyltransferase"
                     /protein_id="YP_910905.1"
                     /db_xref="GI:119356261"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR002375"
                     /db_xref="InterPro:IPR005764"
                     /db_xref="GeneID:4570977"
                     /translation="MTIKSRIRSIPDYPKKGIMFRDITTLIKDPVGFRLVIDNLTQHY
                     LQNGVDFDVIVGIEARGFIIGGALSYALGKGFVPVRKPGKLPADVASQKYELEYGSDT
                     IEIHIDALEEGSRVLLVDDLLATGGTALAAAALVEKVGGVVAEMAFIVNLPDVGGEQR
                     ILDKGYSIFSLTDFEGD"
     misc_feature    467865..>468122
                     /locus_tag="Cpha266_0423"
                     /note="Phosphoribosyl transferase (PRT)-type I domain;
                     Region: PRTases_typeI; cd06223"
                     /db_xref="CDD:206754"
     gene            complement(468916..469224)
                     /locus_tag="Cpha266_0424"
                     /db_xref="GeneID:4570978"
     CDS             complement(468916..469224)
                     /locus_tag="Cpha266_0424"
                     /note="PFAM: histone family protein DNA-binding protein;
                     KEGG: cte:CT0295 DNA-binding protein HU-alpha, putative"
                     /codon_start=1
                     /transl_table=11
                     /product="histone family protein DNA-binding protein"
                     /protein_id="YP_910906.1"
                     /db_xref="GI:119356262"
                     /db_xref="InterPro:IPR000119"
                     /db_xref="GeneID:4570978"
                     /translation="MGTTTTKADLVNVIAHRTGLTKNETEAVVDCLFESIIDSLKSGK
                     RIEIRGFGSFNIRHKNLRQARNPRTGEKVTVDPKNVPTFKISKEFKHAVSESLKNGQE
                     "
     misc_feature    complement(468949..469209)
                     /locus_tag="Cpha266_0424"
                     /note="Integration host factor (IHF) and HU are small
                     heterodimeric members of the DNABII protein family that
                     bind and bend DNA, functioning as architectural factors in
                     many cellular processes including transcription,
                     site-specific recombination, and...; Region: HU_IHF;
                     cd00591"
                     /db_xref="CDD:238332"
     misc_feature    complement(order(468949..468951,468970..468972,
                     468976..468978,468988..468993,469057..469059,
                     469072..469077,469084..469098,469108..469113,
                     469120..469125,469132..469134,469174..469176,
                     469186..469188,469195..469197,469204..469209))
                     /locus_tag="Cpha266_0424"
                     /note="IHF dimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238332"
     misc_feature    complement(order(468964..468966,468973..468975,
                     468979..468981,468991..468993,469021..469032,
                     469039..469041,469045..469050,469054..469056,
                     469066..469068,469075..469080,469084..469086,
                     469090..469092,469135..469137,469201..469209))
                     /locus_tag="Cpha266_0424"
                     /note="IHF - DNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238332"
     gene            complement(469269..469634)
                     /locus_tag="Cpha266_0425"
                     /db_xref="GeneID:4570979"
     CDS             complement(469269..469634)
                     /locus_tag="Cpha266_0425"
                     /note="KEGG: cte:CT0296 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910907.1"
                     /db_xref="GI:119356263"
                     /db_xref="GeneID:4570979"
                     /translation="MQFMIMFITGIAGGILAGMFGVGGGIIIVPVLVLLVGMTQHSAS
                     ATSLVALLLPVGILGVMEYYRSGRITTEHLWFGLIIALGLFIGAYFGAKIAISLSSDT
                     LRKAFAVFTGIVAFRLWFK"
     gene            complement(469677..471635)
                     /locus_tag="Cpha266_0426"
                     /db_xref="GeneID:4570980"
     CDS             complement(469677..471635)
                     /locus_tag="Cpha266_0426"
                     /EC_number="3.6.4.6"
                     /note="KEGG: plt:Plut_1722 peptidase M41, FtsH;
                     TIGRFAM: ATP-dependent metalloprotease FtsH;
                     PFAM: peptidase M41; AAA ATPase, central domain protein;
                     peptidase M41, FtsH extracellular; ATPase associated with
                     various cellular activities, AAA_5;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="FtsH peptidase"
                     /protein_id="YP_910908.1"
                     /db_xref="GI:119356264"
                     /db_xref="InterPro:IPR000642"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005936"
                     /db_xref="InterPro:IPR011546"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="GeneID:4570980"
                     /translation="MPENKKERPVKKDSSNKFKPVRNDDQPQGWLPGKTGGGQGKFPV
                     VLVFMLLAFLMLFLFQRFFSSSDSPEVTYNSYRSLLVSDLVRDVTVKTFSDKSAIING
                     KLKSVTKLELTNSMTLESDRFSVRIPAFSVEQADLLAEKGIRVKVEDGTPAFTAFLML
                     FAPWIIFGLLYFFIFRRMSSQNGNAAKNIFSFGKSRAKMVSEFDVKTSFKDVAGVDEA
                     IEELQETVEFLTNPERFEKIGGKIPKGVLLLGPPGTGKTLLAKAIAGEAKVPFFSISG
                     ADFVEMFVGVGASRVRDLFEQAKKNAPCIVFIDEIDAVGRSRGAGVGGGHDEREQTLN
                     QLLVEMDGFTTSENVILIAATNRPDVLDSALLRPGRFDRQITIDKPDIRGREAILKIH
                     TRKTPLGSDVDLTVLAKSSPGFSGADLANLVNEAALLASREGKEEITALDFEHARDKV
                     LMGPERRSMYISDEQKKMTAYHEAGHVLVASYTKGSDPIHKVTIIPRGRSLGLTAYLP
                     LEDRYTHNREYLLAMITYALGGRVAEELVFNEISTGAANDIEKASDIARRMVRQWGMS
                     EKLGPINYGDSQKEVFLGKDYSHIREYSEETALQIDVEVRNIIMSCMDNAKKILIEKK
                     SILQKLAETLIEKESLDAGEIRKIIGND"
     misc_feature    complement(469686..471176)
                     /locus_tag="Cpha266_0426"
                     /note="ATP-dependent metalloprotease FtsH; Region:
                     FtsH_fam; TIGR01241"
                     /db_xref="CDD:233327"
     misc_feature    complement(470499..>470858)
                     /locus_tag="Cpha266_0426"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(470706..470723)
                     /locus_tag="Cpha266_0426"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(470526..470528)
                     /locus_tag="Cpha266_0426"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(469692..470321)
                     /locus_tag="Cpha266_0426"
                     /note="Peptidase family M41; Region: Peptidase_M41;
                     pfam01434"
                     /db_xref="CDD:216502"
     gene            471873..473381
                     /gene="gltX"
                     /locus_tag="Cpha266_0427"
                     /db_xref="GeneID:4570981"
     CDS             471873..473381
                     /gene="gltX"
                     /locus_tag="Cpha266_0427"
                     /EC_number="6.1.1.17"
                     /note="Charges one glutamine molecule and pairs it to its
                     corresponding RNA trinucleotide during protein
                     translation"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl-tRNA synthetase"
                     /protein_id="YP_910909.1"
                     /db_xref="GI:119356265"
                     /db_xref="InterPro:IPR000924"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR004527"
                     /db_xref="GeneID:4570981"
                     /translation="MVAQRYRTRFAPSPTGYLHVGGLRTALYNYLFVKKMKGDFVLRI
                     EDTDRSRRVEGAQQNLLKTLEWAGIVPDESPELGGDFGPYIQSERLEIYKKYCDELLE
                     GKYAYYCFATSEELEENRQLQLKQGLQPKYNRKWLPEEMGGSMPSSEIRKKMEQNAPY
                     VIRMKVPDYVSVWFEDLIRGPVEFDSSTIDDQVLMKSDGFPTYHFASVIDDHLMEFTH
                     IIRGEEWLPSMPKHLLLYEFFGWEPPKFAHLPLLLNPDRSKLSKRQGDVAVEDYIRKG
                     YSAEAIVNFVAMLGWNEGEGTEQEVYSLEQLVERFSLERVGKAGAIFNVDKLNWLEKQ
                     YIKSRSADRIIAVIKPLLMAELEKRPTAMHESVITSDLYLEQVIELMRERVGFEHEFV
                     TFSPYFFFDPETYEEEGVRKRWTAETNTLLREFVTVLASLDAFTAEAIETELKAFVAP
                     KGLKAAALIHPLRILCSGVSFGPSLYHMLEVLGKDAVIRRISRGIETVVCLS"
     misc_feature    471891..473357
                     /gene="gltX"
                     /locus_tag="Cpha266_0427"
                     /note="glutamyl-tRNA synthetase; Reviewed; Region: gltX;
                     PRK01406"
                     /db_xref="CDD:234953"
     misc_feature    471891..>472178
                     /gene="gltX"
                     /locus_tag="Cpha266_0427"
                     /note="catalytic core domain of discriminating
                     glutamyl-tRNA synthetase; Region: GluRS_core; cd00808"
                     /db_xref="CDD:173905"
     misc_feature    471927..471938
                     /gene="gltX"
                     /locus_tag="Cpha266_0427"
                     /note="HIGH motif; other site"
                     /db_xref="CDD:173905"
     misc_feature    <472443..472886
                     /gene="gltX"
                     /locus_tag="Cpha266_0427"
                     /note="catalytic core domain of discriminating
                     glutamyl-tRNA synthetase; Region: GluRS_core; cd00808"
                     /db_xref="CDD:173905"
     misc_feature    order(472479..472481,472491..472493,472533..472538,
                     472542..472547,472620..472625,472647..472652)
                     /gene="gltX"
                     /locus_tag="Cpha266_0427"
                     /note="active site"
                     /db_xref="CDD:173905"
     misc_feature    472647..472661
                     /gene="gltX"
                     /locus_tag="Cpha266_0427"
                     /note="KMSKS motif; other site"
                     /db_xref="CDD:173905"
     gene            473467..473542
                     /locus_tag="Cpha266_R0011"
                     /note="tRNA-Phe1"
                     /db_xref="GeneID:4570982"
     tRNA            473467..473542
                     /locus_tag="Cpha266_R0011"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:4570982"
     gene            473682..474812
                     /locus_tag="Cpha266_0428"
                     /db_xref="GeneID:4570983"
     CDS             473682..474812
                     /locus_tag="Cpha266_0428"
                     /EC_number="4.2.1.-"
                     /note="PFAM: hydroxyneurosporene synthase;
                     KEGG: plt:Plut_1720 hydroxyneurosporene synthase CrtC"
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxyneurosporene synthase"
                     /protein_id="YP_910910.1"
                     /db_xref="GI:119356266"
                     /db_xref="InterPro:IPR010791"
                     /db_xref="GeneID:4570983"
                     /translation="MNITTERSQELWHDLQEPGAYEWWYFDAEDKKNGLSIVLIWFGG
                     FPFSPYYMQHYEEWKKGKTAGPPFPSNYSGFSFQLYENGKETVNFIREGSNGLFESNR
                     EEIGVRFEQNRFTYDQEQDEYRISVDFSFPARTRKISATLVFKPLRRVIYSKKDGNNS
                     GHVPRHQWLLSVPRAAVEGSIDITEGRSDISRRIHVEADGYHDHNLGTMPMQEYIKKW
                     YWGRAFSEEFDLIYYVIFFKNDHYQPVSLLMLHDNRSNQMRIMEDVAFSEHNFSRGVF
                     SPLHGRVLELRHGNVLLSIHQHKVLDAGPFYLRFASTISLRADGEHLNGISGISEFLN
                     PSCLRSKVMRFFIKSRIWRDGVPSIMYNQYNYIKNHFDWFRK"
     misc_feature    473742..474686
                     /locus_tag="Cpha266_0428"
                     /note="Hydroxyneurosporene synthase (CrtC); Region: CrtC;
                     pfam07143"
                     /db_xref="CDD:219307"
     gene            474993..475541
                     /locus_tag="Cpha266_0429"
                     /db_xref="GeneID:4569218"
     CDS             474993..475541
                     /locus_tag="Cpha266_0429"
                     /EC_number="1.10.99.1"
                     /note="PFAM: Rieske [2Fe-2S] domain protein;
                     KEGG: plt:Plut_1719 plastoquinol--plastocyanin reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="plastoquinol--plastocyanin reductase"
                     /protein_id="YP_910911.1"
                     /db_xref="GI:119356267"
                     /db_xref="InterPro:IPR005805"
                     /db_xref="InterPro:IPR005806"
                     /db_xref="GeneID:4569218"
                     /translation="MAQQGNFKSPSRMGGLGEGAPLSSSGAVQAGKPREQGLKGVDFE
                     RRSFLGKVVGGVGAVVAVSTLYPIVKYIVPPPVKEAAIVSELIVGKASEVPENSGKIY
                     QFNKDKVLVVNDNGKLTACSAVCTHLGCLVHWEDKDNLIFCPCHGAKYKQTGEIISGP
                     QPLPLAPFNVRVEGENLIISKA"
     misc_feature    475254..475529
                     /locus_tag="Cpha266_0429"
                     /note="Rieske domain; a [2Fe-2S] cluster binding domain
                     commonly found in Rieske non-heme iron oxygenase (RO)
                     systems such as naphthalene and biphenyl dioxygenases, as
                     well as in plant/cyanobacterial chloroplast b6f and
                     mitochondrial cytochrome bc(1) complexes; Region: Rieske;
                     cd03467"
                     /db_xref="CDD:239550"
     misc_feature    order(475365..475367,475371..475376,475419..475421,
                     475425..475430,475434..475436,475440..475442)
                     /locus_tag="Cpha266_0429"
                     /note="iron-sulfur cluster [ion binding]; other site"
                     /db_xref="CDD:239550"
     misc_feature    order(475365..475367,475371..475376,475419..475421,
                     475428..475430,475434..475436)
                     /locus_tag="Cpha266_0429"
                     /note="[2Fe-2S] cluster binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239550"
     gene            475569..476864
                     /locus_tag="Cpha266_0430"
                     /db_xref="GeneID:4569219"
     CDS             475569..476864
                     /locus_tag="Cpha266_0430"
                     /note="PFAM: Cytochrome b/b6, N-terminal domain;
                     KEGG: plt:Plut_1718 cytochrome b-c complex, cytochrome b
                     subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome b/b6 domain-containing protein"
                     /protein_id="YP_910912.1"
                     /db_xref="GI:119356268"
                     /db_xref="InterPro:IPR005797"
                     /db_xref="InterPro:IPR005798"
                     /db_xref="GeneID:4569219"
                     /translation="MAENNQNAATGNTPVKPKPAAPGAAKPAAPGAAKPAAPAAAKPA
                     APVAAKAQPSTSTGGGVYKPPVDRPDPNPYKDSRLSPLGSWFQERFYVMMPVIDYLKK
                     KEVPQHRLSFWYYFGGLTLFFFIIQIVTGLLLLQYYKPTAAEAFASFVFIQQEVPFGW
                     LIRQVHAWSANLMVMMAFIHMFSTFFMKSYRKPRELMWVSGFVLLVLSLGFGFTGYLL
                     PWNELAFFATQVGTEVPKVAPGGAFLVGILRGGEEVGPETLTRMFSLHVVLLPGLLML
                     VLSAHLLLVQVLGTSAPIGYKESGMIKGYEKFFPTFLAKDAIGWIIGFGLLVYLAVVF
                     PWEIGVKAEALTAAPVGIKPEWYFWAQFQLLKDLTFEGGELVAIALLTVGAIVWILVP
                     FIDRQASSEQKSPLFTIFGLLVLAFLLINTYRVYAEYGW"
     misc_feature    475803..476360
                     /locus_tag="Cpha266_0430"
                     /note="Cytochrome b (N-terminus)/b6/petB:  Cytochrome b is
                     a subunit of cytochrome bc1, an 11-subunit mitochondrial
                     respiratory enzyme. Cytochrome b spans the mitochondrial
                     membrane with 8 transmembrane helices (A-H) in eukaryotes.
                     In plants and cyanobacteria; Region: Cytochrome_b_N;
                     cl00859"
                     /db_xref="CDD:242146"
     misc_feature    475812..476837
                     /locus_tag="Cpha266_0430"
                     /note="Cytochrome b subunit of the bc complex [Energy
                     production and conversion]; Region: QcrB; COG1290"
                     /db_xref="CDD:224209"
     misc_feature    order(475875..475877,475887..475892,475908..475913,
                     475920..475925,475932..475934,476004..476006,
                     476049..476051,476058..476063,476070..476075,
                     476079..476084,476088..476093,476100..476102,
                     476121..476138,476148..476153,476160..476165,
                     476172..476174,476181..476186,476214..476216,
                     476226..476246,476256..476261,476283..476285)
                     /locus_tag="Cpha266_0430"
                     /note="intrachain domain interface; other site"
                     /db_xref="CDD:238176"
     misc_feature    order(475875..475880,475884..475886,475953..475955,
                     475965..475967,475974..475979,476004..476009,
                     476016..476021,476028..476042,476046..476054,
                     476061..476063,476145..476147)
                     /locus_tag="Cpha266_0430"
                     /note="interchain domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238176"
     misc_feature    order(475908..475910,475917..475922,475926..475931,
                     476085..476087,476097..476099,476106..476111,
                     476115..476117,476157..476162,476169..476174,
                     476178..476183)
                     /locus_tag="Cpha266_0430"
                     /note="heme bH binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238176"
     misc_feature    order(475938..475940,475947..475952,475959..475964,
                     475968..475973,475980..475982,476013..476015,
                     476055..476057,476064..476069,476076..476078,
                     476199..476204,476211..476216,476220..476225)
                     /locus_tag="Cpha266_0430"
                     /note="heme bL binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238176"
     misc_feature    order(476184..476186,476193..476198,476205..476210,
                     476247..476249,476256..476261,476271..476273,
                     476352..476354)
                     /locus_tag="Cpha266_0430"
                     /note="Qo binding site; other site"
                     /db_xref="CDD:238176"
     misc_feature    476490..476837
                     /locus_tag="Cpha266_0430"
                     /note="Cytochrome b(C-terminus)/b6/petD:  Cytochrome b is
                     a subunit of cytochrome bc1, an 11-subunit mitochondrial
                     respiratory enzyme. Cytochrome b spans the mitochondrial
                     membrane with 8 transmembrane helices (A-H) in eukaryotes.
                     In plants and cyanobacteria; Region: cytochrome_b_C;
                     cl00193"
                     /db_xref="CDD:241673"
     misc_feature    order(476490..476492,476502..476504,476511..476516,
                     476523..476528,476532..476537,476541..476549,
                     476556..476558,476571..476573,476577..476582,
                     476586..476600,476607..476615,476622..476624,
                     476628..476639,476682..476684,476712..476714,
                     476721..476723,476733..476735,476739..476747,
                     476751..476753)
                     /locus_tag="Cpha266_0430"
                     /note="intrachain domain interface; other site"
                     /db_xref="CDD:238179"
     misc_feature    order(476490..476492,476514..476516)
                     /locus_tag="Cpha266_0430"
                     /note="Qi binding site; other site"
                     /db_xref="CDD:238179"
     misc_feature    order(476496..476504,476508..476513,476520..476522,
                     476535..476540,476547..476552,476556..476558,
                     476574..476576,476583..476588,476760..476765,
                     476775..476780)
                     /locus_tag="Cpha266_0430"
                     /note="interchain domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238179"
     misc_feature    order(476622..476624,476628..476633,476640..476642,
                     476649..476654,476700..476702)
                     /locus_tag="Cpha266_0430"
                     /note="Qo binding site; other site"
                     /db_xref="CDD:238179"
     gene            complement(477245..480748)
                     /locus_tag="Cpha266_0431"
                     /db_xref="GeneID:4569220"
     CDS             complement(477245..480748)
                     /locus_tag="Cpha266_0431"
                     /note="PFAM: alpha amylase, catalytic region;
                     SMART: alpha amylase, catalytic sub domain;
                     KEGG: plt:Plut_1717 alpha amylase, catalytic subdomain"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha amylase"
                     /protein_id="YP_910913.1"
                     /db_xref="GI:119356269"
                     /db_xref="InterPro:IPR006047"
                     /db_xref="InterPro:IPR006589"
                     /db_xref="GeneID:4569220"
                     /translation="MTSNNYQPAPPGKEHFYLNRQARELFKQRDPEFLVLFDRSGDSL
                     AHAREQTAIINSFLKKKKGDQAKLILPAQFHGMKLLHEVFHALIAQSVASRKPDFFKT
                     VDDNFHRELSQNRANEYEKRFLDDFPPDALFRGVQSTEEYLSIPEKREQLIEESFLVW
                     LNNQNPALGQFEDLITDRNLVKDDAYLQLIRSLKGSIHDMGAVGPGDIDLLELLWLPI
                     RHSPDSILEQLRYIRLHWADLLEDSPFWSLLADAIILIQDEDRYIFVEQLSKHQDSRH
                     PDFWMEKETHVPDYGDPGEAGAHYSADSSWMPEVVMLAKSTYVWLDQLSKIYHRHIAR
                     LQDIPDRELDLLSERGFTALWLIGLWQRSEASETIKRIQGNPEAKASAYALEQYNISR
                     DIGGYEGYLDLRNRAMQRGIRLASDMVPNHTGIDSELVRNNPDWFLSASSAPYVNYSY
                     NGPNLSSDARYGIFLEDGYWNRSDAAVTFKRVDYLNGDTRYIYHGNDGTTMPWNDTAQ
                     LDFLSAEVREGVIQQILHVARMFPIIRFDAAMVLAKRHIQRLWYPLHGQTAGVPSRSS
                     FSMSMEEFNAAIPEEFWREVVDRIQAEVPGTLLLAEAFWMLEGYFVRTLGMHRVYNSA
                     FMHMLKKEDNASYRYLIKNTLEFDAEILKRYVNFMNNPDEDTAIAQFGRGDKYFGVCM
                     MMITMPGLPMLGHGQVEGFTEKYGMEYAKAYYDEQPDQHLVDRHYREIFPVMKKRPLF
                     AEVENFFLYDVYSPEGSVNENIFAYSNRLGEEKALVIFNNCAVQAAGWVSTSVGYRKG
                     DEIRQTSLADGLFLSREDNLYVIFRDQCSGMEFIRSNRIIAEQGLFVALEGYRYNLFL
                     DFREVKPSRLTPYDRLCAELNGNGTASIEHDVLFMSLEPLHRLLSEFLAPDNLAPLHG
                     TTENELIFPVFKTMIATLLQEVAVKYGNLLEKPVDVPATLADETVSRFRHACQMVEEM
                     ANLPESDRFNAALGTTEREKSGFSTILLHWLALDSLQEMLRANELLSSNLIDDWLMSN
                     TLQQLYSQKGLNGIPGDNIPDLLYCLLSEKPATLPADEESALYALLALLDASHSEHVA
                     RILQFENRHEKTWFREHRFSVLAAWLSVEAMLKKENLPVEQESGKTEHPVAGWVAAAR
                     KLDMQAFLSGYEMGALLRQKA"
     misc_feature    complement(478529..479803)
                     /locus_tag="Cpha266_0431"
                     /note="Alpha amylase catalytic domain family; Region:
                     AmyAc_family; cl07893"
                     /db_xref="CDD:244824"
     misc_feature    complement(order(478760..478765,478943..478945,
                     479138..479140,479144..479146,479483..479485))
                     /locus_tag="Cpha266_0431"
                     /note="active site"
                     /db_xref="CDD:200451"
     misc_feature    complement(order(478760..478762,478943..478945,
                     479138..479140))
                     /locus_tag="Cpha266_0431"
                     /note="catalytic site [active]"
                     /db_xref="CDD:200451"
     gene            complement(480951..481340)
                     /locus_tag="Cpha266_0432"
                     /db_xref="GeneID:4569221"
     CDS             complement(480951..481340)
                     /locus_tag="Cpha266_0432"
                     /note="KEGG: cch:Cag_0262 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910914.1"
                     /db_xref="GI:119356270"
                     /db_xref="GeneID:4569221"
                     /translation="MITNNEPLNSIEARIEELHNTIAEKEEQIKTRTRQLKDDIQTEL
                     DPATVVRRHPFEIAGSIFVTGILIGRSVKSMVGSSRKHQSNTASASDSVPAKAPTQLS
                     VLGIDILRSVKDLGFTYLTHYLDKKIK"
     gene            complement(481324..481722)
                     /locus_tag="Cpha266_0433"
                     /db_xref="GeneID:4569222"
     CDS             complement(481324..481722)
                     /locus_tag="Cpha266_0433"
                     /note="KEGG: plt:Plut_1715 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_910915.1"
                     /db_xref="GI:119356271"
                     /db_xref="GeneID:4569222"
                     /translation="MGSSPVQKSGTAAPKRTHSGIPKMLDDTVTSTYEDVVSIVDAKI
                     ELLKLDLTKKISIVVAIVILALMLLLATAYLITTVALLLGELTGHLFIGYLLVSLIFL
                     GCFVFFAKFRPDLLQNLIQKTLLSAHDYKQ"
     gene