GenomeNet

Database: RefSeq
Entry: NC_008639
LinkDB: NC_008639
Original site: NC_008639 
LOCUS       NC_008639            3133902 bp    DNA     circular CON 07-FEB-2015
DEFINITION  Chlorobium phaeobacteroides DSM 266, complete genome.
ACCESSION   NC_008639 NZ_AAIB01000000-NZ_AAIB01000077
VERSION     NC_008639.1  GI:119355857
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02598273
            Assembly: GCF_000015125.1
KEYWORDS    RefSeq.
SOURCE      Chlorobium phaeobacteroides DSM 266
  ORGANISM  Chlorobium phaeobacteroides DSM 266
            Bacteria; Chlorobi; Chlorobia; Chlorobiales; Chlorobiaceae;
            Chlorobium/Pelodictyon group; Chlorobium.
REFERENCE   1  (bases 1 to 3133902)
  AUTHORS   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina
            del Rio,T., Hammon,N., Israni,S., Pitluck,S., Goltsman,E.,
            Schmutz,J., Larimer,F., Land,M., Hauser,L., Mikhailova,N., Li,T.,
            Overmann,J., Bryant,D.A. and Richardson,P.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Complete sequence of Chlorobium phaeobacteroides DSM 266
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 3133902)
  AUTHORS   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina
            del Rio,T., Hammon,N., Israni,S., Pitluck,S., Goltsman,E.,
            Schmutz,J., Larimer,F., Land,M., Hauser,L., Mikhailova,N., Li,T.,
            Overmann,J., Bryant,D.A. and Richardson,P.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (05-DEC-2006) US DOE Joint Genome Institute, 2800
            Mitchell Drive B100, Walnut Creek, CA 94598-1698, USA
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review.
            URL -- http://www.jgi.doe.gov
            JGI Project ID: 3634474
            Source DNA and bacteria available from Donald A. Bryant
            (dab14@psu.edu)
            Bacteria available from DSMZ: DSM 266
            Contacts: Donald A. Bryant (dab14@psu.edu)
                      Paul Richardson (microbes@cuba.jgi-psf.org)
            Quality assurance done by JGI-Stanford
            Annotation done by JGI-ORNL and JGI-PGF
            Finishing done by JGI-PGF
            Finished microbial genomes have been curated to close all gaps with
            greater than 98% coverage of at least two independent clones. Each
            base pair has a minimum q (quality) value of 30 and the total error
            rate is less than one per 50000.
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. It is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider          :: NCBI
            Annotation Date              :: 12/05/2014 14:54:03
            Annotation Pipeline          :: NCBI Prokaryotic Genome Annotation
                                            Pipeline
            Annotation Method            :: Best-placed reference protein set;
                                            GeneMarkS+
            Annotation Software revision :: 2.9 (rev. 452448)
            Features Annotated           :: Gene; CDS; rRNA; tRNA; ncRNA;
                                            repeat_region
            Genes                        :: 2,848
            CDS                          :: 2,740
            Pseudo Genes                 :: 51
            CRISPR Arrays                :: 5
            rRNAs                        :: 6 ( 5S, 16S, 23S )
            tRNAs                        :: 47
            ncRNA                        :: 4
            Frameshifted Genes           :: 36
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..3133902
                     /organism="Chlorobium phaeobacteroides DSM 266"
                     /mol_type="genomic DNA"
                     /strain="DSM 266"
                     /db_xref="taxon:290317"
     gene            1..1473
                     /locus_tag="CPHA266_RS00005"
                     /old_locus_tag="Cpha266_0001"
     CDS             1..1473
                     /locus_tag="CPHA266_RS00005"
                     /old_locus_tag="Cpha266_0001"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743921.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="WP_011743921.1"
                     /db_xref="GI:500064004"
                     /translation="MSEATNRVPEVKIPSNLHKPILLEQQVWDSCLEAIREKINPLAY
                     KTWFSPIKPVNFSGSELTIQVPSQFFYEWIEENYSSFLKQALKDVIGSEAKLMYSIVM
                     DKSQGQPVTIELPHQSTPLSACSSDSSESTQIKNKEAFEKNLQRFETHLNPKYVFETL
                     IRGDCNSLAFAASKSVAQNPGLNAFNPLVIYGGVGLGKTHMMQAIGNSVRKNCLSEKV
                     LYVSSEKFAVDFVNAIQNGKIQEFSSFYRNIDVLIIDDIQFFAGKEKTQEEIFHIFNT
                     LHQTNKQIILSSDRPIKDIKGIEDRLISRFNWGLSADIQPPDYETRKAIILSKLEQSG
                     VNLDESVIEFIATNVTENVRELEGCIVKLLAAQSLDNREIDLHFTKSTLKDIIRHTTK
                     QLTLDTIEKAVCSFFAITPNDLKGKSKKKEIATGRQIAMYLAKNLTESSLKTIGLHFG
                     GRDHSTVIHAVNTVGNRMEQQSDERKKIEELKKRIEILSM"
     gene            1901..3025
                     /locus_tag="CPHA266_RS00010"
                     /old_locus_tag="Cpha266_0002"
     CDS             1901..3025
                     /locus_tag="CPHA266_RS00010"
                     /old_locus_tag="Cpha266_0002"
                     /EC_number="2.7.7.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743922.1"
                     /note="binds the polymerase to DNA and acts as a sliding
                     clamp; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="WP_041467432.1"
                     /db_xref="GI:752831130"
                     /translation="MKFTAPIRLLQDAVNRVSQAIPSKAIDPRFENIHLAIEPGKLTL
                     FASDGEMSITAKSEISSEDTGNISIKARTLQDFLRSMYDTEVTFSIERQEISDHGTVS
                     ISTDKGKYKIPCFFESKMEIYEKNYVINLDLPSVELQYLIQKTIFACSVDGMRPAMMG
                     VLFELESSSITAVSTDGHRLVRCRKSTVIEVEDKQKIVVSARVLSILQKLPLHETVII
                     QIDQDKRFVRFTQNNVVIDASLIVEPYPNYEAVIPVIHDKQVSCDRSNIYDSVKRVGR
                     FSSVGDIKMVLADSIIKVMAENTNEGESAQEELPCSYTGEDITIGFNAKFIEAALAHI
                     DEKEIIIELKSPTTAVIFKPVQEKETGSLIILVMPVRINA"
     gene            3303..4400
                     /locus_tag="CPHA266_RS00015"
                     /old_locus_tag="Cpha266_0003"
     CDS             3303..4400
                     /locus_tag="CPHA266_RS00015"
                     /old_locus_tag="Cpha266_0003"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743923.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RecF"
                     /protein_id="WP_011743923.1"
                     /db_xref="GI:500064006"
                     /translation="MRLTRITYNNFRNYRKMTFEPNAGITLLYGSNGSGKTNILEGIH
                     YCALTKGFTSIADSDCIFDSSDYYALQSTCLGENGSDIEVRISFSREKGKTLFVNNNE
                     IKKFSNHVGTIPCITFSPPEISIVSGSPSERRKFIDNIICQSDKKYLKDLLTYRRVLL
                     QRNALLAQISEKKSSINMLPYWSENLSVLAASIVFKRLEFLDKFIDNFRDLFKKLSIN
                     EEPGIVYRSVLGRYDNIRNIDELAALYYRKYDDNLRYELLRSQTSCGPHRDDLEFYIN
                     DKEIKKYASQGQLRTFLIGLKLAVYDYLFDTTHEKPICLLDDIFSELDTQRTENILSI
                     LQTLGQSIITSTVRRDSDIISSVSVHDLIND"
     gene            4411..4704
                     /locus_tag="CPHA266_RS00020"
                     /old_locus_tag="Cpha266_0004"
     CDS             4411..4704
                     /locus_tag="CPHA266_RS00020"
                     /old_locus_tag="Cpha266_0004"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743924.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011743924.1"
                     /db_xref="GI:500064007"
                     /translation="MSRTKSPRILSSVVQDVCRTLGMNKAIDDFRTVQIWKEVVGTTI
                     AEITLVERYTDGKLFVRVKSAPWRMELNYRKTEIKNKLNVAIGKEIIEEIIFR"
     gene            5093..6328
                     /locus_tag="CPHA266_RS00025"
                     /old_locus_tag="Cpha266_0006"
     CDS             5093..6328
                     /locus_tag="CPHA266_RS00025"
                     /old_locus_tag="Cpha266_0006"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011745769.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_011743925.1"
                     /db_xref="GI:500064008"
                     /translation="MPPLPSLTSHYHQLLGLPPNWNVENVTLSITGKQIEIRLVYTDK
                     QAECPECGQLCKIYDHTSEQQWRHLDTMQFETIIVARLPRCKCKEHGVKTVRVPWAAR
                     HSRFTLMFESFAIELLMHCSSIKAASSMLNLNWHAVDEIMRRAVKRGLNRRESEAIAY
                     LGIDEKSFKAGQHYVTTLNDLDKGRVLEVVEHRTNEAAKALLESLNKKQQEQVKAVSA
                     DMWKPYANAVEELLPNADLVHDRFHISKYLSEAVDAVRRKESRELDQAGDKRLVGSKY
                     VWLRNPENMREQQKVELSNLMACEFKTSQAWALKNMFRYFWQLGDTDGASFFFEYWSR
                     RVDEVGLTPLIDVKELLQRHFDHILTYFKHAITNAVSEGLNSKIQIVKASARGFHRFE
                     SYRNRILFYCGKLNMAISS"
     gene            complement(<6377..6691)
                     /locus_tag="CPHA266_RS00030"
     CDS             complement(<6377..6691)
                     /locus_tag="CPHA266_RS00030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011745203.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_041467433.1"
                     /db_xref="GI:752831131"
                     /translation="MAYSCFPITISPQDGVIDWMLGGKMDTVSMGAFLRQVSHKHPEE
                     FVMMVVDGAPSHRAEHLRVPKNMVLVKLPPYSPELNPVEHLWDELREKEFANRVFETL
                     GAV"
     gene            6781..8352
                     /locus_tag="CPHA266_RS00035"
                     /old_locus_tag="Cpha266_0008"
     CDS             6781..8352
                     /locus_tag="CPHA266_RS00035"
                     /old_locus_tag="Cpha266_0008"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011745977.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_011743927.1"
                     /db_xref="GI:500064010"
                     /translation="MRTQLKKLTMYNKVKEFAREGLSIRQISRKTGMDRVTVRKFLRM
                     TDEEFSAFLALQKRRLRKLQPYEQFVKDRVTDYPDCSATQVEDWLKEHHPVFPEVTTR
                     TIYSFVQWIRKAYDLPKPKGTPRAYHPVEQLPYGEQAQVDFGEYWMASADACKVKVHF
                     MIMLLSRSRRKFVSFSQQPITTRFVLEAHEQAFSFFEGIPHTLVYDQDSTIVTDENRG
                     AILYTEAFRKYLLHRSLKIHLCRKSDPESKGKIEAGVKYVKYNFLPGRRFVNLEVLNQ
                     EALLWLERTANAKEHATTRLIPDAEWQVEKQHLRPFEPLPYPISGTVGKEYHVRKDNT
                     ISYRGNFYSLPVGTYAGPGTLVVLEVRQNTLCLYAQEGRLLANHPIESGKGTVVINNN
                     HRRDTSSKLRELQDSLMLLFTNQEHAERFLESIHNRYPRYSRDQFLHVRNAISGCQQK
                     LIDDALAHCVDHHLFSSGEFHDILHHYRKQEEKQSHQAVFNTFRPKTLRSDMDRMLSF
                     VPDSSGITTYENIFS"
     gene            8358..9194
                     /locus_tag="CPHA266_RS00040"
                     /old_locus_tag="Cpha266_0009"
     CDS             8358..9194
                     /locus_tag="CPHA266_RS00040"
                     /old_locus_tag="Cpha266_0009"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743928.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_011743928.1"
                     /db_xref="GI:500064011"
                     /translation="MERTITTIQEHARELNLTGLAGTVDLLLEEARKSEPSYSDFALT
                     LLESELSCRRKAHLERRRKIANLPLLHDLDHYDSGVQNGISQVQLQQLRQLLWLDQNF
                     NLILIGPSGTGKSYLAGGLCHEALKLGYHALFRTMDDLIQTIRFKEITAAAAREYKRL
                     LSAHLLVIDDIMMFPLEKSVAVGLFQLVNQLHEQTSFIITTNKSPKEWAEMLGDEVLA
                     TALLDRLLYKCEVIKLTGKSYRLEHRTTIFEQQQSPEGGGNRRKKQLPLQKGVGNHCK
                     MT"
     gene            complement(9405..9935)
                     /locus_tag="CPHA266_RS00045"
                     /old_locus_tag="Cpha266_0011"
     CDS             complement(9405..9935)
                     /locus_tag="CPHA266_RS00045"
                     /old_locus_tag="Cpha266_0011"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012507847.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011743929.1"
                     /db_xref="GI:500064012"
                     /translation="MARPAVITDEMECLAKKIVKEANTARELRAGLSILIPKTCDITY
                     SETAELLGISVPTVVRIHRDISNQAAGKATPKGSWGGRRRQTLSLDEEARFLAEWVEK
                     AEQGGVLVVPPIHTALEQRLGKTVAVSTVYRMLARHGWRKVEPDTCHPKQNMEEQEEF
                     KKNSQRYWYKPPSKMY"
     gene            complement(10369..11016)
                     /locus_tag="CPHA266_RS00050"
                     /old_locus_tag="Cpha266_0013"
     CDS             complement(10369..11016)
                     /locus_tag="CPHA266_RS00050"
                     /old_locus_tag="Cpha266_0013"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011746100.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_041467434.1"
                     /db_xref="GI:752831132"
                     /translation="MDTKATVHVGQYSRGGKSRGIKAVEAWDHDMRPKEKLVPGGILE
                     PVSGKSFLFFGSSNKTSDFLVDGLELWWNERKSELYNVKQLVINMDNGPECNGRRSQF
                     LYRMTMFADMTGLNIRLIYYPPYHSKYNSIERYWAGLEKSWNGYLLESVTTVINRAGN
                     FAWRGIAAKARLVDTVYQKGVKLCGKDKKNLEKRLMRSPSLHWWDISISPKTVFL"
     gene            complement(11058..11600)
                     /locus_tag="CPHA266_RS00055"
                     /old_locus_tag="Cpha266_0014"
     CDS             complement(11058..11600)
                     /locus_tag="CPHA266_RS00055"
                     /old_locus_tag="Cpha266_0014"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011745579.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_011743931.1"
                     /db_xref="GI:500064014"
                     /translation="MKTSVLSRNNISPEVSGLITRLVSLIPWPARRQAMGDVVVTILD
                     SKPRVAENEFGWNRSAVALGIKEFESGIVCVNDLTERHKPKSEEKHPELLEAIRKIME
                     PQSQAEPRLRTTLLYTNMTAQSVYNALLAEGWSEESLPAVRTISNILNRQNYRLRTVQ
                     KTKVEKKQQKPTPSSKTSGK"
     gene            <11686..>12456
                     /locus_tag="CPHA266_RS00060"
                     /old_locus_tag="Cpha266_0015"
     CDS             <11686..>12456
                     /locus_tag="CPHA266_RS00060"
                     /old_locus_tag="Cpha266_0015"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013031336.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467435.1"
                     /db_xref="GI:752831133"
                     /translation="KNTLFSMDATVIDLCLRVFPWAEFRQRKGAIKLHYLYDHRSSLP
                     AFMVMTDGKKSDIRVARSQEKLDFHLLPDSIVSFDRAYIDFEWLYTLDQRKVWFVTRS
                     KANIQYRIIGQHQPIKNKQVTRDERIELIIEKSRAKYLKPLRLVCYTDQETGKAYEFI
                     TNNIKLAASTIAAIYKSRWQIETFFRWIKQNLKIKSFQGTSQNAVLSQTWIAMCYYLR
                     LSYIKFKTKYRHSLQELTRMIAAVLIEHRLLIDISSLRS"
     gene            12686..14092
                     /locus_tag="CPHA266_RS00065"
                     /old_locus_tag="Cpha266_0017"
     CDS             12686..14092
                     /locus_tag="CPHA266_RS00065"
                     /old_locus_tag="Cpha266_0017"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743933.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_011743933.1"
                     /db_xref="GI:500064016"
                     /translation="MQLPYTNIHTDQPNQQALFPDCFEVSVAPVKGKKVVLDFQGGNA
                     TSDAGVLLLKEVESMTRIVPKLADCIADSRRTSSVMHSIPDLIAQRVYQIACGYEDGN
                     DSNSMRKDPALKMALNRLPESGDDLASQPTFSRLENMVTRPELYRMAVGFLDHFLDSY
                     TEAPRVIVLDFDDTEDVVHGKQQLALFNGYHQETCYQPLHVFEGLTGKLIASILRPGR
                     RPTGKEIVSYVKRIVRHIRSRWPETIIVYRGDSHYGVPEVYSFLAREQNCYSVTGLGG
                     NDVLLRSVKDIIEEVKKHGAGYRRYHTFQYQARSWKETRRVVAKVEMTEKGLNVRFIS
                     TDMQEAKAKTLYEQIYSARGNDELYIKAHKTFMKSDRTSCHRFLANQFRVFLHSAAYV
                     LVHAFQTNLLRGTALATATFETIRLKLLKIGAKVIEMKTRIKVHLPTSYPYKPILNKC
                     FAVLEHLRSVPWPSTAIP"
     gene            complement(<14365..15489)
                     /locus_tag="CPHA266_RS00070"
                     /old_locus_tag="Cpha266_0018"
     CDS             complement(<14365..15489)
                     /locus_tag="CPHA266_RS00070"
                     /old_locus_tag="Cpha266_0018"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743934.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_041467436.1"
                     /db_xref="GI:752831134"
                     /translation="MDIHDDDIDLIRIRFEKIEWALDERMRRLFAANEAYALGHGGVT
                     KVSQATGVSRRAIHVGLDELVAAKPPVPEQEKRIRKVGGGRKSITKTESGVLIALEQL
                     VEPTTRGDPESPLRWTCKSLRTISEELARQGFKVSYPKVADLLRELGYSLQANRKTLE
                     GADHPDRNAQFELINTQTKETIAGGNPVISVDTKKKELVGAFKNNGTNWRPQGEPEEV
                     KVHDFIDKDLGRANPYGVYDIGSNTGWVSVGTDHDTASFAVETIRRWWYTMGKPRYAD
                     ATKIMITADGGGSNGSKVRLWKLELQKLADELRMSIHVSHLPPGTSKWNKIEHRLFSY
                     ISMNWRGQPLISHEVIVNLIAGTTTKAGLKVYSELDDTTYP"
     gene            15849..>16103
                     /locus_tag="CPHA266_RS00075"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            16159..17565
                     /locus_tag="CPHA266_RS00080"
                     /old_locus_tag="Cpha266_0019"
     CDS             16159..17565
                     /locus_tag="CPHA266_RS00080"
                     /old_locus_tag="Cpha266_0019"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743933.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_011743933.1"
                     /db_xref="GI:500064016"
                     /translation="MQLPYTNIHTDQPNQQALFPDCFEVSVAPVKGKKVVLDFQGGNA
                     TSDAGVLLLKEVESMTRIVPKLADCIADSRRTSSVMHSIPDLIAQRVYQIACGYEDGN
                     DSNSMRKDPALKMALNRLPESGDDLASQPTFSRLENMVTRPELYRMAVGFLDHFLDSY
                     TEAPRVIVLDFDDTEDVVHGKQQLALFNGYHQETCYQPLHVFEGLTGKLIASILRPGR
                     RPTGKEIVSYVKRIVRHIRSRWPETIIVYRGDSHYGVPEVYSFLAREQNCYSVTGLGG
                     NDVLLRSVKDIIEEVKKHGAGYRRYHTFQYQARSWKETRRVVAKVEMTEKGLNVRFIS
                     TDMQEAKAKTLYEQIYSARGNDELYIKAHKTFMKSDRTSCHRFLANQFRVFLHSAAYV
                     LVHAFQTNLLRGTALATATFETIRLKLLKIGAKVIEMKTRIKVHLPTSYPYKPILNKC
                     FAVLEHLRSVPWPSTAIP"
     gene            18030..18560
                     /locus_tag="CPHA266_RS00085"
                     /old_locus_tag="Cpha266_0021"
     CDS             18030..18560
                     /locus_tag="CPHA266_RS00085"
                     /old_locus_tag="Cpha266_0021"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743936.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011743936.1"
                     /db_xref="GI:500064019"
                     /translation="MKKIRTLLVLSMLLATGCQSTIPKDALVLNNESLATRQLQTRKY
                     QTKDEAKVLSSVAGVLQDLGFNLNESHSALGVISASKTRSAVNAGQQILAVTFALLGG
                     GVSATDDHQVMTASVVTKPVGEKSDYVAVRVTFQRLVYNTNGQVSKAESLQDSEIYQG
                     FFEKLSKSIFLEAQEI"
     gene            18557..18973
                     /locus_tag="CPHA266_RS00090"
     CDS             18557..18973
                     /locus_tag="CPHA266_RS00090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015751399.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467109.1"
                     /db_xref="GI:752830807"
                     /translation="MKNTYLIGTLLLLSLTGCATTKERLLDSDVSQVQIRSIQTRAFD
                     TTDKEKALRTVIATLQDLGFVIDKADVVLGTVSATKLNNYSLKMTVTTRQRGTTQLLI
                     RANAQYNVAPVTDPLPYQQFFIALEKAMFLTAHQVD"
     gene            complement(19639..19836)
                     /locus_tag="CPHA266_RS00095"
     CDS             complement(19639..19836)
                     /locus_tag="CPHA266_RS00095"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006322765.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467110.1"
                     /db_xref="GI:752830808"
                     /translation="MDRVTVRKFFRMTDDEFSAFLALQNRRLRKLQPYEQFVKNRVTD
                     YPDCSATQVEDWLKGAPDSCT"
     gene            complement(19873..20247)
                     /locus_tag="CPHA266_RS00100"
     CDS             complement(19873..20247)
                     /locus_tag="CPHA266_RS00100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008438390.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_041467437.1"
                     /db_xref="GI:752831135"
                     /translation="MVVTGANRHDVTQLKAVLENIVVKRPESEQNLCADKGYQGKPAL
                     LIILSEHYIPHVKQFNEEVQEKKDNPNYKPRRWVVEVSHSWFNRFRKILVRFEKLNER
                     YEALLFMAASIIALRKVGFIYE"
     gene            complement(20192..20719)
                     /locus_tag="CPHA266_RS00105"
     CDS             complement(20192..20719)
                     /locus_tag="CPHA266_RS00105"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744748.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_041467111.1"
                     /db_xref="GI:752830809"
                     /translation="MGEVMSKIKSWEVSDSFWSVVEPLIPPPERDPNKEYKRKSGGGR
                     KPIPSRKIFEGIMFVLRTGCQWQALPKERFGSPSAIYTHFARWQRKGFFLALWQKGLA
                     EYDDMEGIAWTWQSIDGAMTKAPLAQETVGRNPTDRGKKWDKAPYTGRRAWGPALDSR
                     NRSKPTRCHSTKSSA"
     gene            complement(20845..22209)
                     /locus_tag="CPHA266_RS00110"
                     /old_locus_tag="Cpha266_0024"
     CDS             complement(20845..22209)
                     /locus_tag="CPHA266_RS00110"
                     /old_locus_tag="Cpha266_0024"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743937.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_011743937.1"
                     /db_xref="GI:500064020"
                     /translation="MRKSKKAATMSLVHPNAAGIDIGSQFHDVAIPPDRAEETVKSFK
                     SFTGDLHAMAKWLTACRIDTIAMESTGVYWIPAFEILENYGFKVFLVNAREAKNVPGR
                     KTDSNDAQWLQKLHQLGLLRASFQPTSVIAELRAYLRQREKLLDYKAAHIQHMQKALM
                     QMNIQLHHVVSTITGKTGMDIIRAIVAGNRNPQELVKFRDVRCKNSIETMTAALTGNF
                     KPEHIFALMQSLELYDIYNEKAEACDREIQAVLDRLQQNSIPPDQPLPKAKYRECNKN
                     APAFDVRQTLFNIIGVDLTQITGLGSYLALKLVSECGADMSKWPTDKHFTSWLCLSPG
                     NKISGGKILSSRTRPSSSRAAALLRLAATAIGRTETALGAFYRRLATRTGKAKAVTAT
                     ARKIAVLFYNTLRYGMRYVDPGADYYEEQYKARILGQLRRRADSYGFSLQPMEIPDTA
                     IGVS"
     gene            complement(22688..22966)
                     /locus_tag="CPHA266_RS00115"
     CDS             complement(22688..22966)
                     /locus_tag="CPHA266_RS00115"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467112.1"
                     /db_xref="GI:752830810"
                     /translation="MRLFEYLFNSSLFIHPQQRSVPNGKSIAVQVFTASPSKAICTGL
                     RAAENRFQSCMRSLITIFLFWFTHPVPPKPLMNGMQISSPNCNVFLMS"
     gene            complement(23043..24266)
                     /locus_tag="CPHA266_RS00120"
                     /old_locus_tag="Cpha266_0026"
     CDS             complement(23043..24266)
                     /locus_tag="CPHA266_RS00120"
                     /old_locus_tag="Cpha266_0026"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743938.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase"
                     /protein_id="WP_011743938.1"
                     /db_xref="GI:500064021"
                     /translation="MIDNKILPVTQDVTWIGVLDPGLITFDIVMETKYGTTYNSYFIN
                     ADKKTIVETTKEKFWPIYLDKIKQVTNPEEIEYIIVDHTEPDHSGNVRNLLSVAPHAT
                     VVGSGNALKFLRDQTGHDFKSLVVKTGDTLDLGNKTLHFINAPNLHWPDTIYTWLEED
                     RVLFTCDSFGSHFCHEGMYDDAVGDFDDAFTYYYDAILRPFSKYMLQAIEKIAPLDIK
                     IICPGHGPILRSNWKKYVDLSHRLATKAIALPNEKNILIAYVSAYENTAVLAEKIAEG
                     LRESCDFTIEICDIENIHFSKLEDKLAHCYGLIVGSPTINQNILLQIYNLFAAINPIR
                     DKGKLAAAFGSYGWSGEGVKMIETNLSMLKLKVFDQNVMVKFKPHEAEFEKCRLFGKS
                     FADKMIEMFQLSCNL"
     gene            complement(24550..26940)
                     /locus_tag="CPHA266_RS00125"
                     /old_locus_tag="Cpha266_0027"
     CDS             complement(24550..26940)
                     /locus_tag="CPHA266_RS00125"
                     /old_locus_tag="Cpha266_0027"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743939.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase"
                     /protein_id="WP_011743939.1"
                     /db_xref="GI:500064022"
                     /translation="MDTLSHEILNNDLLFGKDKEENIVGAYQLSDTHIRLFFRNDEKI
                     SHRDEPFYPYFFLSESSLLEGFVPEENRKYWIIKLNGNNFYRFLAIFSSWKDFRSGLD
                     IINGKNRAASPEADTTNPAPSFIPLTYSKGDAVTQYFFQSGKTLFKGLDFSRLRRMQL
                     DIETCYDPDKKRTGSGIGDDEIIIVSLSDNTGWEQVIHSKNRGEKKLLEHLVEIIIAR
                     DPDVIEGHNIFSFDLPYIQKRCDRHNINFAIGRNGTTVRSYPSSIRFAERIIDYPYFE
                     IPGRHVIDTLFLVQGYDVSKRAMQSYGLKAVAKYFGFASPDRTYVEYKDIISTWENNP
                     DKLLAYALDDVRETRALASHLSGSNYYLSRMMPYTYAMTSRLGQAAKIEALFIREYLR
                     QKHSIPKPSSGQQHSGGYTEVFLKGILGPIVYADVESLYPSIMLTCGICPKTDDLRVF
                     PSVLGNLKDLRFKTKKLSGEEKQKGNLQMADNFDAMQGSFKILINAMYGYLGFNNGIF
                     NDFDEADKVTTTGQGIAKKMIHEFEARGCKVIEVDTDGILFVPPPGIVTENEERTLVR
                     EVSSLMPEGINIGYDGRYKKMISYMKKNYALLDDDNVMIVKGSSLTSRSSEKFGRDFV
                     KRGFEKLLSEDIAGLHDLYTEYKEKILAHALDIGDFSRTETLKSTMEQYLEDVRSGRR
                     SKSVTYEIALKNGKQVTKGERITYYISGTGGINQTFEKGKLASDWKKDNPDDNTVFYL
                     KRLDEHCQKFLPFFKPQDYSSIFSSDTLFSFTPEGIELIKEIIHTDTDTTGSAGLY"
     gene            complement(27338..29203)
                     /locus_tag="CPHA266_RS00130"
                     /old_locus_tag="Cpha266_0028"
     CDS             complement(27338..29203)
                     /locus_tag="CPHA266_RS00130"
                     /old_locus_tag="Cpha266_0028"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BCG1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA uridine 5-carboxymethylaminomethyl
                     modification protein"
                     /protein_id="WP_011743940.1"
                     /db_xref="GI:500064023"
                     /translation="MYDIIVAGAGHAGCEAVLAAARTGMSCLLITSDLSAIARMSCNP
                     AIGGVAKGQITREIDALGGEMAKAIDETGIQFRMLNKSKGAAMHSPRAQADRALYSVY
                     MRKIIEEQDNIDLVQDTVTGLDVESGAVRGAILPSGRIIKGKSVILCCGTFLNGLIHI
                     GMNHFPGGRTIAEPPVSGLTENLQSLGFRAGRLKTGTPPRIDSRSVNYSLVEEQSGDP
                     DPRPFSFHTDSLGHRAQVSCFVTKTKETTHELLRTGFSRSPLFSGKVQGVGPRYCPSV
                     EDKIFRFPDKNSHHIFLEPEGAETNEMYVNGFSTSLPEDIQLLALRSIPGLEHVKMIR
                     PGYAIEYDFFFPYQIKNTLETKIIENLYFAGQINGTSGYEEAAAQGLMAGINASLKIQ
                     NRKPFVLDRSQAYIGVLIDDLVTKDIIEPYRMFTSSAEHRISLRHDNADIRLCRMGHE
                     AGTVDFSSFTKTEYKISAIRQLRQLCDTMKLHPDQIISAMAGAAQQPPLQPIAISNLL
                     KRPEIDFENLLVLSEDFRAGVNEITTDPDVFEQVVIDLKYEGYLKRDLLMTEKIARLE
                     SHSIPGSFSYATVSGLSNEGREKLTLHKPETIGQASRIPGVSPSDISVLLIKIGR"
     gene            29628..30065
                     /locus_tag="CPHA266_RS00135"
                     /old_locus_tag="Cpha266_0029"
     CDS             29628..30065
                     /locus_tag="CPHA266_RS00135"
                     /old_locus_tag="Cpha266_0029"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743941.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiosulfate-binding protein SoxY"
                     /protein_id="WP_041467113.1"
                     /db_xref="GI:752830811"
                     /translation="MKRRKFLGAGAVMAASISMMPSRLFAAWCEKCFSPCPIDNAFIN
                     TLGTRDFVQTDKITIVAPQVASDSSLVPVEIISSIKAERLYLFVEKNISPLVFQCTLY
                     GSAEPYVSLNVKLKESSLVYAVLKEGSRYYRASVHINVLAQAC"
     gene            30107..30403
                     /locus_tag="CPHA266_RS00140"
                     /old_locus_tag="Cpha266_0030"
     CDS             30107..30403
                     /locus_tag="CPHA266_RS00140"
                     /old_locus_tag="Cpha266_0030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743942.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfur oxidation protein SoxZ"
                     /protein_id="WP_011743942.1"
                     /db_xref="GI:500064025"
                     /translation="MRVLARELNGIVLLKIIIEHPSESGTRKDEQGNVIPAHFIREGR
                     IALNGAPLFDLDLGPSVSRDPFFQLKFAGKKGDQIKLEFTDSKFQEFSADCVVT"
     gene            30479..30859
                     /locus_tag="CPHA266_RS00145"
                     /old_locus_tag="Cpha266_0031"
     CDS             30479..30859
                     /locus_tag="CPHA266_RS00145"
                     /old_locus_tag="Cpha266_0031"
                     /EC_number="1.-.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743943.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfide dehydrogenase (flavocytochrome),
                     cytochrome c subunit"
                     /protein_id="WP_011743943.1"
                     /db_xref="GI:500064026"
                     /translation="MQAKLRLWLTFCVVTPVLLLFGNAGLAEQTPAPKVLKPVTSKAV
                     GVTPRGQVLSLSCSSCHGTDGKSVGIMPSFYGKTPQYIETALLEFKSGKRYSTVMGRH
                     AKGYSDDEIHLIAQYCGIKGQKTK"
     gene            30874..32166
                     /locus_tag="CPHA266_RS00150"
                     /old_locus_tag="Cpha266_0032"
     CDS             30874..32166
                     /locus_tag="CPHA266_RS00150"
                     /old_locus_tag="Cpha266_0032"
                     /EC_number="1.-.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743944.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C"
                     /protein_id="WP_011743944.1"
                     /db_xref="GI:500064027"
                     /translation="MSNKLSRRDFNKLLVSGVAGSAFGVFGGASSAFAAKNRVVVIGG
                     GFGGAAAAKYLKKLDPTLSVTLIEPKETFYTCPFSNWVLGGLKTMEDIGQTYTVLKTR
                     YGIDVVVDAAAGVDASKNAVTLKSGRVIKYDRLIVSPGIDFKWKAIEGYSQAVSETKM
                     PHAYQGGAQTILLHKQLLAMPDGGRVIITAPGNPFRCPPGPYERASLIANYLKKNKPK
                     SKIIILDAKDKFSKQALFRKGWEKLYPGMIEWRGSTTGGKISMVDGAAMTVTTEFGVE
                     KGDVINVIAPQQAGKIAFDCGLTDASGWCPVNPITFESTMHPGIHVIGDACIAGAMPK
                     SGFAASSHGKVAAASIIRLFQGKVPAPPSLVNTCYSLLAPGYGISVAGVYKLSAEGIV
                     EIPGSGGLTPLDADEEKLGEEATFAQGWYNNIAQDIWG"
     gene            32395..34254
                     /locus_tag="CPHA266_RS00155"
                     /old_locus_tag="Cpha266_0033"
     CDS             32395..34254
                     /locus_tag="CPHA266_RS00155"
                     /old_locus_tag="Cpha266_0033"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743945.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecD"
                     /protein_id="WP_011743945.1"
                     /db_xref="GI:500064028"
                     /translation="MKNKQFPLFLLLAVTAISLWSLWPTWRDYSLTKQIERFSSSEDS
                     LKFSLAHRDEIENARRKSLKLGLDLKGGMHLVMEVDQIDLFMQKAWNKDARFFELMDK
                     VKQKSVTSDARVIDLIVNEFTKENIRLSRYFYDIRNSDKEIVGKLEKESEDALLRAKE
                     IIRNRIDQYGVAEPVITTQGSRRIIIELAGVSDENRVRNLLKGTAKLEFKLLRDPDML
                     LRALDRVNSALVQASVQKPVVPDSLAVKDSAATASPAVAPPLDATASKQAKTAGPLYD
                     VIGVLPNGTVFTPEQSREFVLTLLQRADVQALLPQDSELLLSAKPEVGEKGEKYYPIY
                     LVKKTAELTGGVITEAKATFGSEGVQPEVMMSMNSDGTGKWARITGANIGKRIAIVLD
                     GAVYSAPVVQSKIPNGNSVINGIESLEEAKDLEIVLKAGALPAPVRIMEERTVGPSLG
                     ADYIRAGMLSLLWGFCAVSIFMLVYYRKAGIAADIALLLNILIVLSVLAGFNASLSLP
                     GIAGIVLTMGMAVDANVLIYERIREELDEGKPLKSAITLGYDRAFSSILDSHVTTLSA
                     AFLLYTYGIGPIQGFALTLMIGTAASLFTAIVVTREIFTILLGRNMMTEKSFG"
     gene            34277..35212
                     /locus_tag="CPHA266_RS00160"
                     /old_locus_tag="Cpha266_0034"
     CDS             34277..35212
                     /locus_tag="CPHA266_RS00160"
                     /old_locus_tag="Cpha266_0034"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743946.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecF"
                     /protein_id="WP_011743946.1"
                     /db_xref="GI:500064029"
                     /translation="MRIFHKTSFDFIKYRKISYAISVFLLLIGIGSLFVKGLNYGIDF
                     RGGSEVLIRFEKNIDVAAVRSVLDNTGMSGTLKQYGLDRSFLFSTAFNGQTNELKSLI
                     SNSLNDRLKGNPHEIVRIDAVGPSIASDLKWSALKALLAALLAILLYVGIRFEIKFAT
                     AGVVAIFHDIFVVLGLFSLLGGVFDFMPLELDQSIIAAFLTIAGYSITDTVVVYDRIR
                     ERIRGQKPADYERIFNESMNQTLSRTIITSGTLLISVLVLFVFAGPAIRGFAFAVFMG
                     VFIGTYSSIFVAAPIVYDWLKLTKSSVKLRGGSAS"
     gene            35469..36785
                     /locus_tag="CPHA266_RS00165"
                     /old_locus_tag="Cpha266_0035"
     CDS             35469..36785
                     /locus_tag="CPHA266_RS00165"
                     /old_locus_tag="Cpha266_0035"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743947.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="WP_011743947.1"
                     /db_xref="GI:500064030"
                     /translation="MKKMLTAAVFVMLVAFSFTLGNLHADVADRIVAVVGNEVILKSE
                     IDDRALMTVMQYPETQKDTRLKEKILAGIIDQKVILVKARIDSTQVDESTLDALTNER
                     LKMLASRFASKEAMEEKFGKSMGVIRQEIRNELKDQQLIETLRKKQLAGITVTHEETV
                     DFYRNHKQQLPQVSELVGLSQILKYPDLPQGSKDAALAQMKIVQAELKAGADFAATAR
                     KYSQDPGSAKLGGDLGYVQKGELVRSFEDAAFLLKDGKISDIVETRYGYHIIQRLEKK
                     PNAVHLRHILIAYDQSKTDEPGTVQLLSRIKSDVLAGRATFADMAKKYSDDPVSGKLG
                     GVILSGGSGKTLLPVASLRPQMMQIVGSLRNIGDISDPQKIDFQKGNLFYGIFQLNAK
                     IPVHQLNLEQDYASLEELALEAKKQERYNEWLSQLKKEVLVRISDI"
     gene            complement(36774..38705)
                     /gene="gyrB"
                     /locus_tag="CPHA266_RS00170"
                     /old_locus_tag="Cpha266_0036"
     CDS             complement(36774..38705)
                     /gene="gyrB"
                     /locus_tag="CPHA266_RS00170"
                     /old_locus_tag="Cpha266_0036"
                     /EC_number="5.99.1.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743948.1"
                     /note="negatively supercoils closed circular
                     double-stranded DNA; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit B"
                     /protein_id="WP_011743948.1"
                     /db_xref="GI:500064031"
                     /translation="MQETVPQAPSPYIASNIQILDGIEHVRKRPAMYIGDIHTRGLHH
                     LIYEIVDNSIDETLGGFNEYIFVSLNPDGSVTVIDHGRGIPVDIHPQKQKSALELVMT
                     VIGAGGKFDKGSYKVSGGLHGVGASVVNALSEWCEVEVYRDGKAYFQRFERGVPQGNV
                     REIGLSDQKGTKTTFKPDNLIFKTTEFRKDIIIDRMRELAFLNKNLSITVQDADGAQE
                     IFHYEGGLKEFVRFTDINRLSLIKEPIYFIGERDTTIVEIALQYNDSYQENVFSYVNN
                     INTHEGGTHVTGFRKALTRTLNLYAQKNDLLKNLKLSLTGDDFKEGLTAVISVKVEEP
                     QFEGQTKTKLGNSETQSIVESIVNELLSEFAESNPNVIKMIIEKVKGAAMSREAARKA
                     KELTRRKSVLESSGLPGKLADCSINDPEHCELYIVEGDSAGGSAKQGRDRSFQAILPL
                     KGKILNVEKARLHKMLENEEIKTIILALGTSFGEEEFSPEKLRYGKIIIMTDADVDGA
                     HIRTLLLTFFFRYMRSLIEAGKVYIAQPPLYLVKSGKDQQYAWDDEERNSITDTLKKM
                     QKGKANIHIQRYKGLGEMNPEQLWSTTMDPAHRSLLQVSVENAREADQIFSTLMGDKV
                     EPRREFIEKNARYVRRLDV"
     gene            complement(38787..39170)
                     /locus_tag="CPHA266_RS00175"
                     /old_locus_tag="Cpha266_0037"
     CDS             complement(38787..39170)
                     /locus_tag="CPHA266_RS00175"
                     /old_locus_tag="Cpha266_0037"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BCI0.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011743949.1"
                     /db_xref="GI:500064032"
                     /translation="MSSDPHMLGIQGEQIAAAYLSRHGYRIIQRNYRYRRNEIDIIAK
                     KHATICFIEVKTRASLEKGHPSEAVTPKKQKEIIKAAKSYLFSLGTDRCECRFDVIAI
                     LVRSMKQEEIGLYDLDHFTDAFQAE"
     gene            complement(39180..39797)
                     /locus_tag="CPHA266_RS00180"
                     /old_locus_tag="Cpha266_0038"
     CDS             complement(39180..39797)
                     /locus_tag="CPHA266_RS00180"
                     /old_locus_tag="Cpha266_0038"
                     /EC_number="3.1.26.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BCI1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease HII"
                     /protein_id="WP_011743950.1"
                     /db_xref="GI:500064033"
                     /translation="MTTDYEYSLWPTLSLISGIDEAGRGPLAGPVVAAAVIFPRWFRP
                     RHAGLDKLDDSKKLSPNLREQLAPTIKTFAAFWAVAVIEPDIIDRINIFQATMQAMNN
                     AVASLHQPPELILVDGNRFMPNAPIPYETIVKGDAKVFSIAAASVLAKTHRDAIMTAY
                     GKEYPEYGFERHFGYPTASHIKAIETFGRTPVHRKSFRLKQLGEK"
     gene            complement(39830..40219)
                     /locus_tag="CPHA266_RS00185"
                     /old_locus_tag="Cpha266_0039"
     CDS             complement(39830..40219)
                     /locus_tag="CPHA266_RS00185"
                     /old_locus_tag="Cpha266_0039"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011743951.1"
                     /db_xref="GI:500064034"
                     /translation="MKDSRDFREFLSGGHAAGKRTFIVVLSLTTHHPLFSERSTRMPS
                     NVSFVVTALSFTAQMSINGRQRSLWPLKRDQRDRQGAEAEKLRMNRKVKQAARGMKRI
                     NGPISGKSFDPACRRNHCNEYLQLSEQ"
     gene            complement(40467..40667)
                     /locus_tag="CPHA266_RS00190"
     CDS             complement(40467..40667)
                     /locus_tag="CPHA266_RS00190"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467114.1"
                     /db_xref="GI:752830812"
                     /translation="MILPKLEPLCPTEGYAMKIRHRIRRKKRGRKQPTKKRHHSETAV
                     AYKKLTPGSGDCLREENSLKNL"
     gene            40727..42424
                     /locus_tag="CPHA266_RS00195"
                     /old_locus_tag="Cpha266_0040"
     CDS             40727..42424
                     /locus_tag="CPHA266_RS00195"
                     /old_locus_tag="Cpha266_0040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743952.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease"
                     /protein_id="WP_011743952.1"
                     /db_xref="GI:500064035"
                     /translation="MKKSLNKQLLMNKTGDEIQVALVEEGRLAELIIERPESRRSIGD
                     IYLGRVHKVVEGLKAAFVDIGQKSDGFLHFSDVGTTTEDYRALIEDDDDDDTTGTDES
                     DGDEIAAVLSQPAVLPEQNGKSSARSGAKRLTAPAQDGEDGGRRQSYTQMIAGKLKPN
                     DSILVQVIKEPISTKGSRLTSDITIAGRFMVLLPFGGGQVAVSRRVIARKERSRLKKL
                     VRSMLPDGFGAIIRTVAEMQEETLLKQDLEKLLAKWTQIEEKLQDAVPPQLIFKEDTI
                     ISSVLRDSLNADVTEIVANSPVIYKETLNYIQWAAPEMEKNVTLYQGKLPLFEGYSIA
                     KDVESIFSRKVWLKSGGYIIIEHTEAMVVIDVNSGRYAAKREQEENSLKTNLEAAREI
                     VRQLRLRDIGGIIVVDFIDMLDQKNAKKVYDSMRTELRNDRAKSNILPMSDFGIMQIT
                     RERIRPSLMQRMGDQCPACGGTGVVQARFTTINQIERWLRKYALQNTMKLQQLDLYVS
                     PTVAEPLQQSEMNTELKWFLQHLLFVRVKPDESLRSDDFRFYSRKNNKEITAEYGDL"
     gene            42441..43304
                     /locus_tag="CPHA266_RS00200"
                     /old_locus_tag="Cpha266_0041"
     CDS             42441..43304
                     /locus_tag="CPHA266_RS00200"
                     /old_locus_tag="Cpha266_0041"
                     /EC_number="2.3.1.117"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743953.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2,3,4,5-tetrahydropyridine-2,6-carboxylate
                     N-succinyltransferase"
                     /protein_id="WP_011743953.1"
                     /db_xref="GI:500064036"
                     /translation="MTSYASLKEEISGLAPLSAVQLADYPDARRVFDDFKKLLNAGTV
                     RAAEKKEGEWQVNLWVKEGILLGMRLGRLVESHLVFPETGGGFDFFDKDTYPLRRMTL
                     EDRVRIVPGGSAVRDGSYLAPSVVMMPPAYVNVGAYVDEGTMIDSHALVGSCAQVGKN
                     VHLSAGVQVGGVLEPVGAVPVIIEDDVMVGGNCGIYEGTIVKERAVIGTGVILNGSTP
                     VYDLALETVYRKTSGHPLVIPAGAVVVAGSRRMKGDFALEHGLSLYTPVIIKYRDEKT
                     DSATALEQALR"
     gene            43676..45067
                     /locus_tag="CPHA266_RS00205"
                     /old_locus_tag="Cpha266_0042"
     CDS             43676..45067
                     /locus_tag="CPHA266_RS00205"
                     /old_locus_tag="Cpha266_0042"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006366770.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467438.1"
                     /db_xref="GI:752831136"
                     /translation="MGLGLSKFGGAAYVTSVVEGYPAWKAGIRTGDRIMAINGVSLSK
                     SNIDNLREMIKGPAGGSLTVKIEREKSGRPPAPETVTLVRQAVHLNTVSFAGIVDGVA
                     YIVMDSFSAKSAEELSAALQKLMKESEPEGRSLKGVVLDLRGNPGGLLTSAIDVAGLF
                     VEKGSEVLSIRGRHPEDRQAYTTQQSPFSSTIPLVVLIDGQSASASEIVSGAIQDLDR
                     GIIIGERSFGKGLVQSIVELPFNYSIKLTTAKYYTPSGRLIQKDLHSETELIKEGDVP
                     PAGKEKRAKVYYTAKKRSVYGGGGILPDISVSAVMLSEYEKALVKDGLIFRFAISYHS
                     EHAEQPTLPLDHPSLLLAFDKFLEDQKFSYTSQPEQEFEKLRTLLIKETPSDGNSEAS
                     ALLGMKEEIVRRKRLELSRNREHIARLLELEILRHYSETGAKRAGLHDDPVVRTALEL
                     LSDKKRYSGILSR"
     gene            complement(45059..45742)
                     /locus_tag="CPHA266_RS00210"
                     /old_locus_tag="Cpha266_0043"
     CDS             complement(45059..45742)
                     /locus_tag="CPHA266_RS00210"
                     /old_locus_tag="Cpha266_0043"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743955.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467439.1"
                     /db_xref="GI:752831137"
                     /translation="MLSLPNWIIHLSSTLEWGIAALMMFRYGMITGRKDIRMFGISML
                     PHWVGSFFIIAYHLTGDSIPLLLDLSETVNLFGSAALLYAVLTLLKKTSNPTPTGYAT
                     CLATIMIAGKPQSYLGEDIFDAILQVSSIVYITFLVLLIVVRKRDPEVFSPLTVAGFW
                     FVLVFISFTVFSIYLATEVRGNLSLSHDDLLHGLAESLLTLSNLMIVIGIHRQTVWYE
                     KLAKKAESA"
     gene            complement(45810..46952)
                     /locus_tag="CPHA266_RS00215"
                     /old_locus_tag="Cpha266_0044"
     CDS             complement(45810..46952)
                     /locus_tag="CPHA266_RS00215"
                     /old_locus_tag="Cpha266_0044"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743956.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="geranylgeranyl reductase"
                     /protein_id="WP_011743956.1"
                     /db_xref="GI:500064039"
                     /translation="MRFDVAVIGGGPSGAVAAAELARAGIPTVLIERNLDHVKPCGGA
                     IPLGLIEEFGIPGELVEKKLSHMRARSPKGRIIEMNMPNGYVGMVRREKFDRYLRSEA
                     ERAGAVIVEGLVNTIRRSSFGFTISTLNDKVPPIEAHYIIGADGANSKTADELRFPPN
                     ELKVIAMQQRFKYTPELEQFRDIVEIWFDGEVSPDFYGWIFPKADHLAIGTGTEDRRH
                     SIKELQKRFIEKIGITEAPYLDEAAKIPMKPRKSFTAEGAILVGDAAGLVTPANGEGI
                     FFAMRSGKLAAQAMIGHLKHAEPLENYETGFRKLYAPIFFGLEVLQYVYYRNDRLRES
                     FVAICADDDVQQITFDSYLYKKMVPAPWSTQMKIFSKNIYHLVKGS"
     gene            complement(46993..48462)
                     /locus_tag="CPHA266_RS00220"
                     /old_locus_tag="Cpha266_0045"
     CDS             complement(46993..48462)
                     /locus_tag="CPHA266_RS00220"
                     /old_locus_tag="Cpha266_0045"
                     /EC_number="6.1.1.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743957.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycyl-tRNA synthetase subunit beta"
                     /protein_id="WP_011743957.1"
                     /db_xref="GI:500064040"
                     /translation="MSNTDSKRVQNVNLPPEKVMHKLVSLAKRRGFIFPSSEIYEGLS
                     SCFDYGPLGSEMKKNIKDLWWNAMTRRHQNIVGIDASIMMNPRVWEASGHVASFNDPM
                     IDDKATKRRYRADHLIENHIEKLRRDGKDDTALKVQTAYEQASTAADLNRALYDIIIA
                     EGIKAQDTGSGEWTEVRQFNLMFQCGMGALADKASIVYLRPETAQGIFVNFHNVRESS
                     RMKVPFGIAQIGKAFRNEIVKGNFIFRMVEFEQMEMQYFVKPGTQAEAFEAWREERFN
                     WYTSALGINRDKLHWYKHDKLAHYADLAYDIKFEFPFGIEEIEGIHSRTDFDLKQHQE
                     YSGKNMEYIDQLTNERYIPYVVETSAGCDRLFLALLSDAYSEDVVDGEPRISLRFSPK
                     VAPVKAAVLPLLKKGEMAEKAARIADDLRQLYMIQQDDAGSIGKRYRRQDEIGTPFCL
                     TIDHETLENDTLTIRHRDTASQERISASSIREFLAAGMV"
     gene            complement(48703..49020)
                     /locus_tag="CPHA266_RS00225"
                     /old_locus_tag="Cpha266_0046"
     CDS             complement(48703..49020)
                     /locus_tag="CPHA266_RS00225"
                     /old_locus_tag="Cpha266_0046"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743958.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Clp protease adaptor protein ClpS"
                     /protein_id="WP_011743958.1"
                     /db_xref="GI:500064041"
                     /translation="MIFSVSTSLSATRPTPETRQTEQSSGPDLLDAYRVVLYNDEEHT
                     FDEVISQIIKAVQCNRQKAERCTWEVHTKGRSVVFVGMIDRCIKVSAVLEEIALKTEI
                     QTD"
     gene            complement(49083..50030)
                     /locus_tag="CPHA266_RS00230"
                     /old_locus_tag="Cpha266_0047"
     CDS             complement(49083..50030)
                     /locus_tag="CPHA266_RS00230"
                     /old_locus_tag="Cpha266_0047"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743959.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S66"
                     /protein_id="WP_041467440.1"
                     /db_xref="GI:752831138"
                     /translation="MKTLLPKALRKGDTIGLISPSSHSAFPERIARAILYLEERSFKV
                     KPSTYLNCIDVNPAIADQQKLSDLHAMFEDTEVDAVICLRGGAGATRLLKNIDYALIE
                     ANPKILIGYSDITALSLAILAYTGLVSFSGPMIATELYEPTPYTEEHFWGMLTDPRYA
                     LSLKNHSQHRVTCLKPGDASGNLIGGNLSVLCSLIGTPYLPILDDAILFLEDVNEPAY
                     RIDRMLSHLLNAGLLSRCRAILFGQFTGTPEKAGEDTRLEHIFDYYATQAHIEGPVMT
                     GLSYGHIADLMTLPLGAPFQVTVRPRYFSLEARYPVIHA"
     gene            complement(50094..50360)
                     /locus_tag="CPHA266_RS00235"
                     /old_locus_tag="Cpha266_0048"
     CDS             complement(50094..50360)
                     /locus_tag="CPHA266_RS00235"
                     /old_locus_tag="Cpha266_0048"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743960.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase subunit epsilon"
                     /protein_id="WP_011743960.1"
                     /db_xref="GI:500064043"
                     /translation="MASSEKGFDIEIVTPQQQYFSGEIQSIIAPGRDGLFQVLKSHAP
                     LLSALKNGTVRLTLANKSEKTFTISDGFFEVSNNKAILLTEEIS"
     gene            complement(50376..51764)
                     /locus_tag="CPHA266_RS00240"
                     /old_locus_tag="Cpha266_0049"
     CDS             complement(50376..51764)
                     /locus_tag="CPHA266_RS00240"
                     /old_locus_tag="Cpha266_0049"
                     /EC_number="3.6.3.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006366764.1"
                     /note="Produces ATP from ADP in the presence of a proton
                     gradient across the membrane. The beta chain is a
                     regulatory subunit; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="F0F1 ATP synthase subunit beta"
                     /protein_id="WP_011743961.1"
                     /db_xref="GI:500064044"
                     /translation="MQEGKISQIIGPVVDVDFPEGQLPSILDALTITRPDGTKLVLET
                     QQHLGEERVRTVAMESTDGLIRGLSVTNTERPIQVPVGPEVLGRMLNVVGDPIDGRGS
                     VHTSKTYSIHRSAPKFDELSTKTEMFETGIKVIDLLEPYSRGGKTGLFGGAGVGKTVL
                     IMELINNIAKQQSGYSVFAGVGERTREGNDLWHEMMESGVIDKTALVFGQMNEPPGAR
                     ARVALTGLSIAEYFRDEENRDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLAT
                     EMGELQDRIVSTKKGSVTSVQAIYVPADDLTDPAPATAFAHLDATTVLSRSIAELGIY
                     PAVDPLDSTSRILDPNIVGDDHYDTAQAVKQILQRYKDLQDIIAILGMDELSDEDKLV
                     VSRARKVQRFLSQPFFVAEAFTGLAGKYVKLDETIKGFKEIIAGKHDNLPESAFYLVG
                     TIEEAVQKAKTL"
     gene            complement(51893..51965)
                     /locus_tag="CPHA266_RS00245"
                     /old_locus_tag="Cpha266_R0001"
     tRNA            complement(51893..51965)
                     /locus_tag="CPHA266_RS00245"
                     /old_locus_tag="Cpha266_R0001"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(51930..51932),aa:Thr,seq:cgt)
     gene            52157..52699
                     /locus_tag="CPHA266_RS00250"
                     /old_locus_tag="Cpha266_0050"
     CDS             52157..52699
                     /locus_tag="CPHA266_RS00250"
                     /old_locus_tag="Cpha266_0050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743962.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="redoxin"
                     /protein_id="WP_011743962.1"
                     /db_xref="GI:500064045"
                     /translation="MNNMNRIITIVAAGFMLLLATVSTAGAAQPGTQYPVAPSFSVTG
                     IDNRTITSQSLAGKVYIVNFFASWCPPCRAEIPAMIALQKAYKAKGFTFVGLAVNESG
                     STIRKFSLANGINYPVALADSKIIADYGRFIDGGIRAIPTSFIVDKSGRVVGIISGAR
                     DKAYFEAVILDLLKGTKPTK"
     gene            52835..54700
                     /locus_tag="CPHA266_RS00255"
                     /old_locus_tag="Cpha266_0051"
     CDS             52835..54700
                     /locus_tag="CPHA266_RS00255"
                     /old_locus_tag="Cpha266_0051"
                     /EC_number="4.1.1.32"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743963.1"
                     /note="catalyzes the phosphorylation and decarboxylation
                     of oxaloacetate to form phosphoenolpyruvate using GTP;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate carboxykinase"
                     /protein_id="WP_011743963.1"
                     /db_xref="GI:500064046"
                     /translation="MTLVDINAPDFVVNKKLLQWVQETADLCRPDLVHWCDGSQEEYD
                     LLCEQMVESGTFIRLSAEKRPNSFLCRSDPSDVARVEDRTYICSIRKQDAGPTNNWVA
                     PKEMKKILAGLYDGCMQGRTMYIIPFSMGPLGSHIAHIGVEITDSPYVVTNMRIMTRM
                     GRKVLDVLGANGDFVHCLHSVGAPLKAGDQDVSWPCSETKYIVHFPEERSIMSFGSGY
                     GGNALLGKKCFALRIASAMARDEGWLAEHMLILGVESPDGEKTYVSAAFPSACGKTNF
                     AMLIPPESFAGWKVTTIGDDIAWIKPGEDGRLHAINPEYGFFGVAPGTSDKSNPNAME
                     TLKKNCIFTNVALTPDGDVWWEGMTDDIPEELTDWRGNPWTPGCGRPSSHPNARFTAP
                     ASQCPSIDPDWENPHGVPISAFIFGGRRRDTIPLVYQSANWYFGVYMAATMGSEMTAA
                     AAGLIGDVRRDPYAMLPFCGYHMGDYFNHWLHIGRTVVDPPRIFGVNWFRKDDDGKFL
                     WPGFGENMRVLKWIVDRVRGRAGAVESPLGWMPRYEMLGFEGDDGLTQDQFTKLMSID
                     REAWKKELFSHEELLEKLYDRLPKEFSHIRELMLSTLWMSPEHWELAAERYSEDQ"
     gene            54772..55500
                     /locus_tag="CPHA266_RS00260"
                     /old_locus_tag="Cpha266_0052"
     CDS             54772..55500
                     /locus_tag="CPHA266_RS00260"
                     /old_locus_tag="Cpha266_0052"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743964.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011743964.1"
                     /db_xref="GI:500064047"
                     /translation="MKINAGLLLLFSVLVISGCSGKTDSAQTGSVLEASSSSVPKRYE
                     LKSGIVYYEPTELMGSKSVETLYFDDYGRREARETISDANVMGMKMHSHKMQITDGDY
                     VISYEIENSVNGKDEASKEATRTDMKEFREMAIMMGQTFDPEEMKRNFDYREEGVEEV
                     AGVNGTKYSISLNKEKPGERVYGVLYKKISVKSTFGTIVIKAKKIEENVAVPASKFEV
                     PAGYTIKDVNLEEEMRKASQSGEE"
     gene            complement(55586..57391)
                     /locus_tag="CPHA266_RS00265"
                     /old_locus_tag="Cpha266_0053"
     CDS             complement(55586..57391)
                     /locus_tag="CPHA266_RS00265"
                     /old_locus_tag="Cpha266_0053"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743965.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase RecQ"
                     /protein_id="WP_041467115.1"
                     /db_xref="GI:752830813"
                     /translation="MYETLRKVFGFRDFRPNQEMIVRTIIEKRDVFAVMPTGGGKSLC
                     YQLPAVLLPGTCMVISPLIALMKDQVDGARANGIRAAFLNSSLAPEERTLVLRDLLSN
                     SLDLLYVAPERFTLDQFQEMLKRVNISMAVIDEAHCISEWGHDFRPDYLSLSQLVTLF
                     PDLPVAAFTATATHQVQRDILDKLALRNPFVVRASFDRANLYYDIRFKENASDQLVAL
                     LKQNSGKAGIIYRTSRKSVNETAALLKAKGFRVLPYHAGLGDDERKQNQEAFIRDEVD
                     VIVATVAFGMGIDKSNIRFVIHADLPKSIENYYQETGRAGRDGEAARCTLLFSQSDIP
                     KVRFFIDAMQDETERARALGAFSKVISFASTSVCRRKTLLDYFGETYPHDNCNSCDIC
                     LGTREVVDCSLEAQMLLSAIARTEERFGATHIVDIVTGSANKKIRDFGHDRLKTYGVG
                     KGRDKKFWRQLIDELLAQKVIAKSEGLYPTIVLLPKAVQILKNEARVEIVRVLEKKSA
                     KAGKQELSGSYDHELFDQLRELRKQIADEQGIPPYVVFSDRTLRDMASIFPENNEAML
                     SVSGVGEVKLDRYGRQFLNLINRYRSDHPERNALS"
     gene            complement(58580..58768)
                     /locus_tag="CPHA266_RS00270"
     CDS             complement(58580..58768)
                     /locus_tag="CPHA266_RS00270"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467116.1"
                     /db_xref="GI:752830814"
                     /translation="MPTNYTDFHEKEIGCWFSLASPIKTTAGFLIKKRIGYVISTIGR
                     DLSSLLSPARTHLGEVDP"
     gene            complement(59048..59395)
                     /locus_tag="CPHA266_RS00275"
                     /old_locus_tag="Cpha266_0054"
     CDS             complement(59048..59395)
                     /locus_tag="CPHA266_RS00275"
                     /old_locus_tag="Cpha266_0054"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743966.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011743966.1"
                     /db_xref="GI:500064049"
                     /translation="MIVSYILSLSEPLSLPSTALLRIEIRDTSLADAPSVTLAETQQT
                     AEQVSGKTVVDGAIDLQKSFSPKATITLWAHLSLSGEKRIKKEDFITTRSYPITTIDE
                     NGQVLAELHPVSR"
     gene            complement(59403..60692)
                     /locus_tag="CPHA266_RS00280"
                     /old_locus_tag="Cpha266_0055"
     CDS             complement(59403..60692)
                     /locus_tag="CPHA266_RS00280"
                     /old_locus_tag="Cpha266_0055"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743967.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM protein"
                     /protein_id="WP_011743967.1"
                     /db_xref="GI:500064050"
                     /translation="MHYPYFPFFLSKQDRDTFMASSPYGGFTVNKAGAAILEWSNGSR
                     SMGEIVKKLQSRYVAESASIAAKTEQFIHDLAKKGYVLIKEKPMRWFDAPPPQTIFWE
                     ITSQCNLQCLHCVVSAGQSTEPDLSTARCFELLDEWAALGVEEITFSGGEPLLREDFF
                     DLAAAAAKNNLSISLATNGTLVTREVAKKLKALNVDVQISLDGSTAEIYGRVRGRKEA
                     FNDVVQGIRNTLAAGVNLTIGTVVTKNNIDDIPEILKFTERSGVPYFRLIPFVPSGRG
                     KHNRDLELDPLQIQTVSRELVEQRDRWSFTILPLEFELTFSPPSGEQADLSRPSECGG
                     ATNYCTVTPSGEVLPCHYFEGVVADSLRNRSFRDIWRNSRFLNYFRSIEIGDIQGYCH
                     GCDWLSECRGGCKAANFSRGDLFQSNCHCWVVKENHQ"
     gene            complement(60768..62186)
                     /locus_tag="CPHA266_RS00285"
                     /old_locus_tag="Cpha266_0056"
     CDS             complement(60768..62186)
                     /locus_tag="CPHA266_RS00285"
                     /old_locus_tag="Cpha266_0056"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743968.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M12"
                     /protein_id="WP_011743968.1"
                     /db_xref="GI:500064051"
                     /translation="MARKKNGNTPQEYGEFSPSGKLRTAIIEGNTFGYKSVQYTDVDG
                     MAMFEGDIILGKVADVDSKTEQRKREIQQGVTLRGITITGAKYRWPNCKVPYTIDTAL
                     PNQSRVTDAIAHWEAKTKFRFILRTNANASSYPDWVTFRSGSGCSSYVGKQGGQQYIN
                     LASGCSKGNTIHEIGHTIGLWHEHSREDRNAFVTIHWDKIIAGYEHNFNQQISDGDDV
                     GAYDYGSIMHYPRTAFSTDGSETITPTDPSASIGQRTALSAGDIAAANSLCPTVSLCP
                     AAPKTCPGAPIQVCPVSPKLVCPPGIKLACPPGIKQLCPPGIKQSCPSAPIQVICPPG
                     IKLACPPGIKVTCPPVPKIPICPPSPVPGCAAGPTNKPWVGPEGYTTTYRLDPASGAY
                     YSDEAPPPGMNQMPPVVININFHGYQPPSIQSDYAQYDPSAYENQDWTATEYPDPGEE
                     ADDSITNEESEAPEDFNPECSE"
     gene            62719..65244
                     /locus_tag="CPHA266_RS00290"
                     /old_locus_tag="Cpha266_0057"
     CDS             62719..65244
                     /locus_tag="CPHA266_RS00290"
                     /old_locus_tag="Cpha266_0057"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006622826.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467117.1"
                     /db_xref="GI:752830815"
                     /translation="MDKSEHDRERFISLMAAYDLLDKSENPHRAAELLLEAGSLVDGE
                     AEPKKWAAFRQLYAQYSETSDPEAAITAYRDALSVWDPVLDRDAWVACHSGIGSLMVN
                     LQPFGPKELDEAVMHLESAVQAQPFLSSMLAVLYRFRSAGDPRENWQKRVHHLRQALL
                     LIDRDEEPCGWAAANNELAIAIGDEPDADFGAALEERLRLHLESFGLLEGNKDDTWID
                     TCLSLSECYLFRGGIDDRENQEQAERYARLALDAAGTEVSGPLRAEVLLNLARVLMAP
                     GRFFDADRIRQCLSCCDESAALIDPVRSPALMASVESFRANALLKLIQNGEPCDEERL
                     AAHAEAALALLPGVEHTSSRRSILQVAGEGMLAARHDERAAGYFREALDAAASALLFA
                     ESREGRMQRIWEFRDTSALLAWSLLKLGDKENALVELEKGKGRFWRTDDEALSVAAIR
                     SIVPSGGALLVANFSCREGAVIVVTGERIEIVWLPSFGKDRLMALQRGGLDVASPGGW
                     LRAYHMRNSEHEAWRRMIEETGETLYRELWEPVLDLLQDMGIADDAELVWFPQGGSGV
                     FPVHAAWRQDSDGSKRWLIDRFTVRYAPDFQVLLSGESGVGCASGSLLLVANPCGDLD
                     FSELECAWVRQYHTGRELKLLHGIDATPDAVLDAIGSAGIVHFSTHAIFDLNRPLCSA
                     LLLAGGEPLSLERLIPALEQKAPYLVVLSACETAMSRISSTPDEFLGFPAAFLHSGVR
                     TVLATLWPVDDAATAVLTGRFYRELAVNNHSPSRALREAQNWIRSVTALELMELMREM
                     KNAPPPAGPLAGRIRTALRAFDPELKPFASPYYWAAFTISGKE"
     gene            65249..66577
                     /locus_tag="CPHA266_RS00295"
                     /old_locus_tag="Cpha266_0058"
     CDS             65249..66577
                     /locus_tag="CPHA266_RS00295"
                     /old_locus_tag="Cpha266_0058"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018802001.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011743970.1"
                     /db_xref="GI:500064053"
                     /translation="MTELVQQLALLDALLSNWDGVLVRMGAPDVLRDEALAALAVKLS
                     SAESPDDLDLLLDDLFDLVEDTPAYDYVRGLIARARLDTGTVAKTRGGYAGELVSDDE
                     KSLLFGASRLAGRALGNAVSADVEPCQVEVFFATNRKSSDASDLQFTGEHDAGGYTCG
                     VAHVTIPVGVHRAGVLEGKRWWHLLREKDDSRRYVVLGSVEKLAEDLFTTRIVEGAPE
                     CRDLLVFLHGFNVTFEDAARQAAQFAFDLQFQGRVVLYSWPSLGSLAGYCADEERAFL
                     SNGRFAGFLGMLEDGPWDKVHILAHSMGNRVMLYGLSGNSWPNGRISQVVFAAADVYV
                     ETFRELFPKIREKAALYTSYTSKKDRALLISGILHKAKRIGISRGEPFVMDGLETIDA
                     SKVDNGFPGHGYFAEETKLIEDISQLLGKGLSAGRRKLYQPPSKAYWDFR"
     gene            complement(66590..67027)
                     /locus_tag="CPHA266_RS00300"
                     /old_locus_tag="Cpha266_0059"
     CDS             complement(66590..67027)
                     /locus_tag="CPHA266_RS00300"
                     /old_locus_tag="Cpha266_0059"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012078845.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SH3 type 3 domain-containing protein"
                     /protein_id="WP_011743971.1"
                     /db_xref="GI:500064054"
                     /translation="MAEENKNFWGTIPGILTGIGTVLTAATGFYMAISGGSPTAKHKP
                     EASAPPATAVMQATVQTTPAKEEVTPHLQDIFILKAVIDDPDGFTNVRSMKSSSSSIV
                     AKVTRNEQFHTYLQDGSWWQVKTADGKIGYMHTGHIRILQDPR"
     gene            67361..68095
                     /locus_tag="CPHA266_RS00305"
                     /old_locus_tag="Cpha266_0060"
     CDS             67361..68095
                     /locus_tag="CPHA266_RS00305"
                     /old_locus_tag="Cpha266_0060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743972.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_041467118.1"
                     /db_xref="GI:752830816"
                     /translation="MARPFKALQMPNLSESIKEAAWRQINEFGASSLSLRKIARELGI
                     TAPAIYNYFPDRDALVTALIIDAYASFGDCQHEAGQAHPGQGREIERLKATGLAYRKW
                     ALVHPLRYLLIFGNPVPGYVPPMQKLLPVMMRSLGTLVGIIAELHVLGRLHIEGVPLP
                     MLKPGNRFFALMETADEGMHAVYAVAMLIWSRVHGLVSLEITGQQLPFAEDGAALYLF
                     ELDSICRQFVRSPESAPDATGFSSNH"
     gene            68108..68572
                     /locus_tag="CPHA266_RS00310"
                     /old_locus_tag="Cpha266_0061"
     CDS             68108..68572
                     /locus_tag="CPHA266_RS00310"
                     /old_locus_tag="Cpha266_0061"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743973.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011743973.1"
                     /db_xref="GI:500064056"
                     /translation="MKKTIVAGLAGGMAMNLAMLLTFRTLGFGWDGKGILLTSPMQSH
                     KLIAVWTEIQPLPLVVNTPLPIILGLMLFGIGHAFIYRSVASAWPAGVLPRAMRMSGL
                     IFFMTFLFWEFFTPFNQFGEPLPLIALELSFWVVIATAEGIAIAWVMERRTA"
     gene            68569..69876
                     /locus_tag="CPHA266_RS00315"
                     /old_locus_tag="Cpha266_0062"
     CDS             68569..69876
                     /locus_tag="CPHA266_RS00315"
                     /old_locus_tag="Cpha266_0062"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743974.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADPH-dependent FMN reductase"
                     /protein_id="WP_011743974.1"
                     /db_xref="GI:500064057"
                     /translation="MKALIFDGSPEGDSTGGRLAEVLAELLAAKGYETGHIVLRQKTI
                     GNCNGCFQCWLKTPGICVLDDDNRELSQRFIGSDLLILLTPVTFGGYSPELKRMLDHF
                     IANVSPFFMTVNGETHHRNRYAAYPDLLVIGWLDQPDRVQESLFNHLAWRNSINFYAK
                     RSSWGIIERSAGSVVLRQKLADLFQGLDSPAERVEMKLPDVAAVSGKSGPPRKALLLC
                     GSPRMAKSTSDSLGGYLLDRLEAQGVETQTIYIYKMLHDGRKVQQMLDAVDSTDLCIL
                     AFPLYIDSLPAPVLSALRMIKEHRKARPAQGGFAAIANCGFIESAQNENALAACEAFA
                     GASGFNWMGSVSVGGGEGLVHGRPLAELGGPAIPYRRALDSVAQFLAAGKPVPEDARR
                     QLGRPFVQSWIFRFFGSRNWKKRARQNGVLHKLNDCPYQPSAR"
     gene            70230..72956
                     /locus_tag="CPHA266_RS00320"
                     /old_locus_tag="Cpha266_0063"
     CDS             70230..72956
                     /locus_tag="CPHA266_RS00320"
                     /old_locus_tag="Cpha266_0063"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743975.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011743975.1"
                     /db_xref="GI:500064058"
                     /translation="MPKKNAGTPAKKVKDALPSAGSSTAVKLATGSSGTPAAPSAGSS
                     ATVKPATGSSGTPAAPSTGSSTTGKPASGSPATGTPATGAQSSGTPPSGTGTAPAAVA
                     SQTTAGAWLSKNQAADYIQRFQDAGYDDLSDLLPEIIRTVLQSEKPGVVDRLVRIRTQ
                     ELRQPQPLPAPALKPGMEMDLSAPVLKGMDGISIKLPDLGFAPGPDKRGDVVSPASMT
                     DEDWLALAINSDMLMGLDLENFFEGESSTPQECFAPALWWKVPASREFFNCEHLSAKI
                     NTEITYTSKSATMVSAGFTSVTASVSTPWVSASVSHEKSYRNAQSSKISTLYIVGMYD
                     LDRVRVDLDECTVVSPRFVAAVENALADPNPKDALAKVFQKYGQIIGRQITLGGRLFF
                     VHVKEEMENSRIETLKSTTSAAIAGAYGAFGGSGSVSFGSSSEKQESSQSMNEKIAFQ
                     AIGGDVTLANEPEKWKDTIKSPAMWEVIRYDKIRYTYELLSPELRELVLMYWERPMGS
                     DEGPIVLPKAKVETMKSSDGVAITGFKIHFGQKVPGLSMRYYATSEDGSFYDWVNEGK
                     LCGTESNGASPLQDFLVELTGGLARRYELHYRAMRADDTFTEWVSGTKICGAKGMKIK
                     DIQAVLSPLGGGIVRIPAESFIPSEGKGTYDIGKYGTGIVNAAVPGEWVLTYQCQYTG
                     SKPVRRRLEALFASANESRPVKVEFNGAIVNGAALEYATGAWDTSGLRTARIGTVTLL
                     PGMNTLKISRPGPGSPHMKEFRLVAEVIDIPATSFIGTTPLGKNNYGLGVIDSGACGN
                     SVTVPYEFTFTGKKPTTLMLEGVYTAMDSRPVDIVINPEDEKPQTFSKVMATVTGSWW
                     KDRQRVETIGDVIVRPGKNTLMLRTTKNALPHIQEFRLVSKETFFDFDPDAD"
     gene            73144..73341
                     /locus_tag="CPHA266_RS00325"
     CDS             73144..73341
                     /locus_tag="CPHA266_RS00325"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467119.1"
                     /db_xref="GI:752830817"
                     /translation="MHEKEIGSWFSLASPIKTTAGFLIKKRIGMKRKSFAHELHEFAR
                     KRNWQLVFSGFADKNNSRFFD"
     gene            73902..74390
                     /locus_tag="CPHA266_RS00330"
                     /old_locus_tag="Cpha266_0064"
     CDS             73902..74390
                     /locus_tag="CPHA266_RS00330"
                     /old_locus_tag="Cpha266_0064"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743976.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011743976.1"
                     /db_xref="GI:500064059"
                     /translation="MSVSMKSWATPLAIGSFIILAVTGILMFFKIEGGYIKPVHEWLS
                     WAMVAGVLLHIFANWKSFLAYFSKIPAVSIISIGVIVTALAVFMPASRDGGNPKMKMM
                     KAIESARLETVAEISGKESSEIVAALKEKGIMVDDPTMTVRQIARTNNKEAMEVLGVV
                     FR"
     gene            74997..75524
                     /locus_tag="CPHA266_RS00335"
                     /old_locus_tag="Cpha266_0065"
     CDS             74997..75524
                     /locus_tag="CPHA266_RS00335"
                     /old_locus_tag="Cpha266_0065"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015160664.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011743977.1"
                     /db_xref="GI:500064060"
                     /translation="MKRALSAIGFHGTSKSNYEGIKRQGFLLSDNSYDWLGVGFYFFQ
                     DAPNRAKEWAKRHEDPIIIGAEISLDHCMDLLDNVWYELLHRVFIAYEGACRKKNIPM
                     AIQTPGNHRRDKIVIDMAVRALAERGFSVKTVRSVFKEGPECFQNSALTTQNHVQIAV
                     RDISTIVDFWSEELN"
     gene            75533..76708
                     /locus_tag="CPHA266_RS00340"
                     /old_locus_tag="Cpha266_0066"
     CDS             75533..76708
                     /locus_tag="CPHA266_RS00340"
                     /old_locus_tag="Cpha266_0066"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011743978.1"
                     /db_xref="GI:500064061"
                     /translation="MDHNEIQNIVLDYVNSLSKDELERYNHDPKYDGEDAGAFGLAEY
                     SLEQKYDRCKKVLSITRSAVCANQGQLVQFMFLAAEKHKALRVLMQAPQRRDAGLIKE
                     KILELRDYIDFHLKKNIDRNIEYIYQYFDGRCDIKPRICIKGKSVVDKKHQIIRIFSD
                     KSLQYNSNVDIDKSSAYKYIKDNGRYYLQNDIPGSVKRNTYENSRLDIDKINHYMSID
                     ADLNSVWSNCWKNSPIDERNGLSFYKSTLIIPVTLLNNALDKEFVYEFNSKIDKEVGE
                     SVINPNEIERTIFAFLCIDHVEKWYFDEEDDVRIGYMIADLISFYLFLRVMYIEISDV
                     FANACQYLNECGVDITINKHVYAPVDEDLSAECVTGEDEYSKTNNNLIASISGLIAD"
     gene            complement(76742..76933)
                     /locus_tag="CPHA266_RS00345"
     CDS             complement(76742..76933)
                     /locus_tag="CPHA266_RS00345"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467120.1"
                     /db_xref="GI:752830818"
                     /translation="MDLQTKTISEIVQLRNLVLKAFSHDNTEKHEIRTEPESAIPADK
                     YFQEVISSNRRFWNKIQRG"
     gene            76983..77174
                     /locus_tag="CPHA266_RS00350"
     CDS             76983..77174
                     /locus_tag="CPHA266_RS00350"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467121.1"
                     /db_xref="GI:752830819"
                     /translation="MNTSLFQKALIIEAAGNFKGLFCLLCVKSRCFPAVLVIKKAFSV
                     SLQFVKKVWLAERLHQQQG"
     gene            complement(<78398..>81073)
                     /locus_tag="CPHA266_RS00355"
     CDS             complement(<78398..>81073)
                     /locus_tag="CPHA266_RS00355"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012507823.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467441.1"
                     /db_xref="GI:752831139"
                     /translation="AVTWLHVSDFHLSDKGPYDQEVILRSLVESIRHFRENENREPDL
                     IFATGDIAQYGKAKEYEKATNFFDDLLDAAGLNRDRLFIVPGNHDVERKMGKGLTRTL
                     ETNDDADEYFDPNTPTPHLTQKFHAFSEWYNDYFKTIRSFPTNTTCSPVELVTINGLR
                     LAVLPLNSALFCIDDHDHKKLFIGRRCLDAARKLLEAADLKVALIHHPLDWLSPIEQS
                     NIEAKLEESVDILLQGHYHQTSTKSIIAENGGYLKLAAGAAYQTRQWPNTAMYATFDG
                     SGVTIFPIRYEDKPKERWTLDTSLYPSPSYTRQYPIPGRVASRQDSLLPSCACDRGMN
                     PDTGCPEIKSYERYREALRNLFGIVASRGLDNYQDIEIPLEDVFIDLHIRELCGNVDA
                     HDKGHTIETKKMSQDALLQEIFHGNARTNVLLLIGDPGSGKTTLLQHYAMLCLEGDHG
                     RLFPEAASVRVLFLELRKLNFDAHNKPVRLAAQIVELNRSLSLAADEAETWWREMSER
                     ERVLVLLDGLDEVTELEKRKAICQWIDEEGHAYPNRFFIVTTRKTGYVTSDGVELIQS
                     HRRAALDDLLPDQQWDFLLKWFRAASKFEKERGFTIHDNTPPDDKARELYAYLYPQEG
                     DKGEEMSSEETEKKKKGLQQIAGIPLLLKLMALLYKLRDFKPDSRIALYRVVIVYLLH
                     GRDNARQISYGIDPEQSATVLGLLAYTMQKKTCLDLSEGEMKEIMESRFRLLTTTVGL
                     DTFFGFMVNRSGILKPNGKAFRFWHKTFQEYLASLEMLRCSKSDAFIRSIVQHYDDRK
                     WEWDETLRFYFAQIDADIFDSFMNQLFNPEITTDVLQRKLQLMKTLIRESRECSTGAL
                     CQKLKDSKLSLGVQWHVLDCLEVINKSAALDAVRNF"
     gene            81090..81395
                     /locus_tag="CPHA266_RS00360"
     CDS             81090..81395
                     /locus_tag="CPHA266_RS00360"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467122.1"
                     /db_xref="GI:752830820"
                     /translation="MDVSQKNNVIYYGWLRKQSVKQGGRNCINEYNRLFMRRLSIMQA
                     SSDAGINVFCAARRQFILLFKKPGDAPKPAKELKERSAMTTAKSGTPVSPDIGTLPR"
     gene            complement(81466..81666)
                     /locus_tag="CPHA266_RS00365"
     CDS             complement(81466..81666)
                     /locus_tag="CPHA266_RS00365"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467123.1"
                     /db_xref="GI:752830821"
                     /translation="MVSLLYVMTPDQHLPEILPIKINQGSSIVFYRDFNKRIVLPQQL
                     GFKKLDTVFLFVLPAFFRVEFE"
     gene            81714..81941
                     /locus_tag="CPHA266_RS00370"
                     /old_locus_tag="Cpha266_0070"
     CDS             81714..81941
                     /locus_tag="CPHA266_RS00370"
                     /old_locus_tag="Cpha266_0070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743982.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CopG family transcripitonal regulator"
                     /protein_id="WP_011743982.1"
                     /db_xref="GI:500064065"
                     /translation="MKTKEFDKAFDQGKDVTVYLDLGKASRVKQQHKRVNVDFPVWMI
                     DSLDKEATRLGVSRQSVIKVWLAERLQQQKG"
     gene            complement(82008..83015)
                     /locus_tag="CPHA266_RS00375"
                     /old_locus_tag="Cpha266_0071"
     CDS             complement(82008..83015)
                     /locus_tag="CPHA266_RS00375"
                     /old_locus_tag="Cpha266_0071"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743983.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_011743983.1"
                     /db_xref="GI:500064066"
                     /translation="MKSPMSGREMTLIKEARTMIFRKKEYPVCYHVYHCNDTQQQFTS
                     TELDEINLVQVYNQYRDEHNLPFPEEIRSIREAYGLSAAKMAEVLGLGTNTYRNYEQG
                     EVPSESNARLIQVAQDPEEFRKIVCLSCALKGNQLEKLNARIQHLIENRKKTTCIDIE
                     EYLMGSKLPDEYSGYLKPSLEKLGEMVVFFAEKLKPWKTKLNKLLFYADFLHFKRSGF
                     SISGTRYCAIPLGPVPDNFNSIFEWMEKKGALAIIEQEFPDGGTGERFFPAESRSFDE
                     RKFSAKELDTLNTVAFAFLKTGTKEIIAISHNENAWIENIHAGNGMISYLRYGFDLKA
                     L"
     gene            complement(82993..83373)
                     /locus_tag="CPHA266_RS00380"
                     /old_locus_tag="Cpha266_0072"
     CDS             complement(82993..83373)
                     /locus_tag="CPHA266_RS00380"
                     /old_locus_tag="Cpha266_0072"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743984.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="toxin"
                     /protein_id="WP_011743984.1"
                     /db_xref="GI:500064067"
                     /translation="MTATKHQVHAFLRDFKNKLKIWSIVFRDDRGKNAQTLLDLEIRP
                     VDRQKIIEDLDAEDYSEGPIDDIMNKGPEMWVFGKEVKRCEIYIKITKVSPDASVICI
                     SFHIAEHRISYPLKTQCHEKPDER"
     gene            83855..>85117
                     /locus_tag="CPHA266_RS00385"
                     /old_locus_tag="Cpha266_0073"
     CDS             83855..>85117
                     /locus_tag="CPHA266_RS00385"
                     /old_locus_tag="Cpha266_0073"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743985.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA methylase N-4"
                     /protein_id="WP_041467442.1"
                     /db_xref="GI:752831140"
                     /translation="MKTRHTIIEGDSRQMNLLPDSSVHLIITSPPYWQLKDYGTENQI
                     GFHDSYESYINNLNLVWSECERVLHPGCRLCINIGDQFARSVYYGRYKVIPIRTEIIR
                     FCETIGFDYMGAVIWQKVTTTNTTGGASIMGSFPYPRNGILKLDYEFILLFKKQGDAP
                     KPSKELKERSAMTTEEWNTCFSGHWNFAGAKQDGHIAVFPEDLPHRLIRMFAFVGETV
                     LDPFMGSGTTSLAAKNLDRNSVGYEINPEFIGIAREKLNSNQTDFAGTEYVFQHDTLK
                     GDISEMIERLPYRFQDPHKLDKKIDPRKLTFGSRVEKGGGAKQEETFIVREILSPEMV
                     RLSNGLTVRLIGVKEDPFTREKAVGYLVDKIKGKRIFMKYDSMKYDGRNNLLCYLYLE
                     NRTFVNAHLIRSGLVGIDGSYEYRYKQKF"
     gene            complement(85239..85529)
                     /locus_tag="CPHA266_RS00390"
                     /old_locus_tag="Cpha266_0074"
     CDS             complement(85239..85529)
                     /locus_tag="CPHA266_RS00390"
                     /old_locus_tag="Cpha266_0074"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005816035.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467124.1"
                     /db_xref="GI:752830822"
                     /translation="MKQEITMRIENLDDVAEFARTVILNGVNLHPDDDFRNYVNIETG
                     QPTYTEEEASAYNRNMANAFSICDKCGVDIYGFMQKIFLVETGLDKVIPMPD"
     gene            complement(85572..85790)
                     /locus_tag="CPHA266_RS00395"
     CDS             complement(85572..85790)
                     /locus_tag="CPHA266_RS00395"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467125.1"
                     /db_xref="GI:752830823"
                     /translation="MGEEKKYTEAEIMSLSGLSRQTLFNMRTGRESGKYEYLPKLKTP
                     EHYTIFGRTIMYSEKGKDAILDTVQKRK"
     gene            complement(85805..86278)
                     /locus_tag="CPHA266_RS00400"
                     /old_locus_tag="Cpha266_0075"
     CDS             complement(85805..86278)
                     /locus_tag="CPHA266_RS00400"
                     /old_locus_tag="Cpha266_0075"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011743987.1"
                     /db_xref="GI:500064070"
                     /translation="MKMPSTAKLIADLLYDYENEPETTFGDLVDGIEDLSIETGDLEL
                     SLAISKYRIEERYDRKYLGMRGDMDSVEADFIEAVRLLAFGRTFSEDRNASANFDNWD
                     YTLINSTIEKGQPYPAVLIYKVIGAREHELPLLEKAGYTLFNDTYLPPSAGKTSD"
     gene            86782..88353
                     /locus_tag="CPHA266_RS00405"
                     /old_locus_tag="Cpha266_0076"
     CDS             86782..88353
                     /locus_tag="CPHA266_RS00405"
                     /old_locus_tag="Cpha266_0076"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011745977.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_011743927.1"
                     /db_xref="GI:500064010"
                     /translation="MRTQLKKLTMYNKVKEFAREGLSIRQISRKTGMDRVTVRKFLRM
                     TDEEFSAFLALQKRRLRKLQPYEQFVKDRVTDYPDCSATQVEDWLKEHHPVFPEVTTR
                     TIYSFVQWIRKAYDLPKPKGTPRAYHPVEQLPYGEQAQVDFGEYWMASADACKVKVHF
                     MIMLLSRSRRKFVSFSQQPITTRFVLEAHEQAFSFFEGIPHTLVYDQDSTIVTDENRG
                     AILYTEAFRKYLLHRSLKIHLCRKSDPESKGKIEAGVKYVKYNFLPGRRFVNLEVLNQ
                     EALLWLERTANAKEHATTRLIPDAEWQVEKQHLRPFEPLPYPISGTVGKEYHVRKDNT
                     ISYRGNFYSLPVGTYAGPGTLVVLEVRQNTLCLYAQEGRLLANHPIESGKGTVVINNN
                     HRRDTSSKLRELQDSLMLLFTNQEHAERFLESIHNRYPRYSRDQFLHVRNAISGCQQK
                     LIDDALAHCVDHHLFSSGEFHDILHHYRKQEEKQSHQAVFNTFRPKTLRSDMDRMLSF
                     VPDSSGITTYENIFS"
     gene            88359..89195
                     /locus_tag="CPHA266_RS00410"
                     /old_locus_tag="Cpha266_0077"
     CDS             88359..89195
                     /locus_tag="CPHA266_RS00410"
                     /old_locus_tag="Cpha266_0077"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743928.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_011743928.1"
                     /db_xref="GI:500064011"
                     /translation="MERTITTIQEHARELNLTGLAGTVDLLLEEARKSEPSYSDFALT
                     LLESELSCRRKAHLERRRKIANLPLLHDLDHYDSGVQNGISQVQLQQLRQLLWLDQNF
                     NLILIGPSGTGKSYLAGGLCHEALKLGYHALFRTMDDLIQTIRFKEITAAAAREYKRL
                     LSAHLLVIDDIMMFPLEKSVAVGLFQLVNQLHEQTSFIITTNKSPKEWAEMLGDEVLA
                     TALLDRLLYKCEVIKLTGKSYRLEHRTTIFEQQQSPEGGGNRRKKQLPLQKGVGNHCK
                     MT"
     gene            complement(89710..91437)
                     /locus_tag="CPHA266_RS00415"
                     /old_locus_tag="Cpha266_0078"
     CDS             complement(89710..91437)
                     /locus_tag="CPHA266_RS00415"
                     /old_locus_tag="Cpha266_0078"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004359142.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467126.1"
                     /db_xref="GI:752830824"
                     /translation="MSEITSSFNDFILKSVSRYLQTVVLIDDKIYPPKAVRTPTDLQE
                     PPSRHRKAASKSAEPVLEKKEVIDKLAEEIDQSEEVSFHDIQNSFAEKRIICSLYQPK
                     QGASFNSSSDVYNLCSVADVVVVDWDIHGDSGKKATELVVTLIEQSMKEVPHQLRLVL
                     IYTMDPNLGSVANSVYEAFSSQIDTALIDVLEDGNGLVFTSENARVVVLGKKINTAFL
                     QYSDFFVPEKDLAERTINEFSHLASGLLQCIILQGIASLRENNRRILMRFHKGLDAAF
                     LAHRALLMPDEAFGQIIPMLTDELRAVLEDNLGEHPLGDEIISKEIISDWCNKHWKPV
                     TVSDLQIGSSVDPTAFAIDVFCNGSNIADYSKYRGSRISGMLEMKDGLNKWKEKKCDL
                     LAEYLSSDEKGNFSHEMLSALMSQRIAYENSRKSLRLGVILRIKITEKPRYMLCLQPV
                     CDSVRVNEKGTPFIFCLLDVPNNGSIFTHTVKDSSDSTIRLVYKAKVTNCYISLFSSN
                     TGVVCASENGEGQFIFKDTEDKEYEWVAELKIEHAQRAAEEFGRILSRVGLNESEWLR
                     LKTKQLNNQ"
     gene            complement(91430..94393)
                     /locus_tag="CPHA266_RS00420"
                     /old_locus_tag="Cpha266_0079"
     CDS             complement(91430..94393)
                     /locus_tag="CPHA266_RS00420"
                     /old_locus_tag="Cpha266_0079"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001063091.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_011743989.1"
                     /db_xref="GI:500064072"
                     /translation="MAKFRTKARAVDMLGRQQIADASTAISELFKNAHDAYADNVEVD
                     LFKSDSLLVIRDDGIGMSPSEFEANWLVLGTDSKFSSAGKLHAYRPSNKPERAVMGEK
                     GIGRLAIAFLGPQVLVLTRSEKLDHNDTLTMCYLHWGLFEQQALNLDDIDIPVKSISG
                     GELPSLQDVSELLLENTRNVEQLQKRFPQCDLCSIIDDLSDFQVDPRDFEKSVQGLSL
                     SDHKCGTHFYIATANEVIIADIVAEKYTLTKEFTKCLLGFCNSTFAETSPPPIQTKFR
                     YWPTDNRYEDLIAPNEFFTTDDLALSDHFVSGEIDEYGQFNGIVRVYDQEYPDHVISW
                     KEGGGKPTECGPFRVEFGYLQGAHRESMADPDDWSILDSKLKQIGGLYVYRDRIRILP
                     YGNSNVDWLDIELRRNKGMGYYYFSYRRIYGAICTTRKENATLREKAGREGFQKDKAY
                     RQLKSVLENLFIQLAADFFRKDATHGDYFQERKDELDRLERARRKREQQITTKRTKLS
                     DTLDVFFSKVNERIPESEIATLSHHVQSRMQSASFMMDSDTASQELLDAEREANEKLA
                     LLRTTYTLIRPRGVGLTKQLTRDWDAYQREHNRLEIEVFEPFVKDVGKKLGSMAAQAK
                     IYIDQRRRLQELIKNVADEQNANVKNESKVLQETSSQTRRAAVNTARSAMKELRDTIE
                     AVNADLAHRDLNDLLPEQIEEIRSTYEKRIDSVASRNAETLGSVRELLAGIVESLENN
                     MQNSQLDIVEAMDTELESLREQAETDEELVQLGLAVAVINHEFVAAIKMIRGQLRELR
                     SWAMVNKDLLPVYQEIRTNFDHLDAHLNLFTPLQRRLYKKRVNIEGKEIIHYVRALFN
                     VRFERHKIHLEATQAFLDSHVTSYPSTIYPVFVNLIDNFIFWLKDKQGDRLISLDCTD
                     NSYHIKNNGPAINRRDAESIFEQGFSRKPGGRGLGLYISKKVLEKEGMTLALDKTLTM
                     DSGVSFNLSWSDNNE"
     gene            complement(94386..95501)
                     /locus_tag="CPHA266_RS00425"
                     /old_locus_tag="Cpha266_0080"
     CDS             complement(94386..95501)
                     /locus_tag="CPHA266_RS00425"
                     /old_locus_tag="Cpha266_0080"
                     /EC_number="2.1.1.37"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007291593.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-cytosine methyltransferase"
                     /protein_id="WP_011743990.1"
                     /db_xref="GI:500064073"
                     /translation="MNQQSEPTCSKIRVYDFFSGCGGTSVGFGRAGIQHALAVDSCSD
                     AISTYQKNFIGVPVITDPIETLNVDRIQNYFSHNPEVKLFCGCAPCQPFTKQKTNTKK
                     DAASDDRRGLLIYFSDIVHACLPELVFVENVPGLQKFSLEDGGPLAMFISRLKQNDYF
                     VDFDVIAAQDYGSPQVRRRFVLIASRLGKITLPAPTHGPNTKNSYVTVHDAIGNLPSV
                     KHGTEHPDNQNYPNHRAAMLSALNLERIRHTGANGRRDWPERLLPKCYAQKKDGKRYE
                     GHSDCYTRLAWGEPAPGLTTRCISYSNGRFGHPEQDRAITIREAAKLQGFPDDFIFTG
                     SLNSMARQIGNAVPVSVAEVFGRHFLNHVKAMESTNG"
     gene            complement(95816..97144)
                     /locus_tag="CPHA266_RS00430"
                     /old_locus_tag="Cpha266_0081"
     CDS             complement(95816..97144)
                     /locus_tag="CPHA266_RS00430"
                     /old_locus_tag="Cpha266_0081"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743991.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467127.1"
                     /db_xref="GI:752830825"
                     /translation="MRLSTLQSIMKNKGCRTIYAKVLAANDNRKQQVYFGGDFQAINI
                     IPFDTIAPDPDKPHIFKAPLNFWWLSDDESLHNASRAQLILYPQYPEVRFSGFLQGCS
                     AAPSELMDERLRLAGRILFLGISPDGRIIGYLCHPESELAREFVSLGELPRSGVFLEP
                     GLGTGVLDDRSLLIEKLRVIHQKGWIRSRKLGSNGVILPCEAPNCGGMTLEAELDIIP
                     NSRSEPDWLGYEVKQYNVTNFQRINSGVLTLMTPEPTGGYYRSAGIEAFIRKFGYPDM
                     TGAADRGDRLNFGGIHKVGEYHRLTSLQIVLKGFDAIKGKITDATGGISLMNIEGEEA
                     AVWGYAEVMAKWNRKHNKAVYIPSRCVQSPERRYWYGNLIRIGTGTDFLKYLQAMAEG
                     KVYYDPGIKLENASTTPRTKQRSQFRIKSSNLPALYHSMDIVDLNEEQSE"
     gene            complement(<97152..97595)
                     /locus_tag="CPHA266_RS00435"
                     /old_locus_tag="Cpha266_0082"
     CDS             complement(<97152..97595)
                     /locus_tag="CPHA266_RS00435"
                     /old_locus_tag="Cpha266_0082"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743992.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA glycosylase"
                     /protein_id="WP_041467443.1"
                     /db_xref="GI:752831141"
                     /translation="MADVVSPETRSRMMSGIRSENTVPEMRVRRGLHARGFRFRLHCG
                     GLPGKPDIVFPKYRAVIFIHGCFWHAHECPLFKWPKTREDFWKKKIGKNRIRDLAVMD
                     ELARQGWRVLIVWECALKGKGRRPIDEVVDSCAEWLLSSSTKREIR"
     gene            complement(<97663..98865)
                     /locus_tag="CPHA266_RS00440"
                     /old_locus_tag="Cpha266_0083"
     CDS             complement(<97663..98865)
                     /locus_tag="CPHA266_RS00440"
                     /old_locus_tag="Cpha266_0083"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743993.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytosine methyltransferase"
                     /protein_id="WP_041467444.1"
                     /db_xref="GI:752831142"
                     /translation="MNTTQSFSVLRQQAGLSIDKIAHITGYSQREVYRWEKNEVVPRK
                     MVLDQLTRIAQPLSTYGKDSSSFTFIDLFAGIGGMRKAFEELGGRCVFTSEWDKYSRQ
                     TYCANFDCDHEIGGDITKIDARDIPSHDILVAGFPCQPFSIAGVSKKNALGKPHGFAD
                     KTQGTLFFDVARVIEYHQPKAILLENVKNLQRHDKGKTFAVIKETLTELGYYFDWKII
                     DAGNWVPQHRERIFIAGFREDCGFSFDRFDLPHGNERPVIETILHPENGMEDEEPPYT
                     VGPLARISDRYTLSDHLWEYLQKYAEKHRAKGNGFGFGLVGPHDVARTLSARYYKDGS
                     EILVKQEGKNPRRLTPRECARLMGFDTPNGNSFVIPVSDTQAYRQFGNAVVVPVVMSV
                     ARYMLEYLM"
     gene            complement(98862..99062)
                     /locus_tag="CPHA266_RS00445"
     CDS             complement(98862..99062)
                     /locus_tag="CPHA266_RS00445"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467128.1"
                     /db_xref="GI:752830826"
                     /translation="MNGKLCRSRAINQAMLPDVDFFPVAGFRCLPCPFLPFLLHDFHA
                     GIYGLLLILVIMSKYFPWRRGS"
     gene            complement(99268..100713)
                     /locus_tag="CPHA266_RS00450"
                     /old_locus_tag="Cpha266_0084"
     CDS             complement(99268..100713)
                     /locus_tag="CPHA266_RS00450"
                     /old_locus_tag="Cpha266_0084"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743994.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_011743994.1"
                     /db_xref="GI:500064077"
                     /translation="MIINSSELTGVLRQYNPWWSGNRFPDLPAWKRAAFHEIAHWVEN
                     PPAGRALLLSGARQVGKTTLFLQAIDELLAKGIPPGNILYATFDHPLLKLAGLDGLLR
                     LWDEAEPSKQGTEYLFLDEIQSIKEWQVWLKHQVDFEKRRRIAVTGSATPLAMEGQES
                     GVGRWHTIKLATLSFYEYLKLRNDPVPKLPAISSLADLFDMTPAWFSKTGSEARILTG
                     FFHEYLLRGGFPQTATVSSIPLAQKLLREDIVDKILKRDMTALFGVRRIIELEQTFLY
                     LCLHDGGMLDMQELSKNLEVKRPTAMSFISILEATHLIYRLQPFGYGKEILRGKHKIY
                     LADPAIAPGVLLKGISLLDNPTLLGQAAETAFFKHVFSRYYARSIAFSYWRGGKKGLE
                     VDIIADIGGRYVPFEVKYRSTAVETADLKGLTEFCRTRAVNKSCVITRNMEDFGIIPL
                     TGDNNIQALKIPAPLVCYWLGESETTSAVGS"
     gene            complement(100871..101596)
                     /locus_tag="CPHA266_RS00455"
                     /old_locus_tag="Cpha266_0085"
     CDS             complement(100871..101596)
                     /locus_tag="CPHA266_RS00455"
                     /old_locus_tag="Cpha266_0085"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743995.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-phosphopantetheinyl transferase"
                     /protein_id="WP_011743995.1"
                     /db_xref="GI:500064078"
                     /translation="MIIAKETVTLIHTDTKIHGLPETELYESLSDDEKTRAGRIHAAS
                     ERQNFIVRRGILRSLLGTTFGIEPFRIRFAATPVGKPFVAFPGNSGIFFNLSHSGNDI
                     VYAFSGHPETGIDIERIRTLEDIDELARNYFSAEEYAILMNQPGWKKNNAFIRIWSLK
                     EALIKASGWPLEQGLAAFDVAAYCQMNRFELPFGDIHTFTCIAPVFDYICGFATALAI
                     RLDRNEPLNIKRYSLQGGQFFEL"
     gene            complement(101725..102045)
                     /locus_tag="CPHA266_RS00460"
     CDS             complement(101725..102045)
                     /locus_tag="CPHA266_RS00460"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467129.1"
                     /db_xref="GI:752830827"
                     /translation="MNSKNPSVSSMKPGVFISYTQNQPFVIVIVLVNYSGFIKEVRKL
                     VCIIRPFDRQRGCVRTIRRAIARLSTENIGDARENQLPISFRANSCNSWATPPLHQSV
                     FYYG"
     gene            complement(102059..102997)
                     /locus_tag="CPHA266_RS00465"
                     /old_locus_tag="Cpha266_0086"
     CDS             complement(102059..102997)
                     /locus_tag="CPHA266_RS00465"
                     /old_locus_tag="Cpha266_0086"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012465048.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011743996.1"
                     /db_xref="GI:500064079"
                     /translation="MKRITIPALLAIMLLLCQSLSFAAVSQFTGTWKNTDPNTAGVTK
                     LSITGNGNSLRMRAWGKCHPQDCDWGEVNAYAYAPGVSSDIDQNAQAVSALFTTGFSQ
                     TLVIVRPISRSSIRADIYTRFTDNSGRSNYTASYTFNRQLIVGPIGPIGPIGPIRPMP
                     SVEEDCISFNPSTVTVKNLDGRWTIVDGNHLMFNFGPNRTEALQALRIIKHYRMNSSC
                     FVGRPDPSFQYLLVNGRAPQGNMPGEDCVSFNPNTIEVRNIGGSWKIVDGSHWVFDFG
                     SKEDEARKAFAIIKKYGFTRSCFVGRPDPSFQYLKK"
     gene            103094..103168
                     /locus_tag="CPHA266_RS14235"
     ncRNA           103094..103168
                     /locus_tag="CPHA266_RS14235"
                     /ncRNA_class="other"
                     /product="sX9"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
     gene            103347..104657
                     /locus_tag="CPHA266_RS00470"
                     /old_locus_tag="Cpha266_0087"
     CDS             103347..104657
                     /locus_tag="CPHA266_RS00470"
                     /old_locus_tag="Cpha266_0087"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743997.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_011743997.1"
                     /db_xref="GI:500064080"
                     /translation="MSNADESINGNDNSPAEQSPTTLKEKVLSAFPAFRSRNFRLYFI
                     GQIVSMVGTWLQMVAQGWLVLEMTGSAFWVGVAAAASSLPTLFLSLIGGVIVDRYNRK
                     TILLWTQSASMVLALVLGIITLTGSVTLAVILALAFLLGCVAAVATPAIQAFLSEMVD
                     RDQLHSAVALNAAIFNASRVIGPAIAGLMIAWIGTGGAFIANGLSYFAVIAALLAITI
                     ATPRKIPAVHQPPLQSIRDGIVYTWEHPVIRTIVMFVSVVSIFGWSFMSMLPVVAKQT
                     YGLGSDGMGYLFSAFGLGSLSGTVVVSMSSGKIRSSAMVIGGILVFSLALTAFTFASD
                     ERVAMAFLFIAGIGMLSAFATMTATVQRLVEDSYRGRVMSIYLMVLMGFMPLGNLQVG
                     FLSEQFGTAIAIRIGSIVVLLATIFLFSYRKEIQSAWHEYRMQE"
     gene            complement(104732..105310)
                     /locus_tag="CPHA266_RS00475"
                     /old_locus_tag="Cpha266_0088"
     CDS             complement(104732..105310)
                     /locus_tag="CPHA266_RS00475"
                     /old_locus_tag="Cpha266_0088"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743998.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011743998.1"
                     /db_xref="GI:500064081"
                     /translation="MQFGKTFQIPALIAVSCALVAPAPAMAEHGRNTRTVAAAVAAAA
                     IVGLAINAANHQGHYKDGRRYDNDRDSGEFDRGYRDGLYDTNRNNYNHTDAYRDGYRA
                     GQDERELRVSHNQSNRWEQGRHVADSNMMYKATDEAERYWNLPRGSATPVRSSYNEDS
                     GNYRVAVAAGYLRGVCVLDRYGRVIRFEDKRD"
     gene            complement(105373..105780)
                     /locus_tag="CPHA266_RS00480"
                     /old_locus_tag="Cpha266_0089"
     CDS             complement(105373..105780)
                     /locus_tag="CPHA266_RS00480"
                     /old_locus_tag="Cpha266_0089"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743999.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA breaking-rejoining protein"
                     /protein_id="WP_011743999.1"
                     /db_xref="GI:500064082"
                     /translation="MKTKSLVFLLLFTLFSIRAYAADDRYEQVKFPRGASGTSIKSSI
                     VGYQGVNYTLDAKAGQTMTVKLQSSNLSNYFNIYAPGKGPGDEAMVIGDINGNSYSGV
                     LPSTGTYTIQVFLMRNAARRNEKASYTLDISVK"
     gene            106136..106678
                     /locus_tag="CPHA266_RS00485"
                     /old_locus_tag="Cpha266_0090"
     CDS             106136..106678
                     /locus_tag="CPHA266_RS00485"
                     /old_locus_tag="Cpha266_0090"
                     /EC_number="1.8.4.11"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744000.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine-R-sulfoxide reductase"
                     /protein_id="WP_011744000.1"
                     /db_xref="GI:500064083"
                     /translation="MHRMLMFIFFATVGLFACSGEPTSPKFSPSKAMSDSRALNPYYS
                     RTDTTKLDLPDSVWKKVLPPEVYEVARKAGTERAFTGKLWDFEGIGTYYCAACGNALF
                     RSDAKFASTCGWPSFFETVRPGSVEYRTDMAFGMARTEVLCGRCGAHLGHVFDDGPPP
                     TGKRFCMNSIVLDFEPDEGD"
     gene            complement(106689..107087)
                     /locus_tag="CPHA266_RS00490"
                     /old_locus_tag="Cpha266_0091"
     CDS             complement(106689..107087)
                     /locus_tag="CPHA266_RS00490"
                     /old_locus_tag="Cpha266_0091"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744001.1"
                     /note="stability determinant protein; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="twitching motility protein PilT"
                     /protein_id="WP_011744001.1"
                     /db_xref="GI:500064084"
                     /translation="MRYLLDTNICIYIINSRPADVLKRFRQEQIGTIGISSITAAELT
                     FGVIKSGSEKNRRALEMFFTPLEILPFDGSIIWHYGRLRYYLEKLGQPIGALDTMIAS
                     HALALDTVLVTNNVREFMRVPGLRYENWAE"
     gene            complement(107084..107317)
                     /locus_tag="CPHA266_RS00495"
                     /old_locus_tag="Cpha266_0092"
     CDS             complement(107084..107317)
                     /locus_tag="CPHA266_RS00495"
                     /old_locus_tag="Cpha266_0092"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744002.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="virulence factor"
                     /protein_id="WP_041467130.1"
                     /db_xref="GI:752830828"
                     /translation="METAKIFQSGRSQAVRLPKEFRFQGKEVLISHFADGVLLLPIDK
                     SWATLEAALEEFEPEFKLEREQPEAEKREAIAS"
     gene            complement(107423..108994)
                     /locus_tag="CPHA266_RS00500"
                     /old_locus_tag="Cpha266_0093"
     CDS             complement(107423..108994)
                     /locus_tag="CPHA266_RS00500"
                     /old_locus_tag="Cpha266_0093"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744003.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator transporter"
                     /protein_id="WP_011744003.1"
                     /db_xref="GI:500064086"
                     /translation="MLPAAHAYETGSRRIIITLTVIVSAMLELIDTTIVNVAITEISG
                     NLGASIEDVAWVVTSYAIANVIVIPLSGFLGNLLGRRNYYIGSILLFTAASLLCGIAT
                     DIWTLVFFRFLQGIGGGALLPTSQAILYETYPPEDRGKATGIFSMGLVLGPTFGPLLG
                     GFLVDNFSWEWCFFVNIPVGLLAAWSAFTFIKEPKTVHKVVKIDWAGIGLLTIGIGSL
                     QFILERGESKDWFETPYITWFTIIAIVSLMLFVWWELRVEEPAVDLSVLARSHNLAIA
                     AVLTFVVGYGLYGSLFVFPVFVQRLLGFSALLTGTVLFPSALVTGIIALPLGIALQKG
                     ASAKILMTVGMAAFSIFCWELGQQTMQSGAGNFFWILLLRGVALGFIFIPVTMLAVAG
                     LHGKDIGQATGLNNMVRQLGGSFGIALTNTYIVKRVAEHRNEILSNLSPYDPAAVERL
                     NAIGQAAQSRMISPVEAEQVALRALEGTVTAQSYHLAYMDAFMLIALLFALCMPLLFF
                     IRIKKGEKADLSQAH"
     gene            complement(109147..110133)
                     /locus_tag="CPHA266_RS00505"
                     /old_locus_tag="Cpha266_0094"
     CDS             complement(109147..110133)
                     /locus_tag="CPHA266_RS00505"
                     /old_locus_tag="Cpha266_0094"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744004.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="secretion protein HlyD"
                     /protein_id="WP_011744004.1"
                     /db_xref="GI:500064087"
                     /translation="MAEQEKNIGTAEKPEEKATNPLRLVITVLLVLAAVVWGGSKIRH
                     SFLYVETDNAQIEGDVYPVISKVPGTVQSVLVRTNQEVRRGDTLVLLDPADYKVKRDM
                     AEAALQNARASVSAAGEAATAAAATGQKLKSDLARSQNLRRQDVISPSEFDAVKAAAL
                     SSSAQSAAAESQHRGAAAQVTMRQAELRNADLQLSYTTITAPAAGHVSKKNVQPGQYV
                     APGQQLIALVGSSELWVVANFKETQLENIRTGQPVTIRVDAYPGKEFEGRVESISSGT
                     GARFALLPPDNASGNFVKVAQRVPVKILFTGKPDKDHKLAAGMNVVVEIKVK"
     gene            complement(110135..110608)
                     /locus_tag="CPHA266_RS00510"
                     /old_locus_tag="Cpha266_0095"
     CDS             complement(110135..110608)
                     /locus_tag="CPHA266_RS00510"
                     /old_locus_tag="Cpha266_0095"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744005.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein UspA"
                     /protein_id="WP_011744005.1"
                     /db_xref="GI:500064088"
                     /translation="MKTKPKKIICAVDFSPLSDNLVTYAAGLRPYDAELTLLYIEKEG
                     KRTLNMLQNRLHAFSRYSELLVQANRSARFAVECGDPAAEILAYADRVHADLLLLGSH
                     GSTAFTRLLMGSTAETVLRRAACPVAIYKVPDRRTPARKRQEATTLLLKDNKQTA"
     gene            complement(110611..111936)
                     /locus_tag="CPHA266_RS00515"
                     /old_locus_tag="Cpha266_0096"
     CDS             complement(110611..111936)
                     /locus_tag="CPHA266_RS00515"
                     /old_locus_tag="Cpha266_0096"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744006.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_011744006.1"
                     /db_xref="GI:500064089"
                     /translation="MKKTLKIHACIATAALMLAIPHRTDAVMPPPGAPMTLEETIMLV
                     KENNPALKAAAEEVNAADARIRQQKSAYYPQISASAGYRYIDPVSEMGFGGSEPLQFM
                     PNNNYEAKISAKATLLDFGRRGVEIDLAESGKNSAVHTLTLTRRDLSFSTVELFYGIL
                     FLRESIRVEEKEITALQKAFDYTSKRYQAGTATRFDVLTTDVRIQAARSKKLNLEHQV
                     RRNELALYRLTGIATDRPLELKGSFSVHPARPLESTLVAEAMKQRPEVQLAGENEQSA
                     KLRRSLAVKAGLPVVSATASWGAANGYQPDIDEIRENIAAGIHIELPIFTGFRTTAER
                     QEASARLRAATLRKLDTEEQVKTDVEETLHALETARKNILTTQSQVQLANLAAEHARA
                     RYQNGIATTLDLLDTESSLAQAELSRLQAAYDYVMNSYTLKRATGETFW"
     gene            112186..114285
                     /locus_tag="CPHA266_RS00520"
                     /old_locus_tag="Cpha266_0097"
     CDS             112186..114285
                     /locus_tag="CPHA266_RS00520"
                     /old_locus_tag="Cpha266_0097"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744007.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fis family transcriptional regulator"
                     /protein_id="WP_011744007.1"
                     /db_xref="GI:500064090"
                     /translation="MQNIAVHEASTLMRYISNAIGSIRDPQELFRTVTDKLRLVFEFD
                     SAFIITLDRDRRFINVVFEMVRFDLPDTIQRKKRPVAGSWIESHLGDEGVSVVAIEGE
                     MDRYPADFPVPRMLYDLGMRQVVLSPLRSGGKVIGFLNFVSREQKQWKESDKELLSTL
                     SSPVAVALSSALAYEELRQREAQTAMQLAVNNALLTIKDRSRMLLAVCEQIDKLVPCT
                     FLGIRVMDRDGNFRIFDNFMRETPSGFFPVSAHEKLDVPDFAEMARESFSLITSPGCF
                     SGEAFQLLCDKYRLVGLVREKFNICSLISVRLWDLPGSCAGLIISDTSRAFDEHDQET
                     VGLIVPQLSLALQNYLAFEEIDKLRRKLEGEKAYLFEEIKATHDFEEIKGESAVLASV
                     LHRVSQVAPTDATVLIQGETGTGKELFARALHNLSRRRNRMLVKVNCAALPATLIESE
                     LFGHEKGSFTGAIERRIGKFELAEGGTVFLDEVGELPLELQAKLLRVLQERELERLGG
                     RGVISVDVRVLAATNRNLEKEVAEGRFREDLFFRLNVFPLFVPPLRERREDIPLLALY
                     FAAKFARLMGKPHCEFRESDMLLLKAREWKGNIRELAHLVEQAVIVSDGRWLDFSTML
                     SPSLAFTEPREQGQLKSMREFEEQVAMMERELILEVLSQSNGRVSGEGGAAEKLGMHP
                     KTLYSRIEKLEIRKRYR"
     gene            complement(<114356..115630)
                     /locus_tag="CPHA266_RS00525"
                     /old_locus_tag="Cpha266_0098"
     CDS             complement(<114356..115630)
                     /locus_tag="CPHA266_RS00525"
                     /old_locus_tag="Cpha266_0098"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744008.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_041467445.1"
                     /db_xref="GI:752831143"
                     /translation="MEILFLLFLIIINGIFAMSEIALITTKRTRLTKLAESGDKSAAA
                     ALKLGHEPTTFLSTIQIGITSIGILNGIVGQGALAEPFAVWLESLGMAHDASHIGATA
                     VVVISITYITIVVGELVPKRLGQFNPEGAARLFARPMLMLATIARPFVRLLSVSTDTL
                     LRLMGKSPQAMPSVTEEEIHAMLEEGSEAGVIEQQEHDMVRNVFRLDDRQLGSLMVPR
                     ADIVYLDITRPLEENILRVTESEHSRFPVCNGGMQSLLGVVNAKQLLSQTLKGGLNDF
                     TSQLQPYVYVPETLTGMELLDHFRTSGTQMVFVVDEYGEVQGLVTLQDMLEAVTGEFV
                     PRNLEDSWAVEREDGSWLLDGLIPVPELKDKLELLSVPEEDKGLYHTLSGLLMWSLGR
                     MPQTGDVATWENWRLEIVDLDGNRIDKVLASKI"
     gene            complement(115662..115913)
                     /locus_tag="CPHA266_RS00530"
     CDS             complement(115662..115913)
                     /locus_tag="CPHA266_RS00530"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467131.1"
                     /db_xref="GI:752830829"
                     /translation="MIFSCLNLFVRQYVIINEFLTATLTSFGSELLLSGIFDPDEQRR
                     KEPWKGRKKKCGKNIPEKSYLYPETTGFPVRLLINETPH"
     gene            complement(116027..116800)
                     /locus_tag="CPHA266_RS00535"
                     /old_locus_tag="Cpha266_0100"
     CDS             complement(116027..116800)
                     /locus_tag="CPHA266_RS00535"
                     /old_locus_tag="Cpha266_0100"
                     /EC_number="1.3.5.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744010.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinate dehydrogenase"
                     /protein_id="WP_011744010.1"
                     /db_xref="GI:500064093"
                     /translation="MNFTLKIWRQSNTKAKGGLVTYNVADISAECSFFEMLDILNQQL
                     ITSGNDPVSFDHDCREGICGTCSLYINGRPHGPLKGITTCQLHMRSFSDGDTITIEPW
                     RAKAFPIVRDLIVDRSALDKIIQAGGYISVNTGGIPDANTLPVQKERSDASFDAAACI
                     GCGACVAACPNASAMLFAGAKVSHLSLLPQGKIEAARRVRNMVACMDELGFGNCSNSY
                     ACEAECPKGISVSVIARMNREFLGAKLFSEKDKAIRNAL"
     gene            complement(116807..118747)
                     /gene="sdhA"
                     /locus_tag="CPHA266_RS00540"
                     /old_locus_tag="Cpha266_0101"
     CDS             complement(116807..118747)
                     /gene="sdhA"
                     /locus_tag="CPHA266_RS00540"
                     /old_locus_tag="Cpha266_0101"
                     /EC_number="1.3.5.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744011.1"
                     /note="part of four member succinate dehydrogenase enzyme
                     complex that forms a trimeric complex (trimer of
                     tetramers); SdhA/B are the catalytic subcomplex and can
                     exhibit succinate dehydrogenase activity in the absence of
                     SdhC/D which are the membrane components and form
                     cytochrome b556; SdhC binds ubiquinone; oxidizes succinate
                     to fumarate while reducing ubiquinone to ubiquinol;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinate dehydrogenase"
                     /protein_id="WP_041467446.1"
                     /db_xref="GI:752831144"
                     /translation="MIPLAAGIPEGPISEKWTSYKSGARLVNPNNKRKLDIIVVGTGL
                     AGASAAATLGQLGYRVKVFCYQDTPRRAHSIAAQGGINAAKNYQNDGDSVYRLFYDTI
                     KGGDYRAREANVYRLAEVSREIIDLCVAQGVPFAREYGGLLANRSFGGAQVSRTFYAR
                     GQTGQQLLLGAYGALSRQIAAGTVTLYNRRDVLDMVIEEGKARGIIARNLVTGEIESH
                     SAHAVVLASGGYGNVFYLSTNAMGSNVTPAWSAYKKGAFFANPAFTQIHPTCIPVHGD
                     FQSKLTLMSESLRNDGRIWVPTDKAIAEKLRKNEITPLDVAEKDRDYYLERRYPAFGN
                     LVPRDVASRAAKERCDAGNGVGITGMAVYLDFADAIKRKGHDTIDALYGNLFQMYEQI
                     SADDPYKTPMKIYPAVHYTMGGLWVDYNLMTTVPGLFSIGECNFSDHGANRLGASALM
                     QGLADGYFILPYTIGNYLASEIHTPRIETGCSAFELAAQSVNDRLSRLMHTGGKQSVD
                     YFHRKLGLIMWEYCGMARTREGLIKALDLINELKTAFALDVRIPGGMQEYNPELEKAC
                     RVADFIELGELMVRDALQRNESCGGHFREEFQTPEGEALRNDEEFAFVGAWMYNGPDT
                     KPSLHRENLQFSEIKLSQRCYK"
     gene            complement(118798..119460)
                     /locus_tag="CPHA266_RS00545"
                     /old_locus_tag="Cpha266_0102"
     CDS             complement(118798..119460)
                     /locus_tag="CPHA266_RS00545"
                     /old_locus_tag="Cpha266_0102"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744012.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinate dehydrogenase"
                     /protein_id="WP_041467132.1"
                     /db_xref="GI:752830830"
                     /translation="MNKSALLSSITKKVVMALAGLFLATFLFVHLFINLMLLLDDGGQ
                     AFTTAASFMGTNPVIRIFEQVLFAGFLLHIVFGILVSIQNRQSRPVSYSYSNRSDTSF
                     LSKYMFHSGIVVLIFLLLHFFDFYFIKVGLVAPPPGVEAHDFYHRSILLFSNNLYASF
                     YLISFLFLGFHLNHATQSAFQSMGWNHSRYTGALKVIGTIYAVVISGGFMAIPIFFLL
                     FR"
     gene            complement(119559..120194)
                     /locus_tag="CPHA266_RS00550"
                     /old_locus_tag="Cpha266_0103"
     CDS             complement(119559..120194)
                     /locus_tag="CPHA266_RS00550"
                     /old_locus_tag="Cpha266_0103"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744013.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cyclase"
                     /protein_id="WP_011744013.1"
                     /db_xref="GI:500064096"
                     /translation="MNIIDLTHSLEPGMPVYPGTPPPLFQELFSFADQGFRERQITLT
                     THTGTHLDVPSHILERGDDLDSFSVQHFAGPAAVISLNCSPTTRLAIGDLEAHLPSLR
                     GCDFLLLSSGWSRYWGSEKYFTGYPVLSMEAASALAGLGLKGIGVDMISVDDPDAHDL
                     PVHRIFLEKRIILVENLANLEQLPPVGFDFFCMPLKLSHSEASPVRAIAII"
     gene            120343..120849
                     /locus_tag="CPHA266_RS00555"
                     /old_locus_tag="Cpha266_0104"
     CDS             120343..120849
                     /locus_tag="CPHA266_RS00555"
                     /old_locus_tag="Cpha266_0104"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467133.1"
                     /db_xref="GI:752830831"
                     /translation="MNLRSAGRLLTVVGFLLPLLSCGKSPEEKLMEKVIEHSTGQKVD
                     IDADGNKLTIESDGQKMEFQQQQKGVWPADIPSDVPEFSRGKIVAVTRASIPENESWS
                     VVYEDVKTSDIKEYEPRLKERGFTTSATFFSSDEGEHGTVSGQKGKLNVAVMAGSGKA
                     SLSVVSEK"
     gene            120920..121306
                     /locus_tag="CPHA266_RS00560"
                     /old_locus_tag="Cpha266_0105"
     CDS             120920..121306
                     /locus_tag="CPHA266_RS00560"
                     /old_locus_tag="Cpha266_0105"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744015.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine triad (HIT) protein"
                     /protein_id="WP_041467447.1"
                     /db_xref="GI:752831145"
                     /translation="MHNSFYNPDCLFCRIAAGEIPADIVYRDEHVLAFRDINPAAPEH
                     LLIIPLKHIASLNELQSEDKEIAGHLLLAAGEVARRAGLYDSGYRMVFNTGADALQSV
                     FHIHGHLIGGCRMGWPPFPGEVVGHG"
     gene            121365..124133
                     /gene="acnA"
                     /locus_tag="CPHA266_RS00565"
                     /old_locus_tag="Cpha266_0106"
     CDS             121365..124133
                     /gene="acnA"
                     /locus_tag="CPHA266_RS00565"
                     /old_locus_tag="Cpha266_0106"
                     /EC_number="4.2.1.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744016.1"
                     /note="catalyzes the conversion of citrate to isocitrate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aconitate hydratase"
                     /protein_id="WP_011744016.1"
                     /db_xref="GI:500064099"
                     /translation="MRSQKDPSGVTRSLQTGDGTVLYCSLSALETSGFGAVSRLPKSM
                     KVLLESALRNVDDETVRQSDVMLLAEGACAGVKAVEVPFKPARVLLQDFTGVPALVDL
                     ASLREACLLSGGDPERINPVVPCDLVIDHSLQVDAYGTSDALKINLDLEFDRNRERYA
                     FLKWAERAFRNFRVVPPGTGIVHQVNLEYLSRVVCVENGIAFPDSLVGTDSHTTMING
                     LGVTGWGVGGIEAEAVMLGQPVYLLRPSVTGVRVHGELVAGVTATDLVLTMTERLRRV
                     GVVNDFVEFFGPGLDLLSLPDRATIANMAPEYGATMGFFPVDAVTLDYLHMTGRGSCC
                     DLVERYSKEQGLWRDPASDPLFTRVVDFDLGTVVPSVAGPGRPQDRIALSMVKESWLR
                     GFAELYGRQPKVRFPGARVMDNEEGKFFLPDAKPEGDGAGEGRHGFSLDDGAVVIAAI
                     TSCTNTSNPSVMIAAGLLAKAAVSRGLAVKPWVKTSMAPGSRVVSDYLEQSGLAVPLD
                     ALGFNIIGYGCTTCIGNSGPLPENVARAIDAKGVVAAAVLSGNRNFEGRIQSQVRANY
                     LMSPPLVVAYAIAGTMAIDLLTEPMGTDHDGIPVYLRDLWPTQGEVNSVRERSVRQKM
                     YADNYNDVFKGTTQWAEIPASEECLYRWDERSTYICRPPFLDRVAEVPPIPAPVLGAR
                     CLVLFGDSITTDHISPAGSIGASRPAGLYLQSLGVPPGEFNSFGSRRGNHEVMTRGTF
                     DNIRIRNRLAPGMEAGMTTWFSSDGSRREAMPIFDAAMRYLAENVPLVVIAGRDYGMG
                     SSRDWAAKGTLLLGVRAVVARSFERIHRANLVRMGVLPLEFADAGSPESIGLKGDEFF
                     EIPLGGTITPRERITVTATDPLSLEKKQFSVISRIDTPVEADYFRNGGILPAVLRKIL
                     KDEHKTEG"
     gene            124222..124515
                     /locus_tag="CPHA266_RS00570"
                     /old_locus_tag="Cpha266_0107"
     CDS             124222..124515
                     /locus_tag="CPHA266_RS00570"
                     /old_locus_tag="Cpha266_0107"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744017.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron transporter FeoA"
                     /protein_id="WP_011744017.1"
                     /db_xref="GI:500064100"
                     /translation="MNLSELQVGDKAEVTAVKAESAVRRRILDMGLIKGTCFKVLRVA
                     PLGDPMEIYFKGMYLSLRKKEAEGILVIKTGEHGDGVPMSRNRKTCCSAGDGG"
     gene            124512..126650
                     /locus_tag="CPHA266_RS00575"
                     /old_locus_tag="Cpha266_0108"
     CDS             124512..126650
                     /locus_tag="CPHA266_RS00575"
                     /old_locus_tag="Cpha266_0108"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744018.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron transporter"
                     /protein_id="WP_011744018.1"
                     /db_xref="GI:500064101"
                     /translation="MIEKKGISVALAGNPNCGKSSLFNVLTGARQKVGNFSGVTIEKH
                     EGFLDFKGYSLKVVDLPGIYSLTPYSPEEIVTRRYLIDEKPDVVVNVIEGPNLERNLL
                     LTTQMMEMEVDFVVALNMIDEVEEKGISIDVKQLQKLLGCHIIPTSAKKKTGIDSLLD
                     HVVRAYRKDIDLKKNKLSFRPEVEESVHAIAALLMHQPELERFNPRWLAIKLLENDRE
                     VYHQVQQLPVWIKVELLLQDAIRIAARLFDSDPEVLITEDRHAFIRGAMKECVRQRSP
                     ERATMTDVIDSVVLNRVLGLPIFLFVVWAMFQLTFTLGSPLMDGLEYLFGLLGSSIEP
                     YLGNKILKSIIIDGIIAGVGGVLVFLPNIVLLFIALSFLEASGYMARAAFVIDKVMHR
                     IGLHGKSFIPMITGFGCSIPAIMATRTLKSPTDRLTTILVIPFMSCGAKLPVYVLLAG
                     AFFPPDVAANVLFGIYMLGIGVGLWTAWLLKSTVLKSDSEPFVMELPPYRWPALHAVF
                     FQAKVKAMMYLKKAGTLILGAVMLIWGVSNYPRNPVLDQWLASETSRIGALHMTPVEK
                     TSAIDAVRQQVQADQLEYSVAGRAGKMIEPLIKPLGFDWRIGIALVTGLVAKEVVVST
                     MGTIYALGQTDESSAELKSILKNDPGFSQATALSLMVFVLLYIPCVAAVGVMKKEIGR
                     WKPVLLYSVYVLAVSWILSFVTYRLALILL"
     gene            complement(126637..129036)
                     /locus_tag="CPHA266_RS00580"
                     /old_locus_tag="Cpha266_0109"
     CDS             complement(126637..129036)
                     /locus_tag="CPHA266_RS00580"
                     /old_locus_tag="Cpha266_0109"
                     /EC_number="5.99.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744019.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase I"
                     /protein_id="WP_011744019.1"
                     /db_xref="GI:500064102"
                     /translation="MALKSPAASARNRTLIVVESPSKAKTINKYLGDKYTVFASVGHI
                     KDLPKKEIGLDFDHHYEPRYEVIAGKEKVVRQLKKLADESNEILIATDPDREGEAIAW
                     HIANEVEFAHKPVFRVLFNEITKTAIIAAIQQPRQIDYRLVRSQQTRQGLDKIVGYKI
                     SPFLWNVVLRGLSAGRVQSVALRLICEREAEINGFQIQEYWSIAADFKTDLNETFRTK
                     LIKIKGDKPELSNQKKAETAAAEISERLFAVKEITTRVQQRKPPFPFTTSLLQQAASN
                     QLGFGSQKTMRIAQQLYEGIELGDEGATGLITYMRTDSIRIGTEATAEARNYITAQFG
                     KEYVGYGGAAKAGKNAQDAHEAIRPTSLLRKPESVKHFLSSDQFRLYELIWRRLLTAM
                     MAPAKIEQTRVDVEDREKEFTFRANGSRVLFAGFMRVYDDQQELDYEAQSSTRDDVEK
                     EQTVQLPEKLKEQDKLGLAGLDSKQSFTRPPARYSEATLVKDLDNYGIGRPSTYASIF
                     STLQDRRYVELQKKKIIPTELGKDVSLILVANFPELFNVGFTAHMEDELDKVASGDDE
                     YEAVLEKFYRPLETALSLRKSDPIIPQNSATETCDKCGKGQMTVKWTASGKFLGCSRY
                     PSCKNIKPLSSSKAKPKDTGIQCPSCKEGHMLLRDGRLGPFLACSSYPKCNTLLNLGK
                     QRQVEPMKIPPLLTTLVCPKCGAPMNLRSGKRGLWLGCSKFPKCRGRLAWGTLDEEVQ
                     RHWETLMTEHQKAHPTVALTMIDGRPVPLTLSVDDIITRAEEAGLIAAVPEEQQELTA
                     E"
     gene            129362..130975
                     /locus_tag="CPHA266_RS00585"
                     /old_locus_tag="Cpha266_0110"
     CDS             129362..130975
                     /locus_tag="CPHA266_RS00585"
                     /old_locus_tag="Cpha266_0110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744020.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylmuramoyl-L-alanine amidase"
                     /protein_id="WP_041467448.1"
                     /db_xref="GI:752831146"
                     /translation="MSLQVSKGNGEGYRIKVFALRKAGNILIDVESFARALRLGFRQS
                     NGFLVIDEAETLSGSSCQLRDGNNFVSIVSKDPRQEPGTMQLQATPVQIASKLYLPVS
                     QACRFFSLWLQREVRYDPATGLISAILWGERPAYSLKKFSSSIQDEPEPVGSNGKRAA
                     SSEALTVISGVSVENRENGALISFSAVGNSVRTLLMKPDKNGIAYLTFQNATGNVDEM
                     TKSFGVGIVQAVKAKRFQKGGFQVALSMDNRSYRINSMEVKRDDINNRYLVYVAGEPD
                     TGGGGMREKESQISRVIERDIEKWKFDTVVLDAGHGGKDPGAIGGHGTMEKDVVLNIV
                     RDLGSIIARQWPDIKVVYTRNSDVFIPLHERGKIANRSGGKLFVSIHCNANSKSHIRG
                     QEVYILGPHRTQKSLEVAMFENSVITREADYRERYKGFSTEYLIMSSMAQNAFAKQST
                     TLAQDVLKRIERKGGTTSRGVHQAGFMVLWTPSMPSILIETGYLSNPEEERILRERKE
                     QIRIAEAVFQGLDRYRRNNETARLSAVER"
     gene            131086..132072
                     /locus_tag="CPHA266_RS00590"
                     /old_locus_tag="Cpha266_0111"
     CDS             131086..132072
                     /locus_tag="CPHA266_RS00590"
                     /old_locus_tag="Cpha266_0111"
                     /EC_number="6.3.4.15"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744021.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biotin-(acetyl-CoA carboxylase) ligase"
                     /protein_id="WP_011744021.1"
                     /db_xref="GI:500064104"
                     /translation="MNQISSSILHHLRLSGGFLSGEDISVSLGITRSAVWKHIGALRR
                     EGYRIDAVSGQGYRLFSLSGRPVHEEVSPWLTTRFIGRDLHYHELLESTNFSARVLAG
                     TGTREGSVVVADAQSGGRGRMMRSWVSPGGVNLYFSLILRPRVPGIRVPQLTLLAAAA
                     VHQALCSCVPEIASRIKWPNDIMVGEKKLCGVLCEMQSEPDMTHFVIIGIGINVNIGE
                     FPDELRNIATSLFLESGRMVSRPELLASVLNHFESLYEAWLLHDDLGFVLPYLHEYSL
                     VYRRQVIIRQTTGDVCGTVSGIARGGELMLDLDDARTVLISSGDCLLCRQSP"
     gene            132094..133098
                     /locus_tag="CPHA266_RS00595"
                     /old_locus_tag="Cpha266_0112"
     CDS             132094..133098
                     /locus_tag="CPHA266_RS00595"
                     /old_locus_tag="Cpha266_0112"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BCQ5.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biotin synthase"
                     /protein_id="WP_041467449.1"
                     /db_xref="GI:752831147"
                     /translation="MRPVPLHPDILQAYAVLETGEPVCRELAFALGELHGPDVLDLAS
                     LAHKVKLRHGGSSGSIHACSIMNARSGVCSENCRFCAQSAHHQAAIDVYGLVDVDAVL
                     FHARQTASEGISHFGIVTSGFGYKTLSKEFRQILAMIDRLHQELPDLEICASLGVLGE
                     EPALELARHGIAQYNINIQVAPRRYGELIADTHSVDDRIDTIKRLRRNNIDVCCGGII
                     GVGEQMKERVEMIFAFADLDVSVIPLNILVPIDGTPLEGSPGIPLDDIVKTFALCRLV
                     HPRKIIKIAAGRETVMKDFQGLLMLSGADGLLTGGYLTTRGRATADDRMFMRQLQWFN
                     "
     gene            133110..134270
                     /locus_tag="CPHA266_RS00600"
                     /old_locus_tag="Cpha266_0113"
     CDS             133110..134270
                     /locus_tag="CPHA266_RS00600"
                     /old_locus_tag="Cpha266_0113"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744023.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="8-amino-7-oxononanoate synthase"
                     /protein_id="WP_041467450.1"
                     /db_xref="GI:752831148"
                     /translation="MPIRESIERELLALRQKGRYRELPSVTQRSGNRIRIGGKLLLNL
                     SSNDYLGLGDRREMLDRYLVTLREAGYAMTSSSSRLLTGNHPLYGELEQTLADLYGRE
                     AALVFNSGYHANTGILPALSTRHDLILCDRLNHASIIDGLMIAAAPYIRYRHGDYQHL
                     EELLSDAAGRYRQLFIISESVFSMDGDLADLERLVALKKRYGAFLIIDEAHGVGVFGQ
                     KGLGLCEVAGMVEGIDMIVGTFGKAFASVGAYAVMDTLFREYLINTMRPLIFTTALPP
                     AILGWSLAVVRQQAVMSDERNRLQALAARLRNALRERGLAVAGESQIVPVVAGGDRQA
                     VLLAEKLAAAGILALPVRPPTVPENSARLRLSLRADLQWEDIESVPELLQGL"
     gene            134275..134961
                     /locus_tag="CPHA266_RS00605"
                     /old_locus_tag="Cpha266_0114"
     CDS             134275..134961
                     /locus_tag="CPHA266_RS00605"
                     /old_locus_tag="Cpha266_0114"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012509451.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744024.1"
                     /db_xref="GI:500064107"
                     /translation="MKTAWISRTGELELLLFFAGWGMDSALAEHLWAHDDKEGFGMDI
                     LAFHDYGSLEISPGIREHFESYSKITLIAWSLGVWAAAHAALPRVDRAVALNGTLRPL
                     SERYGISPEVFFATHAGWSEQNRTRFYRRMCGSGEALDHFLSMAPLRSPADQKEELGF
                     LGESLIASENSPLPWGYDQIIIGDRDMVFPFQRQVIAWDGFGVSLVEGMPHFPFFHLK
                     SFREVLLCCK"
     gene            134949..135731
                     /locus_tag="CPHA266_RS00610"
                     /old_locus_tag="Cpha266_0115"
     CDS             134949..135731
                     /locus_tag="CPHA266_RS00610"
                     /old_locus_tag="Cpha266_0115"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744025.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malonyl-CoA O-methyltransferase"
                     /protein_id="WP_011744025.1"
                     /db_xref="GI:500064108"
                     /translation="MLQVIDKGLVRERFSRTLHSYGSNAPVQNAMAVELARLICREEP
                     TCRFERVLEVGAGTGALTAELLKRCRISLYVANDLVGESLRYISREIEPWQPEAFRFL
                     EGDVETLTELPDRLDLVLSNAALQWLSDLEGFFRRVSALLKPGGLFAFTTFSARNMEE
                     LSSIQKVGLAYPTALDIERFASGSFTPLLIREDRKRLEFASPEEVLRHLSRTGVNGIS
                     RHAWTKSSYERFLHRYRQEFSSGGKVYLTYNPLYCCFRKRLS"
     gene            135728..136402
                     /locus_tag="CPHA266_RS00615"
                     /old_locus_tag="Cpha266_0116"
     CDS             135728..136402
                     /locus_tag="CPHA266_RS00615"
                     /old_locus_tag="Cpha266_0116"
                     /EC_number="6.3.3.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744026.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dithiobiotin synthetase"
                     /protein_id="WP_011744026.1"
                     /db_xref="GI:500064109"
                     /translation="MKGSVTAISGIGTGVGKTVVTGLLAQGLQKCDRKVVTQKIVQTG
                     CTGISSDILEHRRLMGSSLIDVDYEGVTCPYSFGYPASPHLAARLEGAAVEVMTLRRA
                     TFTLQKQFDHVLLEGVGGLLVPLAPDLLFADYIRDAGYPLILVTATGLGSINHTLLSL
                     EACIARRITLKAVICNRFGEIDTLIGDDTVEMTRHYLKKYGLRAPLFTLVGDTLDCGC
                     IESLFL"
     gene            136426..137730
                     /locus_tag="CPHA266_RS00620"
                     /old_locus_tag="Cpha266_0117"
     CDS             136426..137730
                     /locus_tag="CPHA266_RS00620"
                     /old_locus_tag="Cpha266_0117"
                     /EC_number="2.6.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744027.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenosylmethionine--8-amino-7-oxononanoate
                     aminotransferase"
                     /protein_id="WP_011744027.1"
                     /db_xref="GI:500064110"
                     /translation="MTLPLPVIDLAFDRSHIWHPYTSLADPLPVYPVTGARGVYLELA
                     DGRRLVDGMSSWWAAIHGYNHPVLNQAVTTQLERMSHVMFGGLTHEPAITLAEQLAEL
                     TPEPLQKVFFSDSGSVSVEVAIKMAIQYWATLGETRKTRLLTVRSGYHGDTFAAMSVS
                     DPVTGMHRLFSGVLQRQIFAESPSCAFHDPWNEECIGDLRRKLERHADEIAAVIIEPV
                     VQGAGGMRFYAPRYLGRLRELCDEFGVLLIFDEIATGFGRSGKLFALEHAEVSPDILC
                     VGKALTGGYMTLAATLTTGVVAETISSGNPGLFMHGPTFMANPLACAVAAANIRLLLS
                     YDWKSKVAGIERGLESALSPCRTMEGVVDVRVLGAIGVVELENPVEMGLIQKKFVDRG
                     VWVRPFGRLVYLMPPYIITDEELGLLADAVTEVVYETLAESR"
     gene            complement(138482..138694)
                     /locus_tag="CPHA266_RS00625"
                     /old_locus_tag="Cpha266_0118"
     CDS             complement(138482..138694)
                     /locus_tag="CPHA266_RS00625"
                     /old_locus_tag="Cpha266_0118"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744028.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744028.1"
                     /db_xref="GI:500064111"
                     /translation="MSSHIYKKIELVGSSPTSIEEAVNNAIEKASESIRNIRWVEILE
                     TRCHVENQKLMYWQVTVKIGFTLDDN"
     gene            138731..138982
                     /locus_tag="CPHA266_RS00630"
     CDS             138731..138982
                     /locus_tag="CPHA266_RS00630"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467134.1"
                     /db_xref="GI:752830832"
                     /translation="MLPFGFAFLSGINMSKSWIICKIPVRCEDGVNFFFSANQAAPGY
                     KFLLCNKIRSFFLLAEKNRNQVFFWEIYFLVLLYNQVVI"
     gene            139074..140627
                     /locus_tag="CPHA266_RS00635"
                     /old_locus_tag="Cpha266_0119"
     CDS             139074..140627
                     /locus_tag="CPHA266_RS00635"
                     /old_locus_tag="Cpha266_0119"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744029.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin"
                     /protein_id="WP_011744029.1"
                     /db_xref="GI:500064112"
                     /translation="MNYGFVIDARKCIGCHACTVACKSENQVPLGVNRTWVKYVEKGS
                     FPETRRYFTVLRCNHCAEPPCVAICPVEALQKREDGIVDFDGRRCIGCKACAQACPYN
                     ALYIDPETHTSAKCNYCAHRKEVGLQPACVAICPQQAIVSGDLDDPSSKIAALVAGEQ
                     TVVRKPEKGTSPKLFYINGDGASLDPLQVSLEKEYHWSAQARGVGHFADKQKGAPAIE
                     KPHHEAPATGPAMRRVYDIPSKGAVWGWEVPAYVSAKAVSSGVFLLFFALTALLGQEL
                     SGMMQWAAWATSLVFLGLTGGFLIKDLDRPDRFSSVMLRPQFGSWLVKGGLTITGYGA
                     FLALWGASRFLQIPALERVALWGGALFALITAIYTAFLFGSAKGRDFWQSPMLLLHML
                     LNALLAGGSTMLLLGFGTGASVELFALLKQLLAAGFSLHLVIMLLELYGKHPSLQAER
                     TAEIIRSGSLKNEFWIGSFIAGNLLPLILSILSSDPLMLAAAAILGLCGVFYTEKVWV
                     QAPQRVPLS"
     gene            140647..143508
                     /locus_tag="CPHA266_RS00640"
                     /old_locus_tag="Cpha266_0120"
     CDS             140647..143508
                     /locus_tag="CPHA266_RS00640"
                     /old_locus_tag="Cpha266_0120"
                     /EC_number="1.2.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744030.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase"
                     /protein_id="WP_011744030.1"
                     /db_xref="GI:500064113"
                     /translation="MSYTHKPTVIESIAEKLHLIPDLHKENVRDGARRAAEEGSEISC
                     PPPSQWDNWVEYDSKSWPERKATEYMLVPTACFNCEAGCGLLAYVDKENMKIRKLVGN
                     PYHPASRGRNCAKGPATLNQIEDSDRVLYPMKRTGKRGEGKWARVTWDSVLDDIAGRM
                     RKAILEGRNNEISYHVGRPGHDGFMEWILRAWNVDGHNSHTNVCSSGARFGYAIWEGF
                     DRPSPDHANAKFILLVSAHLESGHYFNPHSQRIIEARMKGAKLAVLDPRLSNTASMSD
                     YWMPSYPGSEPAILLAMAKIIIDEGIYNRDYLENWVNWQAYLQTEYPGTPVTFENFID
                     ALKKEYSEYTPEYASKESGVDAAAIVEVARKIGEAGTQFSTHVWRSASSGNLGGWAVS
                     RTLHFLNVLTGSVGTPGGTSPSAWNKFKPTVHAEPKPQTYWNTLQLPDEYPLAHFEMS
                     FLLPHFLKEGRGKLDVYFTRVFNPVWTYPDGFSWIEALEDESKIGLHAALTPTWSETA
                     YFADYVLPMGHSAERHDLLSYETHAGKWIAYRQPVLRTALKRMGKPVKYTWEANPGEV
                     WEEDEFWIELTWRIDPDGTMGIRQYCMSPYRPGEKITIEEYYRYVFEHTHGLPEKAAE
                     EGLTAYDYMQKYGAFEVESNVYSLNEKPVAPADLQGSEVHQQSGLITKNGKAVGVEVN
                     GRSCTGFPTPSRKQEFFSQTMVDWKWPEYRVPGYIKSHIHQEIMNRSKGEFVLVPTFR
                     LPVLIHSRSGNAKWLAEIAHRNPVWINAADGAALHIENGDLIRVNTDIGFFVNRAWVT
                     EGIRPGVVACSHHIGRWRRDQDPEANRWATNRVQISKEGKGKWKMRVEESIQPYESND
                     PDSSRIFWSDGGVHQNITFPVHPDPISGMHCWHQKVRIEKAQDGDCYGDVFVDTERSF
                     AIYKEWLAMTRPAPGPGGLRRPLWLNRPFRPDEKTYYLQ"
     gene            143690..144622
                     /locus_tag="CPHA266_RS00645"
                     /old_locus_tag="Cpha266_0121"
     CDS             143690..144622
                     /locus_tag="CPHA266_RS00645"
                     /old_locus_tag="Cpha266_0121"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744031.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_041467451.1"
                     /db_xref="GI:752831149"
                     /translation="MLKTAGTAGASILFFIIPGILYAFPADQTGQMAWWVWVILLFAF
                     SFILGIFSVLAGVGGGVLFVPIVSGFFPFHLDFIRGAGLVVALTGALSAGAPLMRKGL
                     ADLKLGLPMALVGSISSIAGALAGLAMPVAMVQLLLGLSIMFIAGIMIKSGKSGYPEV
                     KEPDTLSKILHISGIYHDEAMSKDIAWQIHRTPIGLFLFMIIGFIGGMFGMGAGWANV
                     PVFNLLMGVPLKVAVATSGLVLSINGAAAAWIYIFKGALLPLIAVPAVAGIMLGSKIG
                     AGLLTKVNTRSVRLIVISMLLLAGLRSLLKGFGI"
     gene            144619..145047
                     /locus_tag="CPHA266_RS00650"
                     /old_locus_tag="Cpha266_0122"
     CDS             144619..145047
                     /locus_tag="CPHA266_RS00650"
                     /old_locus_tag="Cpha266_0122"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744032.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744032.1"
                     /db_xref="GI:500064115"
                     /translation="MKDTNREKPDEGDVQFVYAKVLDFVSHAGMVFIAAGYLIYVMQL
                     LPLSVSIRAVADNWHLSASDMQQKLHVPSGWSFMGSMADALHGDVVSYMSILFLCMAT
                     ILCLVFAVKVFFREKNYIYTAITFLQALVLLVAASGVISR"
     gene            145415..145924
                     /locus_tag="CPHA266_RS00655"
                     /old_locus_tag="Cpha266_0123"
     CDS             145415..145924
                     /locus_tag="CPHA266_RS00655"
                     /old_locus_tag="Cpha266_0123"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744033.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase"
                     /protein_id="WP_011744033.1"
                     /db_xref="GI:500064116"
                     /translation="MAETKKLAIIASQGTLDWAYPPFILASTAAAMDMEAVIFFTFYG
                     LPLLKKEIDAKVAPHTNPAMPMKMPFGSKEFQSYNWPIPNFISGNVPGFDSMATSLMK
                     ETFKKKGVATIEQLRGMCQEFGVRFIACQMTMEVFGFEKEEFIEGVEYGGAATFLEYA
                     ADANISLFI"
     gene            146008..146487
                     /locus_tag="CPHA266_RS00660"
                     /old_locus_tag="Cpha266_0124"
     CDS             146008..146487
                     /locus_tag="CPHA266_RS00660"
                     /old_locus_tag="Cpha266_0124"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744034.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfurtransferase"
                     /protein_id="WP_011744034.1"
                     /db_xref="GI:500064117"
                     /translation="MRRFIELIRNCLTDVREIMPWELVDRMRLNPELMILDVREPAEF
                     DAMHISGSLCVPRGILESACEWDHDETVPELVKAREREIVVVCRSGHRSVLAAHSMQV
                     LGFEDVVSLRTGLRGWNDYEEPLRNSAGEVVDSEVADAFFTSKLREDQKRPAEKHQA"
     gene            146655..146891
                     /locus_tag="CPHA266_RS00665"
                     /old_locus_tag="Cpha266_0125"
     CDS             146655..146891
                     /locus_tag="CPHA266_RS00665"
                     /old_locus_tag="Cpha266_0125"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744035.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator SirA"
                     /protein_id="WP_011744035.1"
                     /db_xref="GI:500064118"
                     /translation="MSDIASNMDLNCEGLNCPLPILKTKKAVDGLQSGEVLKMTATDP
                     GSINDMASWAKRTGNELVSHTEQAGVHTFYIRKK"
     gene            147068..148495
                     /locus_tag="CPHA266_RS00670"
                     /old_locus_tag="Cpha266_0126"
     CDS             147068..148495
                     /locus_tag="CPHA266_RS00670"
                     /old_locus_tag="Cpha266_0126"
                     /EC_number="6.3.5.9"
                     /EC_number="6.3.5.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744036.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrogenase expression protein HypE"
                     /protein_id="WP_011744036.1"
                     /db_xref="GI:500064119"
                     /translation="MDAVTLPRLMISAAQKSSGKTTISLGLLSHLKSRGVAVRSFKKG
                     PDYIDPMWHKLASGSECYNLDPYLMGQEGCLDSFFKNSRNGNSDFCLIEGNHGLHDGL
                     SLDGSDSSAGLASMLKTPVLLVVDSRKTNRGVAALVMGMQAMQPQADIAGVILNQVQS
                     ARQAAKQKLAIEHYCKVPVFGAIPVDEELVIPERHLGLTTVGETADAAKFITGAAERL
                     ERYCDMAAIRALFSMASPIGMPPLETRGINPVARARVGVFRDAAFCFYYPDNLAALQE
                     HGAELIFIDSMSESSLPDIDGLYLGGGFPESFFDAISSRRGLLRDVRERVKSGMPLYA
                     ECGGLIYLSRSAEYGGKRYDLAGVLPLDIGFQQRPAGHGYLDLRSSAESAWFKTGERI
                     RAHEFHYSRPLLSSGACSYQFEVLRGYGVTGERDGAVDNHVFASFAHVHALSTPGWAP
                     KFVSLASIYKDRCLSGWAVPPQRQD"
     gene            149068..149403
                     /locus_tag="CPHA266_RS00675"
                     /old_locus_tag="Cpha266_0127"
     CDS             149068..149403
                     /locus_tag="CPHA266_RS00675"
                     /old_locus_tag="Cpha266_0127"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011362966.1"
                     /note="transfers sulfur from TusBCD complex to MnmA;
                     involved in thiouridation of U34 position of some tRNAs;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfur transfer protein TusE"
                     /protein_id="WP_011744037.1"
                     /db_xref="GI:500064120"
                     /translation="MAIVVNGVSCETDENGYLVNLEDWTEDVAKVLAEGEEIEMTEAH
                     WDLVKFLRGYYDEYQIAPAVKVLTKAIAAEKDMDKKNASEFLYGLFPKGPGLQACKIA
                     GLPKPTGCV"
     gene            149458..150711
                     /locus_tag="CPHA266_RS00680"
                     /old_locus_tag="Cpha266_0128"
     CDS             149458..150711
                     /locus_tag="CPHA266_RS00680"
                     /old_locus_tag="Cpha266_0128"
                     /EC_number="1.8.99.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744038.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfite reductase"
                     /protein_id="WP_011744038.1"
                     /db_xref="GI:500064121"
                     /translation="MDGAEGAASKEVHHCNECGAHSGEKFLNPTPMLDELEKGPWPSF
                     ISGFKELAERTKKPMLRGVMDQLEYSYNTKMGYWKGGLVTVDGYGAGIITRYSMIKDK
                     FPEASEFHTMRIQPAPGLHYNTAMLRELCDIWEKYGSGLIALHGQTGDIMLQGIEQDK
                     VQACFDELNQAGWDLGGAGAGMRTAVSCIGPGRCENACYDNLKLHLHALKHFVGVLHR
                     PEWNYKLKFKFSGCPNDCTNSIMRSDLAVIGTWRDAIQVDRDEVKAWIEKKGVDALVN
                     QVINHCPTKAISLKDGEMVIETRDCVRCMHCLNAMPKALSPGKDRGISLLMGGKNTLK
                     VGVNMGSLIIPFMKMESEEDIEAFIEQIEAIIDWWDDSGLDHERIGETIERVGLKQFI
                     EGIGLEADINMVSRPRDNPYFKARY"
     gene            150794..151873
                     /locus_tag="CPHA266_RS00685"
                     /old_locus_tag="Cpha266_0129"
     CDS             150794..151873
                     /locus_tag="CPHA266_RS00685"
                     /old_locus_tag="Cpha266_0129"
                     /EC_number="1.8.99.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012465659.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfite reductase"
                     /protein_id="WP_011744039.1"
                     /db_xref="GI:500064122"
                     /translation="MSSPEKKWKTVESGPHTYEEALHPVVRKNYGKWKYHEIPKPGVL
                     VHVAESGDSLYTVRAGTPRQDTVDMIRRLCDIADKYCDGYLRFTVRNNVEFLTPKQEN
                     VEPMIRELESMGLPVGGTGMCVSSVSHTQGWLHCDIPATDASGVVKSMMDTLYAEFRG
                     MQMPNKVRLSTSCCSINCGGQADIAVVVKHTRPPRVNHDHLAMICELPKAVARCPVAA
                     IRPTVVNGKRSLMVDEEKCICCGACFGACPAMEINHPEHSKFAIWVGGKNSNARSKPS
                     TMSIVAHNLPNNPPRWPEVTDAVGKILLAYKEGGRPWERIGEWINRIGWKRFFEETGL
                     TFDEDMIDSYRHARTTFNQSAHVRF"
     gene            151889..153625
                     /locus_tag="CPHA266_RS00690"
                     /old_locus_tag="Cpha266_0130"
     CDS             151889..153625
                     /locus_tag="CPHA266_RS00690"
                     /old_locus_tag="Cpha266_0130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744040.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate synthase"
                     /protein_id="WP_011744040.1"
                     /db_xref="GI:500064123"
                     /translation="MKVESNPILDYALNYEFPEFTELQGTEKIVAFGDHSHKCPVYVR
                     QVPPCSAECPAGEDIRGYQRFLNGVEKSEDPWKSAWETIVDTNPFPAVMGRICPHPCQ
                     GGCNRQYHDESVAINAVEQVVGNYGIEHNLQLPGPGEDTGKRVAVIGGGPAGLSAAYQ
                     LRRKGHAVTIFDANEKLGGMVLYGIMGYRVDRAVLEAEIQRIISLGVETKMGVRIGTD
                     ITLDQLEKEYDAVFVGIGAQVGRSLPITGSADTKGVTNAIDFLKNYEVEGDSIAVGKK
                     VVVIGDGNVAMDVARLALRLGSEAVLISGVPREEMACFANEFDDAIREGSAIHYMTGT
                     VEVLKGEEGVRGLLCSKMVKKEKGEEGWNSPIPFLRYKSTDETFEIPCDMVVAAIGQT
                     TNMEGFESVAGDRPWLKVDRYFRLPGKENVFGGGDAIKVDLITTAVGHGRKAAMAIDA
                     FVKGDSFAEQGYREVAKVQKQDILYFYHSPQAKRETIELENVVGNHQELLEALSREEA
                     KAESERCMSCGLCFDCKQCVSFCPQEAVKRFRDNPPGEVVYTDYSKCVGCHICSLVCP
                     SGYIQMGMGEGL"
     gene            153669..154037
                     /locus_tag="CPHA266_RS00695"
                     /old_locus_tag="Cpha266_0131"
     CDS             153669..154037
                     /locus_tag="CPHA266_RS00695"
                     /old_locus_tag="Cpha266_0131"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744041.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744041.1"
                     /db_xref="GI:500064124"
                     /translation="MSEDLIRRVEEAIACSRNWAEKGWPVTFGSRNVAVSSLKEAKAL
                     PSSFLYRQEALNYWNQARLMGNDAGDAGAKALDALKSGNMRAAHDALYLSQYIEKPLA
                     ENARTWHPLYEAFTAEISSC"
     gene            154089..154448
                     /locus_tag="CPHA266_RS00700"
                     /old_locus_tag="Cpha266_0132"
     CDS             154089..154448
                     /locus_tag="CPHA266_RS00700"
                     /old_locus_tag="Cpha266_0132"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011362961.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfurtransferase"
                     /protein_id="WP_011744042.1"
                     /db_xref="GI:500064125"
                     /translation="MKIGILLKEGPYNHQASDTAYKFAEAAIKKGHTIDAVFLYNDGV
                     GNVTKMMDPPQDDRNIAARWDALSKQHGVEILACIAASKRRGINDDVIIEGGTITGLG
                     TLTDIAIRNDRLITFGD"
     gene            154452..154841
                     /locus_tag="CPHA266_RS00705"
                     /old_locus_tag="Cpha266_0133"
     CDS             154452..154841
                     /locus_tag="CPHA266_RS00705"
                     /old_locus_tag="Cpha266_0133"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744043.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfur oxidoreductase"
                     /protein_id="WP_011744043.1"
                     /db_xref="GI:500064126"
                     /translation="MGNMDIEENTDIKKIMHVMRHAPHGTIYSYEGLEMILIMAAYEQ
                     DLSVVFIGDGIYALKKNQDTHAIGIKGFSKTFMALDGYDVEKLYVDRVSLEERGLTED
                     DLVVPVEVLTSAEIGGLMREQDVIIHH"
     gene            154917..155210
                     /locus_tag="CPHA266_RS00710"
                     /old_locus_tag="Cpha266_0134"
     CDS             154917..155210
                     /locus_tag="CPHA266_RS00710"
                     /old_locus_tag="Cpha266_0134"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744044.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug MFS transporter"
                     /protein_id="WP_011744044.1"
                     /db_xref="GI:500064127"
                     /translation="MLHTINKSPFASDTFDTCGRFLLPGDPVLFIEDGVYAVQAGNRF
                     SSMIETIQKTNPVFALRPDLDARGIAAVDEGVTLVDYEGFVELVENHQVNSWL"
     gene            155257..155703
                     /locus_tag="CPHA266_RS00715"
                     /old_locus_tag="Cpha266_0135"
     CDS             155257..155703
                     /locus_tag="CPHA266_RS00715"
                     /old_locus_tag="Cpha266_0135"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744045.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744045.1"
                     /db_xref="GI:500064128"
                     /translation="MTKALDRVIQQNRKEILDRWHGQALALFSEKMARGTPIFDLLNE
                     SMGMILDGFEEGSESCLEGVDSFARIFAVHPFPPSGSMRLFFELQFILAAFCPDEESR
                     DAMQTRIQAIMLDACDDFMAHREKIYQLKVEERQRSMYMALRRAEG"
     gene            155700..156695
                     /locus_tag="CPHA266_RS00720"
                     /old_locus_tag="Cpha266_0136"
     CDS             155700..156695
                     /locus_tag="CPHA266_RS00720"
                     /old_locus_tag="Cpha266_0136"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744046.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="menaquinol oxidoreductase"
                     /protein_id="WP_011744046.1"
                     /db_xref="GI:500064129"
                     /translation="MKKVLMPIVMVAVLGLIPFIGVTYAGLDYLFGVIIPYASVLIFI
                     AGFVYRLVDWLKRPVPFRITTTCGQEKSLDWIKQNKLDSPSRAWHAAFRVLFEVFFFR
                     SLFRNTRSELREGPSLVHGSSKWLWMGGLVFHWSLLVIGLRHARYFFVMVPDFIQLVE
                     GADRFFDLALPAFYLTDALVLSAVTFLFVRRMSDAKMRIISLQTDYFPLFLITGIVLV
                     GIIMRYIVKVDVMPVKDQMLRLVAFNFEAPAPIGALFYVHLFLVCVLAVYFPFSKLMH
                     MGAIFLSPTRNLCNNSREKRHVNPWNAAIKFRTYTEYEDEYREKMKKAKLPVEKQ"
     gene            156698..158347
                     /locus_tag="CPHA266_RS00725"
                     /old_locus_tag="Cpha266_0137"
     CDS             156698..158347
                     /locus_tag="CPHA266_RS00725"
                     /old_locus_tag="Cpha266_0137"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744047.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Hdr menaquinol oxidoreductase iron-sulfur
                     subunit"
                     /protein_id="WP_011744047.1"
                     /db_xref="GI:500064130"
                     /translation="MSKYLPKLSDLKKDFEEKPSILKGDYSKKEWWDTPFEFRDGNWS
                     FPAKPEVVEELGFPNSRKWSALDQDWKLPADWQKTISEGLKVRLKKFRSLKLYLDSCV
                     RCGACADKCHFFLGTGDPRNMPVLRAELLRSVYRNDFPLVEKILKGFSGSRKLTAEVI
                     KEWHMYYYQCTECRRCSVFCPLGIDTAEITMVARELLNLIGVNNNWILAPVANCNRTG
                     NHLGIEPHTFVQNIESLVEDIEDMTGVRVNPTFNRKGAEILFITPSGDVFGDPGVYTM
                     MGYLLLFHHIGLDYTISTYASEGGNFGMFTSNDMMKKLNAKMYHEAERLKVKWILGGE
                     CGHMWRVVHQYMNTMNGPADFLEVPVSPVTGTKFSNAAATKMVHIAEFTADLIYHKKL
                     KLDPRRNDHLKTTFHDSCNVARGMGMFEEPRFVLNNVCNSFHEMPENTIREQTFCCGS
                     GSGINSEENMEMRMRGGFPRANAVRHVRNQHQVDSLVTICAIDRASLPALMKYWNPGV
                     TVYGLHELVGNALVMQGEKKRKEDLREHPMKGFDDEEGDVD"
     gene            158337..158732
                     /locus_tag="CPHA266_RS00730"
                     /old_locus_tag="Cpha266_0138"
     CDS             158337..158732
                     /locus_tag="CPHA266_RS00730"
                     /old_locus_tag="Cpha266_0138"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744048.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome DsrJ"
                     /protein_id="WP_011744048.1"
                     /db_xref="GI:500064131"
                     /translation="MSIKKNHIIFSLLALLLLAGSYAFMHVVQAADPVPPTPRPAASA
                     AIDSSKCIMPTAYMKANHMRVLHEWRNSSVRDGNRVHVAPNGSKFDKSLNTCLGCHAN
                     NRLFCFNCHMYANVKPKCWNCHISPMETP"
     gene            158732..159508
                     /locus_tag="CPHA266_RS00735"
                     /old_locus_tag="Cpha266_0139"
     CDS             158732..159508
                     /locus_tag="CPHA266_RS00735"
                     /old_locus_tag="Cpha266_0139"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744049.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin"
                     /protein_id="WP_011744049.1"
                     /db_xref="GI:500064132"
                     /translation="MNEQRRDFIRKTGLGVLAGLGVASGLFAESSFEKTVLPAWDEKP
                     VAGKIRWGMLVDTRTCNESCQECVLTCHHVHNVPDFGSRKDEVKWIWKSPYEKAFPTA
                     SQQFQNKETRDRSCLTLCNHCAESPCTKACPTEATFKRWDGIVAMDYHRCIGCRFCMA
                     ACPYGSRSFNWQDPRMAIKNPSADYPTRMQGVVEKCNFCSERLVKGLKPACVESCPNQ
                     ALTFGDLNDPESDIRKLLENNQTMQRKPELGTLPSVFYII"
     gene            159518..160669
                     /locus_tag="CPHA266_RS00740"
                     /old_locus_tag="Cpha266_0140"
     CDS             159518..160669
                     /locus_tag="CPHA266_RS00740"
                     /old_locus_tag="Cpha266_0140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744050.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Hdr menaquinol oxidoreductase integral membrane
                     subunit"
                     /protein_id="WP_011744050.1"
                     /db_xref="GI:500064133"
                     /translation="MIEKALKGNRNYWLWIAFLCLVIGSGLFAYSQQRWFGLTVTGMG
                     RDVSWGLYIAQFTFLVGVAASAVMVVLPYYLHNQKAFAKTVIIGEFMAVSATMMCLLF
                     ILADMGRPDRVLNVLLYPSPHAMVFWDVLVLNGYLVINFVSAWTVLGAERKGVPPPAW
                     IKPVIYLSIPWAVSIHTVTAFLYAGLPGRHLWLTAVLAPRFLASAFAAGTALLILVTL
                     ILKKTTGFDAGKEAREKLAVLVIYAGLVNFFLIGTEFFTAFYSNVPAHMQSLQYLFFG
                     LEGKSQLVPWMWVSLLAGIGALAMLFSQKRKSSNLWLAAASGAMVLSIWIDKGVGLII
                     GGFVPSPLEEIVEYSPTVTEIVITLGIWAIGTLLLTVLLKVAVAVKTMD"
     gene            160697..160909
                     /locus_tag="CPHA266_RS00745"
     CDS             160697..160909
                     /locus_tag="CPHA266_RS00745"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467135.1"
                     /db_xref="GI:752830833"
                     /translation="MAFSETKKAYLFYKLAIVMRAFNFLFKEAILIVRANGAGSVYEK
                     NGLGNLSAADCCSQFLCVQGRAVNAI"
     gene            160915..161358
                     /locus_tag="CPHA266_RS00750"
                     /old_locus_tag="Cpha266_0141"
     CDS             160915..161358
                     /locus_tag="CPHA266_RS00750"
                     /old_locus_tag="Cpha266_0141"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744051.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porphyrin biosynthesis protein"
                     /protein_id="WP_041467452.1"
                     /db_xref="GI:752831150"
                     /translation="MKVFLPVNIRIDDKKILFVGGGSIAMHKMQTVEQYARNITILAP
                     RIDDKLKAKGFCEIRKEYEKTDLEGFFLVYACTNDLEVNRRIKKDAEELRVLVNVADN
                     SELSDFISPAVFKLDEMTVAISSNGQNAKKSVEWRNRIKAMLQES"
     gene            161397..162785
                     /locus_tag="CPHA266_RS00755"
                     /old_locus_tag="Cpha266_0142"
     CDS             161397..162785
                     /locus_tag="CPHA266_RS00755"
                     /old_locus_tag="Cpha266_0142"
                     /EC_number="2.1.1.107"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744052.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen-III C-methyltransferase"
                     /protein_id="WP_011744052.1"
                     /db_xref="GI:500064135"
                     /translation="MTKSDHSQRVDVSEKGYVYIIGAGPGDPELLTIKAERALQEADV
                     LLYDDLVSGELVDQFQGIKIYTGKRKDSHHFEQDEINSEIVRHALMGKKVARLKGGDP
                     FVFGRGGEEIEVLRKNGIRYEIIPGITAAYGASAYTEIPLTMRKISSSVAFCTGHPVN
                     KIQVPDADTLVYYMVASTVHDVLDAVVSKGRSENTKVAIVQNATRYNQKIFTGTLGEL
                     RRREKAVYSPALLIIGDNINQFIEKNWFSGKRKVLLTGGDAKRYNAMEHIMVHFPCRQ
                     VDGADRERVKEYFDDFSPYSTLLFTSKFSVKYFFASLFEYGKDVRHLAAATICATGKA
                     AALELQKHGVIPDLFFEPDGCADIVTMFRERGMTDEHILLPGSNLVDEYLVRELTTLR
                     NRVTPLCVYMHEAQEHAESIDLAFIDEIYFASPSCVNNFRTLYSSIPENITVTAADTR
                     TEKEYRSLFGES"
     gene            162859..163638
                     /locus_tag="CPHA266_RS00760"
                     /old_locus_tag="Cpha266_0143"
     CDS             162859..163638
                     /locus_tag="CPHA266_RS00760"
                     /old_locus_tag="Cpha266_0143"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744053.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbon monoxide dehydrogenase"
                     /protein_id="WP_041467453.1"
                     /db_xref="GI:752831151"
                     /translation="MKIAVSGKGGVGKTTISSLIALGLAEKGKKVLAIDADPNGNLAE
                     ALGYNSGESGRITPLIERKALIEERTGARPGEMGGYFVLNPKVDDFVERFSVPVGGLR
                     TMVMGELKEALSGCYCAENALLRSFLRHLMVDRDEWVVLDMEAGFEHLTRGTAQSVDL
                     LLIVVEPGARSIATAHKLQRLALQSGIPRTGFLVNKLYSPSQKEQIIPELEGGEILAS
                     IPFDEMAVEADLAARSPFGSCSLMKESLRPLIEALSDNSTG"
     gene            164039..165280
                     /locus_tag="CPHA266_RS00765"
                     /old_locus_tag="Cpha266_0144"
     CDS             164039..165280
                     /locus_tag="CPHA266_RS00765"
                     /old_locus_tag="Cpha266_0144"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744054.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_011744054.1"
                     /db_xref="GI:500064137"
                     /translation="MSNEQKPTSRREFLRSSAFGLSAVLGGLPLIQGCSKESGQEKGA
                     PNIGTSGKKLKSSYLPITDATPIILAHELGFYKELGIDSEKPVLIRGWAPMAEAFMAG
                     RFNLTHLLAPIPIYMRYSKGFPVKVVAWDHINGSALTVGKESGIKSCADLGGKQIAIP
                     YWYSMHNIILQMIAREHGIEPVIQSKTAPLTSKQMNLFVMAPPDMPTAIASKAIDGYI
                     VAEPFNAAGEVLAGGRIVRFTGDVWKNHPCCVAVMNEKELEDKEWSHKVIQALVKAEL
                     WALNNVEEAAHILSKDGAQYLPLPEKIVKRAMMKYDLETYGAGSGTGAIQNPDWHASR
                     ISYEPYQFESATRHIVEMLKQTRVDGDAAFLKALDPGKVHKELMYTAGVEAAAAALGG
                     LGQFAGVNSASPLVREEVIKV"
     gene            165499..166257
                     /locus_tag="CPHA266_RS00770"
                     /old_locus_tag="Cpha266_0145"
     CDS             165499..166257
                     /locus_tag="CPHA266_RS00770"
                     /old_locus_tag="Cpha266_0145"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744055.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_041467454.1"
                     /db_xref="GI:752831152"
                     /translation="MTARLADRGFYLLGVVLFMIVWQIASALKLFGADFSESFSPLAA
                     MLALFEMIKNGELIHHALPSLRRVLTGLSLAVVVALPLGVLVGYFKRIEQLTYVVFQF
                     MRMISPLAWMPIAIIIFGVGDVAVIFLLWLVAIWPLILNTSHGAGRVSPLWVNMAKTM
                     GAKDSGILRKVIIPAAVPDMLTGLRLAVGVSWIILVPAEMLGVPDGLGYFILDTRDRF
                     RYDQLMATIMAIGMIGYLLDSANRWLIHKFSWKM"
     gene            166278..167090
                     /locus_tag="CPHA266_RS00775"
                     /old_locus_tag="Cpha266_0146"
     CDS             166278..167090
                     /locus_tag="CPHA266_RS00775"
                     /old_locus_tag="Cpha266_0146"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744056.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_011744056.1"
                     /db_xref="GI:500064139"
                     /translation="MTSGRQVLISVQHVSKTYKKGGREFHALRDCTFDILKNEFLVVV
                     GPTGCGKSTLLNLLAGIEFPTSGSILLNGAPVTGPGADRGMIFQDYALLPWRSVLKNA
                     ELGFEFMKKPMKGDQIKAEAMRYLEMVGLGYAVNKHPGELSGGMKRRASLAMILAIKP
                     VILLMDGAFNALDSKTKMTMHQEITRIWETEKNTVVFVTSDLDEAVKLADRIIVLNKD
                     GALEAILVNELPRPRLGSAARDPDFHHRFIAFRETVMNVIKKDAGLRTCAIS"
     gene            167125..167934
                     /locus_tag="CPHA266_RS00780"
                     /old_locus_tag="Cpha266_0147"
     CDS             167125..167934
                     /locus_tag="CPHA266_RS00780"
                     /old_locus_tag="Cpha266_0147"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744057.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_041467455.1"
                     /db_xref="GI:752831153"
                     /translation="MNGIAAPEKPLLEIRDVSKTFMKDGKEFLVLERVNLSINEGEFV
                     CILGPTGCGKSVTLQIVAGLLEQSSGSVILDGKEEHGPGPHKGMVFQEYALLPWRTVV
                     ENVEIGLELKGISKKERRRIAEEQLDLVGLKGAESRMVHEISGGMRQRAAIARALANR
                     PKILLMDEPFEALDALTKEEMQIQILKAWEKTKTTIFFVTHDVDEAIFLSDKLCVMDI
                     NPGRVKKIITNTLPRPRHELVCRTDKAFCEMRDQIIQLYSSLKDEELDLVF"
     gene            167957..168703
                     /locus_tag="CPHA266_RS00785"
                     /old_locus_tag="Cpha266_0148"
     CDS             167957..168703
                     /locus_tag="CPHA266_RS00785"
                     /old_locus_tag="Cpha266_0148"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744058.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C"
                     /protein_id="WP_011744058.1"
                     /db_xref="GI:500064141"
                     /translation="MKTNNAGLRPFARAVLIGSAMISGMLTGCSEKKTVETPPKEPEK
                     TVAASNESPLKGLRLYLGYCFICHGQTGRGDGPYAASLTAKPADLTNRGYFSARTDQQ
                     IYDFISKGGIAHGKSIHMRPFGMQLTRQQIMGLVSYVRVLNEGRTVDLEKSSGNTADD
                     IYGMSCIMCHGSDGNGDGEIARKLNIAIRPLGSKAVQDMSDQQLYAIISGGITDTARV
                     NASYMPAWSNSLTKEQIDELVAYIRELGKP"
     gene            168852..>170780
                     /locus_tag="CPHA266_RS00790"
                     /old_locus_tag="Cpha266_0149"
     CDS             168852..>170780
                     /locus_tag="CPHA266_RS00790"
                     /old_locus_tag="Cpha266_0149"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744059.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbon monoxide dehydrogenase"
                     /protein_id="WP_041467456.1"
                     /db_xref="GI:752831154"
                     /translation="MKLVHRLNYSKEEVIKHTANKAVAEMVEHMDKEAISNTFDRFAQ
                     QHPQCGYGLTGACCAFCSYGPCRVTEKTLYSVCGKDVDLIVAGNALRRLASGMAAHGA
                     HAREVFIALKAAAEGSAPIPIKCPEKGVAVARALGIETEGKTIEAICGEIADIFIDDL
                     QRSLPKRHETLHALAPKERAELWERLGIIPISAYHECFEVNNLTSHGTDSDFESHMQA
                     FLRTVLAYAITTVTSTSLATDIVYGLPRRSKLNVNLGSIVPDGCVNIGINGHAPMVAF
                     AICDIVGTPKIMEKVKRAGADTIRLYGMCCTGGEFIERDLNIPLVAMASSAEMAVATG
                     AFDAIVVDQQDVLPGMMHVARQFHTRVITTSPSGRKEGAIVLELDYYLKNLDKIYELA
                     EEILDIAIDNYRNRESKKVHVPNIRAKVELGFSVEEVMKLFNGSMPDKKIHGLAALLK
                     AGKIRGIVNFGSCGNVRGAVFERNQIIIAKQLIKNDVLVTAHGCSGMGLLFAGLAHPD
                     ASVLCGTGLREVVQAKDIPPVLHVGACTDSTRASQIMAYTANAAAQPNPAMPFAMVAA
                     DPAAEKTMGARYAFVLNGIETYSCVQDNTLASDRFIDYVSNRLRTIVGAAMNWNPDPY
                     RTSEDILCMLDEKRAALGW"
     gene            170931..171131
                     /locus_tag="CPHA266_RS00795"
                     /old_locus_tag="Cpha266_0150"
     CDS             170931..171131
                     /locus_tag="CPHA266_RS00795"
                     /old_locus_tag="Cpha266_0150"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744060.1"
                     /db_xref="GI:500064143"
                     /translation="MLFDCEKQAMERWTIAEHKVCDGCPYRGSVAGEPPFCIMRQNPP
                     ECFVARLSGRAAVTGQDKPSGA"
     gene            complement(171220..172038)
                     /locus_tag="CPHA266_RS00800"
                     /old_locus_tag="Cpha266_0151"
     CDS             complement(171220..172038)
                     /locus_tag="CPHA266_RS00800"
                     /old_locus_tag="Cpha266_0151"
                     /EC_number="3.6.1.19"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744061.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside triphosphate pyrophosphohydrolase"
                     /protein_id="WP_011744061.1"
                     /db_xref="GI:500064144"
                     /translation="MPIPRNTTTEERKAAILAKRERSLSEHFERVVSLVDVLRNECPW
                     DRKQTPASLAHLLLEESYELVHAIDENDDIELKKELGDLFLHLCFQVILAEETQKFTF
                     SDVFEALSAKLIGRHPHVFGDTVADTEQEVLKNWETLKLQEGRKKLLDGVPKAMSELL
                     RAYRVQKKVSGVGFDWQNDEGVLDKLVEEIAELKNAATKEEQEEEFGDLLFTVVNYSR
                     FIGANPEDALRKATNKFMKRFEAVEATVQQSGRNWQAFSAEELDLLWQKAKNEL"
     gene            172146..172817
                     /locus_tag="CPHA266_RS00805"
                     /old_locus_tag="Cpha266_0152"
     CDS             172146..172817
                     /locus_tag="CPHA266_RS00805"
                     /old_locus_tag="Cpha266_0152"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744062.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_011744062.1"
                     /db_xref="GI:500064145"
                     /translation="MELKGSIAVVTGSSTGIGYHTARLLLEKGAEVYGLSRRATAVRH
                     DRFHWLQCDVTIAEEIDRAFDAVLERHGCVDILVNNAGFGLFGDLETLQPDEWHRLLA
                     TNLTAVFLCTRRVIPSMKERRRGMILNIGSVAGKRGFKGGAAYSATKFAINGLSESLM
                     DDLREFGIRVSCVNPGSVETEFFDRAGMQPKKAMDPAHLAGFLVSIIELPDSMLPDQI
                     TVRPL"
     gene            172835..174262
                     /locus_tag="CPHA266_RS00810"
                     /old_locus_tag="Cpha266_0153"
     CDS             172835..174262
                     /locus_tag="CPHA266_RS00810"
                     /old_locus_tag="Cpha266_0153"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BCU6.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA modification GTPase"
                     /protein_id="WP_011744063.1"
                     /db_xref="GI:500064146"
                     /translation="MQQETGIHPIVQCDPIAAIATPLGVGALAVVRISGATAFDIAGR
                     VFRKARDPHQPLSETPGYTAHFGRLYDGLTLIDEVIALVFRSPSSFTAEDMVEFTCHG
                     GPVVTRHVLQLLLDNGCRLAEPGEFTRRAFLNGKIDLLQAEAIGEMIHARSESAYRTA
                     VIQMKGDLSATLGALREKLLRSCALLELELDFSEEDVEFQSREELRVEIASLQSEVAR
                     LVDSYQHGRLLTEGVATVIAGRPNAGKSTLLNTLLGEERAIVSHMPGTTRDYIEECFI
                     HDKTMFRLTDTAGLRETGEEIEHEGVRRSRMKMAEADLLLYLLDLSREGMAEEIKEIV
                     ALKAAHASSKFLVVANKIDLVPDATTLLCRLGEEAGCEAIGISARQKLGIDELKSRMS
                     SMVEGLDKLHEASVLVTSLRHYEALRNAGDALRNAQNLLDEQADTELIAFELRAALDY
                     VGEITGKVVNEEILHAIFERFCIGK"
     gene            174371..174754
                     /locus_tag="CPHA266_RS00815"
                     /old_locus_tag="Cpha266_0154"
     CDS             174371..174754
                     /locus_tag="CPHA266_RS00815"
                     /old_locus_tag="Cpha266_0154"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744064.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfurtransferase"
                     /protein_id="WP_041467136.1"
                     /db_xref="GI:752830834"
                     /translation="MSTIRDVTPRDSFAMIQKGALLVDVREPHEVARKSFDVPDSMLI
                     PLSQLHKRFKEIPAKRQTVIACRSGNRSVTAVRFLMSHGYSKAVNLQDGIIRWEKEGL
                     PVRRPLKQKSGSWFTRLFGRKSPVQ"
     gene            complement(175073..175488)
                     /locus_tag="CPHA266_RS00820"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(175509..176249)
                     /locus_tag="CPHA266_RS00825"
                     /old_locus_tag="Cpha266_0156"
     CDS             complement(175509..176249)
                     /locus_tag="CPHA266_RS00825"
                     /old_locus_tag="Cpha266_0156"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744065.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744065.1"
                     /db_xref="GI:500064148"
                     /translation="MTPEQLSQTLVTSEELVYHPIAVKFVTSLSELPEGIHKFGASSG
                     ERLPKSFLCAMWGDCLRGAAPFYTTREHQLCGGGAIAAGFGSLLPLEVAEKFMIGDGK
                     LFGTMKALRCSMESTMPFEDGEFEAQIIGPLSAMNNDTLRPDVVLIVCKPYQGQHILR
                     AYGFDSGELVHGIAGGSTCEMVSSYVKKTGKPTFTLGDTGGNAGLSLEPDELLLAFPY
                     DKLETAVSNLSRICRTSTMHRHTIVHER"
     gene            176617..>177318
                     /locus_tag="CPHA266_RS00830"
                     /old_locus_tag="Cpha266_0157"
     CDS             176617..>177318
                     /locus_tag="CPHA266_RS00830"
                     /old_locus_tag="Cpha266_0157"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744066.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_041467457.1"
                     /db_xref="GI:752831155"
                     /translation="MKRVIIIGATSGIGRALASLYIAEGWTTGLCGRRTAFLEDLRSV
                     AGKQVLVRAMDVTDTVAARKVFVELVQVMGGVDLVIISAGTGYLDPSFPWEKELETLK
                     TNVTGFAAIAHAAFEVFRHQGFGHLAGISSIAAIRGGSVPAYHASKAFVSNYLQGVRC
                     LAAASGLQIHVTDILPGFVDTAMAKGDGLFWVASPEKAALQIFRAISKKKYRVCITKR
                     WQIIAILLRVMPSGVY"
     gene            complement(177557..>178031)
                     /locus_tag="CPHA266_RS00835"
                     /note="ATP-binding protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            178891..181584
                     /locus_tag="CPHA266_RS00840"
                     /old_locus_tag="Cpha266_0160"
     CDS             178891..181584
                     /locus_tag="CPHA266_RS00840"
                     /old_locus_tag="Cpha266_0160"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010919289.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744067.1"
                     /db_xref="GI:500064150"
                     /translation="MTTTRLRRQYQYFAFISYSHTDAKVAEWLHRKLESYRLPNAVLR
                     KSDGQLPRHVRPIFRDIADLSSGSLARTLREEIGQSQFLIVICSPDSAKSEWVEMEVS
                     HFLTLRGHEFVIPVIIKGTPYAKDAVDECLPLSLLRTEVDLLGISFAGQSKEQVLLKT
                     VSALLDIKYDSLYDRHRRRQRRQRMFAATVVTVMFVVVLTASLFSFIQWNRAEQRRAE
                     AEQLLNYLLLDLHPKLKQFGRLDILESVAEKSREYIDYISTDVRDPIDAIQAISLRRN
                     MAEVYQSVGKLENAEALHLKNISVLKKLEQIDPKMEIIHLLKGEEHQALASIRKTEGR
                     FQDALHESLTAFSVFKSFVSVKSDARWRSAKASSEQRLSDAYYDLGMGKQAAWHINSA
                     VSDFRRILHEHSAGDNSYKADLAYALVSKSRVEVKWGTTSRAYSVFVEASELFRQHLE
                     EHPEDREVRASFANVVSDLAAMLKDMGRLEDALIYWDLAIDAERELVTFEPLNVRWHA
                     DLSETMMNKANALGRLGRTGEGFLLYEEVSRHQRKLIALQPKVARWRATYAWCRHNMA
                     IEYARLGKNKGAIDLWNDAIATIEQLRKDGRAKREWLLDLCNMLDQRATITAENGNFE
                     KAEQDIKASQAIRASLISDSNSSPDELSQMGLNQARKALLDYYRKDYSHAMVSIKAAE
                     GYLRRAVKLDEANCEWRAHLAGTLRNSSVIHRAAGFPDKAKRAIDECIVILEKLRIRQ
                     PSDKKIRVDLSQAYNNQGNLYNDFGSIKSSVSAWEKSLTLDSDPAQREFLATRLGTLA
                     YQYILLQDPGKSEMSARKALEVDAAPWIQINLGHALFLQDMREAAKAQYLNAMRKDGK
                     ILASISADFVDMENHGIHVRNAIQMLDELRGAALETNNEKQ"
     gene            complement(181999..182385)
                     /locus_tag="CPHA266_RS00845"
                     /old_locus_tag="Cpha266_0161"
     CDS             complement(181999..182385)
                     /locus_tag="CPHA266_RS00845"
                     /old_locus_tag="Cpha266_0161"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744068.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744068.1"
                     /db_xref="GI:500064151"
                     /translation="MKSFIDAVKNNKTGFVIKNSVFLPFHCEILTIWLGKEMSLLSTP
                     DLITDLTDAEILGIREGNYYTNLVFRKRGDLAKELGHHKGHIILRAAEKGADIFQVEN
                     IHYVRIGFHDHHKELSLEMIDNPFDL"
     gene            complement(182418..183893)
                     /locus_tag="CPHA266_RS00850"
                     /old_locus_tag="Cpha266_0162"
     CDS             complement(182418..183893)
                     /locus_tag="CPHA266_RS00850"
                     /old_locus_tag="Cpha266_0162"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744069.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="citrate transporter"
                     /protein_id="WP_011744069.1"
                     /db_xref="GI:500064152"
                     /translation="MLPTLTRHALCLLVFVLVVAGVTGISGILIAAEAFDINAAASPV
                     AIENNLPPVWLVAPFATLLVMIATGPLLFHRFWEQHYPKVSTGLGFIVAVYYVFMIEN
                     GLQVLEHTLEEYLSFIALISSLFVVAGGILIRIERRGTPLINASLLFIGAVISNLVGT
                     TGASMLLIRPYMRINAGRIKAFHIVFFIIIVSNIGGALTPVGDPPLFLGFLKGVPFFW
                     VFPKLILPWIITIAGLLFIFIFLDAKAGHGKMKGTEPDGEISITGKRNFFFLAIIITS
                     VFLDPAVIEGVPSLQKLFHLPFGIRELIMFIVAVTAYKYSNPAAFKGNEFNFEPIKEV
                     AFLFIGIFATMIPALELIGNYAETHAEVFSVSRFYWLTGVLSGVLDNAPTYLNFFAGA
                     LGKFGLDIDIPEDIILFANGVNSAIQGDVSSDIYLMAISVASVFFGALTYIGNAPNFM
                     VKNIAAQADVDVPDFLEYIYKYSIPILLPFLMLIWVLFFNY"
     gene            184699..186093
                     /locus_tag="CPHA266_RS00855"
                     /old_locus_tag="Cpha266_0164"
     CDS             184699..186093
                     /locus_tag="CPHA266_RS00855"
                     /old_locus_tag="Cpha266_0164"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011119326.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="putative methyltransferase"
                     /protein_id="WP_011744071.1"
                     /db_xref="GI:500064154"
                     /translation="MSLKFSSSFLLNSIDAWEEDRKDRFDLDALTQSFHESVPALGFI
                     DWKITVVERGYAETVLPLTPNSSNQYIAHQGPLMLLAAEYTGGLALTSLFHRVPIIGF
                     WPSVDENAGYMWGAKASIKWITPSCHNLTCKARIEKERWEGLAKRFANSNKVVVTIPV
                     KMFNGDKLVAVADFTYWAQDINSLKRNAYDVEKIDLLYEHKTKTTAKLIVGLRALEQE
                     KPIDQRRFDDPYAFMLAGKHGITLARRFSVATPQLQNMISARTQHLDECVKQFSLGKT
                     KFNVVNIGAGYDSRFWRLNIANAVIYDLDLPVMLHERKRIFDYSRNNAIHNVDIDLEI
                     QSIDQALLEKSDFDSELPTFFIWEGGSMYFMDENIESILGSIRRIVNQDSRIWLDYVS
                     KDLVEISTGIPEAEGFIYNIRKMGEPFINGYNDIGVLAGKYDLVIAQNIRSGELLNIE
                     EDVYSHYSFCVLKS"
     gene            <186211..>188220
                     /locus_tag="CPHA266_RS00860"
     CDS             <186211..>188220
                     /locus_tag="CPHA266_RS00860"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012474360.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467458.1"
                     /db_xref="GI:752831156"
                     /translation="IGLWGHPLYYLLCAFIFPQPYESFELRFASAISFIPILFHQRYP
                     EKFRSLLMLYWYLWLTFTFPVVFTYLMLMNDFSGLWLVAETVMLFVFIIFITNYFLLF
                     VLFFSGILIAYAGFVLDTGAHLLITKEIIEYFVSIPIAILLGLLVNSTNKKGELAQER
                     NSVLQSLAGSIAHEMRNPLGQIRHCLYSIQNLLPQVNPEECDKPLGKEKLETLYERVS
                     RGQLAVKRGAQVIDMVLSEVRERPIGPESFTYLSATRVTRNALDEFGYESEQDRRRVH
                     LETKDSFIFHINETLFVFVLFNLLKNALFYFKTHPHSEISVRLERGERFNYLYFRDTG
                     PGISSETLPFIFDSFYTTGKASGTGLGLSYCKRIMTAFGGSITCKSVEGEYSEFILSF
                     PVISEQDMNLYTERVIAVGQADFQGKRLLIVDDSALYRSILKKYFAPLQVEIDEAAGG
                     REALDLLSIRRYDLVIMDLNMPSMSGYETVERLRRGEAGPQSCSVPVVAHSSESVMTA
                     RSKSENAGMQAFIAKPCSQAELISSLRSVLDTIPERNYPGSPFSGRKVLLVDDSALNR
                     DLLAMYLRDSGIEVTVSDSGAEALNILRNQDFELLITDIHMPGMDGLELTRTIRSSRS
                     EQLCRLPIIGLSGAVEEEVVARKAGMNDFRIKTDSPNLLLASIGRQ"
     gene            188924..189253
                     /locus_tag="CPHA266_RS00865"
                     /old_locus_tag="Cpha266_0166"
     CDS             188924..189253
                     /locus_tag="CPHA266_RS00865"
                     /old_locus_tag="Cpha266_0166"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744073.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744073.1"
                     /db_xref="GI:500064156"
                     /translation="MMVRRICFFSLMLSLVFFMSGADNVGPLTAEDYYKSGKIKYHKD
                     DYSGAIEDYNKAAELAPDVAKIFGSRGAARRKLGDREGAIADAQKAARLGDKDAQRIL
                     RMLDLGW"
     gene            complement(189446..190696)
                     /locus_tag="CPHA266_RS00870"
                     /old_locus_tag="Cpha266_0167"
     CDS             complement(189446..190696)
                     /locus_tag="CPHA266_RS00870"
                     /old_locus_tag="Cpha266_0167"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744074.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate dehydrogenase"
                     /protein_id="WP_041467459.1"
                     /db_xref="GI:752831157"
                     /translation="MHSKPNPFKTAQRQLDEAAALIGLDPAAHQLLRWPLRELHVAMP
                     VKMDDGSTKVFRGFRVQYNDARGPNKGGIRFHAEETIDTIRALAAWMTWKTAVLDLPL
                     GGAKGGVICNPKSMSPGELERLSRAYIRQAGRILGLEKDVAAPDIYTTPQIMAWMADE
                     YSFMQGNNEFGVISGKPLALGGSAGRNDATARGGIACVIEAAKELGIELQGATAAIQG
                     YGNVGSFAHKLATELLGMKIIAVSDSGGGIYNPDGLLYDEVKAHKEKTGSVTGFPGSD
                     SVSDETLLELNVTVLFPSALEQVITEHNAQNIRAGIIAELANGPTTPEADKILFENGC
                     YVIPDFLCNAGGVTVSYFEMVQNTYGYYWEEDDVRKRLEKKMKTAFHSVHETSRKYKV
                     HNRLGACIVAIERVAEAMKLRGWY"
     gene            complement(190837..191235)
                     /locus_tag="CPHA266_RS00875"
                     /old_locus_tag="Cpha266_0168"
     CDS             complement(190837..191235)
                     /locus_tag="CPHA266_RS00875"
                     /old_locus_tag="Cpha266_0168"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008592598.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744075.1"
                     /db_xref="GI:500064158"
                     /translation="MTEIKRKGLFSKIESRIDAIVLVEETTIGFFFVAGLQAILSIWQ
                     GLPVLVDAAIFALSSLFIRQFQSRVAAITLTLYAAVSVALAATNTAGAYFGGNNNIFL
                     SAILLWASIRAAEATIKLHGKFAIPENPKK"
     gene            complement(191334..192296)
                     /locus_tag="CPHA266_RS00880"
                     /old_locus_tag="Cpha266_0169"
     CDS             complement(191334..192296)
                     /locus_tag="CPHA266_RS00880"
                     /old_locus_tag="Cpha266_0169"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744076.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744076.1"
                     /db_xref="GI:500064159"
                     /translation="MNLQLGQAIKIVAQTKVYLLYRTMVYGAIVGVVAIVLGILVLIG
                     TVFGSGAAFVLFLITLFAGSFGFRLLRDYVLYLLQAGHIALITEIAETGTLPPGISQT
                     SWAKEKVMKYYKEVSVLALVDQLVKGVLVTLNRTIFNVFNALPIPALEGLAGIVQRIV
                     NFSLTYIDESVIAYTFRTRNENVFDAAKSGILVYCQSWKAVLMNAVALTVLSYLFVIL
                     MTTLFMIPLGAVSLMLPSSWSFVKFALFVLALFLGISTKWILFDPIACTSTLLTFLNE
                     AETTKPDPAWESKIEMVSDQFRTLKTKAGEMMRGTAKSREAQST"
     gene            complement(<192441..193247)
                     /locus_tag="CPHA266_RS00885"
                     /old_locus_tag="Cpha266_0170"
     CDS             complement(<192441..193247)
                     /locus_tag="CPHA266_RS00885"
                     /old_locus_tag="Cpha266_0170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744077.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan transglycosylase"
                     /protein_id="WP_041467460.1"
                     /db_xref="GI:752831158"
                     /translation="MKLVKNLFILLLLFFIADIARYAFYPDIGRLAYENPKKSAFMLY
                     REAEWEKQGLYEKTVKQQWVPIEKVSPNLIKAVLIAEDDKFWQHEGFDYKAIGVALEK
                     NIAEKKFKMGGSTISQQLAKNLFLSPSKNPIRKIKEAILTWRIEKTLTKRRILEIYIN
                     VAEWGDGIFGIEQASRHYYGVSAARLTAQQASKLASVLPNPIRYSPKGSSSYVHNRSR
                     KILAIMKKRGIVLPDYDAVMTTAQPDTTTVDSVTIGIPQELIDQAASPDSS"
     gene            193428..193844
                     /locus_tag="CPHA266_RS00890"
                     /old_locus_tag="Cpha266_0171"
     CDS             193428..193844
                     /locus_tag="CPHA266_RS00890"
                     /old_locus_tag="Cpha266_0171"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744078.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C"
                     /protein_id="WP_011744078.1"
                     /db_xref="GI:500064161"
                     /translation="MKRVFIGLVTGLLCFPVAQSRAATPDGKEVFERNCSVCHSVNPP
                     SKSAPPILPISGRYHMQFSTKSAGVAAMAAFMKAPSKQKSVIEPEAITRFGLMPPMAL
                     GDAELTAVAGWVWDQGGSASGRGSGRGAGQGAGGCN"
     gene            complement(193926..194001)
                     /locus_tag="CPHA266_RS00895"
                     /old_locus_tag="Cpha266_R0002"
     tRNA            complement(193926..194001)
                     /locus_tag="CPHA266_RS00895"
                     /old_locus_tag="Cpha266_R0002"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(193966..193968),aa:Arg,seq:cct)
     gene            complement(194046..195920)
                     /locus_tag="CPHA266_RS00900"
                     /old_locus_tag="Cpha266_0172"
     CDS             complement(194046..195920)
                     /locus_tag="CPHA266_RS00900"
                     /old_locus_tag="Cpha266_0172"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BCW2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutL"
                     /protein_id="WP_011744079.1"
                     /db_xref="GI:500064162"
                     /translation="MAKIARLPDNVANKISAGEVVQRPASVIKELLENAIDACASKIT
                     VTIKDAGKELVQIVDNGIGMSRQDALLSVERFATSKISGVEDLDSLMSLGFRGEALPS
                     IASVSQFELKTKPEGALLGFRFRCDGGEPVEESEVNAEKGTTITVRNLFYNVPARRKF
                     LKSNATEFRHIFESVKSLALAYPEIEWKMVSDDEELFHFRTPDIYERLDAFYGENFSL
                     SLIPVSEENDYLSISGFLGKPGMQKRQKLDQYIYVNRRIIQNRMLSQALQQAYGELLV
                     ERQAPFALLFLGIDPSRIDVNVHPAKLEVKFEDERSVRTMFYPVIKRTIQLHDFSPDA
                     AEKEPCSIKEGTLDCSSRKLGFQDIAEPASTTSTLYANYRQGAFGDTPFERPAYAEKE
                     PRPSSINTGFERFEPDLREGGDLFSTTLQARPYEDDNTPDPGENDPKIWQLHNKYIIC
                     QIKTGMMIIDQHVAHERVLYERAVDVMNQNVPNSQQLLFPQKIELRAWEYEVFEEIRD
                     DLYRLGFNLRSFGAKTVMIEGIPQDVRPGTEVTILQDMITEFQENSSKLKLERRENLA
                     RSYSCRNAIMAGQKLSLEEMRSLIDNLFATRVPYTCPHGRPVIIKLSLDQLDRMFGRK
                     "
     gene            196237..198909
                     /locus_tag="CPHA266_RS00905"
                     /old_locus_tag="Cpha266_0173"
     CDS             196237..198909
                     /locus_tag="CPHA266_RS00905"
                     /old_locus_tag="Cpha266_0173"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744080.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_011744080.1"
                     /db_xref="GI:500064163"
                     /translation="MKTGHLTCWHCLTTEDVFNKLQTTSGGLSSSEAFRLLGVYGPNR
                     IHAERRTSPLKLLVAQFKNVLILTLLIATLLSVYLGHGFEAVAIAVIVLFAVLLGFVQ
                     EFRAEKAIEALREMAAPLARVMRDGKEAVINASELVPGDILLLAVGDRVAADARLLQA
                     SNLRADEASLTGESLPSEKDVEAVLSEDAAPGDQKNMVFAGTSISYGRASAVVVSTGM
                     ATEFGRIAAMLQNVETEKTPLQKNLDKVGSALAGVALLIVLVIVVFGLFRGQSFIEML
                     IFGIALAVAVVPEALPAVVTISLALGVQRMVKRNALMRRLPVVETLGSTTVICSDKTG
                     TLTRDEMTVRTLYSSGVFIDVNGSGYNPEGSLAVVDGGSLPESLNELLLAGVLCNDAR
                     IVKSDSGFWGVAGDPTEGALLVVARKAGLNELTLRQLYERLDERPFSSETKKMMTLHR
                     MGETTKAFIKGAPEVLLADSVAVRCSEGVKALDDPLRAALLAEADNLGKRALRVLAFA
                     VKDGADMSSAGDGMTFLGFAGMIDPPRAEAGDAVRQCLAAGIRPVMITGDHPLTAEAI
                     ARELGILRDGKVVTGAMLQTMSAEELRHSVGSVSVFARVAPEHKLRIVEALQMNGEVV
                     AMTGDGVNDAPALKKADIGISMGLTGTDVSKEASAMMLMDDNFATIVAAVEEGRGIYD
                     NIKKYLTYLLSSNIGELGLMAGATLMGIPLPLSAVQILYVNLATDGFPALALAVDPSE
                     RDIMLRSPNNPKKGIFTPSVLAFMLTGGIWSTMVNLSLFLWAFASGRTLQESMTMTFV
                     SLVLIQFFKAYNFRSEKVSLFVRPFANRWLNLAIVWELVMLIAIINVPFLQRLFGTCL
                     LTPEDWVIVIGSAMTVVPIIELLKWLMRSGRFGF"
     gene            complement(198999..200054)
                     /gene="hemE"
                     /locus_tag="CPHA266_RS00910"
                     /old_locus_tag="Cpha266_0174"
     CDS             complement(198999..200054)
                     /gene="hemE"
                     /locus_tag="CPHA266_RS00910"
                     /old_locus_tag="Cpha266_0174"
                     /EC_number="4.1.1.37"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BCW4.1"
                     /note="catalyzes the formation of coproporphyrinogen from
                     uroporphyrinogen III; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen decarboxylase"
                     /protein_id="WP_011744081.1"
                     /db_xref="GI:500064164"
                     /translation="MLKNDLFLRALKRQPCSRTPIWVMRQAGRYLPEYRAVREKTDFL
                     TLCKTPELAAEVTIQPVDLMGVDAAIIFSDILVVNEAMGMDVEIIESKGIRLSPAIRS
                     QVDIDRLIIPDINEKLGYVMDAIRLTKKELDNRVPLIGFSGAAWTLFTYAVEGGGSKN
                     YAFAKKMMYREPKMAHMLLSKISSVITEYVLMQIEAGADAIQIFDSWASALSEDDYRE
                     FALPYIKENVQAIKTKYPDTPVIVFSKDCNTILSEIADTGCDAMGLGWNMDIAKARKE
                     LNDRVCIQGNMDPTVLYGTPDKIRSEAAKILKQFGQHTATSGHVFNLGHGILPDVDPA
                     NLKLLVEFVKEESVKYH"
     gene            complement(200220..201068)
                     /locus_tag="CPHA266_RS00915"
                     /old_locus_tag="Cpha266_0175"
     CDS             complement(200220..201068)
                     /locus_tag="CPHA266_RS00915"
                     /old_locus_tag="Cpha266_0175"
                     /EC_number="1.3.5.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011890869.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinate dehydrogenase"
                     /protein_id="WP_011744082.1"
                     /db_xref="GI:500064165"
                     /translation="MKRYAYYLSCINESMTKELDRSIDLWQKDLDLELIKLHESTCCG
                     GSNLEYVSPKHFALVNARNIAHAEKLGLDLVVSCNTCLMTIRTAKKKLDSSAELKCEV
                     NEILKKEGLEYKGTSEVRHLLWILIEDVGLDVIKSKVKVPLKNYKIAPFYGCHILRPS
                     TVLGKDNPLDPSSLDQLIEALGGTTIPYEHKNRCCGFHTLLVAEEESLNVAAEALNEA
                     IESKADFIVTPCPLCHTVLDGYQAKALKQAHINASIPVFHLSEMVGLALGYTKKQLGI
                     KRHIVS"
     gene            complement(201087..202121)
                     /locus_tag="CPHA266_RS00920"
                     /old_locus_tag="Cpha266_0176"
     CDS             complement(201087..202121)
                     /locus_tag="CPHA266_RS00920"
                     /old_locus_tag="Cpha266_0176"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744083.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinate dehydrogenase"
                     /protein_id="WP_041467461.1"
                     /db_xref="GI:752831159"
                     /translation="MTGAAEQHKEEKRDITFRVFRFNPQVDIKPYFDDYTIPVERGIT
                     VLRALNYIKEHVDPTVSYRAFCQAGICGSCGMRVNGISKLACTTQVWDELDRCKEPGI
                     LRVEPLRNMPPIKDLIVDMDPLVDKMKHYMNWVDSSMPESEMGKKEFLVSEDEFLKYD
                     KATDCILCASCVSECTILRAHKEYVSPAVLLKSYRMNVDSRDSIHDTRLAELVKDHGV
                     WDCTHCYRCQETCVKSIPIMDAIHGIRENALEVRGTKDTSGAKHAEAFMDDIAKKGKL
                     VEATLPFRTNGVLWTLQNLLPMAVKMIMKRRTPPPPPMVKPSKGIKAFREEFREMTEH
                     VKDDHQTHNK"
     gene            complement(202132..203835)
                     /locus_tag="CPHA266_RS00925"
                     /old_locus_tag="Cpha266_0177"
     CDS             complement(202132..203835)
                     /locus_tag="CPHA266_RS00925"
                     /old_locus_tag="Cpha266_0177"
                     /EC_number="1.3.5.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012467232.1"
                     /note="part of four member fumarate reductase enzyme
                     complex FrdABCD which catalyzes the reduction of fumarate
                     to succinate during anaerobic respiration; FrdAB are the
                     catalytic subcomplex consisting of a flavoprotein subunit
                     and an iron-sulfur subunit, respectively; FrdCD are the
                     membrane components which interact with quinone and are
                     involved in electron transfer; the catalytic subunits are
                     similar to succinate dehydrogenase SdhAB; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinate dehydrogenase"
                     /protein_id="WP_011744084.1"
                     /db_xref="GI:500064167"
                     /translation="MKPFDIVIVGGGGAGLYAAMEAMKTNPSLNIAVLSKVYPNRSHT
                     SAAQGGANAALANKAKDDTVEMHIFDTIKGSDYLADQDAVDILCSEAPKIIRELDNIG
                     TPWSRLDDNTIAQRPFGGAGRPRCCYCADKTGHTILQTLYEQCLKKGVFFFNEYFSLS
                     LSVNNSRMRGLLAINMKTGKIEAFPAKTVIFATGGYAKMYWNRSSNAAGNTGDGQAIA
                     YRAGIPLKDMEFVQFHPTGLRKSGLLVTEGARGEGGYLVNKDGERFMSRYAPEKMELG
                     PRDLVSRSIETEILQGRGFDSPAGKYIHLDLTHLGAELIKSRLPQIREMSMNFEGVDP
                     IEEPIPVRPTAHYSMGGIDTDNYGRTVMDGVYAAGECACVSVHGANRLGGNSLLDILV
                     FGRIAGHTAAEEAGKFEPGNISPEEIKAKDEELRSFMQSSGHYERYGALREELGQTLA
                     LNVGIYREASKISRGMEDLSLLKDRFKKIRVFDSSDIFNTNLIQVLELQNMLDLAETV
                     ATGALAREESRGSHTRNDFPTRNDEKWHKHTLATLENGTVKLGQKPVTMGRYELQERT
                     Y"
     gene            complement(203961..204407)
                     /locus_tag="CPHA266_RS00930"
                     /old_locus_tag="Cpha266_0178"
     CDS             complement(203961..204407)
                     /locus_tag="CPHA266_RS00930"
                     /old_locus_tag="Cpha266_0178"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744085.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal transduction protein"
                     /protein_id="WP_011744085.1"
                     /db_xref="GI:500064168"
                     /translation="MHQLITLRTLPVSDLMQKDYHTIKGSCTVAEALQLMKRTKESGL
                     IVEPRNEDDCYGIVTEKDILEKVIDPGEDVHRDPWNTPIFQIMSKPIISVNPSLRIKY
                     ALRLMKRTNVRRLTVMENNKVIGVLNMTDVLHAVEELPIHDDNIAL"
     gene            complement(204591..205232)
                     /locus_tag="CPHA266_RS00935"
                     /old_locus_tag="Cpha266_0179"
     CDS             complement(204591..205232)
                     /locus_tag="CPHA266_RS00935"
                     /old_locus_tag="Cpha266_0179"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744086.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase"
                     /protein_id="WP_011744086.1"
                     /db_xref="GI:500064169"
                     /translation="MIIKQFRTGGDRNLGYLAADEVSGDALVVDASYNPGMIYNFACE
                     HGLTIRYLFSTHGHSDHTNGNATTSQLTGLKPLLYGDTCPETGISVRAGARFPLGSGS
                     VLIIHTPGHTEDSICLHVGDALFTGDTLFTGKVGGTMTAEQALAEYDSLRNKLMRLPD
                     ETRVFPGHDYGSSPASTIAEEKKSNPFLLQPDFRSFLALKQNWAAYKKEHGIA"
     gene            complement(205257..205565)
                     /locus_tag="CPHA266_RS00940"
                     /old_locus_tag="Cpha266_0180"
     CDS             complement(205257..205565)
                     /locus_tag="CPHA266_RS00940"
                     /old_locus_tag="Cpha266_0180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744087.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744087.1"
                     /db_xref="GI:500064170"
                     /translation="MKFLAIMGHEETRPMVRNLFKEYQVNLFSNVAIRGCNCQKPALM
                     EQSWWPADEMIGTYSSLCFAILDDDKAEAIMLELEKNPIAVDKDFPARAFLMHVEKTA
                     "
     gene            complement(205588..208794)
                     /locus_tag="CPHA266_RS00945"
                     /old_locus_tag="Cpha266_0181"
     CDS             complement(205588..208794)
                     /locus_tag="CPHA266_RS00945"
                     /old_locus_tag="Cpha266_0181"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744088.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug transporter AcrB"
                     /protein_id="WP_011744088.1"
                     /db_xref="GI:500064171"
                     /translation="MNEGIAGKLAKQFINSKITPLLMIASLLVGVMATFMTPREEEPQ
                     IVVPLVDLYIPYPGATPSEVEERVAKPVERALTEIPGVDFVYSTSMPDVALVTVRYKV
                     GEDTEQSMVKLWSVLMKNMDKMPAGAQFPLIKKVAIDDVPVLNLTFWSKTKDPYQLRQ
                     TVAAVGDELKQIESIGDVEIKGGLKRQVRVVLNKEKLSQFNISALQIARQIQQSNSQM
                     TAGDFKQMNNEIIVRSGRFLESADDVRGIVVGIYGASPVYLRDVSEVIDGPEEVNNYT
                     FFGWGAAGPKNAATGEYPAVTLTVAKRKGTDATVLANKVMTKVEGLKKTTIPSDITVT
                     ETRNYGETASEKVFTLLEHLIMAVVAVTIVVGFFLGWRGALVVFASVPITFALTLLIY
                     YLLDYSLNRVTLFALIFVTGIVVDDSIIIAENIHRHFAMKRQPRLQAAITAISEVGNP
                     TILATFTVIAAVLPMVFVSGLMGPYMSPMPIGASLAMVFSLLVALIATPWLSYRLLKT
                     EEGHHEEYDITKTGYYKLFNSILSPFIESKLKTWLAFGGVAILLIGAIALVPLKAVQM
                     KMLPFDNKNEFQVIVDMPEGTALEQTARVTKEISAYLKTVPEVSSYQYYVGTNAPINF
                     NGLVRHYYLRQADNMGDIQVNLIHKGERSLQSHDIAKKVRSAVQNIALKYNGNAKIVE
                     IPPGPPVLSTLVAEIYGPSQKEQIALAGEVKKIFSQTPGVVDVDWLVEDDQRVYDLEV
                     NKEQAAFRGVSAEQIAQTLRMSLHGVEVGLLHTRKSIEPVTIQLRLPQNQRTSIQDLS
                     GIFVQSQGMGSLTTRLRAGEMIPLSSLVTIKEKIQDKSIYRKDLRQVVYVTADVAGAT
                     ESPVYAMLAMDKKIEQLKLPGGYSISPLYTSAPTSQAKSSMKWDGEWQITFEVFRDLG
                     TAFAVVLVIIYLLIIGWFQSFKTPLIMMIAIPLSLVGIIPGHWIHGAFFTATSMIGMI
                     ALAGIMVRNSVLLIDFIQIRREEGVDLKQAVIESAAVRTRPIILTSGAVVIGSLVMLF
                     DPIFQGLAISLIWGGVLSTILTLVVVPLVYYMAEKKSH"
     gene            complement(208787..>209032)
                     /locus_tag="CPHA266_RS00950"
     CDS             complement(208787..>209032)
                     /locus_tag="CPHA266_RS00950"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011358712.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467462.1"
                     /db_xref="GI:752831160"
                     /translation="ILVPKSSVFQQGGLTGVFVVGDDQKATIRWIRTGRIDHGSVVVL
                     GGIDKGEMVIANYNPELKEGVSVTKSQAVTREATSNE"
     gene            complement(209243..210568)
                     /locus_tag="CPHA266_RS00955"
                     /old_locus_tag="Cpha266_0183"
     CDS             complement(209243..210568)
                     /locus_tag="CPHA266_RS00955"
                     /old_locus_tag="Cpha266_0183"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744090.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_011744090.1"
                     /db_xref="GI:500064173"
                     /translation="MKVYKTLIGIMLAGSIALPGCVQAAEKTIKLSLGEAVSMARENN
                     RTIKAAQSRVAQAEAKIVQTRQSYLPKVTLSETAVITNDPGAALVFKLQQNIITQSDF
                     IPDRLNNADVINDFNTSLLVMQPVYNPDASTGRTIAFTAKKAQEQMAARTTETVELQV
                     SKLYYGLILARKNIEAVEQSIITMKNHSNEADKAYRVGLLTKSDKLSTDVRLAELLEQ
                     KLMLHDAIKNATDALKVMLNLDANLTIIPTEDLVVDKRLPVVDEKNTPEGRSDLKALQ
                     TYREIAGYQEKMAQAAKLPRVNAFFQTNLHSSDIFSGGSSWALGMTMQWNIYDGMATT
                     GRIQEAKAQQLEAMYNHEEAKSQSLVEIKKAQRDLKTAKARIAVSQESLEEARVSLDY
                     IGTQFKTGMAMTFELLMREGAYTYAKLRLNQAKYDYCIARSELAYYSAR"
     gene            complement(210575..210805)
                     /locus_tag="CPHA266_RS00960"
                     /old_locus_tag="Cpha266_0184"
     CDS             complement(210575..210805)
                     /locus_tag="CPHA266_RS00960"
                     /old_locus_tag="Cpha266_0184"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012467239.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467463.1"
                     /db_xref="GI:752831161"
                     /translation="MDDVILRLKKVNGQIQGLIRMVENSDNCEKVIVQFQAAKAALDK
                     TYSLVLDRSLKECMSHNDTENVGRILKLISKH"
     gene            complement(210923..211795)
                     /locus_tag="CPHA266_RS00965"
                     /old_locus_tag="Cpha266_0185"
     CDS             complement(210923..211795)
                     /locus_tag="CPHA266_RS00965"
                     /old_locus_tag="Cpha266_0185"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744092.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_011744092.1"
                     /db_xref="GI:500064175"
                     /translation="MSFADTTRGKIYYEDTGWGVSDNREVVLFFNGWSISARYWIPVI
                     DRLSSQYRCLSFDQSGTGRTVCSHSCLSFSVEGFADEASELLVHLGLLGSRKLHIVGH
                     SMGGMIATEICNRHPESLVSATIVNCGIFDDELLKSFHHVLVGGMIDVAMLFKGVFLL
                     EPFKSLFIDRAIGRPIDQKYRTVFVEDFVASDTRAATAVGKFAIDPEIIGKYTAEAVK
                     IGAPLLCVVGMADRTIPPEGMQTLYNRRIEQSDFLTRLARFDHAGHLPMLEVLPEFEQ
                     ALRNHFYAASKLLG"
     gene            complement(211792..212448)
                     /locus_tag="CPHA266_RS00970"
                     /old_locus_tag="Cpha266_0186"
     CDS             complement(211792..212448)
                     /locus_tag="CPHA266_RS00970"
                     /old_locus_tag="Cpha266_0186"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012509363.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isoprenylcysteine carboxyl methyltransferase"
                     /protein_id="WP_011744093.1"
                     /db_xref="GI:500064176"
                     /translation="MAMHDELPFRIIFAGIYVAGFLMRGLFIQRMKPQEKPIIPEAGN
                     AGEISRFRVIFQKVMFFLWIAIVASYTWYPPWVEALHFPFPTWLRYGGAIAAAVSFLF
                     LFLTMKTLGRYWSPLPRLMEGHKLVITGPYRFIRHPMYTAMMLLFIAFILITANAAVT
                     VFSLIATVLTVKWALNEEKMLIGFFGDEYRAYMTRTGAFLPAPRKMVRHIFFNQHEKL
                     "
     gene            212771..213394
                     /locus_tag="CPHA266_RS00975"
                     /old_locus_tag="Cpha266_0187"
     CDS             212771..213394
                     /locus_tag="CPHA266_RS00975"
                     /old_locus_tag="Cpha266_0187"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012509364.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012509364.1"
                     /db_xref="GI:501501136"
                     /translation="MEVVGKSKALVVLESCLQESTVYFSNHEKILKCNPYCRYVRYIP
                     DFDVFQWTFEVDDPRNNPIVAIFFVRQTEEHIPTDSAVFRRYVGESRAPIDTETPGKK
                     IIWETVESAPELLFNNDHTFIGKTFSEIFLLHQTDNRTTVHFETNISLDFKLSFPLNL
                     MPEPALKFMSDMIMSKIMQQATESMLCQVQSDICCSMPEIATEGGKK"
     gene            213646..214821
                     /locus_tag="CPHA266_RS00980"
                     /old_locus_tag="Cpha266_0188"
     CDS             213646..214821
                     /locus_tag="CPHA266_RS00980"
                     /old_locus_tag="Cpha266_0188"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012509365.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="coenzyme F420 hydrogenase subunit beta"
                     /protein_id="WP_012509365.1"
                     /db_xref="GI:501501137"
                     /translation="MGNAWPVKESLESCVFRCGWVENHEKRIFGRVRNPDDSDELRFG
                     ISLKRFNATLKKPVNGAQWSGIITRISTMALQTNLVDAVLTLHGEPLQPKAVLAKTAQ
                     DIHEARGNKPVLSPVLQALHTAYREKTRRLLVVGAACHVHMVRDFTRKSPYFADLDLY
                     IVGIPCTDNLEPSHLQWVFRNISKNPETVINFEFMQDYRVHILHKAGKVEKIPFFCLP
                     SAVMKVGVFPNSCLSCFDYINSLSDITVGYLGAPYSKNRKTQWIIVRTERGEKLLDLI
                     NDEIETSPEVFFGDSHSAVQAALQPTLMPILQPEKLDDRKAMPKWLGIYLSRKKAKSG
                     PGGTEFAKYSIDIHAIRNFYFLKMYRPDDIGIVPTHIYDLLSQYDLSSIQRIIEARI"
     gene            214842..215615
                     /locus_tag="CPHA266_RS00985"
                     /old_locus_tag="Cpha266_0189"
     CDS             214842..215615
                     /locus_tag="CPHA266_RS00985"
                     /old_locus_tag="Cpha266_0189"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012509366.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_011744096.1"
                     /db_xref="GI:500064179"
                     /translation="MKNIVITGSSRGIGLGLAHAFLSKGCRVMISSSNSSNLDKALNE
                     LVEQHGSEHISAKTCDVANYQEVQDLWDHAQKSIGQVDIWINNAGIAHPLLPFWKLDM
                     TQIGHTLDVNLAGTINGSHVAIRGMIEQGSGYLYNLEGQGADGGIIHGMGVFGTSKAA
                     VHYFSKSLIEETRSLKIKVGTIIPGIIRTELQAKTSQQTDAGRLFLSLLGENVREATE
                     DLAKRILANNTHGVCINRMTTPDMIGKIATLPINFLLGR"
     gene            complement(215789..216013)
                     /locus_tag="CPHA266_RS00990"
                     /old_locus_tag="Cpha266_0190"
     CDS             complement(215789..216013)
                     /locus_tag="CPHA266_RS00990"
                     /old_locus_tag="Cpha266_0190"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744097.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744097.1"
                     /db_xref="GI:500064180"
                     /translation="MPQLPQNIIPEELTKPAAAIVSGAFLLSPLGIPPFIRGIPRVLL
                     AGAGGFLAGAVAEKVIENIGQILPPQPEDD"
     gene            complement(216052..216417)
                     /locus_tag="CPHA266_RS00995"
                     /old_locus_tag="Cpha266_0191"
     CDS             complement(216052..216417)
                     /locus_tag="CPHA266_RS00995"
                     /old_locus_tag="Cpha266_0191"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012509367.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744098.1"
                     /db_xref="GI:500064181"
                     /translation="MANESRKGGFFSVFRKEEKSVANKSAITSQQSETKAASSEKPAV
                     SVSREMTPKPVANVKPAATAEQQEKPVVFEAIDTTAAFSACWKAFGDLGLSQIKTVDM
                     VLTMLSNSIAKITDGQQTK"
     gene            complement(216448..217989)
                     /locus_tag="CPHA266_RS01000"
                     /old_locus_tag="Cpha266_0192"
     CDS             complement(216448..217989)
                     /locus_tag="CPHA266_RS01000"
                     /old_locus_tag="Cpha266_0192"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744099.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744099.1"
                     /db_xref="GI:500064182"
                     /translation="MIADKVQTLYPRVSEYFGKIRNGNRYLEHILEVDSFWKNFEHSP
                     CRKVVLQGSEMPADACVSDEYDLVYAGGSLGLLHASVMASKYARKVLVFDRHMSGKPS
                     RDWNISWNELEKLEQVGLFSYEEINASIACRYKTGWAEFYVENGRKKRLYIDNVLDCA
                     VESDQLLSIARQKILADECNRIVDKMTFMRCFQFPESVVIEVENNMHERVYFRAKVFV
                     DAMGVHSPVAMQLNDGASFTHLCPTVGTVSSGLENVDPDIGEILVSTEPADTSSGRGR
                     QLIWEGFPAGGDRYTTYLFFYDSRSSDNDKSLLGLFETYFLKLPSYKKPGKDFVVHRP
                     VYGVIPAYYHDGFERTRQVADNNILMLGDAAALGSPLTFCGFGSFVRNLKSLTEGLEK
                     ALACNSFEKKNLEQISAYEPNVAAMANLMKFMCYNKYTDHPNFVNELMNEVMIVLDGL
                     PPRYREAMFKDTLELSDLLLIGLNVAWKYPGVLMATATKLGLEGSLGMMKNMIGWAMS
                     SKASN"
     gene            218179..218400
                     /locus_tag="CPHA266_RS01005"
                     /old_locus_tag="Cpha266_0193"
     CDS             218179..218400
                     /locus_tag="CPHA266_RS01005"
                     /old_locus_tag="Cpha266_0193"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744100.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744100.1"
                     /db_xref="GI:500064183"
                     /translation="MSQDSAKLFLAQMKQDKELSDKIHNAATKEDRWTIIRQEGFDFT
                     REELDHATVTELNHFERWNWEAKLLADWL"
     gene            complement(218428..219309)
                     /locus_tag="CPHA266_RS01010"
                     /old_locus_tag="Cpha266_0194"
     CDS             complement(218428..219309)
                     /locus_tag="CPHA266_RS01010"
                     /old_locus_tag="Cpha266_0194"
                     /EC_number="4.1.2.13"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744101.1"
                     /note="involved in autoinducer 2 transport and processing;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldolase"
                     /protein_id="WP_011744101.1"
                     /db_xref="GI:500064184"
                     /translation="MAEYDKDKQAKEYYTDVPVEKHGFFLKGAHSLDWGMKNRLSRIF
                     RPDTGRTVMFAIDHGYFQGPTTGLERPDVNIVPLMSHADAIMLTRGMLRTTVPPSLTR
                     AVVMRCSGGPSILKELSDEELAVDIEDAIRMNVAAITLQIFIGGEFETRSIHNMTRLI
                     DMGLRYGIPTMAVTAVGKDMVRDAKYFRLACRIAAELGAQIVKTYYVPEDFETVVASC
                     PVPIVMAGGKKISELEAVTMSYQAIQEGAAGVDMGRNIFQSDAPLAMMKTVGKVVHEN
                     MPPAEAYEYFQSIRREG"
     gene            complement(219381..221498)
                     /locus_tag="CPHA266_RS01015"
                     /old_locus_tag="Cpha266_0195"
     CDS             complement(219381..221498)
                     /locus_tag="CPHA266_RS01015"
                     /old_locus_tag="Cpha266_0195"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744102.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_011744102.1"
                     /db_xref="GI:500064185"
                     /translation="MQNLWNDAELQRSVNGQRSANDIPVELAELVYASRLLGSESTLV
                     MHGGGNTSVKSELHDIIGYRVNVIFIKGSGVNLAGVDAHDFMPVRIEPLQKLQHLYAT
                     GGRSSEEDIQQFSTQRFKNFLYLNLFYLTEHMVNHSLSPSIETLLHAFLPHRFIFHTH
                     STALLTLSNQPDGQDLCREVLGESFGMVPYIKPGLGLARSAATAYESAPSIRGLVLQK
                     HGLVTFADTPDEAYHCMIESANLLEERITRAGRKVFPSVSLPAGIASLEDTAPVIRGA
                     VVEEIMPGSRDYRQFVLEFRTSPDILAYVNSDSLSDVSQRGAMTPDFIIRTKNRPLIV
                     PTPDASDLDAFKTAVHEAVERYDAEYRAYFQRRRQAAGIEVSMLDPLPRVVLVPGLGL
                     FGLGRTAREAAVNADIAESTASAILDAESVGRFESITEQEVFDIEYWEMEQAKMTKVR
                     HDVFAGKVALVTGAASGIGLATARAFRQRGAELVILDLNPEALQQAAEELGGGVLPIA
                     CDVTDRAAVRRAFDKVCRRYGGLDILVSNVGVALQGRIGDVPDEVLRRSFELNFFSHQ
                     SIAQEAVRIMRLQGTGGVLLFNVSKQAVNPGPDFGPYGLPKAATMFLVRQYALDHGRD
                     GIRANGINADRIRTGLLTDEMIKIRSTARGLNEREYMAGNLLQVEVTAEDVAEAFVHQ
                     ALETKTTGSIVTVDGGNIAAALR"
     gene            complement(221628..222833)
                     /locus_tag="CPHA266_RS01020"
                     /old_locus_tag="Cpha266_0196"
     CDS             complement(221628..222833)
                     /locus_tag="CPHA266_RS01020"
                     /old_locus_tag="Cpha266_0196"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744103.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744103.1"
                     /db_xref="GI:500064186"
                     /translation="MSTKRIITKEDVHLKARLLSEGAKVTVNKPPKTGFNPFRAMVLN
                     GSDLATLVRPEPYTRLEVQVNGDDVEFYDCGKHLASGRMQEWFSWRDGTLSNGRPVNA
                     AVIGMNQDIINIHYSYSCDNNNTGRSCRFCFFFADQHVSVGQDLAKMPFQKIEALAKE
                     QAEAVKIATDNGWRGTLVVIGGLVAPERRSQVVDLVEIVMAPLREQLSPEVFNELHIT
                     ANLYPPDDFKDMERWKASGINSTEFDLEVTDPDYFKAICPGKCATYPLEYWHAAQDAS
                     VEIFGPGRGTTSFILMGLEPMNCMLEGVEERLSKGVYPNMLVYQPVPGADMFRMPPPN
                     ADWLVEASEKLADLYFKYQDRFDMPLATDHRPGYTRMGRSQYIMLTADVIARRLYEQG
                     YELPAAYPV"
     gene            complement(222922..223140)
                     /locus_tag="CPHA266_RS01025"
                     /old_locus_tag="Cpha266_0197"
     CDS             complement(222922..223140)
                     /locus_tag="CPHA266_RS01025"
                     /old_locus_tag="Cpha266_0197"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744104.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744104.1"
                     /db_xref="GI:500064187"
                     /translation="MLKGSFTELWNKAMIYTGSGWLVLVCMIWLSGHFRDSGEQIVFV
                     SVLAAGYVAVYVLGFYIKHRHSEKTAKL"
     gene            complement(223223..223699)
                     /locus_tag="CPHA266_RS01030"
                     /old_locus_tag="Cpha266_0198"
     CDS             complement(223223..223699)
                     /locus_tag="CPHA266_RS01030"
                     /old_locus_tag="Cpha266_0198"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744105.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-oxoglutarate synthase"
                     /protein_id="WP_011744105.1"
                     /db_xref="GI:500064188"
                     /translation="MPRYTPEQLAQRNTTVWTDVQLILAPIQFVFFLIGVGVTYLHYI
                     NPDIIAFFWVDVAILFKSFLFALLFFTGAYFEKEIFDKWIFSREFLWEDIGSVTAGAF
                     HILYFILAFTGASREVLVWEAFLAYFTYIANAMQYIVRILLEKRNEKILRNSNALS"
     gene            complement(223952..224164)
                     /locus_tag="CPHA266_RS01035"
     CDS             complement(223952..224164)
                     /locus_tag="CPHA266_RS01035"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467137.1"
                     /db_xref="GI:752830835"
                     /translation="MKRPDSEQYLYTDKGYDGKPALLITLSGQHIYTLYIFIIYNNNE
                     IALLARLAGGPQKYLTHCLLGSERFR"
     gene            224962..226368
                     /locus_tag="CPHA266_RS01040"
                     /old_locus_tag="Cpha266_0200"
     CDS             224962..226368
                     /locus_tag="CPHA266_RS01040"
                     /old_locus_tag="Cpha266_0200"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744107.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM protein"
                     /protein_id="WP_011744107.1"
                     /db_xref="GI:500064190"
                     /translation="MCSVRVIKKLNIMPLRLLFIAPKGKKDSKTNQKPLFHMAIGVLV
                     SLTPDEHTIEIADEHFGDTINYDGDYDLVGITSRTIDATRAYEIADEFRRKGKKVILG
                     GLHVSFNPEEARSHADSIVSGEAENLWATVLEDASSGQLKPAYDSKDFPLVTKIVPLD
                     YERIARASKRGKVDGSKSIPIYITRGCPYECSFCVTPNFTGKLYRYQNPEDLVRQIET
                     AKKVFFKAKGKSSKPWFMLCDENLGINKKKLWENLALLKECNINYSVFFSMNFLEDKE
                     TVRRLVDSGCNMVLVGFESIKQSTLEAYNKGHVNSAEKFASVIEECRSAGLNIQGNFL
                     VNPALDTFEDMDDLVEFVGKNHVFMPIFQIITPYPGTKMYLEYKEKGLITDEDWEKYN
                     AINLVIRSEHYDPIAFQHKFMTSYYKTYSWGKIANRVRRNPYKFLNLITSLAFKKNLK
                     EQLETFERNHNIRTARTP"
     gene            complement(226551..227177)
                     /locus_tag="CPHA266_RS01045"
                     /old_locus_tag="Cpha266_0201"
     CDS             complement(226551..227177)
                     /locus_tag="CPHA266_RS01045"
                     /old_locus_tag="Cpha266_0201"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744108.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protochlorophyllide reductase"
                     /protein_id="WP_011744108.1"
                     /db_xref="GI:500064191"
                     /translation="MKAVILYDSKTKGGSTEMLIDSIGQQLAESGLYVEKAKCIATAD
                     YSFIKEFDIVILGAPVYNFIVSPQLLGAFLQGNLKKHLKKKRVALFLTCWTAESMAAV
                     FYLPQLKMHLLTNRILVEKIFHPVESSSDNAIESFVDDLLKQYERSIGSRNKSIIWSD
                     EAQDWLEVVPGFLREKIRSMAAEYAIMNGYKEITVEMLDIARHEIGEK"
     gene            227469..227696
                     /locus_tag="CPHA266_RS01050"
                     /old_locus_tag="Cpha266_0202"
     CDS             227469..227696
                     /locus_tag="CPHA266_RS01050"
                     /old_locus_tag="Cpha266_0202"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744109.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chlorosome envelope protein B"
                     /protein_id="WP_011744109.1"
                     /db_xref="GI:500064192"
                     /translation="MSNGTSNDFSGAITNLMDTLGKLGQQQVEMLNNGIKTGSQMIEP
                     LGKTVTDLAGNMLNMVNQVLQSVSSALAPKK"
     gene            227835..228842
                     /locus_tag="CPHA266_RS01055"
                     /old_locus_tag="Cpha266_0203"
     CDS             227835..228842
                     /locus_tag="CPHA266_RS01055"
                     /old_locus_tag="Cpha266_0203"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744110.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminoglycoside phosphotransferase"
                     /protein_id="WP_011744110.1"
                     /db_xref="GI:500064193"
                     /translation="MNTEHHIRCFYGQEDRNQLQITPIQGDASTRRYYRVSGPKGSAI
                     ACCDPLLRETTTDDYPFLIVYDLLRRNDIPVPEVIAVNAGEGLLLIEDCGTLQLQYLV
                     FPECGSLAADIYRDVIDTLAGIQAITGDSSQLPFRLSFDREKLMFEFDFFIEHALMGY
                     FAPVSGGVDVGALRSEFKAIADILVQPERFVLNHRDFHSRNIMIRDGKPVIIDFQDAR
                     MGLPQYDAVSIIRDSYVALDQTLADELKTRHYQALMDRNGITMSHDEYLYLFDLMAFQ
                     RNIKAIGTFSYQTAVLKKTQYEHSIAPALRYLPDYISGRNELKKAGRLLQPVIEQRHE
                     R"
     gene            228839..229774
                     /locus_tag="CPHA266_RS01060"
                     /old_locus_tag="Cpha266_0204"
     CDS             228839..229774
                     /locus_tag="CPHA266_RS01060"
                     /old_locus_tag="Cpha266_0204"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744111.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotidyl transferase"
                     /protein_id="WP_011744111.1"
                     /db_xref="GI:500064194"
                     /translation="MKAFVLAAGFGTRLRPFTHRIPKPLIPVLNLPALLYTFALLKDA
                     GITDIICNIHHHADDVRESVASFGIEGLAISFSEETTILGTGGGLKKCEQLFDDEDFL
                     LINSDIITDIDFSAFIRHHKLSGLPGTLALYETPEAMAIGCIGIENGQVKDFRNMRNT
                     GLKSSLIYTGTALLSPKIFRYLNEDFSSIVDTGFTGLIDHGGLGAFRHSGSWMDIGTP
                     EDYLDANNGKGMLPERLTRRVRDAIGIEPHRIAADAWIASGARVIRSVIGSRCMVSRN
                     AVVENSVLLPGAVVAEGECLLNSIRDRENTLQTIP"
     gene            229800..230963
                     /locus_tag="CPHA266_RS01065"
                     /old_locus_tag="Cpha266_0205"
     CDS             229800..230963
                     /locus_tag="CPHA266_RS01065"
                     /old_locus_tag="Cpha266_0205"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744112.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744112.1"
                     /db_xref="GI:500064195"
                     /translation="MVKTGLDIFLENIDGYRNRTIGMIVNQTSVTSDLRYSWNVLREK
                     GLDIRKIFSPEHGLFATEQDQIAVGSQPVPDIELVSLYGSSSDTLIPDCTTLDDLDLI
                     LFDIQDVGARYYTYVNTLALFMEAATGRDLEIMVLDRPNPLGGAVVEGPLLDMAYRSF
                     VGIFPVPVRHGMTPGELALLYRDWKKLDIRLSVLSMRGWSRTMLFHETGLPWVPPSPN
                     MPTVESAAVYPGMCLFEGLNASEGRGTTTPFQLLGAPFINPNHLLEQCKGTGFEGIYL
                     RPTWFKPTFHKFQGEAIGGLWIHVCDQNRFRPFATAVALTAALHKLYPVDLRFLDGVY
                     EFNDTIPAFDLLAGTDSVRHALLDGNDTPSIISSWQQDETAFLVTKEQYHLYR"
     gene            230985..232397
                     /locus_tag="CPHA266_RS01070"
                     /old_locus_tag="Cpha266_0206"
     CDS             230985..232397
                     /locus_tag="CPHA266_RS01070"
                     /old_locus_tag="Cpha266_0206"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744113.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:solute symporter"
                     /protein_id="WP_011744113.1"
                     /db_xref="GI:500064196"
                     /translation="MQALDIAIIVFFLAGSILLGLWQGKSNKNTGDYFLGGHKFPWIV
                     AMLSIVATETSVLTFVSVPGLAYRGDWTFLQLPLGYILGRILVSILLLPVYFKNGVTS
                     IYEVIGSRFGTGMQKLASIVFLVTRILGDGVRFLATGVVVQVVTGWSLPVSVMIIGVV
                     TLVYTITGGLKTVVWLDSIQFGLYLLGGIITIAFILLHLESSPQETFAALADAGKLAV
                     LNTGGNILFNPMTFGSAFTGGIFLSLASHGIDYMMVQRVLGCRDLGSARKALIGSGFF
                     VFFQFMIFLLAGSLMYLFMQGSVTEKDREFASFIVNYLPSGLKGLLLAGILSAAMSTI
                     ASSINSLAASTVTDLLGGRVSLNFSKLISAGWAVVLIGIALIFDESDKAIIMVGLEIA
                     SFTYGGLLGLFLLSKTTQKYHPASLAIGLLASMGIVFVLKLYGIAWTWYILVSVSVNI
                     MITILVNTMLRSIMSKGEQS"
     gene            232510..232761
                     /locus_tag="CPHA266_RS01075"
                     /old_locus_tag="Cpha266_0207"
     CDS             232510..232761
                     /locus_tag="CPHA266_RS01075"
                     /old_locus_tag="Cpha266_0207"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744114.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chlorosome protein E"
                     /protein_id="WP_011744114.1"
                     /db_xref="GI:500064197"
                     /translation="MSKISGAFTQWAEAYGRFVEIFTDGHWWVTGDCMENVGKTTKRL
                     LRNAYPYIYGGGSSVDIKGSSPDKGGYATPTKEIKRRFE"
     gene            complement(232932..233630)
                     /locus_tag="CPHA266_RS01080"
                     /old_locus_tag="Cpha266_0208"
     CDS             complement(232932..233630)
                     /locus_tag="CPHA266_RS01080"
                     /old_locus_tag="Cpha266_0208"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744115.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent epimerase"
                     /protein_id="WP_011744115.1"
                     /db_xref="GI:500064198"
                     /translation="MNNTCDYRGTVLVAGSTGKTGLWVVKRLQHYGIPVRVLVRSARK
                     AAVFGNTVEVAVGLVQNSADLTEAVKGCDAVISALGSSQFFGEASPAEVDRNGAIRLA
                     DEASRMGVRHFAMVSSIAVTRWYHPLNLFAGVLSMKYAAEEHVRSLFSRENRSYTIVR
                     PGGLKDGDPLQFRLHVDQGDRIWNGWINRSDVAELLVESLWLESAKNKTFEVINEAEE
                     VQESLEQYYGKLSN"
     gene            233837..235177
                     /locus_tag="CPHA266_RS01085"
                     /old_locus_tag="Cpha266_0209"
     CDS             233837..235177
                     /locus_tag="CPHA266_RS01085"
                     /old_locus_tag="Cpha266_0209"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744116.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744116.1"
                     /db_xref="GI:500064199"
                     /translation="MKQIWHLAGIVLLTVSGFLPVSSAIGFDPDAVKLLVKSPKEWNA
                     FRQQHSMQPVDLDKAKLEDADLEGANLSNSSLVRAELSGANLNNADLRGSNLQQAFIK
                     KADLKGADLREAYLVKVNLKEAFMEKSMLQKANLQSANLRWTRFHRADLAGSNLQDAV
                     LFETSFVDADLRGANLKGALYVGNANFSGAKISSNTITPSGEKATASWAAIRDAEYIK
                     EADAAMPVYASLPVMVFASPSAGLKSASASSGQAVMGSKQQQALMVDDVETWNTMRAA
                     NPELKIELKEEKLENARLKGVNLQKASMPGADFEDANLDEAMMEGADLSKADFQKADM
                     KKVKLQGANLSGANLDRSFMEGADLRNANLSGANLFGAMLKDANLSGANLSGASLFET
                     DLEGANLSGANLKGANLVEPNLKNAIISPDTILPSGKNATQSWAVIKGATFVKP"
     gene            complement(235520..235813)
                     /locus_tag="CPHA266_RS01090"
                     /old_locus_tag="Cpha266_0211"
     CDS             complement(235520..235813)
                     /locus_tag="CPHA266_RS01090"
                     /old_locus_tag="Cpha266_0211"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744118.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744118.1"
                     /db_xref="GI:500064201"
                     /translation="MIQFRVGDPIVYHKPKTSFSPGPRAKQVYPLQHGEDYHYVVDKF
                     WTVSQVNRDGTLEVTTRTGKKHLLDAGDPNICKAHLIQHILFRKRFPSLADLL"
     gene            complement(236076..237254)
                     /locus_tag="CPHA266_RS01095"
                     /old_locus_tag="Cpha266_0213"
     CDS             complement(236076..237254)
                     /locus_tag="CPHA266_RS01095"
                     /old_locus_tag="Cpha266_0213"
                     /EC_number="3.6.3.16"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744120.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arsenic transporter ATPase"
                     /protein_id="WP_011744120.1"
                     /db_xref="GI:500064203"
                     /translation="MRLILMTGKGGVGKTSMAAATGLRCAELGYKTLVLSTDPAHSLA
                     DSFDMALGHNPNRVSNNLWGAELDVLKELEQNWGTVKRYITGVLQARGLEGIQAEELA
                     ILPGMDEIFGLVRVFRHHKEGDYDVLIIDSAPTGTALRLLSIPEVAGWYMRRLYKPFE
                     KVALYLRPLVEPIFRPLAGFSLPDKEMMDVPYEFYEQIDALGKILTDHAVTSVRLVTN
                     PEKMVIKESLRAHAYLGLYNIAVDLVIANRIIPPEVTDPYFTFWKENQTLYRQEIQDN
                     FAPLPVKEVPLYSREICGMQTLEKLKEMLYGNEDPAQVYYKEQTFQIKQTTQGFTLEL
                     YIPGIPKDQIQLGKNGDELHVRIGNHRRNMVLPQALASLKTTGAEMDGDHLIIHFVEP
                     "
     gene            complement(237528..238454)
                     /locus_tag="CPHA266_RS01100"
                     /old_locus_tag="Cpha266_0214"
     CDS             complement(237528..238454)
                     /locus_tag="CPHA266_RS01100"
                     /old_locus_tag="Cpha266_0214"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744121.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744121.1"
                     /db_xref="GI:500064204"
                     /translation="MHSIHRTFITATVFILVFTLSARGESPEDFIELGIVKGRSGDTS
                     GALDDFNRALILDPKNSGAYYNRGLVNGQLGNFSAAIADYTSAIKLNPHFPGTYNNRG
                     FAHAATGNYRAAIIDISKAIALDPLIPELYNNRGTVKMSLKDYIGAIEDFTKAARLNP
                     KLAGPFNNRGLAKSLAGNIMGAIEDFTLALVRDQTYDAAWYNRGNARLSSGDFNGAIE
                     DYKKALVLQPDLIEAYNNRAFAKASLGDYRGAVDDMNILIEKGTENAMTYYNRGLAKK
                     MLGDLNGAIADFLKASNLGDTLSVSALREMVK"
     gene            238734..239249
                     /locus_tag="CPHA266_RS01105"
                     /old_locus_tag="Cpha266_0215"
     CDS             238734..239249
                     /locus_tag="CPHA266_RS01105"
                     /old_locus_tag="Cpha266_0215"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744122.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rare lipoprotein A"
                     /protein_id="WP_011744122.1"
                     /db_xref="GI:500064205"
                     /translation="MRDEKRNFTIPFYALLIGAWYTALQITFPAFSSAQPPEFSIQSI
                     TNQPSASSSGMLSDQPKSRTFLRVAEGKASYYSNQFHGRRTANGETFDMNELTAAHPS
                     LPFGTWVRVINLRNGKDVVVRINDRGPFVRGRIIDLSAGAAKRIGLFKSGTANVRIEP
                     VKHSPEDPMAG"
     gene            complement(239375..239815)
                     /locus_tag="CPHA266_RS01110"
                     /old_locus_tag="Cpha266_0216"
     CDS             complement(239375..239815)
                     /locus_tag="CPHA266_RS01110"
                     /old_locus_tag="Cpha266_0216"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744123.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744123.1"
                     /db_xref="GI:500064206"
                     /translation="MTNHQNQQVSFALTEITTENLSITPETFDTDKPVQMNIGLNFGI
                     NSEKQSLKTLFKASFHQDDQEFMVIETGCAFTLDPNSWKMLSNDEIRRFILPKTLAAH
                     FSVLTAGTARGILHVKTENTPLNKFIIPANNLDGLIQKDIVLNY"
     gene            complement(240184..240360)
                     /locus_tag="CPHA266_RS01115"
                     /old_locus_tag="Cpha266_0217"
     CDS             complement(240184..240360)
                     /locus_tag="CPHA266_RS01115"
                     /old_locus_tag="Cpha266_0217"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744124.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rubredoxin"
                     /protein_id="WP_011744124.1"
                     /db_xref="GI:500064207"
                     /translation="MEKWVCVPCGYVYDPEIGDPDSGVEPGTPFENIPDDWCCPVCGV
                     DKSLFEPYDERRNR"
     gene            complement(240597..241397)
                     /locus_tag="CPHA266_RS01120"
                     /old_locus_tag="Cpha266_0218"
     CDS             complement(240597..241397)
                     /locus_tag="CPHA266_RS01120"
                     /old_locus_tag="Cpha266_0218"
                     /EC_number="5.1.1.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744125.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diaminopimelate epimerase"
                     /protein_id="WP_011744125.1"
                     /db_xref="GI:500064208"
                     /translation="MQINFSKLSGAGNDFIIIDNRALAIHLTQPQINALCTRRTGVGA
                     DGLILVEPSLHCDFTMKYFNADGFPGSMCGNGGRCAVYFAFMQGVTSAEPEHFSFEAN
                     SNRYDAEVTNSETVRLHMLDARDFRYHMEIEGFACTFVNTGSPHVVIFADDINAINVA
                     EKGVAIRRNTDFFPEGTNVNFVEITSPSSIALRTFERGVEEETLACGTGAVAAAIISR
                     KLGKILPNSVKVTVKSGDMLEVSFSENMQNITLTGPAKIVYQGSVTIP"
     gene            241814..244009
                     /locus_tag="CPHA266_RS01125"
                     /old_locus_tag="Cpha266_0219"
     CDS             241814..244009
                     /locus_tag="CPHA266_RS01125"
                     /old_locus_tag="Cpha266_0219"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012465162.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="photosystem I reaction center subunit IX"
                     /protein_id="WP_011744126.1"
                     /db_xref="GI:500064209"
                     /translation="MAEQVNPAGVKPKGSVPPPKGNAPSPKGNGASGGPSVIKEQDAA
                     KMRRFLFQRTETRSTKWYQIFDTEKLDDEQVVGGHLALLGVMGFLMAIYYISGIQVFP
                     WGAPGFHDNWFYLTIKPRMVSMGIDTYSTRSADLEQAATNLLGWALLHVISGSILLFG
                     GWRHWTHNLTNPFTGRAGNFRDFRFLGKFGDVVFSGTSAKSYKDALGPHAVYMSLLFL
                     GWGLIMWLALGWAPVPDFQTINSETFMSFVWFVVFFALGIYWWNNPPNAATHLNDDMK
                     AAFSVHLTAIGYINIALGVIAFVAFQQPSFAPYYKELDNLVFYLYGEPFNRVSYDFVQ
                     EGGQIVSGSKEFTEFAPYAILPKNGEAFGMSRVVINLITFNHIICGVLYVFAGVYHGG
                     QYLLKIQLNGLYNQIKSIWITKGRDQEVQVKILGTVMALCFATMLSVYAVIVWNTICE
                     LNIFGTNIMMSFYWLKPLPMFQWMFADPSINDWVMAHVITAGSLFSLIALVRIAFFAH
                     TSPLWDDLGLKKNSYSFPCLGPVYGGTCGVSIQDQLWFAMLWGVKGLSAVCWYIDGAW
                     IASMMYGVPVADAKAWDSVAGLQHHYTSGIFYYFWTETVTIFSSSHLSTILMIGHLIW
                     FISFAVWFEDRGSRLEGADIQTRTVRWLGKKFLNRDVTFRFPVLTISDSKLAGTFLYF
                     GGTFMLVFLFIANGFYQTNSPLPPTVGDASLSGQQMLTQVVDYLMKLIA"
     gene            244107..244808
                     /locus_tag="CPHA266_RS01130"
                     /old_locus_tag="Cpha266_0220"
     CDS             244107..244808
                     /locus_tag="CPHA266_RS01130"
                     /old_locus_tag="Cpha266_0220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744127.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin"
                     /protein_id="WP_011744127.1"
                     /db_xref="GI:500064210"
                     /translation="MAEPVKQPDVPPAPVSKAAPAAPKAAPKAASPAAKQGEVKPKIS
                     AAPKQTSGKIRLEALNVNLGRTGIRQESALPVKKAPPKAAPKPAPGGAKPAPGAKPAP
                     KTAGAPAGTPVAKSAPAAGTPLAKAAPRAKSHYFIIENLCVGCGLCLDKCPPKVNAIG
                     YKFYGDVQEGGFRCYIDQDACISCSACFSTDECPSGALIEVLPDGQVLDFSFTPPERL
                     DFDLRFLHRFHREVR"
     gene            244927..245670
                     /locus_tag="CPHA266_RS01135"
                     /old_locus_tag="Cpha266_0221"
     CDS             244927..245670
                     /locus_tag="CPHA266_RS01135"
                     /old_locus_tag="Cpha266_0221"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744128.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dolichyl-phosphate beta-D-mannosyltransferase"
                     /protein_id="WP_041467464.1"
                     /db_xref="GI:752831162"
                     /translation="MPNEKYEAPVALVIIPTYNEADNIEKLLVAIFKMYPSSVDVLVI
                     DDNSPDGTADIVREVQAYERKLHLVTRAGKLGLGTAYLKGFAYALDHGYRFIIEMDAD
                     YSHDPEMIRTLLEKMAEADLVLGSRYLNNTVNVINWPLRRLILSKAASIYTRYVSGLP
                     VSDPTSGFKCFKREVLETLDLKKVHSEGYSFQIEMNYRVWKKGFAIVEVPIVFTDRTV
                     GKSKMTRKNIREAIWIVWLLKLKTILRML"
     gene            complement(245800..247875)
                     /gene="fusA"
                     /locus_tag="CPHA266_RS01140"
                     /old_locus_tag="Cpha266_0222"
     CDS             complement(245800..247875)
                     /gene="fusA"
                     /locus_tag="CPHA266_RS01140"
                     /old_locus_tag="Cpha266_0222"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744129.1"
                     /note="EF-G; promotes GTP-dependent translocation of the
                     ribosome during translation; many organisms have multiple
                     copies of this gene; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor G"
                     /protein_id="WP_011744129.1"
                     /db_xref="GI:500064212"
                     /translation="MQSIQPDQLRNIVITGHAGAGKTILCESLALAMGVTNRLGSIDD
                     GTTLSDYSAEEVQRKHSLNTSVIHGFWNDKKINIIDTPGLLDFQGDVKSAMRVADTVL
                     ITVNAANGVEVGTDATWDYTKEYHKPTMFVLSRLDADRTNFNNTLEELRDHFGHLVTP
                     IQFPAEEGLGHHILIDVLMMKQLEFSPDRPGNMTISTIPDLYLKRAEEMHQQLVEAVA
                     ETDEELMNRYFEVGNLTEEELRTGIKSALLTRTFFPVFCTSPLHLIGTERLLNIIVNL
                     CPSPIERGPEHALCSLDDTERLLQPDPDGPTIAFIFKTMSEPRVGEISYLRVYSGHLE
                     TGHELIDVQTGQPEKIGQVYTIIGQKKTPVEKLLAGDIGMVVKLKDAHTNDTLADKGS
                     NCRISPILFPVPVLASAIIPVTQGDEEKISAGLHHLHEEDPSFTIMHDVEFNQTILKT
                     FGETHLEIIISRLQNKFNVTVEIAPIKIPYRETIRVTSTAQGKYKKQSGGRGQYGDVW
                     VRLEPKERDSGFEFSSEVVGGVVPTRYIPAVEKGLRESIEAGVLAGYPVVDMKAIVYD
                     GSFHPVDSSEFAFKIAASMAFKAAFDKAKPLLLEPFYELNVFAPEQYTGEIVGEISSK
                     RGKILGMDTDARFQIVKALIPQAALTSFHHALIRLTQSRARYTYKFNHYEEAPPEIVK
                     QVTSEKSVA"
     gene            248120..249433
                     /gene="eno"
                     /locus_tag="CPHA266_RS01145"
                     /old_locus_tag="Cpha266_0223"
     CDS             248120..249433
                     /gene="eno"
                     /locus_tag="CPHA266_RS01145"
                     /old_locus_tag="Cpha266_0223"
                     /EC_number="4.2.1.11"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A4SGL6.1"
                     /note="catalyzes the formation of phosphoenolpyruvate from
                     2-phospho-D-glycerate in glycolysis; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enolase"
                     /protein_id="WP_011744130.1"
                     /db_xref="GI:500064213"
                     /translation="MPIIRKILARQILDSRGNPTVEVDVYTENSFGRAAVPSGASTGV
                     HEAVELRDGDSAVYLGKGVLKAVDHVNTVINDRLKGMFVTDQEEIDMAMLALDGTPNK
                     SRLGANALLGVSMACAKAGAEYSGLPLYRYIGGTMANTLPVPMMNVLNGGAHADNTVD
                     FQEFMIMPVGFSSYSDALRSGAEIFHALKSLLKSKGLSTAVGDEGGFAPNLKSNEEAI
                     ELVIEAVGKAGYKIGSSTANGGLGDAQVMIALDPASSEFYDAAKQKYVFKKSSKQELS
                     SLEMAEYWEKWASDYPIISIEDGMAEDDWDGWKILTDKIGSRVQLVGDDLFVTNTSRL
                     ALGIERGVGNSILVKVNQIGTLTETLQAIDLARRNGYTAVISHRSGETEDSTIAQIAV
                     ATNAGQIKTGSLSRSDRMAKYNELLRIEEELGLQAKYPALSAFRV"
     gene            249641..249946
                     /locus_tag="CPHA266_RS01150"
                     /old_locus_tag="Cpha266_0224"
     CDS             249641..249946
                     /locus_tag="CPHA266_RS01150"
                     /old_locus_tag="Cpha266_0224"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744131.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="septum formation initiator"
                     /protein_id="WP_011744131.1"
                     /db_xref="GI:500064214"
                     /translation="MKMVNEVWAHISADPKKFFFLIALILFSVWFLFDDYGVVKRIRM
                     EADHRLLQQKHLEAERLILNNELRIRNAYAPDSIEKAAREKYNFRKEGEILFIIRNK"
     gene            249984..252017
                     /locus_tag="CPHA266_RS01155"
                     /old_locus_tag="Cpha266_0225"
     CDS             249984..252017
                     /locus_tag="CPHA266_RS01155"
                     /old_locus_tag="Cpha266_0225"
                     /EC_number="1.17.7.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744132.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
                     synthase"
                     /protein_id="WP_011744132.1"
                     /db_xref="GI:500064215"
                     /translation="MFQYRRRFTREVPFGKIALGGYMPIRVESMTNTHTLDTVATVKQ
                     CRRLYEAGCEIIRLTVPTERDAENLRSIRDQLRSDGIDTPLVADIHFSSRAAFKAVEF
                     VENIRINPGNYATKQKFSAETYTDDEYQEEIERVRKEFLPLVYKAREFGASMRIGTNH
                     GSLSDRIVSRYGNSPEGMVEAALEFARICEEEGYHDVLFSMKSSNVKVMIQAYRLLAV
                     KADAELRYAYPLHLGVTEAGDGDEGRVKSAMGIGALLEDGLGDTIRVSLTEDPVNEVP
                     VGFAIVKKYNDLQLIRGENGHVPIKQLIENQGSSFTNELPPFDPFSYQRRISRSFFVG
                     GFAIGGDSMPRVETEAVIPLCRPEELFHEIMQRLLPEESIDAIRSELVGVRVNTVEDL
                     ELLDELLSRLGEAKRFITVSTKDIELFFRLLDKVEKVRLDITEGEMLDRNIFDRLTND
                     RLASVEFCFLHETSGAGVPAEVLGLLAQKAGLQGLERIFFSILSAHSVFVYRRLVQFF
                     SKRGFDYPLVIRFRQMDSVKLDCLISCAVQTGSLFSDGIGDVLALQTGLDVAAEITLA
                     FNILQGARIRMSKTEFISCPGCGRTYFDLEKAAASIKLRLSHLKGLKVGIMGCVVNGP
                     GEMADADFGYVGSGKGRISLYVGKECVEENLPESAAVDRLVGLIQEKGKWVNP"
     gene            252086..252865
                     /locus_tag="CPHA266_RS01160"
                     /old_locus_tag="Cpha266_0226"
     CDS             252086..252865
                     /locus_tag="CPHA266_RS01160"
                     /old_locus_tag="Cpha266_0226"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744133.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_011744133.1"
                     /db_xref="GI:500064216"
                     /translation="MLFTLVTGASMGIGEAFARKFAETGTSLLLVARSEDKLLALAEE
                     LKASGATDVRILAEDLSREGSPERIYEFCLRENIAIDVLVNCAGLSFAGDFDKLPVGK
                     LEEIMAVNMLALCRLTRLFLPGMIKRKGGGIMNIASIGGFQGVPGLALYSATKSFVIT
                     LTEALHTELKETGVKAVAVCPGFIQTGFLAKAGHSQDGILLPVYSRDLVVKAAIKGYK
                     KNRLRIFPTVIDFLLVFSQRFVPRKTAVKLADVLSSARSRR"
     gene            252936..253008
                     /locus_tag="CPHA266_RS01165"
                     /old_locus_tag="Cpha266_R0003"
     tRNA            252936..253008
                     /locus_tag="CPHA266_RS01165"
                     /old_locus_tag="Cpha266_R0003"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:252969..252971,aa:Thr,seq:tgt)
     gene            253022..253104
                     /locus_tag="CPHA266_RS01170"
                     /old_locus_tag="Cpha266_R0004"
     tRNA            253022..253104
                     /locus_tag="CPHA266_RS01170"
                     /old_locus_tag="Cpha266_R0004"
                     /product="tRNA-Tyr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:253056..253058,aa:Tyr,seq:gta)
     gene            253131..253203
                     /locus_tag="CPHA266_RS01175"
                     /old_locus_tag="Cpha266_R0005"
     tRNA            253131..253203
                     /locus_tag="CPHA266_RS01175"
                     /old_locus_tag="Cpha266_R0005"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:253164..253166,aa:Thr,seq:ggt)
     gene            253227..253302
                     /locus_tag="CPHA266_RS01180"
                     /old_locus_tag="Cpha266_R0006"
     tRNA            253227..253302
                     /locus_tag="CPHA266_RS01180"
                     /old_locus_tag="Cpha266_R0006"
                     /product="tRNA-Trp"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:253260..253262,aa:Trp,seq:cca)
     gene            253349..253540
                     /locus_tag="CPHA266_RS01185"
                     /old_locus_tag="Cpha266_0227"
     CDS             253349..253540
                     /locus_tag="CPHA266_RS01185"
                     /old_locus_tag="Cpha266_0227"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744134.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecE"
                     /protein_id="WP_011744134.1"
                     /db_xref="GI:500064217"
                     /translation="MNKYVGKVGQYYRDVVSEMRKVVWPGKDELKDLTIVVLTVSGIL
                     ALFTFLVDWVINAVMGLLL"
     gene            253562..254137
                     /locus_tag="CPHA266_RS01190"
                     /old_locus_tag="Cpha266_0228"
     CDS             253562..254137
                     /locus_tag="CPHA266_RS01190"
                     /old_locus_tag="Cpha266_0228"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744135.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination/antitermination factor
                     NusG"
                     /protein_id="WP_011744135.1"
                     /db_xref="GI:500064218"
                     /translation="MNTRKKAVEEQGVPGPRWYALRIYSGHERKVKEGIEAEVARCGL
                     ADKILQIYVPYERFVEVKNGKKRSLTKNAFPGYVLIEAVLDKQTRNVILDMPSVMGFL
                     GVDDVPTPLRPEEVEKILVTENTVEHRAVIEAPFRIGDSVKVIDGPFSSLTGVVHEVC
                     TERMKVKVMISFFGRSTPTELDFSQVKSVSQ"
     gene            254181..254606
                     /locus_tag="CPHA266_RS01195"
                     /old_locus_tag="Cpha266_0229"
     CDS             254181..254606
                     /locus_tag="CPHA266_RS01195"
                     /old_locus_tag="Cpha266_0229"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BD19.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L11"
                     /protein_id="WP_011744136.1"
                     /db_xref="GI:500064219"
                     /translation="MAKKIIGFIKLQIPAGAANPAPPVGPALGQKGVNIMEFCKQFNA
                     KTQAEAGMITPVVITVYSDKSFTFITKTPPAAVLLLKEAQLKKGSGEPNRNKVGTVSR
                     EQVRRIAELKMPDLNAVDVAGAEQMVMGTARSMGIVVEN"
     gene            254677..255366
                     /locus_tag="CPHA266_RS01200"
                     /old_locus_tag="Cpha266_0230"
     CDS             254677..255366
                     /locus_tag="CPHA266_RS01200"
                     /old_locus_tag="Cpha266_0230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012509313.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L1"
                     /protein_id="WP_011744137.1"
                     /db_xref="GI:500064220"
                     /translation="MAGKKYRDAVAKTDRFQEYDLVDAVEKIREITQVKFDATIDIAM
                     KLGVDPRHADQVVRGTVMLPHGTGKTVSVLVVCKEAKAEEAVAAGADFVGFEEYVEKI
                     QNGWTGVDVIIATPDVMGQLGKVAKILGPRGLMPNPKSGTVTMDVAKAVKEVKAGKIE
                     FRVDKAGNVHAPVGKVSFQSEQLVENITSFLKEVVRLKPSAAKGQYVQGIALSSTMSP
                     SVKVKREKFVA"
     gene            255384..255902
                     /locus_tag="CPHA266_RS01205"
                     /old_locus_tag="Cpha266_0231"
     CDS             255384..255902
                     /locus_tag="CPHA266_RS01205"
                     /old_locus_tag="Cpha266_0231"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BD21.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L10"
                     /protein_id="WP_011744138.1"
                     /db_xref="GI:500064221"
                     /translation="MKRDKKEQIVQDVAEKIDRSQGIYLTEFQGLSVAKMAELRNEFR
                     KAGVEYRVVKNTLIKKALRDLSSADRLASGLKSTTAVAFGYDDPLAPAKIIRKFSKTN
                     EALKFKMASIDGVVYDADSLPALSEMLSKTENIGRAAGLINGVVSSVPMVVNAVARNL
                     VSVLDQIAKQKQ"
     gene            255969..256346
                     /locus_tag="CPHA266_RS01210"
                     /old_locus_tag="Cpha266_0232"
     CDS             255969..256346
                     /locus_tag="CPHA266_RS01210"
                     /old_locus_tag="Cpha266_0232"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B3EER1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L7/L12"
                     /protein_id="WP_011744139.1"
                     /db_xref="GI:500064222"
                     /translation="MSIETLVEEIGKLTLTEASELVKALEEKFGVSAAPAMMAGVMAA
                     APAGDAPAQEEKTEFDVVLTAAGESKINVIKVVRALTGLGLKEAKDLVDGAPKTVKEG
                     ISKDEAEKVAKELKDVGASVELK"
     gene            256527..260465
                     /gene="rpoB"
                     /locus_tag="CPHA266_RS01215"
                     /old_locus_tag="Cpha266_0233"
     CDS             256527..260465
                     /gene="rpoB"
                     /locus_tag="CPHA266_RS01215"
                     /old_locus_tag="Cpha266_0233"
                     /EC_number="2.7.7.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BD23.1"
                     /note="DNA-dependent RNA polymerase catalyzes the
                     transcription of DNA into RNA using the four
                     ribonucleoside triphosphates as substrates; beta subunit
                     is part of the catalytic core which binds with a sigma
                     factor to produce the holoenzyme; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta"
                     /protein_id="WP_011744140.1"
                     /db_xref="GI:500064223"
                     /translation="MQFDKSEVHVKVADATPTPCIDFSKIQSVIDPPDLLKVQLDSFH
                     NFIQDSVPLAKRRDQGLERVLRSAFPITDTRGLYLLEYISYSFDKPKYTVEDCIERGL
                     TYDVSLKVKLKLSYKDEPDEADWKETIQQEVYLGRIPYMTERGTFIVNGAERVVVAQL
                     HRSPGVVFSEAIHPNGKKMYSAKIVPTRGSWIEFQTDINNQIFVYIDQKKNFLVTALL
                     RAIGFAKDEDILGLFDLVEEVKITSAKKEQLIGQYLASDIVDMQTGEVVSARTAITED
                     IVDQIIAAGYKSVRVMKSFSGNDKGPDKSIIINTILNDNSATEEEALEIVYEELRANE
                     APDIDAARSFLERTFFNQKKYDLGDVGRYRIRKKLSKEFEELHGYLDGQPELKKLSDT
                     IYEKILHTIQSFSDEPIGGDILVLTHYDIIAVIYYLIKLVNGQAEVDDVDHLANRRVR
                     SVGEQLAAQFVIGLARMGKNVREKLNSRDSDKIAPSDLINARTVSSVVSSFFATSQLS
                     QFMDQTNPLAEMTNKRRVSALGPGGLTRERAGFEVRDVHYTHYGRLCPIETPEGPNIG
                     LISSLSVYAEINDKGFIQTPYRVVTNGVVTDTVLMLSAEDEENKITVPVSIPLDENMK
                     IAIESVQARTKGDYPLVPAEDVNYMDVSPVQIVSAAAALIPFLEHDDGNRALMGANMQ
                     RQAVPLLTAEAPIVGTGMESKVARDSRSVILAEGDGIVDDVTAEYIKVRYDIDADTDV
                     RLSLLDPDEGLKTYKLIKFKRSNQDTCISQKPLIHIGQRVSKGDVLADSSSTENGELA
                     LGKNVLVAFMPWRGYNFEDAIILSERLVYDDVFTSIHIHEFEANVRDTKRGEEQFTRD
                     IYNVSEDALRNLDENGIVRIGAEVKERDILVGKITPKGESDPTPEEKLLRAIFGDKSS
                     DVKDASMHVPAGMKGIVIKTKLFSRKKKVGLDIKEKIEILEKKYDYKEYDLRKKFLKR
                     LKQLLEGKTSTGIYSDKGKLLVAEDAVYDDSVLERFTAIPFLESIDFVKGVTQSEKVN
                     ENVMLLVKEFRLKLKDLNDERDNEKYKLNVGDELPPGIEELAKVYIAQKRKIQVGDKM
                     AGRHGNKGVVGKILPIEDMPFMENGKPVDIVLNPLGVPSRMNIGQLYETSLGWAGKEL
                     GVKFKTPIFNGATYQEVQQELEKAGLPSHGKVSLYDGRTGEQFDDEVTIGYIYMLKLS
                     HLVDDKIHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWALEAYGAANILREMLTVK
                     SDDVIGRNKTYEAIVKGQNLPEPGTPESFNVLVRELQGLGLEIRIDDRVP"
     gene            260535..265013
                     /locus_tag="CPHA266_RS01220"
                     /old_locus_tag="Cpha266_0234"
     CDS             260535..265013
                     /locus_tag="CPHA266_RS01220"
                     /old_locus_tag="Cpha266_0234"
                     /EC_number="2.7.7.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BD24.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta'"
                     /protein_id="WP_011744141.1"
                     /db_xref="GI:500064224"
                     /translation="MIFSQGASPLKGDFSKIKFSIASPESILAHSRGEVLKPETINYR
                     TFKPERDGLMCEKIFGPTKDWECYCGKYKRVRYKGIICDRCGVEVTTKSVRRERMGHI
                     SLAVPVVHTWFFRSVPSKIGALLDLSTKELERIIYYEVYVVINPGEPGAKQGIKKLDR
                     LTEEQYFQIITEYEDNQDLDDHDSDKFVAKMGGEAIRLLLKSIDLNETAIHLRKVLKE
                     SSSEQKRADALKRLKVVEAFRKSYEPQKKTRKKAVGLFPEDELPEPYVFEGNKPEYMV
                     MEVVPVIPPELRPLVPLEGGRFATSDLNDLYRRVIIRNNRLKKLIDIRAPEVILRNEK
                     RMLQEAVDALFDNSRKANAVKTGESNRPLKSLSDALKGKQGRFRQNLLGKRVDYSGRS
                     VIVVGPELKLHECGLPKSMAIELFQPFVIRRLVERGIAKSVKSAKKLIDKKDQVVWDV
                     LEKVIDGRPVLLNRAPTLHRLGIQAFQPVLIEGKAIQIHPLVCTAFNADFDGDQMAVH
                     VPLSQEAQLEAALLMLSSHNLILPQSGKPVTVPSQDMVLGMYYLTKSRPGDPGEGRIF
                     YSDEDVLIAYNEDRIGLHAQIFVHFNGAVDQKFDPLRVLDTIVDPKSEKYTWLKSQLE
                     KKTILLTTVGRVIFNQNVPDSIGFINRVIDKKVAKELIGRLSSDVGNVETAKFLDNIK
                     EVGFHYAMKGGLSVGLSDAIVPDTKVRHIKNAQKDSTKVVKEYNRGTLTDNERYNQIV
                     DVWQKTSNIVAEESYQKLKKDREGFNPLYMMLDSGARGSREQVRQLTGMRGLIARPQK
                     SMSGQPGEIIENPIISNLKEGLTVLEYFISTHGARKGLSDTSLKTADAGYLTRRLHDV
                     AQDVIVTIEDCGTTRGLHVYRNIEEETSGQIKFREKIRGRVAARDIYDTLNNNVIVKA
                     GEIITEELGDLIQETAGVEEAEIRSVLTCESKIGICSKCYGTNLSVHQIVEIGEAVGV
                     IAAQSIGEPGTQLTLRTFHQGGTAQGGISETETKAFYEGQLEFEDLKTVEHSAITEDG
                     VEEIRIIVVQKNGKINIVDPDSGKILKRYVVPHGAHLHCNAKALVKKDQVLFSSEPNS
                     TQIIAELHGRVKFADIEKGVTYKEEVDPQTGFAQHTIINWRSKLRANETREPRVLIID
                     ESGEVRKNYPVPIKSNLYVEDGQKIVPGDIIAKVPRNLDRAGGDITAGLPKVTELFEA
                     RIPSDPAIVSEIDGYVSFGSQRRSSKEIKVKNDFGEEKVYYVQVGKHVLANEGDEVKA
                     GDAMTDGAVSPQDILRIQGPNAVQQYLVNEIQKVYQINAGVEINDKHLEVIVRQMLQK
                     VRVEEPGDTELLPGDLIDRSAFVEANNNVAEKVRVTEKGDAPSRIQEGQLYKTRDITK
                     LNRELRKNSKNLVAFEPALQATSHPVLLGITSAALQTESVISAASFQETTKVLTDAAV
                     AGKIDYLAGLKENVIVGKLIPAGTGLKRYRNLTLTGESVETISHDASDDASTQNGI"
     gene            complement(265212..266558)
                     /locus_tag="CPHA266_RS01225"
                     /old_locus_tag="Cpha266_0235"
     CDS             complement(265212..266558)
                     /locus_tag="CPHA266_RS01225"
                     /old_locus_tag="Cpha266_0235"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744142.1"
                     /note="an AccC homodimer forms the biotin carboxylase
                     subunit of the acetyl CoA carboxylase, an enzyme that
                     catalyzes the formation of malonyl-CoA, which in turn
                     controls the rate of fatty acid metabolism; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA carboxylase subunit alpha"
                     /protein_id="WP_011744142.1"
                     /db_xref="GI:500064225"
                     /translation="MFKKILVANRGEIALRIMQTCREMGISTVAVYSTADAESIHVKY
                     ADEAVCIGPALSRESYLNIPRIIAAAEVTNADAIHPGYGFLAENADFAEVCSSVNIKF
                     IGPTAKMINQMGDKNTAKATMIAAGVPVVPGSQGLVSNLAEAVKTAQNTGYPVIIKPT
                     AGGGGKGMRVVHEENQLEKALNTARSEAEQAFGNSGVYIEKFLENPRHVEIQILSDQH
                     GNTIHLGERDCTVQRRHQKLIEETPSPAVDDALRKTMGDAAVAAAAAINYEGAGTIEF
                     LLDKHGKFFFMEMNTRIQVEHPVTEERYDVDIVREQIIIADGQSIAGRTFTPKGHSIE
                     CRINAEDPDHLFRPSPGQLQVFHTPGGHGVRVDSHAYASYVVPSNYDSMIAKLIVTAH
                     TRDEAIARMSRALDEFIVLGVKTTIPFHKQVMHSAVFQSGVFDTSFLESFRYEKSI"
     gene            complement(266578..267072)
                     /locus_tag="CPHA266_RS01230"
                     /old_locus_tag="Cpha266_0236"
     CDS             complement(266578..267072)
                     /locus_tag="CPHA266_RS01230"
                     /old_locus_tag="Cpha266_0236"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744143.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA carboxylase"
                     /protein_id="WP_011744143.1"
                     /db_xref="GI:500064226"
                     /translation="MNLNEIKQLIDIVNSSDLQEAIIEEGDFKITLRRHPIAGLSYLQ
                     PAEQQNAPYSVTPPSLSREVASQTPESVAAPAANPKAEPMAGLIDVCSPIVGTFYRSS
                     SPDAPAFVNINDTVNKGDVLCIIEAMKLMNEIEAEMSGTIVEILVENGHPVEYDQPLF
                     RIKP"
     gene            complement(267125..267691)
                     /locus_tag="CPHA266_RS01235"
                     /old_locus_tag="Cpha266_0237"
     CDS             complement(267125..267691)
                     /locus_tag="CPHA266_RS01235"
                     /old_locus_tag="Cpha266_0237"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BD27.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor P"
                     /protein_id="WP_011744144.1"
                     /db_xref="GI:500064227"
                     /translation="MTSISNVSKGSIIRFKGEPHIIESLIHRTPGNLRAFYQANMKNL
                     KTGRNVEFRFSASESVDVIVTERKPYQYLYKDGTDFVMMDSGTFDQINVPEITLGTSS
                     RFLKDGITVVIVFSDDGSILDVEMPTFVEVEVTETSPTTKDDRATSGTKPAIVETGAE
                     VGVPMFIQTGSIIRVDTRTGEYIERVKK"
     gene            267907..268182
                     /locus_tag="CPHA266_RS01240"
                     /old_locus_tag="Cpha266_0238"
     CDS             267907..268182
                     /locus_tag="CPHA266_RS01240"
                     /old_locus_tag="Cpha266_0238"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744145.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_011744145.1"
                     /db_xref="GI:500064228"
                     /translation="MSKAELVEKIASQAGLTKVDAERAVNAFMNVVTESLKEGEDVTL
                     VGFGTFTTGERAERQGRNPQNGETITIAAKKVVKFKPGKALKAGVEG"
     gene            268272..269273
                     /locus_tag="CPHA266_RS01245"
                     /old_locus_tag="Cpha266_0239"
     CDS             268272..269273
                     /locus_tag="CPHA266_RS01245"
                     /old_locus_tag="Cpha266_0239"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BD29.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA carboxylase subunit alpha"
                     /protein_id="WP_011744146.1"
                     /db_xref="GI:500064229"
                     /translation="MANRVVLDFEKPLFELEAKLEEMRVYLRNSSRDQDSSDQDVLNR
                     EIEALEVKVETLRRSIYKNLTRWQKVQLARHAERPFTLDYIYMMTRDFVEMAGDRYFS
                     DDKAIVGGFAILEDIPSGFSQPVMIIGHQKGRDTKSNLYRNFGMAQPEGYRKALRLMK
                     LAEKFNKPVITLIDTPGAFPGIEAEERGQAEAIARNLFEMARLTVPVICVIVGEGASG
                     GAIGLGVGNRILMAENSWYSVISPESCSSILWRSWNYKEQAAEALQPTAEDLLAQGII
                     DRIIPEPMGGAHTDPEAMAGTLKEMLIEELRILMSKESDVLVRERVEKFSGMGVWDE"
     gene            complement(269383..270411)
                     /locus_tag="CPHA266_RS01250"
                     /old_locus_tag="Cpha266_0240"
     CDS             complement(269383..270411)
                     /locus_tag="CPHA266_RS01250"
                     /old_locus_tag="Cpha266_0240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744147.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-oxoacid ferredoxin oxidoreductase subunit
                     beta"
                     /protein_id="WP_011744147.1"
                     /db_xref="GI:500064230"
                     /translation="MTDTRAQLTAKDFTSNQEPKWCPGCGDFAVLQQLKNAMADLGLK
                     TEEVVVVSGIGCSSRLPYYIATYGVHGIHGRALAMASGLKTARPELSVWVGTGDGDAL
                     SIGGNHYIHTVRRNLDLNVILFNNEIYGLTKGQYSPTSKVGLRTVTSPNGVVDHPINT
                     AALTLGAGGTFFARVMDRDGKIMRDIFKRAAEHKGTSLIEIYQNCPIFNDGAFDPFTD
                     KDRKADTTLYLEQGKPLVFGKQNDKGIRLDGFTPVIVDLNNPSVSQNDLWIHDEKDFI
                     KANMLARFFDDPDASEDFLPRPFGIFYVEDRYTYESALSAQIEKAQENGEGTIEELLA
                     GSNTWTIA"
     gene            complement(270415..272298)
                     /locus_tag="CPHA266_RS01255"
                     /old_locus_tag="Cpha266_0241"
     CDS             complement(270415..272298)
                     /locus_tag="CPHA266_RS01255"
                     /old_locus_tag="Cpha266_0241"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744148.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-oxoglutarate ferredoxin oxidoreductase subunit
                     alpha"
                     /protein_id="WP_011744148.1"
                     /db_xref="GI:500064231"
                     /translation="MSETTILNREDMVTAKTSVSVLFAGDSGDGMQLTGTQFANTVAV
                     YGSDLNTFPNFPSEIRPPAGTVAGVSGFQLQFGTSSVYTPGAKFDVMIVMNAAALKAN
                     LNNLHHGGIIITDTDGFDAKNLKLSGYGEENNPLRDGTLNDYTVFEIPVVSLTRKALA
                     ETGLSTKNIDRCKNMFVLGVLYWLYSLPLETTIETLKTKFAKKLDLAEANIKAVTAGY
                     NFGDETEMFSQHGRFSVAPADKKPGVYRRVTGNEASAIGLAVAAKKAGLELFLGSYPI
                     TPATEILQTLAGLKKWGVKTFQAEDEIAGVLSSIGAAYGGALAATNTSGPGLALKSEG
                     LGLAVILEIPLVIINVMRGGPSTGLPTKPEQSDLLMAMYGRHGDAPMPVIAAKSPVDC
                     FYAAYEAAKIAVEYMTPVLCLTDGYLALSSEPMLVPSPDDLASITPVFSPARNADDPP
                     YLPYKRDDRAVRPWAKPGTPGLEHRIGGLEKQNETGNVSHDPENHELMTKLRAEKVAR
                     VADIIPDLTIDNGPESGDILVLGWGSTYGAIKKAVEQVLEGGCSVAHAHLRYINPFPK
                     NLGEVMGHYKKVLIPENNCGQLLSMIRDKFLIEPVGFSKVQGLPFNEMEIEAKITDIL
                     KEL"
     gene            complement(272505..272774)
                     /locus_tag="CPHA266_RS01260"
                     /old_locus_tag="Cpha266_0242"
     CDS             complement(272505..272774)
                     /locus_tag="CPHA266_RS01260"
                     /old_locus_tag="Cpha266_0242"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012465185.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744149.1"
                     /db_xref="GI:500064232"
                     /translation="MSWGVEDEKRRKGVLELMELSSRIVKENPNHVNEVAKSTTGCWM
                     EQMYGMQRCDFCDLASDCPVREETEWQEYLRVNNIVIVKDNDNIT"
     gene            273033..275699
                     /locus_tag="CPHA266_RS01265"
                     /old_locus_tag="Cpha266_0243"
     CDS             273033..275699
                     /locus_tag="CPHA266_RS01265"
                     /old_locus_tag="Cpha266_0243"
                     /EC_number="6.1.1.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BD33.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanyl-tRNA synthetase"
                     /protein_id="WP_011744150.1"
                     /db_xref="GI:500064233"
                     /translation="MNSREIRQSFLDFFDRKGHTIVRSAPVIPLDDPTLLFTNAGMNQ
                     FKDVFLDKGTRPYVRAADTQKCIRASGKHNDLEDVGRDTYHHTFFEMLGNWSFGDYYK
                     KEAISWAWELLTSVWHLPKERLYATVYYDDEESYLLWQEETDIPHDHIIKFDEKDNFW
                     EMGETGPCGPCSEIHIDLTEDGSGKPLVNAGDYRVIELWNLVFIQYNRQADGRLEPLP
                     QKHVDTGMGFERVCAVMQGKASNYDTDVFRPLFDRITEITGVSYNASLDDPSDIAMRV
                     LADHARTLTFALTDGAMPSNEGRGYVLRRILRRALRYSKTLGCSEPLLYRLVETLAAS
                     MGDVFPELRKQQQAVSRIIRAEEESFLATLDRGIEIFNELIAAVRSRGTTVVSGDDAF
                     RLYDTFGFPLDLTRLMAAEAGFEVDEEGFDRCMKEQKTRARQDRRDKQHLKGDEGEWT
                     WFSAERTSVFTGYHSLEELASITGVSIFSDRLLVVLDRTPFYAESGGQCGDRGWIETA
                     AYRLRVSDTRKDGDMIVHLVTEVRDSVSDGAISPADLSFDEGKLACRASVDRSDRQGT
                     ERNHTATHLLHAALRRTLGQHVQQKGSFVSSERLRFDFSHFARLTSEELAIVESEVNE
                     QIRSAEPVVKHQDIPYDEAIARGALAFFGDKYADRVRVVEIAGLSVELCGGTHVDSIG
                     QIGLFKIVSESSVASGVRRIEALTGKAAEVLLWKEYRELQDIRQMLKLKADEEVIGRI
                     AELADSKKELEKQLQVYRTEALSGILQRSLDAAESVGSIRFMTLRLEHVDQDSLRQAV
                     LALREKDPASTGLLCTEEDGKVSLTAFAGERAVGEFGLDAGKLVREAAAFVRGGGGGK
                     PEFATAGGKDPEGIQKAFDSFAASVREKVSAK"
     gene            275723..277081
                     /locus_tag="CPHA266_RS01270"
                     /old_locus_tag="Cpha266_0244"
     CDS             275723..277081
                     /locus_tag="CPHA266_RS01270"
                     /old_locus_tag="Cpha266_0244"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012509298.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent pyridine nucleotide-disulfide
                     oxidoreductase"
                     /protein_id="WP_011744151.1"
                     /db_xref="GI:500064234"
                     /translation="MKKNVDVLVIGGSAAGIVAASTGKAFYPLKNFLIVRREREAVVP
                     CGIPYIYGTLESINQNIIPNAHIEQAGVELFIDEVVAVDRGAKVATTADGTQITFDKL
                     VFATGSMPKVPAWLKGTGLGNVFTIPKDRDYLENLRMTLEQCTNIVIIGGGFIGVEIA
                     DELRKKGKRITLIEVMPHVLSAAFDDDLSVKVEKILTDNGVMLRTGEKVRELSGEGSV
                     SGVVLENGEILAADAVILATGYAPNVDLARNAGIKINELGAIRVDEYMRTEDKDIFAV
                     GDCAEKFSFITRIVKGLMLAATACSEARIAGMNLYGLSRLRTFSGTISIFSTAIGGTT
                     FAAAGVTEHLALDRGFDVISASAEGIDKHPKSLPGTSSQFVKLIVNRDSGLVLGGAVV
                     GGVSAGELINVIGVIIENKMTIHEVLTLQVGTHPLLTGPPTGYPLIKAAEAVVKKLRS
                     SR"
     gene            277187..277681
                     /locus_tag="CPHA266_RS01275"
                     /old_locus_tag="Cpha266_0245"
     CDS             277187..277681
                     /locus_tag="CPHA266_RS01275"
                     /old_locus_tag="Cpha266_0245"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744152.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin"
                     /protein_id="WP_011744152.1"
                     /db_xref="GI:500064235"
                     /translation="MLVFDCFFGRCEKPSCEGCALKLVRSLRLALKSRAMQKDEEFAV
                     ETACSPEKPAMVALQAKTTSHKQDATKKRKRLLAPREEIPWYPTIKPELCNGCGDCKV
                     LCKPGVFELGAPDPSGIHRPKLVVAHPYKCLVLCTRCVPICTSGAIILPPKEDFERFV
                     EYLD"
     gene            277733..278035
                     /locus_tag="CPHA266_RS01280"
                     /old_locus_tag="Cpha266_0246"
     CDS             277733..278035
                     /locus_tag="CPHA266_RS01280"
                     /old_locus_tag="Cpha266_0246"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744153.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin"
                     /protein_id="WP_011744153.1"
                     /db_xref="GI:500064236"
                     /translation="MSGLPSPSKKKKRLLAPREEIAWFPVIDTAACNGCGDCEGFCKP
                     GVFALGEPEGVKRARMTVANPWNCIVLCTRCEPVCPSGAITLPRPEDFERFVEYVD"
     gene            complement(278091..279047)
                     /locus_tag="CPHA266_RS01285"
                     /old_locus_tag="Cpha266_0247"
     CDS             complement(278091..279047)
                     /locus_tag="CPHA266_RS01285"
                     /old_locus_tag="Cpha266_0247"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744154.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="toxin HipA"
                     /protein_id="WP_011744154.1"
                     /db_xref="GI:500064237"
                     /translation="MDRRCLYCYEPLASGEGDFHRKCSRKMFGTPLPPELPYDENQLE
                     ELALEVIRSQTAITGVQPKLSLHLEPAGKAHAPQRFTIVGLWGGYILKPPSQRFRQLP
                     EIEDLTMRMAEAARIDTVPHSLIRMRSGALAYLTRRIDRTGNGKLHMEDMCQITGRLT
                     ENKYHGSYEQIAKAIHRYSANPGLDVINFFEVVLFCFLSGNADMHLKNFSLIDIEAKG
                     GYSLAPAYDLVSTGLVMPSDKEDLALTLDGKKTRITLNDFRAAFGVLTIDEVVQERMF
                     RKFRNVLPLWDLLIEKSFLDYENQAAYKELIRKKCHQIRLDA"
     gene            complement(279052..279375)
                     /locus_tag="CPHA266_RS01290"
                     /old_locus_tag="Cpha266_0248"
     CDS             complement(279052..279375)
                     /locus_tag="CPHA266_RS01290"
                     /old_locus_tag="Cpha266_0248"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012465191.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidylinositol kinase"
                     /protein_id="WP_011744155.1"
                     /db_xref="GI:500064238"
                     /translation="MQKAEIRYLDRTAGWFIQDEEGFHFLYDQAYLDSKDARPVSLTL
                     PLRAAAYSSRTMFPFFDGLIPEGWLLAVAERNWKLDPRDRMGLLLNCCRDCIGAVSVH
                     PVIME"
     gene            complement(279379..279585)
                     /locus_tag="CPHA266_RS01295"
                     /old_locus_tag="Cpha266_0249"
     CDS             complement(279379..279585)
                     /locus_tag="CPHA266_RS01295"
                     /old_locus_tag="Cpha266_0249"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744156.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_011744156.1"
                     /db_xref="GI:500064239"
                     /translation="MKDIAEFVRDRRKALGMTQPELAEKAGTGLRFIRDLEQGKKTLR
                     MDKVNQVLALFGFVLAPVSPEREA"
     gene            complement(279920..281137)
                     /locus_tag="CPHA266_RS01300"
                     /old_locus_tag="Cpha266_0250"
     CDS             complement(279920..281137)
                     /locus_tag="CPHA266_RS01300"
                     /old_locus_tag="Cpha266_0250"
                     /EC_number="3.1.3.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744157.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoserine phosphatase"
                     /protein_id="WP_011744157.1"
                     /db_xref="GI:500064240"
                     /translation="MSELLLINLTGLDKPGLTSKITAILADARVPVLDIGQAVIHNHL
                     SLGMLVEVPKESASSPVLKDLLFCAHTLGIQISFTPVADEEYDRWVGEQGKPRYLLSL
                     LSRKISAEQLKRVSSIVAEHDLNIDTISRLSGRIPLDNGDNHTRACVEFSLRGTLSDE
                     NLFREQLLAITDSLGIDIAFQEDNIFRRNRRMVVFDMDSTLITSEVIDELALEAGVGE
                     EVSAITEQAMRGELDFNESLQRRVAQLKGLDEHVMESIAARLQLTEGAERLFGNLKRL
                     GYKTAILSGGFTYFGHYLQKKLSIDYVYANTLEIENGCLTGRVLGRVVDGARKAELLE
                     LLAEKENISLEQTVAVGDGANDLPMLGKAGLGIAFRAKPIVRERAKQAISTLGLDAIL
                     YLMGFRDRDELSE"
     gene            281204..>281416
                     /locus_tag="CPHA266_RS01305"
     CDS             281204..>281416
                     /locus_tag="CPHA266_RS01305"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744172.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467465.1"
                     /db_xref="GI:752831163"
                     /translation="MEPFIAVISHDNSARLLNNNIALQNIKIVLFQEPSKTGAGKITE
                     RQASGAGRMSVPYSVTADGATLFCYTF"
     gene            281769..282989
                     /locus_tag="CPHA266_RS01310"
                     /note="ATPase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            complement(283296..283586)
                     /locus_tag="CPHA266_RS01315"
                     /old_locus_tag="Cpha266_0252"
     CDS             complement(283296..283586)
                     /locus_tag="CPHA266_RS01315"
                     /old_locus_tag="Cpha266_0252"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744158.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid stabilization protein"
                     /protein_id="WP_011744158.1"
                     /db_xref="GI:500064241"
                     /translation="MIFSFHPEAKEEFDKAIEYYENIAPGLGYDFALEVHSAIKRSIE
                     HPNAWAVLYEDVRRSLVRRFPYGVLYSKEPAEIFILAVMNLHRNPGYWKKRK"
     gene            complement(283583..283807)
                     /locus_tag="CPHA266_RS01320"
                     /old_locus_tag="Cpha266_0253"
     CDS             complement(283583..283807)
                     /locus_tag="CPHA266_RS01320"
                     /old_locus_tag="Cpha266_0253"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744159.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="addiction module protein"
                     /protein_id="WP_011744159.1"
                     /db_xref="GI:500064242"
                     /translation="MNTKQLIDKAVSLPVEERALVVDSLLRSLNQPESEIDKKWSQEA
                     KRRLAELRSGQVQAIPGDEVFAEVWKKFES"
     gene            complement(283850..285070)
                     /locus_tag="CPHA266_RS01325"
                     /old_locus_tag="Cpha266_0254"
     CDS             complement(283850..285070)
                     /locus_tag="CPHA266_RS01325"
                     /old_locus_tag="Cpha266_0254"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744160.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_011744160.1"
                     /db_xref="GI:500064243"
                     /translation="MNDLTLFQMALGLESPWYVSSSSFDVDQKRLDIRIDFKPGSTFC
                     CPQCGREGVKAYDTSEATWRHLNFFQHEAYLTVRVPRISCPECGILKLQSFPWSRRES
                     GFTLLFEAMIMIMAKSMPVKAIAAIVGEHDTRIWRIINHYVEKAREQEDHSAVTMVGV
                     DETSSKRGHNYVSLFVDLAVSKVLFATEGKDAATVKRFSEDLAAHKGDPALITEFCSD
                     MSPAFIKGVADNFTNAQLTFDKFHIMQVINNAVDEVRRQEQKERPELQRSRYIWLKNQ
                     NNLKASQRKRLDELSLPRLNLKTTRAYRMRLTFQEFFEQPQVLVEAFLKKWYFWATHS
                     QLQPMKEAAYTIKRHWSGILRWFTSRINNGVLEGINSLIQAAKARARGYRTTKNLINM
                     IYLISGKLNFGLPT"
     gene            285352..285561
                     /locus_tag="CPHA266_RS01330"
     CDS             285352..285561
                     /locus_tag="CPHA266_RS01330"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467138.1"
                     /db_xref="GI:752830836"
                     /translation="MFNGLFPWAVIMIVRVFYSISFSGKVPIRNNRQESHQAVIKSNI
                     EGSVLKTKSIQLPFASEELTRNSWM"
     gene            285632..286614
                     /locus_tag="CPHA266_RS01335"
                     /old_locus_tag="Cpha266_0255"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            287276..288241
                     /locus_tag="CPHA266_RS01340"
                     /old_locus_tag="Cpha266_0257"
     CDS             287276..288241
                     /locus_tag="CPHA266_RS01340"
                     /old_locus_tag="Cpha266_0257"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006172542.1"
                     /note="may be involved in the transfer of antibiotic
                     resistance genes to plasmids and transposons; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_041467466.1"
                     /db_xref="GI:752831164"
                     /translation="MQHGPKLLELFREAMRVRHYSRRTEETYCSWVKRYVHFHNMRHP
                     KEMREPEINAFLTHLAVEEKVSASTQNQALSALLFLYRHVIGKEIGDLGHLIRARKPS
                     HLPVVLTRDEVKALLVQLAGVKWLMASLMYGAGLRLMECLRLRVQDIDFSSNEILVRD
                     GKGAKDRITMLPESLKKPLADHLKQIKSLHDKDLAEGWGRVLLPGALDRKYPNAPAEW
                     RWQWVFPQEHRWKNAKTGEEGRHHMDESLIQKAVKAAVFHAQLTKRATCHTFRHSFAT
                     HLLEGGYDIRTVQELLGHNDVRTTMIYTHVLNRGPSGVRSPVDCL"
     gene            288424..288852
                     /locus_tag="CPHA266_RS01345"
                     /old_locus_tag="Cpha266_0258"
     CDS             288424..288852
                     /locus_tag="CPHA266_RS01345"
                     /old_locus_tag="Cpha266_0258"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744163.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744163.1"
                     /db_xref="GI:500064246"
                     /translation="MNNELRTKLIATALEWQDRYGVAPQITTPLSEYDAAMLVGMPEH
                     EYSAYMQDITAVNKGSDFIYRNVRYQVKGNRPSGKPGSKVTMVPKATNYEWDKLIWVL
                     YDKFYVIQEAWLWDVAEYKQKFHNIKRLSPSHYREGVQLA"
     gene            289090..289329
                     /locus_tag="CPHA266_RS01350"
                     /old_locus_tag="Cpha266_0259"
     CDS             289090..289329
                     /locus_tag="CPHA266_RS01350"
                     /old_locus_tag="Cpha266_0259"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744164.1"
                     /db_xref="GI:500064247"
                     /translation="MVKLDYADYKFTVKEGSPSVSGADDAPVSLCCEPRTSELSIVGS
                     GHLSIHLKKGISCDDAQEIAKNLEQWIEKISYVKG"
     gene            289482..289934
                     /locus_tag="CPHA266_RS01355"
                     /old_locus_tag="Cpha266_0260"
     CDS             289482..289934
                     /locus_tag="CPHA266_RS01355"
                     /old_locus_tag="Cpha266_0260"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744165.1"
                     /db_xref="GI:500064248"
                     /translation="MKSSLIRFAIILFVFLSGCGTKEEPTAQEIAEAQLKETPAYKDY
                     SADANTAFLIEVKERLKAPSGADFPWDDLPKEVTTKGVKLSDMSPYLRKVIKEARKLK
                     KENAVRVYQKDSYVDADNSFGAKIRQRYLGTFIIYTEFGYTKSFVEFY"
     gene            complement(290524..291930)
                     /locus_tag="CPHA266_RS01360"
                     /old_locus_tag="Cpha266_0262"
     CDS             complement(290524..291930)
                     /locus_tag="CPHA266_RS01360"
                     /old_locus_tag="Cpha266_0262"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743933.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_011743933.1"
                     /db_xref="GI:500064016"
                     /translation="MQLPYTNIHTDQPNQQALFPDCFEVSVAPVKGKKVVLDFQGGNA
                     TSDAGVLLLKEVESMTRIVPKLADCIADSRRTSSVMHSIPDLIAQRVYQIACGYEDGN
                     DSNSMRKDPALKMALNRLPESGDDLASQPTFSRLENMVTRPELYRMAVGFLDHFLDSY
                     TEAPRVIVLDFDDTEDVVHGKQQLALFNGYHQETCYQPLHVFEGLTGKLIASILRPGR
                     RPTGKEIVSYVKRIVRHIRSRWPETIIVYRGDSHYGVPEVYSFLAREQNCYSVTGLGG
                     NDVLLRSVKDIIEEVKKHGAGYRRYHTFQYQARSWKETRRVVAKVEMTEKGLNVRFIS
                     TDMQEAKAKTLYEQIYSARGNDELYIKAHKTFMKSDRTSCHRFLANQFRVFLHSAAYV
                     LVHAFQTNLLRGTALATATFETIRLKLLKIGAKVIEMKTRIKVHLPTSYPYKPILNKC
                     FAVLEHLRSVPWPSTAIP"
     gene            292108..292848
                     /locus_tag="CPHA266_RS01365"
                     /old_locus_tag="Cpha266_0263"
     CDS             292108..292848
                     /locus_tag="CPHA266_RS01365"
                     /old_locus_tag="Cpha266_0263"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001041990.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744166.1"
                     /db_xref="GI:500064249"
                     /translation="MIIQDYSEHIENFENYLKSKLASIDEISGDNNVLFKKILYVSFL
                     DSLSSCVYPGRGNKERFVSMLERFSKWEDRDRVSLPHLGKFVQIISDPLLEQARKYVT
                     PKLKTWQERSCYVISISEDPIIDEILDKSWKTNKETGIHVSLTDFKHISLLYQLRNAL
                     VHQFQSRGDEMGNLRQLDHPYYQRVQIFNGTLEDMKPVRFELVYPTQFLKSLSEKTLE
                     NVVDYLKDGNINPFPHYYAGDYWITELN"
     gene            292953..293210
                     /locus_tag="CPHA266_RS01370"
                     /old_locus_tag="Cpha266_0264"
     CDS             292953..293210
                     /locus_tag="CPHA266_RS01370"
                     /old_locus_tag="Cpha266_0264"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012509290.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467467.1"
                     /db_xref="GI:752831165"
                     /translation="MFYGILIRMFFRDAEKHHVPHIHADYQGNVAVYSIPEGTLLAGL
                     LPPNKHKLVVAWIEIHHEDLLADWNLAVNGKKPFPIKGLDQ"
     gene            293207..293464
                     /locus_tag="CPHA266_RS01375"
                     /old_locus_tag="Cpha266_0265"
     CDS             293207..293464
                     /locus_tag="CPHA266_RS01375"
                     /old_locus_tag="Cpha266_0265"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744168.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744168.1"
                     /db_xref="GI:500064251"
                     /translation="MRIAELHPQPDWVLSIVSEDGRVGRFDVTPYLEYEAFEELRDHG
                     EFIKVINGGYFVEWECGADLSADTIEAQWKVVGKAEQQNTV"
     gene            293727..294203
                     /locus_tag="CPHA266_RS01380"
                     /old_locus_tag="Cpha266_0266"
     CDS             293727..294203
                     /locus_tag="CPHA266_RS01380"
                     /old_locus_tag="Cpha266_0266"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744169.1"
                     /db_xref="GI:500064252"
                     /translation="MSDVYAELFSIKFLVMSVIVGTALSIAANILSHSIIQNRSKFRW
                     KAGLPLYVGTMVYLWFVLELLSSSSTDRPFGIAFSINAIYLVVSCFRASLQVTSFSAV
                     TKTAVYLQVAIFVLTLPFTDAFWGPQSADVEASIAFNGIIIAALMFMTKGYREGGV"
     gene            294586..295170
                     /locus_tag="CPHA266_RS01385"
                     /old_locus_tag="Cpha266_0267"
     CDS             294586..295170
                     /locus_tag="CPHA266_RS01385"
                     /old_locus_tag="Cpha266_0267"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744170.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744170.1"
                     /db_xref="GI:500064253"
                     /translation="MHGAVYIFENSIAKRVKVGMTINNVADRLCDVNDKWLERKVACQ
                     ICGGRLVNIGGYVPQHVISGNECPGGNALPLEKDLALAVSYLENMKNRLSKLSGSEKG
                     SVTRKIKTLEKRIGLYRHYDGPVGMWQFSIAFYTECAEQVELLSHKILTERLDKVAPF
                     GEVFCCSVSEATEAVEAALSQLGLLHSARKNTCL"
     gene            295418..296188
                     /locus_tag="CPHA266_RS01390"
                     /old_locus_tag="Cpha266_0268"
     CDS             295418..296188
                     /locus_tag="CPHA266_RS01390"
                     /old_locus_tag="Cpha266_0268"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006281990.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744171.1"
                     /db_xref="GI:500064254"
                     /translation="MRIITRVAILLLIVGIQGCATYGKISGIPSEGQKSVFKDGRKTL
                     ISIKQNTVALAPNTETVTSGQKADFVIAVHNGTSQDILFSTDDVTATANTNGQLTTLK
                     VFSYDELVAEEKNRRAWAAVAVGLQGAAESMNAANAGYSNAFGTYSGSTYSNYGTKTF
                     SSGSYSSTTYNYAAAQAARNVAQANTEARFARLEADGRENLKNLSSTTLKKETIFPAA
                     WHGGLIKVELPEVAEQLQDIKFVVNVVGEQHEFNLNNS"
     gene            complement(296448..297854)
                     /locus_tag="CPHA266_RS01395"
                     /old_locus_tag="Cpha266_0269"
     CDS             complement(296448..297854)
                     /locus_tag="CPHA266_RS01395"
                     /old_locus_tag="Cpha266_0269"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743933.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_011743933.1"
                     /db_xref="GI:500064016"
                     /translation="MQLPYTNIHTDQPNQQALFPDCFEVSVAPVKGKKVVLDFQGGNA
                     TSDAGVLLLKEVESMTRIVPKLADCIADSRRTSSVMHSIPDLIAQRVYQIACGYEDGN
                     DSNSMRKDPALKMALNRLPESGDDLASQPTFSRLENMVTRPELYRMAVGFLDHFLDSY
                     TEAPRVIVLDFDDTEDVVHGKQQLALFNGYHQETCYQPLHVFEGLTGKLIASILRPGR
                     RPTGKEIVSYVKRIVRHIRSRWPETIIVYRGDSHYGVPEVYSFLAREQNCYSVTGLGG
                     NDVLLRSVKDIIEEVKKHGAGYRRYHTFQYQARSWKETRRVVAKVEMTEKGLNVRFIS
                     TDMQEAKAKTLYEQIYSARGNDELYIKAHKTFMKSDRTSCHRFLANQFRVFLHSAAYV
                     LVHAFQTNLLRGTALATATFETIRLKLLKIGAKVIEMKTRIKVHLPTSYPYKPILNKC
                     FAVLEHLRSVPWPSTAIP"
     gene            299402..300049
                     /locus_tag="CPHA266_RS01400"
                     /old_locus_tag="Cpha266_0271"
     CDS             299402..300049
                     /locus_tag="CPHA266_RS01400"
                     /old_locus_tag="Cpha266_0271"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744173.1"
                     /db_xref="GI:500064256"
                     /translation="MDEKLKLITSSLAVVAAFIGLIVSVISLVRSSENKQSIVVVTQQ
                     VANVEKQVKDVLIKSKEVVIAFNDVGAIKHIIKDIPSTPYPPYHDRSRIRPSSDIPVY
                     SFPTATISFAQGVHFNKYRITFAWQYHADSNYDPATVEFKVKYPADAHTPSRIETVSK
                     SYQEPLKIWQTATVEINVPKGIPPESLQIFVPQSGDFDFMIKDMHVEALFGEYDL"
     gene            300316..301065
                     /locus_tag="CPHA266_RS01405"
                     /old_locus_tag="Cpha266_0272"
     CDS             300316..301065
                     /locus_tag="CPHA266_RS01405"
                     /old_locus_tag="Cpha266_0272"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467139.1"
                     /db_xref="GI:752830837"
                     /translation="MKVKSSKKSRSDLANSLSAHLKSFGEKYEDIVICPTCLGEFSVK
                     ADQEKFSAGHILPEVAGGQEWTFICRSCNSRFGEKQDKWFGEYLHILNIPTGTFLDAK
                     TKNKYISINGEVVRGDISVRDDGSVEVFVPIDRNPPGKVKSIPKGPKLELSFKPVLID
                     HENEIEIGYITAAYLIWFHEIGYNWVFQSSLDVVRKQILECDRSLNGAKVIDLDFDKS
                     PVEGVGAVLQSDTLYPCCVVVDKLVVIGKQE"
     gene            301160..302731
                     /locus_tag="CPHA266_RS01410"
                     /old_locus_tag="Cpha266_0273"
     CDS             301160..302731
                     /locus_tag="CPHA266_RS01410"
                     /old_locus_tag="Cpha266_0273"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011745977.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_011743927.1"
                     /db_xref="GI:500064010"
                     /translation="MRTQLKKLTMYNKVKEFAREGLSIRQISRKTGMDRVTVRKFLRM
                     TDEEFSAFLALQKRRLRKLQPYEQFVKDRVTDYPDCSATQVEDWLKEHHPVFPEVTTR
                     TIYSFVQWIRKAYDLPKPKGTPRAYHPVEQLPYGEQAQVDFGEYWMASADACKVKVHF
                     MIMLLSRSRRKFVSFSQQPITTRFVLEAHEQAFSFFEGIPHTLVYDQDSTIVTDENRG
                     AILYTEAFRKYLLHRSLKIHLCRKSDPESKGKIEAGVKYVKYNFLPGRRFVNLEVLNQ
                     EALLWLERTANAKEHATTRLIPDAEWQVEKQHLRPFEPLPYPISGTVGKEYHVRKDNT
                     ISYRGNFYSLPVGTYAGPGTLVVLEVRQNTLCLYAQEGRLLANHPIESGKGTVVINNN
                     HRRDTSSKLRELQDSLMLLFTNQEHAERFLESIHNRYPRYSRDQFLHVRNAISGCQQK
                     LIDDALAHCVDHHLFSSGEFHDILHHYRKQEEKQSHQAVFNTFRPKTLRSDMDRMLSF
                     VPDSSGITTYENIFS"
     gene            302737..303573
                     /locus_tag="CPHA266_RS01415"
                     /old_locus_tag="Cpha266_0274"
     CDS             302737..303573
                     /locus_tag="CPHA266_RS01415"
                     /old_locus_tag="Cpha266_0274"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743928.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_011743928.1"
                     /db_xref="GI:500064011"
                     /translation="MERTITTIQEHARELNLTGLAGTVDLLLEEARKSEPSYSDFALT
                     LLESELSCRRKAHLERRRKIANLPLLHDLDHYDSGVQNGISQVQLQQLRQLLWLDQNF
                     NLILIGPSGTGKSYLAGGLCHEALKLGYHALFRTMDDLIQTIRFKEITAAAAREYKRL
                     LSAHLLVIDDIMMFPLEKSVAVGLFQLVNQLHEQTSFIITTNKSPKEWAEMLGDEVLA
                     TALLDRLLYKCEVIKLTGKSYRLEHRTTIFEQQQSPEGGGNRRKKQLPLQKGVGNHCK
                     MT"
     gene            304055..304258
                     /locus_tag="CPHA266_RS01420"
     CDS             304055..304258
                     /locus_tag="CPHA266_RS01420"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467140.1"
                     /db_xref="GI:752830838"
                     /translation="MFGLGIPELIIIFLIFGGFLLPFIINANLAKSRGKSVALMFLLR
                     VFFSWIVTLILALMSKVPEQSKT"
     gene            304684..>305157
                     /locus_tag="CPHA266_RS01425"
     CDS             304684..>305157
                     /locus_tag="CPHA266_RS01425"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004742750.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467468.1"
                     /db_xref="GI:752831166"
                     /translation="MAPRVFISYSHDSQQHKAWVLKLATHLSQAGIDIVFDQWDIEPG
                     SDVALFMEQGIEKSDRVVLVITEKYVEKTKRNDSGTGYERMIITGQLAQELDTHKFIP
                     ITRQTLGKIKLPVFLGNRLYVDFSDDELFEDSCHRLLRTLHGEPEVARPSVGPNPF"
     gene            305551..306744
                     /locus_tag="CPHA266_RS01430"
                     /old_locus_tag="Cpha266_0276"
     CDS             305551..306744
                     /locus_tag="CPHA266_RS01430"
                     /old_locus_tag="Cpha266_0276"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744176.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744176.1"
                     /db_xref="GI:500064259"
                     /translation="MSEGLTESEKFVNSISERAFLHLWTHPNPIGKKGKELCDCLIVC
                     GNHIVIISVKDIKYKDTGDEAGWKRWTKAAIDKSASQIWGAERWLDSSVEFTRHDGRK
                     VELPPKENRIVHRISVSLGAQRKIPTKSGDLGNGIVHVCDEFSLGAIFGLLDTITDFV
                     SFLTEVEALINRANIVFNGGGIEDLLAIYLLNNHSFPYDEADLIIIEDTVFRGFIDSD
                     DYKAIQESYKDSYFWDKLIEHFVGDLLTDGMFEYGTNQVTDNQLALVQMALQPRGHRA
                     NLVDAFSEFLQKPELKIAARVILAYKNTAFVFHLGPSSDREARVQELGLRCLVVRGRL
                     PDVKIVVGISRDKLGPSEVGYSHDIAYVEIPEWNDDFEEQVTKIQKELGYFENTSCTK
                     RPENA"
     gene            306836..307525
                     /locus_tag="CPHA266_RS01435"
                     /old_locus_tag="Cpha266_0277"
     CDS             306836..307525
                     /locus_tag="CPHA266_RS01435"
                     /old_locus_tag="Cpha266_0277"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744177.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744177.1"
                     /db_xref="GI:500064260"
                     /translation="MKDIITEFDRPIVFRTVNAEVYESTINSGSIWLRSSDYYVYLED
                     KARCDKSEGANGTKTLLPLCFHPEGGTKQIYYGDGIIGQKISPHYIFSMHGSSVSECV
                     RKDFGEFTFGIKCISRLSAEILYEASKYLNVTGYRFGQVSYQYTALCRSLHSHGAAVG
                     LGGNLPEFLQSINTDVLRKDPVLPFIEQDEWRIVIFTNSLIKNDYNEPLKLIVNPNNF
                     YEYKSSAKLNA"
     gene            307601..308236
                     /locus_tag="CPHA266_RS01440"
                     /old_locus_tag="Cpha266_0278"
     CDS             307601..308236
                     /locus_tag="CPHA266_RS01440"
                     /old_locus_tag="Cpha266_0278"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744178.1"
                     /db_xref="GI:500064261"
                     /translation="MENQLPRIRDEAAYQQAMREWVVPECLHVPVVAVDEEAIKDHVG
                     DIVEILSPGRALVVAIYPPRERDFRLPIWAYPSANVFFEPIQVWVNPSYTRYRQAYVR
                     AKGADSVSGKVLAHVYNRRMAMLRGYGFVRLVPVSRRANSSSSFTEQWGIKLAAEDFG
                     ARRLKRGLRMQYADLGDLLVMLDISLGGGVQDTCRLGQNLIEIPGRRPPQE"
     gene            309191..309961
                     /locus_tag="CPHA266_RS01445"
                     /old_locus_tag="Cpha266_0280"
     CDS             309191..309961
                     /locus_tag="CPHA266_RS01445"
                     /old_locus_tag="Cpha266_0280"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744179.1"
                     /db_xref="GI:500064262"
                     /translation="MEGRTMTWLKIIGAVVLLWTLTNFFLRYYEYSVFIYLFRFLGNY
                     RQIAHIFIRTDYWGDHREGNRREEYAALRRHEIAERFLIKGGSKAVTGILAELKKTNN
                     EYIRTHLAELIIKIGDTKALPDIEELFNRGAFHSSYGPGGSPIEQFLQSNSPSYRQKR
                     NKEEEESSAKLVQATDMVKDLSDDQMMDILKRLCRAYSVNDESEIKNIEPIAIAIGRK
                     LNQRGGLKAMRELYDKIGNIKGTRSLDMHWNGIGDWQG"
     gene            310485..311354
                     /locus_tag="CPHA266_RS01450"
                     /old_locus_tag="Cpha266_0281"
     CDS             310485..311354
                     /locus_tag="CPHA266_RS01450"
                     /old_locus_tag="Cpha266_0281"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744180.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="abortive infection protein"
                     /protein_id="WP_011744180.1"
                     /db_xref="GI:500064263"
                     /translation="MTTISNSEPGIARSILSSPPARVLVLGFILLVMMGLNTDVMTSY
                     AGEPAKSVLHIMALAIAGISVYLGYAYFIEERDVYELAVPGMGRELGIGLLIGAGLYA
                     LSELILMALGIYRIDGLNPLSYMVPAIAMAQSSGIYEELLFRGVLFRSVETWLGSWAA
                     LVVSSLVFGLTHLMNPHATIEGALFIAVEAGILLAAAYMLTHRLWLSMGFHVAWNYTQ
                     SAIFSGIVSGNEASQGLVRSTIKGPDFLTGGSFGVESSVLALLLCTTTGIVMLVMASK
                     RGNIVPPVWKRAA"
     gene            312094..312396
                     /locus_tag="CPHA266_RS01455"
                     /old_locus_tag="Cpha266_0282"
     CDS             312094..312396
                     /locus_tag="CPHA266_RS01455"
                     /old_locus_tag="Cpha266_0282"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744181.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin"
                     /protein_id="WP_011744181.1"
                     /db_xref="GI:500064264"
                     /translation="MQKQREMPYVAHVFVCTNDRGGEKKSCADNNSQLTKARLKQAVD
                     EKGWRGKVRISTSGCMGLCSNGSHVMIYPQKVWFSGVLPDDVDEIVSAIERILADD"
     gene            312420..312608
                     /locus_tag="CPHA266_RS01460"
     CDS             312420..312608
                     /locus_tag="CPHA266_RS01460"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467141.1"
                     /db_xref="GI:752830839"
                     /translation="MPRNSVIWDTHSVALHSGYSHSIVVFGSTVDQNQVRLDLAITAI
                     VQRADHGVIDSIGPIPYS"
     gene            complement(312684..313556)
                     /locus_tag="CPHA266_RS01465"
                     /old_locus_tag="Cpha266_0283"
     CDS             complement(312684..313556)
                     /locus_tag="CPHA266_RS01465"
                     /old_locus_tag="Cpha266_0283"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018880180.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744182.1"
                     /db_xref="GI:500064265"
                     /translation="MNNISINISGRIDPERVTLLRDIKEVADGLAIHFFVVGAFARDL
                     NFEHIHHIPAPRVTEDIDIGVEVADWETFRYLTDSLIDRDILKPTKSAHRFTGNSPAI
                     VVDIIPYGGISNELKKISWPPDHRIIMSMLGFEEAFQSAMAVCLETEPLLEILVPSVP
                     ALTVMKIISWNDAYPNRNRDARDILFILENYHVIVSEYLYEPPAVLLEEEAFDLCLAS
                     VRLLGRKIAQLCSKITKETIVIILDRESEENGEVKMLSQMGSAGSFQTKQFENSLKLL
                     KKLLQGIREETTKV"
     gene            complement(313519..314571)
                     /locus_tag="CPHA266_RS01470"
                     /old_locus_tag="Cpha266_0284"
     CDS             complement(313519..314571)
                     /locus_tag="CPHA266_RS01470"
                     /old_locus_tag="Cpha266_0284"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744183.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467142.1"
                     /db_xref="GI:752830840"
                     /translation="MNKENIEHKFADNEGIILHQAMEALAVIAPLDYVVEPATYLRDQ
                     EYDYLVKGIVFGKKFVWCVNIKTRLTRTGEMQLLIGKDKALHPLLLVTGYVPPEAADR
                     LRSIGIEFIDKAGNMFINQPPLLIFVKGNKPEKEKNTMPGTRLFKGVGLKIVYLLLCR
                     PDLVNSSYRDLSEMTGVALGTVNTTITELLMKDFILDMGKRGKKILNRKKLFERWVEA
                     YPDYLKPKLFLGRFHGDEFWWKNTNLDPASAQWGGEIAASKLTGYLKPGSAALYTDKK
                     FLTDLVITNRLKKDPQGNVEIFERFWPMDYGFGDLDTTHPIIIYADLLAIGDQRTTET
                     AKMIYEQYLDQYFRQD"
     gene            315008..315379
                     /locus_tag="CPHA266_RS01475"
                     /old_locus_tag="Cpha266_0285"
     CDS             315008..315379
                     /locus_tag="CPHA266_RS01475"
                     /old_locus_tag="Cpha266_0285"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018036065.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744184.1"
                     /db_xref="GI:500064267"
                     /translation="MIRKITITGFLLLAVAFNANAQDIDRINQLEKEVREINIRLSKL
                     ESLLSNPGKPHEHVTPGEGWKSIMNWRKLTTDMDYSDVQKTLGEPQRVDGGQVAHWYY
                     QNGGNVTFMGGKVYQWSEPRH"
     gene            315590..315913
                     /locus_tag="CPHA266_RS01480"
                     /old_locus_tag="Cpha266_0287"
     CDS             315590..315913
                     /locus_tag="CPHA266_RS01480"
                     /old_locus_tag="Cpha266_0287"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744186.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744186.1"
                     /db_xref="GI:500064269"
                     /translation="MSRKERIVRYTDKELESMQVHGQDKSDWKSAAAISGKEIEAAVA
                     GDEDETGMHIDWSSISAEPPRPKAVLNMRVDYDVLEFFRSQGKGYQKKINAVLRSYVE
                     QKQRH"
     gene            315976..316242
                     /locus_tag="CPHA266_RS01485"
                     /old_locus_tag="Cpha266_0288"
     CDS             315976..316242
                     /locus_tag="CPHA266_RS01485"
                     /old_locus_tag="Cpha266_0288"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013820143.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744187.1"
                     /db_xref="GI:500064270"
                     /translation="MLVVFHAATAFFLKSIPDVIWSGLLASFLTLVGVLLSNRGYTQR
                     LRMQLDHDAAEKTKERTATLRRETYLRAAEELVRVNAYLASPSI"
     gene            316311..316595
                     /locus_tag="CPHA266_RS01490"
                     /old_locus_tag="Cpha266_0289"
     CDS             316311..316595
                     /locus_tag="CPHA266_RS01490"
                     /old_locus_tag="Cpha266_0289"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744188.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="toxin"
                     /protein_id="WP_011744188.1"
                     /db_xref="GI:500064271"
                     /translation="MKRINWNTEKSLVLKASRGICFEDVIFFVERGEILDDYLHPNQE
                     VYPGQRIMVIGMTNYAYLVPYVENEEELFLKTIIPSRKATQQYFGEKHES"
     gene            316585..316872
                     /locus_tag="CPHA266_RS01495"
                     /old_locus_tag="Cpha266_0290"
     CDS             316585..316872
                     /locus_tag="CPHA266_RS01495"
                     /old_locus_tag="Cpha266_0290"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744189.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antitoxin"
                     /protein_id="WP_041467143.1"
                     /db_xref="GI:752830841"
                     /translation="MKAKLTKEEKEILDSFEKGEWVPVADLSKRRKELAEYAGNSLKK
                     DKRLNIRISERDLTELQRKAIKEGLPYQTYVASIIHKFINGTLVDGAAKDG"
     gene            317187..317612
                     /locus_tag="CPHA266_RS01500"
                     /old_locus_tag="Cpha266_0291"
     CDS             317187..317612
                     /locus_tag="CPHA266_RS01500"
                     /old_locus_tag="Cpha266_0291"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744190.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotidyltransferase"
                     /protein_id="WP_041467469.1"
                     /db_xref="GI:752831167"
                     /translation="MSNQDISWIQRYRYYVQAFGQLDRAVELARQRPLTELEQQGLIQ
                     SFEYTHELAWNTLKDFLENKGVQPLYGSKDTTREAFKRGLIEDGEIWMQMINSRNLTS
                     HTYNQEIADEIAEAIRIHYHAAYRTLVDTLEPLTSERPE"
     gene            317609..317935
                     /locus_tag="CPHA266_RS01505"
                     /old_locus_tag="Cpha266_0292"
     CDS             317609..317935
                     /locus_tag="CPHA266_RS01505"
                     /old_locus_tag="Cpha266_0292"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744191.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase"
                     /protein_id="WP_011744191.1"
                     /db_xref="GI:500064274"
                     /translation="MKYGLDDTTIARIHGVIARYGQVDKAILYGSRAKGNYRAGSDID
                     LTLVGGHDLNLTVLYRIMDDIDDLLLPYTFDISLLHSISDRDVLDHIKMVGKVFYEKT
                     QTSQFF"
     gene            complement(318232..319209)
                     /locus_tag="CPHA266_RS01510"
                     /old_locus_tag="Cpha266_0294"
     CDS             complement(318232..319209)
                     /locus_tag="CPHA266_RS01510"
                     /old_locus_tag="Cpha266_0294"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744192.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744192.1"
                     /db_xref="GI:500064275"
                     /translation="MKRKIHLSHLLVALLLSLWLPMYGCSTPHSATEDISQQPTAGIS
                     GMAQIDGNSWLVVHDALSFENGPRMSIITLSVDAAPVLHPVTIDSWPDAGGQASDLES
                     LCPVPSHPNEYLMAESGTWKEKGGRLFHLRLNALTRQAAILGVMKLPVLADNNPQQVG
                     DQYEALACVRGADGRLLLLLGERGGSQRFPEGVIRWGVLDIERHELQFTEKGLEGVKV
                     NAPGKWKNELTNRDISDMYISPEGEIWVSAAEDNGDNGPFTSVIYSPGRISGNFSLPV
                     IANRHSGVWRTIGSLKIEALSGPAESVAGSRMSIGSDDENYGGIWRPVE"
     gene            complement(319399..319950)
                     /locus_tag="CPHA266_RS01515"
                     /old_locus_tag="Cpha266_0295"
     CDS             complement(319399..319950)
                     /locus_tag="CPHA266_RS01515"
                     /old_locus_tag="Cpha266_0295"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744193.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744193.1"
                     /db_xref="GI:500064276"
                     /translation="MRPAHIIRILPLCAFLLISGCSGNSSKQSESSSGNASVQQQASK
                     IIEPGDLITAKDAETMLGEPVKPAEKTDNQVVGQKLCLYNPINTGSSEFLQVGLTQDA
                     FMPPQGISSASIYKSLKDNFEGMRTDVKGVGDEAFIATGGIYILTDGYYIQIGAGNSS
                     NETVRNKLIEAGKIAVAKLNTLK"
     gene            320826..323612
                     /locus_tag="CPHA266_RS01520"
                     /old_locus_tag="Cpha266_0296"
     CDS             320826..323612
                     /locus_tag="CPHA266_RS01520"
                     /old_locus_tag="Cpha266_0296"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020875424.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467470.1"
                     /db_xref="GI:752831168"
                     /translation="MPLETALAQLGLSHGGLTTAEANSRRETFGPNELEEKGGRTVWH
                     ILWEQVSSVMIVILLIAGVLALLFKGGGGPPIDAIAIFSIVILFVVQGVMQEYRAQKA
                     IAALKQMSSPTVKVVRDGQVQEMSARDLVPGDLVKLETGSVVPADCRIVESVNLRIQE
                     AALTGESEPIEKFSGVLEGEDLSLGDRKNMGYMGTFASYGRGEALVVETGMRTELGKI
                     ASMIQNVKHEETPLQKKLDKLGKTLALIALVVAVVVALTGVYIEGKTWAEVLIIAIAI
                     SVAIVPEGLPAVQTFSLAIGAQRMVKRKALIRKLPAVEALGSVTVICSDKTGTLTQNK
                     MTVTELETLDHRVELDTQARQYDIEHGQPELAALVACGGLCCDAVLNPDGETGVGDPT
                     EVALAVAAHRYNLSRIALESVLPRVAEIPFDSGRKLMTTIHKLPEGGALPSTISAMAA
                     GLNGSPYVVFTKGAADNMLAICDRVFSVGQVRPLTDDDRARIHAANSKMASDGIRVLG
                     VGYHGLPDLSEYEQPGKVERELVFLGLVGMIDPARPEAKDAVAKCKTAGIRTIMITGD
                     HPDTARYIAADLGITSHDGRVITGVELEKMSDTDLKKALKDANTNCFARVSPEHKLRI
                     VGALQELGNIVAMTGDGVNDAPALKRADIGVAMGITGTDVSKEAADMVLLDDNFATIV
                     AAIEEGRVVYDNLRRFVMFSISGNIAKVIIVAVSPLIGLAAMLKPIQILFSNLLTDGL
                     LGLGMGMEAAEKNTMQRPPYSPQESIISRVVGRHIAIIGPVIGLLLLVVGYLQWQQLG
                     LPNVLQIKNEAERNALFTDPKVLMWGTLMFTALAMMQVGRAFSSRSFLDPFWKQPLRT
                     NKVLVGMILAVVTLQLFVVYTPGVQTFFSAVSLSGTNLGLCIAFAMVVLTIMELLKAL
                     ERRNAAAKQPGGKK"
     gene            complement(324655..327423)
                     /locus_tag="CPHA266_RS01525"
                     /old_locus_tag="Cpha266_0297"
     CDS             complement(324655..327423)
                     /locus_tag="CPHA266_RS01525"
                     /old_locus_tag="Cpha266_0297"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744195.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744195.1"
                     /db_xref="GI:500064278"
                     /translation="MSDHSSIDNQPAGGFAAISKYNPHLWSADQLRAIFVARKNELAD
                     LQHTLSSTPSGTVGQHILLVGARGMGKSTLMRRLALAVEDDPALSAAWLPLRFPEEQY
                     TVATLGQFWANVLDSLADALQHLGQSVSELDAAAERIAAMPPAEQAAACLATIDRCAD
                     KRGQRLLLLVDNTDLLLRNIGSDAQWALRSTLQSNPRLLWVGGSYQSLEAESSYHDAF
                     LDFFRIIHLRPLRLDEMRQALLALAETFGGSVARQQMERQLAAQPERLPTLRQLSGGN
                     PRTTVMLYEILANGQKGNVRSDLEALLDNMTPLYKARMDALADLPRKLLAHILEHWAP
                     ISIGDLAAASQVANTSISPQLKRLELEGLIEKTGLQGTTRSGYQASERFFNIWYLMRL
                     SPRRQRSRLAWLVEFMRLWFSSDELRTLAQQRLSDGRTAFRSSHEQEYDRALADALPD
                     QTPERHALRWSLLKQLKENRSQLAELFDLEGADADFKGADDYLRRLAELSARLHQNPH
                     AATEEEKKRWVNDVLGSIGFNLAQKESLAEAAADLNRDEYDKLEKLLHEERRNLENRF
                     GAAAVQTVRTAVLSQDFFPDMPDSHLAYEQIRACFAEKPEALRFGCELFYNNHNDEWC
                     YKAQKLAQETWPQDAGIAYQCAWLLHIELGRYDEAETAYRRTIELDEKNTYPWNGLGN
                     LLKDHLGRYEEAEVAYRRAIELDEKYAYPWNGLGNLLSDQLGRPEEAEAAYRQAIALD
                     EKDASPWNGLGDLLADQLDRPVEAEAAYRQAIALDEKDPYPLTNLARLLARLERKEDA
                     ETFYRDVVRSNTDDQQLLLQAHLFLGNRQLAIDALQALASAAQSGDQLAFFQLKEQIW
                     ECHELGLGERLADLMAESDAAGFLVPFVQALYTLAGATNKLRDLPLESRQMADEIVRL
                     ARLRQKRT"
     gene            complement(327416..328633)
                     /locus_tag="CPHA266_RS01530"
                     /old_locus_tag="Cpha266_0298"
     CDS             complement(327416..328633)
                     /locus_tag="CPHA266_RS01530"
                     /old_locus_tag="Cpha266_0298"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744196.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744196.1"
                     /db_xref="GI:500064279"
                     /translation="MKLGNPATGDDFFGRTQELSDLWRYLESDHIRFPGVRRLGKTSI
                     LRRLESEAADHGLLARWLDVSNIDSAPGFISLLDQAFPEKSIRSFLSDRAQQAGSWFN
                     RIRKIDATLPDAVGGGGFGIEFGGETVPEWEKDAGSLHSRLCNQPLLILLDEFPWMLE
                     KLIQRDRQEAEQLLSWLRIWRQSQGSCRFVFTGSIGLQSLLERHGLGETMNDCYPYPL
                     GPYKLSEARGLWQYFAPIADKTPWEIADPVIDYALGRVGWLSPYFLSLLLDESMRAAR
                     ERRQECPADATGEARIEIEDVDDAYENLLAERSRFHHWEKRLKSALEPADLDLCLSLL
                     SHLSRHADGLTLPQLSSRLARREPEPDLRTRRIQDLLVRLTDEGYTSPPDSNKRIQFL
                     SFPLRDWWNRNHV"
     gene            329006..331756
                     /locus_tag="CPHA266_RS01535"
                     /old_locus_tag="Cpha266_0299"
     CDS             329006..331756
                     /locus_tag="CPHA266_RS01535"
                     /old_locus_tag="Cpha266_0299"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744197.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA helicase"
                     /protein_id="WP_011744197.1"
                     /db_xref="GI:500064280"
                     /translation="MNSRQNLVIIKGKDRTDQILRIGEATEQRMIVTFSNGKPYFYAR
                     ENVAWLSNPGRITIDHCQVLVEGDLLFDIEEVLRFETWVKIFRRNGESRCCLFSDFSV
                     QRMSSSDGRSTDVLAYFRELAETTGLMTNDNKSMMAMKYRNLGVVSGRSILSSFLQAR
                     PPGSGTVPSDLIFPFGCNMSQKMAVQRAIEHPVSLIQGPPGTGKTQTILNLIGNMLLR
                     RKRVAVVSSNNSATANVLEKLQKYELDFVAASLGSAENKQVFIEGQSSDVVQMPTFQA
                     DQEASVLQEISLLNTSLDNAFAEKNGLAVIIQQIDALKLEMAHFEKYCDETNGGDLRV
                     IDRAMNAELSARKLLHAWLASEKELKRYAKAGVASPSNRRVGFLKKIGFLLRFGTAGS
                     AFFEVSVRERIPLLQKAYYLRKLADMEQRRKTLEGSLAGFHFDERLERLTELSMQLLK
                     HRLAQHYNNRERRIFALEDLRNQPEKFLEEYPVILSTTFSIITSLKSGYLFDCVIVDE
                     ASQVDLLSGVLAMGCAEKLVIVGDSMQLPNVLTAQDEKQAKEVALQYDLPDYARFERH
                     NLLSAVRTAFPDIPETLLLEHYRCHPKIIQFCNQKFYGGELLVMTRDQGEADVLKAYM
                     TVEGRHARGTINQRQVDEITQNVLPELASIHPADIGIVSPFRAQADRMLLSVGSNEIG
                     IDTVHKYQGREKRAIIITTVSNKSNEFVDNPNLLNVAVSRAKEKLRLVVSMEMADGNS
                     NVADLVRYIRYNNCEVIPGRVRSVFDLLYQDYTAARLAVLKKWKRVSIYDSENLVYSE
                     IDAVLQEKAYRGLGIVFQFPLSMLVRNRENLTTEESSYAAHPWTKTDFLVYRRVDKSP
                     VLVIEVDGYAFHREGTRQAERDALKDAVLEKCGLPILRLSTIGSDERNRIRKKLEDVV
                     AS"
     gene            complement(331874..333415)
                     /gene="guaA"
                     /locus_tag="CPHA266_RS01540"
                     /old_locus_tag="Cpha266_0300"
     CDS             complement(331874..333415)
                     /gene="guaA"
                     /locus_tag="CPHA266_RS01540"
                     /old_locus_tag="Cpha266_0300"
                     /EC_number="6.3.5.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A4SGJ0.1"
                     /note="contains glutamine-hydrolyzing domain and glutamine
                     amidotransferase; GMP-binding domain; functions to produce
                     GMP from XMP in the IMP pathway; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GMP synthase"
                     /protein_id="WP_011744198.1"
                     /db_xref="GI:500064281"
                     /translation="MQSVTVLDFGSQYTQLIARRIRELGIYSEILPYNASPETIREHD
                     PKAIILSGGPTSVYGDSALLPDGGVFMLGVPVLGICYGLQAIAKHFGGEVAGSSKQEF
                     GRAKMLVSHNEESESPLFRNIPDSDVWMSHGDKVVRLPEGFRVTASSENSEMCALESY
                     GSKAALKVYGLQFHPEVQHTLYGKQLLSNFLIDIAGIKPDWSPKSFIGHQIEEIRARA
                     GKDKVICGISGGVDSTVAAVLVSQAIGKQLHCVFVDNGLLRKNEAVKVMNFLKPLGLS
                     VTLADASDLFLKRLDKVASPEKKRKIIGRTFIHVFEQHLNEEKYLVQGTLYPDVIESV
                     SVKGPSETIKSHHNVGGLPKRMKLKLIEPLRELFKDEVRAVGRELGIAEDILMRHPFP
                     GPGLAVRVLGSVSRPRLDILREADEIFIEELKTSGLYQHVWQAFSVLLPVQSVGVMGD
                     KRTYENVLALRAVESTDGMTADWAQLPHDFLARVSNRIINEVRGINRVAYDISSKPPA
                     TIEWE"
     gene            complement(333447..335729)
                     /locus_tag="CPHA266_RS01545"
                     /old_locus_tag="Cpha266_0301"
     CDS             complement(333447..335729)
                     /locus_tag="CPHA266_RS01545"
                     /old_locus_tag="Cpha266_0301"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744199.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="penicillin-binding protein 1A"
                     /protein_id="WP_011744199.1"
                     /db_xref="GI:500064282"
                     /translation="MITLRTTVTVNTTFFKKSFITLAALVFFLLTSVSAFALNPFKGL
                     PSLEELENPNPDLASLVYSEDGVLLHKFFVKNRTFIPLKSIPRSARYALIATEDVTFY
                     QHWGVDLRRLALVMGENIIKGRQRWHGASTITQQLAKNLYLTQERTVSRKVKELITAV
                     ELEKTYTKDEILALYLNTVYFGSGAYGIEAAARTYFSKPASQLTLPESATLIATLKNP
                     TGYNPVKNPSGAISRRNLILSLMEKEKFITPEQAATAKRSRLLLHYTPVSHHGIAPYF
                     TEYIRQTVKPASMLGDINLHRDGLTIQTTLDSRMQKYAEQAAVDHLASLQASFDRSWR
                     WPESLKNQMIKESPRFKELLEDGVSAQQALVQLRADRIWLNNLLREKTRIQVALVAID
                     PANGHIKAWVGGNSLSSEDYKYQFDHVWQAKRQPGSTFKPFVYLTAIDKGIPANFRVL
                     DQPLALKSGNGIWSPRNSDGSSGGMTTLRSALTRSLNQVSVRLAYEQLTVPEIISYAK
                     RMGISSVMPQNYSIALGTGEVSPLELAGAFSTFANNGIWTEPVSILKVSDKHHRSMSE
                     STPNRRFAIDSTSNFVMVSMMRDVINRGTASSIRGRYAMTMDAAGKTGTTQSLRDAWF
                     AGFTPQLVAVVWTGFDDERIKFTSMEYGQGARAALPIWAGFMKRCYSDPSLKLTNRYF
                     HIPNTVIAVPISGQASVASAPANNSVYIEYYTPKGFNYYKSNPVQSTPGDQGDSGVPT
                     EGDLEPAPQPAETPAQEGAF"
     gene            complement(335760..336683)
                     /locus_tag="CPHA266_RS01550"
                     /old_locus_tag="Cpha266_0302"
     CDS             complement(335760..336683)
                     /locus_tag="CPHA266_RS01550"
                     /old_locus_tag="Cpha266_0302"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744200.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_011744200.1"
                     /db_xref="GI:500064283"
                     /translation="MSYLASSRCKLYYEDSAEANPAHLDKPAVLFVNGWAISSRYWKP
                     LVQALSGSFRCIIYDQSGTGKTLIKGHNPSFTIQGFADEAGELIEHLGLNKSRNLHIV
                     GHSMGGMVATELSLRYKTALVSSAIIACGIFEETAFTSFGLFFLGGLIDVSMNFRNVF
                     QSEPFRSMFIKRAATKEIAKEYGDIIIEDFTQSDKDATNAAGKFSIDPEALRAYTRHV
                     IEIASPVLCCVGMADHTIPPEGTITLFETRKARSSAPTTLVQFMNLGHLPMLEDTDNF
                     AEALIKHFDSARKFHENNSTEPARCKQYQIS"
     gene            336916..337584
                     /locus_tag="CPHA266_RS01555"
                     /old_locus_tag="Cpha266_0303"
     CDS             336916..337584
                     /locus_tag="CPHA266_RS01555"
                     /old_locus_tag="Cpha266_0303"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744201.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011744201.1"
                     /db_xref="GI:500064284"
                     /translation="MDNSFTGILSTIIDFILHIDTHLQALASEYGIWLYGILFLIIFC
                     ETGLVVTPFLPGDSLLFAAGSLASMPGSELDQHLLFLIFFVAAVLGDTLNYTIGHKLG
                     PKVFGYEKTRFFNPDYLDKTNAFFKKYGGKTIIIARFIPIIRTFAPFVAGIGAMSYKK
                     FILFNIIGALLWVGLFNYSGYFFGQLPFVQKNFKLLILFIIIISVLPPVFEYLKHRFR
                     RSGQ"
     gene            337928..338001
                     /locus_tag="CPHA266_RS01560"
                     /old_locus_tag="Cpha266_R0007"
     tRNA            337928..338001
                     /locus_tag="CPHA266_RS01560"
                     /old_locus_tag="Cpha266_R0007"
                     /product="tRNA-Pro"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:337962..337964,aa:Pro,seq:ggg)
     gene            338068..338544
                     /locus_tag="CPHA266_RS01565"
                     /old_locus_tag="Cpha266_0304"
     CDS             338068..338544
                     /locus_tag="CPHA266_RS01565"
                     /old_locus_tag="Cpha266_0304"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744202.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription activator, effector binding
                     protein"
                     /protein_id="WP_011744202.1"
                     /db_xref="GI:500064285"
                     /translation="MDFECAFVPELLELTPIPAVTIKCTTTVAAIPALFDSGYRRILE
                     YLKRESAGTAGPPFAIYTTLDSDDIDVEFGFPVTRSVAGSGSLTESRTPSGKAVSILF
                     IGPYEDVEPAYDALLKWVADNNLTAGSVAYEVYLSDPKDTLPEMQQTRIHLLLEQS"
     gene            338629..340107
                     /locus_tag="CPHA266_RS01570"
                     /old_locus_tag="Cpha266_0305"
     CDS             338629..340107
                     /locus_tag="CPHA266_RS01570"
                     /old_locus_tag="Cpha266_0305"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744203.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amine oxidase"
                     /protein_id="WP_011744203.1"
                     /db_xref="GI:500064286"
                     /translation="MDMENYNVVVIGAGIGGLAAGALLARKGLQVTVLEAQDYPGGCA
                     ATFSMQGYRFDAGATIGCGFHPGAPMDMLGRELGISWPVTPEPVAWQYRHRGITLNLT
                     TSRSEIINRFPRSEAFWKEQSLLAALLWRLAEGGLSWPVKGPRDLALLARKGVAELPG
                     TAVLLKFAAKTAREWLASHDLDTDAEFVRFLDAQLLVSVQTTTMHANALNAAIALDLP
                     VSGASRIAGGIGRVSEQLAGSIAESGGAVLYGQEVTRIDSVRREVIGVETRDGGAFAA
                     DFTIANLTPDSLEKLVDMEGEPFSREEIGAKWSAFVLYLGMDAAFFGGVLPTHLQIVA
                     GSGELAECGSIFVSASSPVETDRAPEGLCAVTISTHTAPEPWFEAKKRGQSAYLEMKE
                     RYTEKVLDLFSEQIPGVREAIKSITASTPVTWERYTGRANGHVGGYPQTSLFNVRGPA
                     TRFDNLFLVGDSIFPGQSLPGVVTGARRSVELLLQRMAKGTR"
     gene            340193..341449
                     /locus_tag="CPHA266_RS01575"
                     /old_locus_tag="Cpha266_0306"
     CDS             340193..341449
                     /locus_tag="CPHA266_RS01575"
                     /old_locus_tag="Cpha266_0306"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744204.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biotin synthase"
                     /protein_id="WP_011744204.1"
                     /db_xref="GI:500064287"
                     /translation="MNTLEKLQILSGAARYDASCSSSGSKREGSSSGLGNTSSSGICH
                     SWSDDGRCISLLKILLSNDCRYDCAYCVNRISNPVQRASFTAREVVDLTMEFYRRNYI
                     EGLFLSSAVMQSPDHTMERMVSVAETLRIDEKFGGYIHLKIIPGSSSELVRKAGLYAD
                     RISVNIELPSETALQRLAPQKQKAGILEPMAFIGREIKGSLLERQRGRNATPRFAPAG
                     QSTQMIIGASPESDFQILKLSQGLYKKMNLKRVYYSAFIPVNEDSRLPVLASPPLLRE
                     HRLYQADWLLRFYGFTAEEILSDEAPNLDETFDPKTAWALRNPGFFPVEINRADYSVL
                     LRVPGIGVTSARRIVAARRFASITPEGMKKIGVVMKRAKYFITCSGRPFENTDRQPAL
                     LKSRLLLAGGVAPEPPKQLVLPGLFA"
     gene            341454..342191
                     /locus_tag="CPHA266_RS01580"
                     /old_locus_tag="Cpha266_0307"
     CDS             341454..342191
                     /locus_tag="CPHA266_RS01580"
                     /old_locus_tag="Cpha266_0307"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744205.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744205.1"
                     /db_xref="GI:500064288"
                     /translation="MNSYLYDGTPEGLLSAAFRIIADVSDPEKATLAERRDTLFEEGE
                     FIGTDAVAAEKLFKRLRLEAPDAAYIFYYFTLAEKEGLETSLLRYLALALRHGDRVNG
                     NLIDPAVRDVVSVSRKAQRELHRMKGLVRFEKLRDGAYLARMEPDHNILQPLAVHFSR
                     RLRAEDWFIYDVRRRFAARWHCGNLQFGTIEQFTAPALSEEEMRIQALWQAFFKTIAI
                     SDRKNPGLQKSNMPMKYWKYLTEKQGE"
     gene            complement(342385..343239)
                     /locus_tag="CPHA266_RS01585"
                     /old_locus_tag="Cpha266_0308"
     CDS             complement(342385..343239)
                     /locus_tag="CPHA266_RS01585"
                     /old_locus_tag="Cpha266_0308"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744206.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase"
                     /protein_id="WP_011744206.1"
                     /db_xref="GI:500064289"
                     /translation="MQQRSTTITILADNCAAPGLKTEHGLSFFIEKEDITILFDTACD
                     NTLLYNAGALGVDLSQTELLVLSHGHYDHTGGVAEVLFLAPNANIYLHPAAFQERYSI
                     RNGTAKPTSMPDHARSAIINLPQQQIHRVSKPTMLCSGIGITGPIPRLTSYENPGGPF
                     FLDTTGKQPDPIDDDLSLWIESENGLIIVTGCCHAGLINTIRSIVEHTGEKRIAALIG
                     GFHLSAASTERLEKTVKELKEYDIRQIVPCHCTGKNATEYLAQFLGCPVEAGYAGLKL
                     EFQNPPQV"
     gene            complement(343261..343833)
                     /locus_tag="CPHA266_RS01590"
                     /old_locus_tag="Cpha266_0309"
     CDS             complement(343261..343833)
                     /locus_tag="CPHA266_RS01590"
                     /old_locus_tag="Cpha266_0309"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744207.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011744207.1"
                     /db_xref="GI:500064290"
                     /translation="MNRIKGVLGGMFTLFCTVSFAQAATPYASASAGVAILGTSKTET
                     MPETSMSYDPGYALTGAIGLEKGKIRFEGEVGYQKNGLKNTADTDVSIMTYMANGYVD
                     FKLPLSPVTPYVTAGAGVAGVKADGFGFDDDSSTVLAGQVGAGAGFSVAPFVKIDLKY
                     RYFMASDAEFDHEKFSIDSHNVMLGIRVGL"
     gene            344055..344348
                     /locus_tag="CPHA266_RS01595"
                     /old_locus_tag="Cpha266_0310"
     CDS             344055..344348
                     /locus_tag="CPHA266_RS01595"
                     /old_locus_tag="Cpha266_0310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012504916.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C-type cytochrome, putative"
                     /protein_id="WP_011744208.1"
                     /db_xref="GI:500064291"
                     /translation="MMLCLSVAVSVPVFADKAPSSLQGKKLFNSSSLGGAANTKTCNA
                     CHPGGRGLESAGGNPELSKVINTCIAGPLNGSKLEPNSIEMQSLLLYIKSLKQ"
     gene            344364..345188
                     /locus_tag="CPHA266_RS01600"
                     /old_locus_tag="Cpha266_0311"
     CDS             344364..345188
                     /locus_tag="CPHA266_RS01600"
                     /old_locus_tag="Cpha266_0311"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744209.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="epimerase"
                     /protein_id="WP_011744209.1"
                     /db_xref="GI:500064292"
                     /translation="MQKETISILGCGWLGMPLAKALIAQDYPVKGSTTNEDNLEAMRD
                     AGIEPYLVWLDPEVNGEDITDFLQSDILIVNIPPERRDDIVEYHIEQFSSLIDALGQS
                     PVRSVLFVSSTSVYPALQREVTEEDSVEPEALSGQALLHVEEMLMQETGFQTTVVRFG
                     GLIGYDRNPEKNLARMTELKDPDQPMNLIHRDDCVRIIMEIIRLQQWGEVFNACCPVH
                     PLKRDYYRRAAEVSGIPLPSLCSSEAPSPYKLVNSDKLQGALNYTFIYPDPVAQLG"
     gene            345213..346583
                     /locus_tag="CPHA266_RS01605"
                     /old_locus_tag="Cpha266_0312"
     CDS             345213..346583
                     /locus_tag="CPHA266_RS01605"
                     /old_locus_tag="Cpha266_0312"
                     /EC_number="6.3.5.9"
                     /EC_number="6.3.5.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744210.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobyrinic acid a,c-diamide synthase"
                     /protein_id="WP_011744210.1"
                     /db_xref="GI:500064293"
                     /translation="MEKLDLCKKKPAFMLAAPSSGSGKTTLTLALLRILARRGYRVQP
                     FKCGPDYLDTRLHSLAASYGSMVSDGINLDTFMASESHVKELFSRYSCGSDASVVEGV
                     MGLFDGAEKARGSSAEIAKLLGIPVIMVVNAQSMAYSAAPLLYGYRTFDPDVHLVGVI
                     FNQVNTPSHYRYLEEAAFDAGVDPLGYVPRHEPIVISERHLGLNTSSSYDRQGAIEAM
                     ADHIEKSVAVDRLLELVGRDRESFSGSTSLDFHQRERGEKVIAVARDEAFNFTYLENL
                     DVLSQFGRIEFFSPMEDGRLPACDLLYLAGGYPELYAETLSSNSEMRRAIAAYCLGGG
                     AAYAECGGMMYLGAAMTLGDGLRYPMCGVLDLDTTMQDSRLTLGYRKVRLDTGYTKEL
                     RGHEFHYSRIERSGELHTIASITNARDEATETLLFRRQNTFASYLHLYWGETRDFPAF
                     LLNRES"
     gene            346590..347165
                     /locus_tag="CPHA266_RS01610"
                     /old_locus_tag="Cpha266_0313"
     CDS             346590..347165
                     /locus_tag="CPHA266_RS01610"
                     /old_locus_tag="Cpha266_0313"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744211.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744211.1"
                     /db_xref="GI:500064294"
                     /translation="MNSSGYIITGGPGSGKSTLLEAMRDAGYCCFSEVSRQLIRQQSL
                     LADGVLPWNNLPAFARLAFDAMMRQHDQAIDHDGICFFDRGIPDVFGYLEEGGHPVPA
                     CYIDAHERCRYEKNVIVLPPWKEIFTNDSERPQSFQQSVRLYRSICSVYERLGYTLHE
                     LPKSSVNERVRYLLKHFTELQAPARQQFYLH"
     gene            347331..347825
                     /locus_tag="CPHA266_RS01615"
                     /old_locus_tag="Cpha266_0314"
     CDS             347331..347825
                     /locus_tag="CPHA266_RS01615"
                     /old_locus_tag="Cpha266_0314"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744212.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fur family transcriptional regulator"
                     /protein_id="WP_011744212.1"
                     /db_xref="GI:500064295"
                     /translation="MADISLQTKKETSDKTRQAESLFKSFMKEQGLRCTTERIAVLRE
                     LYRSNTHLDADEIFIRLKKKQVGISRATVYHTLNLLFKFHLVSKIDLGHKHTHYEKSH
                     GVTNHLHIICEKCGNVVEVSESGLSELLDRVCRENGFELGSFSLQVFGKCVGNCDENC
                     PKQK"
     gene            complement(347869..348480)
                     /locus_tag="CPHA266_RS01620"
                     /old_locus_tag="Cpha266_0315"
     CDS             complement(347869..348480)
                     /locus_tag="CPHA266_RS01620"
                     /old_locus_tag="Cpha266_0315"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744213.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744213.1"
                     /db_xref="GI:500064296"
                     /translation="MQQRFSKNQEQKLSNWRRRLNTQKKSEVLFEHWLFMHTAAVLFA
                     GKPGELLILKRGLFGLLPEETLESIDSFCSSLALQFNVLLENEHSIKVIFYNEVAVDR
                     RIGCIPKKILHCNLRYPFGLRSESFLKELGRRWLESGTTPHEIGIVLGYPLKDVWGFM
                     GISSDPCSGSCGWRIYGNPLPSLKKRTLYNHARTRAETYLRAA"
     gene            348685..349698
                     /locus_tag="CPHA266_RS01625"
                     /old_locus_tag="Cpha266_0316"
     CDS             348685..349698
                     /locus_tag="CPHA266_RS01625"
                     /old_locus_tag="Cpha266_0316"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744214.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744214.1"
                     /db_xref="GI:500064297"
                     /translation="MNVLLKSTALVGISLVCSSGLFAAEESRQSAALEPALFKGLSFS
                     GLLEVEGAYGESDGESSSDLSLATVELGLEAKVTDWLSARILLLYEQNGDDRILVDEA
                     SIRVQRDNSPFFVQAGRFTQSFGNFATGMISDPITLELGETKHHASLQAGYEGEIVSA
                     SFSFFKGDVQKEGMDEVNSFVGALSIGGEVNERFRYELGGSYCSNMADTDGLQDDFEP
                     DLYRTADYVGGYSVYGLLGFGSVEVRAEYLAAAESFVDGERSGLKPAAYNVEVGCDLP
                     ESLHLALRYAGAEDFNVEKQYGATLACDLSEKATLALEYLHNSNDDETSSDAVTVQLA
                     MSF"
     gene            349731..350033
                     /locus_tag="CPHA266_RS01630"
                     /old_locus_tag="Cpha266_0317"
     CDS             349731..350033
                     /locus_tag="CPHA266_RS01630"
                     /old_locus_tag="Cpha266_0317"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010933405.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467471.1"
                     /db_xref="GI:752831169"
                     /translation="MVPLGFLLQGESAEIVGFRSGREKEHRGFRHGSGAGHGRAHRCA
                     EITKEQRLVEMGFCPGEVIEVLQSKAGGLLLLKLRDSRLALDKQIAMDIIVRRVTA"
     gene            350030..350257
                     /locus_tag="CPHA266_RS01635"
                     /old_locus_tag="Cpha266_0318"
     CDS             350030..350257
                     /locus_tag="CPHA266_RS01635"
                     /old_locus_tag="Cpha266_0318"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744216.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron transporter FeoA"
                     /protein_id="WP_011744216.1"
                     /db_xref="GI:500064299"
                     /translation="MNLSELKKGQAGRVVKLSAVPQLRRRLLDMGVLVGEMIRVVGVA
                     PLGDPVEVTVKNYKLSLRKKEVEGVIVEEVS"
     gene            350257..350436
                     /locus_tag="CPHA266_RS01640"
                     /old_locus_tag="Cpha266_0319"
     CDS             350257..350436
                     /locus_tag="CPHA266_RS01640"
                     /old_locus_tag="Cpha266_0319"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="Fe2+ transport system protein B-like"
                     /protein_id="WP_011744217.1"
                     /db_xref="GI:500064300"
                     /translation="MQVTETAGELVKPEKIIGKPSVIAVVGNPNSGKTTLFNALTGMN
                     QRVGNWPGVINPAIK"
     gene            350470..351522
                     /locus_tag="CPHA266_RS01645"
                     /old_locus_tag="Cpha266_0320"
     CDS             350470..351522
                     /locus_tag="CPHA266_RS01645"
                     /old_locus_tag="Cpha266_0320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020877410.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_011744218.1"
                     /db_xref="GI:500064301"
                     /translation="MMKNDARSYTSDQQKLLRIKAVDMVFREGFTQRATAKALGVSRQ
                     HVVKWCKAFSSGSYEALELGRRGRRPGEQMLLQPWQCAVIFNTIRDKTPDQLKMPFVL
                     WERIGVRELIKKKFGITLALRTVGEYLKRWGMTPQRPIERAYERSSQAVENWLNNDYP
                     AIQKKAEEEGATILWGDETGVQNTSNVGRSYSPSGKTPVIRQSEKKIKTNMISAITNR
                     GKVRFMIYPGKMNQQMFIRFLERVIATIPGKVLFIVDNLKVHHGKKVAEWVTEHIGRI
                     ELFYIPSYSPDLNPDEYLNRDLKKNVNSRAIPRTEVELKMNLLSFMRKLQKLPDRVMS
                     YFNSSPIKYAARAEAV"
     gene            <351488..353752
                     /locus_tag="CPHA266_RS01650"
                     /old_locus_tag="Cpha266_0321"
     CDS             <351488..353752
                     /locus_tag="CPHA266_RS01650"
                     /old_locus_tag="Cpha266_0321"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744219.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467472.1"
                     /db_xref="GI:752831170"
                     /translation="RSSMLLVPKRCNVFDCRINTVDKKTGFFTHNGRHYELVDLPGIY
                     SLSALSQDEEIAREFILEGQADLIINIVDASNPDRNLYLTSRLLEMKVPVLIALNMMD
                     AAKGRGIAFDIARLSSRIGCRIVPLVASRKDGVAELKDAIEEEICLKSFKGCRVTYPA
                     CIEKSIRELSTDIRRFAEDAHYDPDWFALKLLEGDHLLESLIPVSEKDRVVGYRSEIA
                     DTLGDDPDILVADAHYRFINELSSESIRRTSEKGESLSDRIDRVVLNRFAGIPIFLAV
                     MYLMFLFTINLGGAFIDFFDIAAGALFVDGFGELLHLSGSPEWLTAILATGLGGALQT
                     IATFIPPIGFMFIALSLLEDSGYMARAAYVMDRGMRAIGLPGRAFIPLLVGFGCNIPA
                     IMSARTMSDERDRILTIMMVPFMSCGARLPVYVLFAAAFFPSGGQNLVFLLYLIGVAV
                     AVLTGFILKSTLLKGDISPFIMEMPAYHIPTVKGVFMRVWDRLNSFLVRAGRVLVPVI
                     MVLGLMNSLGTDGTFGNEDSENSMLAVTGKAIAPVFVPMGISEDNWPATVGLFTGIFA
                     KEAVVGTLNSLYAGMGRTAAAVEGVSEESDLNLMERFGEAFRTIPENISAITGSLLDP
                     LGISVGDVSDRAGVAEEQGVEVTIFGTMAALFDGTAGAFAYLLFVLLYFPCVAAIAAV
                     YRETNLAWTLFAGAWTTGLAYILAVIAYQAPTYSSHPVSSAVWIAAMVGILAAAVVVM
                     YLLGSRGFRKKTGV"
     gene            353822..354046
                     /locus_tag="CPHA266_RS01655"
     CDS             353822..354046
                     /locus_tag="CPHA266_RS01655"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744220.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467144.1"
                     /db_xref="GI:752830842"
                     /translation="MTLTDLKGFIQERRRVSLSEIAGYFKADMAMIESMLDHWIRKGR
                     VQVKQADAFSASCCGKCGGHKQVWYTWVDG"
     gene            354158..354511
                     /locus_tag="CPHA266_RS01660"
                     /old_locus_tag="Cpha266_0323"
     CDS             354158..354511
                     /locus_tag="CPHA266_RS01660"
                     /old_locus_tag="Cpha266_0323"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744221.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744221.1"
                     /db_xref="GI:500064304"
                     /translation="MNGNEKKRGRCSARCVVNKCSCGAFHLHYRYAVVIIGKQTLFQI
                     MEDCYRWEELNVGMSEGWCTKPFVVMLGIVTITVPQVDFEEFSKAIQDAVSLELDLPG
                     IAGGLLSFPGSSASK"
     gene            354556..355062
                     /locus_tag="CPHA266_RS01665"
                     /old_locus_tag="Cpha266_0324"
     CDS             354556..355062
                     /locus_tag="CPHA266_RS01665"
                     /old_locus_tag="Cpha266_0324"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744222.1"
                     /note="An electron-transfer protein; flavodoxin binds one
                     FMN molecule, which serves as a redox-active prosthetic
                     group; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flavodoxin"
                     /protein_id="WP_011744222.1"
                     /db_xref="GI:500064305"
                     /translation="MKRIGLFWGSQTGNTELAATLIVEAIGSDIVQSYDIRGVDSGTF
                     GSYDSLILGTSTWGAGELQDDWDSFLPQFDAIDFIGKKVALFGLGDQLGYGDYFLDGM
                     GILYENLIGRGAKVTGSWSVDGYEHSYSRAIQYGAFVGLALDADNQNHLTPVRIKQWV
                     DQILPILL"
     gene            355315..356934
                     /locus_tag="CPHA266_RS01670"
                     /old_locus_tag="Cpha266_0325"
     CDS             355315..356934
                     /locus_tag="CPHA266_RS01670"
                     /old_locus_tag="Cpha266_0325"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004320073.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467145.1"
                     /db_xref="GI:752830843"
                     /translation="MQIVASERIGDKVKQRIVRYVGIAMNDEELVKMKELAEFIKAGL
                     EAESAPTLFRPDELARMAIEGRKTADLSSDQPLTVDLKLLREESRVVVGIHEIYGKLF
                     DELGFDRVLGNPARRVQAAKTIKHLVLARIANPASKRKSVIDLERDFGVKLDLSAVYR
                     TLDYVDEQSIELIQKKAWEAATGLFGEKIDVVFYDCTTLYFESFTDDELRDKGLSKEN
                     KHSEVQVLLAMMVSKHGFPLGYRLYNGATWEGHTLKDAIEQIKGMAEVDRVVFVADSG
                     LLSKENLALIEQSEKQYIVAARLKNQPETIKEQILDKAGYQQGEQIRFKEIPLPENRR
                     LLVSYSEKRARKDAFDRQKALDKLQKKLNKSKNPESFLKNTSYRKYVKIEQLSQQTVI
                     IDEEKISYTAQWDGLHGVITNITDITASDAFEHYRGLWQIEETFRLTKHDLKVRPIYH
                     WTPRRIEAHVAMCFMALVCIRHLSYRVQLQYQALSPEIIRNELVHVQQSILMHKTNGC
                     RYGIPSKPTLHAQKIYQVMGEKLSATPFLIQ"
     gene            <357029..357337
                     /locus_tag="CPHA266_RS01675"
     CDS             <357029..357337
                     /locus_tag="CPHA266_RS01675"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744222.1"
                     /exception="unextendable partial coding region"
                     /note="An electron-transfer protein; flavodoxin binds one
                     FMN molecule, which serves as a redox-active prosthetic
                     group; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flavodoxin FldA"
                     /protein_id="WP_041467473.1"
                     /db_xref="GI:752831171"
                     /translation="DSFLPQFDAIDFIGKKVALFGLGDQLGYGDYFLDGMGILYENLI
                     GRGAKVTGSWSVDGYEHSYSRAIQYGAFVGLALDADNQNHLTPVRIKQWVDQILPILL
                     "
     gene            357376..>357705
                     /locus_tag="CPHA266_RS01680"
     CDS             357376..>357705
                     /locus_tag="CPHA266_RS01680"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010933401.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferritin"
                     /protein_id="WP_041467474.1"
                     /db_xref="GI:752831172"
                     /translation="MLSRTILEKLNKQVNLEAYSAHLYLQMSAWLLSQSLDNTALFFR
                     QHAEEEKVHMMKLFDYINETGSLALIGSIEAPRKTGFASLIALLDDAWQHECAITECI
                     NKLVETAF"
     gene            357832..359403
                     /locus_tag="CPHA266_RS01685"
                     /old_locus_tag="Cpha266_0328"
     CDS             357832..359403
                     /locus_tag="CPHA266_RS01685"
                     /old_locus_tag="Cpha266_0328"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011745977.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_011743927.1"
                     /db_xref="GI:500064010"
                     /translation="MRTQLKKLTMYNKVKEFAREGLSIRQISRKTGMDRVTVRKFLRM
                     TDEEFSAFLALQKRRLRKLQPYEQFVKDRVTDYPDCSATQVEDWLKEHHPVFPEVTTR
                     TIYSFVQWIRKAYDLPKPKGTPRAYHPVEQLPYGEQAQVDFGEYWMASADACKVKVHF
                     MIMLLSRSRRKFVSFSQQPITTRFVLEAHEQAFSFFEGIPHTLVYDQDSTIVTDENRG
                     AILYTEAFRKYLLHRSLKIHLCRKSDPESKGKIEAGVKYVKYNFLPGRRFVNLEVLNQ
                     EALLWLERTANAKEHATTRLIPDAEWQVEKQHLRPFEPLPYPISGTVGKEYHVRKDNT
                     ISYRGNFYSLPVGTYAGPGTLVVLEVRQNTLCLYAQEGRLLANHPIESGKGTVVINNN
                     HRRDTSSKLRELQDSLMLLFTNQEHAERFLESIHNRYPRYSRDQFLHVRNAISGCQQK
                     LIDDALAHCVDHHLFSSGEFHDILHHYRKQEEKQSHQAVFNTFRPKTLRSDMDRMLSF
                     VPDSSGITTYENIFS"
     gene            359409..360245
                     /locus_tag="CPHA266_RS01690"
                     /old_locus_tag="Cpha266_0329"
     CDS             359409..360245
                     /locus_tag="CPHA266_RS01690"
                     /old_locus_tag="Cpha266_0329"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743928.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_011743928.1"
                     /db_xref="GI:500064011"
                     /translation="MERTITTIQEHARELNLTGLAGTVDLLLEEARKSEPSYSDFALT
                     LLESELSCRRKAHLERRRKIANLPLLHDLDHYDSGVQNGISQVQLQQLRQLLWLDQNF
                     NLILIGPSGTGKSYLAGGLCHEALKLGYHALFRTMDDLIQTIRFKEITAAAAREYKRL
                     LSAHLLVIDDIMMFPLEKSVAVGLFQLVNQLHEQTSFIITTNKSPKEWAEMLGDEVLA
                     TALLDRLLYKCEVIKLTGKSYRLEHRTTIFEQQQSPEGGGNRRKKQLPLQKGVGNHCK
                     MT"
     gene            360566..361108
                     /locus_tag="CPHA266_RS01695"
                     /old_locus_tag="Cpha266_0331"
     CDS             360566..361108
                     /locus_tag="CPHA266_RS01695"
                     /old_locus_tag="Cpha266_0331"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744224.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_011744224.1"
                     /db_xref="GI:500064307"
                     /translation="MKTSILNRNGITPEIAGLITRLVTLIPWPARRQAMGDVVLTILD
                     GKPRVAENEFGWNRSAVALGIKEYESGIVCVNDLTERHKPKSEEKYPELLASIRKIME
                     PHSQAEPRLRTTLLYTNMTAQSVYNALLAEGWSEESLPAVRTISNILNRQKYRLRTVQ
                     KTKVEKKQQKQMPSSTTSGK"
     gene            361150..361797
                     /locus_tag="CPHA266_RS01700"
                     /old_locus_tag="Cpha266_0332"
     CDS             361150..361797
                     /locus_tag="CPHA266_RS01700"
                     /old_locus_tag="Cpha266_0332"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744225.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_041467475.1"
                     /db_xref="GI:752831173"
                     /translation="MDTKATVLVGQYSRGGKSRGTEAVKAWDHDMRPREKLVPGGILE
                     PVSGKSFLFFGSSNKTSDFLVDGLELWWEERKSSLSHVKQLVINMDNGPECNGRRSQF
                     LYRMTVFADMSGLDIRLIYYPPYHSKYNSIERYWAGLEKSWNGYLLESVTTVINRAKS
                     FTWRGIAATAMLIDTVYQKGIKLCGKEKKQMEKRLMRSKDLQWWDISIRPEMVFL"
     gene            complement(361923..362387)
                     /locus_tag="CPHA266_RS01705"
                     /old_locus_tag="Cpha266_0333"
     CDS             complement(361923..362387)
                     /locus_tag="CPHA266_RS01705"
                     /old_locus_tag="Cpha266_0333"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744226.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744226.1"
                     /db_xref="GI:500064309"
                     /translation="MNVHHILLDDNNPEHRELSICRTGTINRINLNDSKYQVYASFCI
                     DAHNYAALFHYGIIEAMNELHFISESGNGLDSWDEAFLHHSALSALLPIIRRCCESID
                     PQKKETILLGWQNQPVGVAWLRMIDPVKTAGFLRDFDTFIVESEGFDLEFIL"
     gene            362562..365126
                     /locus_tag="CPHA266_RS01710"
                     /old_locus_tag="Cpha266_0334"
     CDS             362562..365126
                     /locus_tag="CPHA266_RS01710"
                     /old_locus_tag="Cpha266_0334"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744227.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent Clp protease ClpC"
                     /protein_id="WP_011744227.1"
                     /db_xref="GI:500064310"
                     /translation="MEGNFSNRVQDVIRLSREEALRLGHDYIGTEHLLLGLIREGEGI
                     AARILKNLKIDLYRLKQKIEDSTHPKVPATQMGNVPLTKQAEKVLKITYLEAKICKSN
                     IIGTEHLLLSILKGEDNIASQILEQFGVSYDMVRDELLSITSGGTESDEPPAEGYASS
                     GGSERSAKKADPKRGERTKTPVLDNFGRDITRLALDDKLDPIIGREKEIERVAQVLSR
                     RKKNNPVLIGEPGVGKTAIAEGLALKIVQRKVSRVLYDKRVVALDLAALVAGTKYRGQ
                     FEERMKALMNELERSRDVILFIDELHTIIGAGGASGSLDASNIFKPALARGELQCIGA
                     TTLDEYRQYIEKDGALDRRFQKIMVEPATVDETILILNNIKSKYEVHHHVRYSEDAIE
                     KAVKLSERYITDRFLPDKAIDVMDEAGARVHLSNIHVPDEILELEKSIEAIKTEKNQV
                     VKMQNFEEAAKLRDKEKHLLESLDHAKQEWEDRAAESVYDVTETDITSVIAMMTGIPV
                     ARVAQSESKKLLSMEADLMKEVIGQDEAIKKITKAIQRTRAGLKDPSRPIGSFIFLGP
                     TGVGKTELAKALTRYIFDTEDALIRADMSEYMEKFSVSRLVGAPPGYVGYEEGGQLTE
                     KVRRKPYSVVLIDEIEKAHPDVFNILLQVLDEGVLTDGLGRKVDFRNTIIIMTSNIGA
                     KDIKSFGAGSGMGFTAPDDASGSYKAMKSTIEDALKRVFNPEFLNRIDDIVVFHPLEK
                     QHIFKIIDITAGKLFKRLREMGIEVEIDEKAKEFLVDKGYDQKYGARPLKRALQKYVE
                     DPLAEEMLKGRFIEGSTIRILFDEDEGELRFIDGEPATKKRKRDEKLDKEVPDPNS"
     gene            complement(365166..366539)
                     /locus_tag="CPHA266_RS01715"
                     /old_locus_tag="Cpha266_0335"
     CDS             complement(365166..366539)
                     /locus_tag="CPHA266_RS01715"
                     /old_locus_tag="Cpha266_0335"
                     /EC_number="4.2.1.20"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744228.1"
                     /note="catalyzes the formation of L-tryptophan from indole
                     and L-serine; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan synthase subunit beta"
                     /protein_id="WP_011744228.1"
                     /db_xref="GI:500064311"
                     /translation="MGTDLTKIILDEHEMPRQWYNIQADLPVPLPPPVGMDGTPISPD
                     DLAQVFPMNLIEQEMSTERWIDIPEEVLSILKLWRPSPLYRAKRLEKALGTPAKIFYK
                     NEGVSPAGSHKPNTAVPQAWYNKQFGIKYLTTETGAGQWGSALAMSCKLIGIECKVFM
                     VRISFDQKPFRKIMMKTWGAECIASPSRETAIGRRILEEMPDTPGSLGIAISEAIEQA
                     VEREDTRYALGSVLNHVMLHQSIIGLEAQKQFEKIGLYPDVVIGCAGGGSNFAGISFP
                     FICDKIHGKDIQIIATEPEACPTLTKGPYIYDSGDVALMTPLLAMHSLGHGFIPPAIH
                     AGGLRYHGMAPLVSHVKQLGLIEATALPQTECYEAALLFAHTEGFIPAPETSHAIAQT
                     IREAKKAKEEGKERVILMNWSGHGLMDLQGYDAFLSGKLSDYALPDELLQQSLAAVRN
                     HPKPPGA"
     gene            complement(366885..366973)
                     /locus_tag="CPHA266_RS01720"
                     /old_locus_tag="Cpha266_R0008"
     tRNA            complement(366885..366973)
                     /locus_tag="CPHA266_RS01720"
                     /old_locus_tag="Cpha266_R0008"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(366937..366939),aa:Leu,seq:taa)
     gene            complement(367091..368158)
                     /locus_tag="CPHA266_RS01725"
                     /old_locus_tag="Cpha266_0336"
     CDS             complement(367091..368158)
                     /locus_tag="CPHA266_RS01725"
                     /old_locus_tag="Cpha266_0336"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744229.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine-monophosphate kinase"
                     /protein_id="WP_011744229.1"
                     /db_xref="GI:500064312"
                     /translation="MPYKAISDLGEFGLIDRISSLVGPTLDASPNLLTGIGDDCAVYQ
                     PTAGMLEVTTTDLLVEKVHFDLLTTPLKHLGSKSISVNVSDICAMNATPQYALIGIAV
                     PPSFSVEMIEELYKGMSHAARIYGVAIAGGDTSVSRSGLFISVTMTGEVSGERLTRRS
                     GAKPGEMICVTGTLGGAAAGLRLLMREKNIMLEHIEHHEPYNKSLMVDLEEYADAIKE
                     QLLPAARIDIIRFFHSRNINPTAMIDISDGLSSDLRHLCNSSGTGAVIHEGRIPVHSG
                     ARRIADELRDDALGWSLTGGEDYQLLFTLPKERFPDIAEHDDISIIGEITEKDAGISL
                     VDIYGMSIDLEKLPGYDHFRS"
     gene            368262..369212
                     /locus_tag="CPHA266_RS01730"
                     /old_locus_tag="Cpha266_0337"
     CDS             368262..369212
                     /locus_tag="CPHA266_RS01730"
                     /old_locus_tag="Cpha266_0337"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744230.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsY"
                     /protein_id="WP_011744230.1"
                     /db_xref="GI:500064313"
                     /translation="MGFFDKFKLSRLKEGLSKTSETFREKLSLITQGKTEIDEEFLEE
                     LEHILVGADVGVETTLSIVDAITERAKRESYRSAEELNRMLMEEIQQMLLDSGEHYPI
                     DFDAPLSAKPYVILVVGVNGAGKTTSVAKLAYNYEKAGKKVIIAAADTFRAAAYEQLK
                     IWADRAGVPLIGQGQGADPASVVYDAVSSAVSRNSDVVLVDTAGRLHNKSHLMEELAK
                     IMRVAKKKIPEAPHEVLLVLDGTTGQNAVSQAREFTRFVNVTGLVLTKLDGTSKGGIV
                     LSISRELNLPVKYIGVGEKIDDLQLFDRARFVEALLGRQE"
     gene            complement(369215..369784)
                     /locus_tag="CPHA266_RS01735"
                     /old_locus_tag="Cpha266_0338"
     CDS             complement(369215..369784)
                     /locus_tag="CPHA266_RS01735"
                     /old_locus_tag="Cpha266_0338"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012509244.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744231.1"
                     /db_xref="GI:500064314"
                     /translation="MPPDQFTIFGDNYPRGSYILFLKVSKPIRLSFGKFQGGRLLDVP
                     KGEYLYIGSALGSGKADKPLAQRLVRHASRSGNNKPQPIQKTLRLLFEPEASCKKAGT
                     TLHKKMHWHIDYLLDCPETEITHIVVVQSPLRLEPLLCNFISSLDTVEPLAKRLGAQD
                     TKNSTHLLKIADSEQLLLIIKNKIPELIA"
     gene            369907..370557
                     /locus_tag="CPHA266_RS01740"
                     /old_locus_tag="Cpha266_0339"
     CDS             369907..370557
                     /locus_tag="CPHA266_RS01740"
                     /old_locus_tag="Cpha266_0339"
                     /EC_number="2.1.1.77"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BDC1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein-L-isoaspartate O-methyltransferase"
                     /protein_id="WP_011744232.1"
                     /db_xref="GI:500064315"
                     /translation="MDSNSRLMTFRRREMVEKLKLSGIADNRVLAAFLSVERHRFFDK
                     ESQEYAYADGAYPIGYGQTISQPYTVACMTSLLVERSPSGKVLEIGTGSGYQAAILYA
                     LGYRVYTIERVVELSEKAEKLFSALGFSIMCRSGDGTLGWPEEAPFDGIMVTAGAPHC
                     PETLLHQLALDGSLVVPIGAHGLQKMTVFQRKKDRFEKEVFSDFAFVPLIGREGWG"
     gene            370590..372692
                     /locus_tag="CPHA266_RS01745"
                     /old_locus_tag="Cpha266_0340"
     CDS             370590..372692
                     /locus_tag="CPHA266_RS01745"
                     /old_locus_tag="Cpha266_0340"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744233.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="WP_011744233.1"
                     /db_xref="GI:500064316"
                     /translation="MAVMTSLRDKTHIILYALLAAFLALIVFEWGMNFSGFSGKKRDI
                     AGKVNGKDISAAQYEEVYNEISGNFRRTNPGAEITPVTELEFRQQAWNIVVDQTLLEE
                     QFAKFGITVQDQEVVESLDSPEPPMIIRQNFSDSTGSIDRKKLDVARRDPKNKDLWLQ
                     LEKMVQRELKVNKLIRALQPMVRVTGRELDDIVRRNFGRFSASFVPVPLSFAGTDTSF
                     PVKEDEIQKYYNEHKELLKQLPSRSADYVFFPLTPSSKDSSSVRSELESLRSEFSAAV
                     NDTDYVKVQSDRPNGVNVLYNRANFSLPAGSIVFSPANLKAGAIVGPVADRGEYRLLK
                     IKEVRTAQPIARASHILLRFNPGNKEEVEKVRERMVMIFKNLQAGVPFETLAGKYSED
                     PGSAVQGGDLGWFTRESMLPEFSAAVFSGTPGAVVKPVQTKFGLHIIKVTGFDQTAVI
                     ASEIVRTIRPSTETVDSARRLAMAFQMQAKDKGLEKSASTEKLVVGKTGDFGKHTLIA
                     DIGFSDKITAFAFNGKEGALSDVIETEKGFYVMKLTGVNDTGYRRLDADLKKRITAEL
                     VRLKKEPVLEKKLSLNAKQSGATLDKIAAAYPGTVVVTADDIRWVDGFIPGYGFDQPL
                     VEAMSAMTEGKLSGPVKTNDGYAIVLLSKKNMPAERDVEAAKTAFTPKIIQDKLNRLF
                     TEYFATIKKNAVIEDLRP"
     gene            complement(372862..>374574)
                     /locus_tag="CPHA266_RS01750"
                     /old_locus_tag="Cpha266_0341"
     CDS             complement(372862..>374574)
                     /locus_tag="CPHA266_RS01750"
                     /old_locus_tag="Cpha266_0341"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744234.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate-protein phosphotransferase"
                     /protein_id="WP_041467476.1"
                     /db_xref="GI:752831174"
                     /translation="EATFNGIGTSRGIAIGECYAYEKEQYEHEITSLDNDNIEAEIER
                     FIEAVHRSEKELKKIERVTTRKLGKGYANIFQAQIMMLQDPMLIDSISLRIRSEMIPA
                     HLVIEEEFGHYHEKFKSSDDVVFQERADDFFDIKNRILRNLHVRKMLSWIPEGTIVVS
                     DHFCPGDIILLSRSNVKGFLSDSGGKTSHISLICKSLNIPMVAGLGNFSQNAVSGTQM
                     IIDGSSGTVIIHPEEKTIQLYQEKQKAEKQSNADASLTATLPASTKCGVRINFFSNID
                     FKEELLGLKETGSEGIGLFRSENLFIDGTKVPGESEQYHYYREMSETVAPQPFVVRLF
                     DIGGDKLIYSPIREPNPNLGWRGIRILIDVPEILENQLRAVIRANALGNINILIPMIT
                     SLDEIMTICAMVDRLHAEVIEQTGVAGEKPELGAMIEVPAAVEIIDEITKCVDFISLG
                     TNDLTQYTLAVDRNNVIVQDLFEKFHPAIIRQLHRVIATAQKNHCRVALCGDMGSDPL
                     ALPFLIGCGLRKFSVVSADIANLKRFVSRYSVAETEALALECIKLDSAQKIKACLETF
                     QAEH"
     gene            complement(374682..376214)
                     /locus_tag="CPHA266_RS01755"
                     /old_locus_tag="Cpha266_0342"
     CDS             complement(374682..376214)
                     /locus_tag="CPHA266_RS01755"
                     /old_locus_tag="Cpha266_0342"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744235.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA helicase"
                     /protein_id="WP_011744235.1"
                     /db_xref="GI:500064318"
                     /translation="MIKPKADILDFSKDIDFNLEGRVPPYSTEIEQEVLACVLLEDDP
                     VEQVIQIFGDSAEEVFFERRHRLIFKSMMQLYNKRQAIDLITVSEELLKMNELDNIGG
                     RHYLAELSGKVISAANVEYYARLAKEKYLYRRMISISAKVSGAAYSSSMDIFDLVEHA
                     SQQFFNISQAGIKKKASPIKDLVKNGIRMLETLRASQSSITGVGSGFSDLDQFTAGFQ
                     SSDMIIIAARPSAGKTAFALALARNAAVDFNTPVLFFSLEMAEVQLAVRLMCAEAYVE
                     SQLVRTGRITPEMMSKIINSMDKLNEAKLFIDDTPGISIMELTAKTRRMKQEHNIGMV
                     VVDYLQLVTPVKDGKTNREQEIAQISRSLKALAKELNIPVIALAQLNRSVEQRSGDRR
                     PQLSDLRESGSIEQDADVVMFLSRPEMYNIQTFSDGSSTKNMVEVVIGKQRNGPIGDI
                     RILFLKQYGRFQSAATSYLSNTDEQNGGSANERNLPPEAPALQKTQMSANTFINADDA
                     PF"
     gene            complement(<376255..376872)
                     /locus_tag="CPHA266_RS01760"
                     /old_locus_tag="Cpha266_0343"
     CDS             complement(<376255..376872)
                     /locus_tag="CPHA266_RS01760"
                     /old_locus_tag="Cpha266_0343"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744236.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase"
                     /protein_id="WP_041467477.1"
                     /db_xref="GI:752831175"
                     /translation="MHPFLFSDHDDTLPSVQSEAGAPFRDLIGLSLAVKSCTKCRLSA
                     SRKNVVFGEGDPRAALVVIGEAPGADEDSQGRPFVGRSGQLLDKILQAVQFKREEVFI
                     CNILKCRPPQNRNPLADEIECCMPWLLLQLELLNPKLILLLGKVAANTILQNSLSMGA
                     MRGRIVKWKAYDCMVTYHPAALLRNPGWKKACWEDVQMMRQHYDKL"
     gene            complement(376893..378125)
                     /locus_tag="CPHA266_RS01765"
                     /old_locus_tag="Cpha266_0344"
     CDS             complement(376893..378125)
                     /locus_tag="CPHA266_RS01765"
                     /old_locus_tag="Cpha266_0344"
                     /EC_number="4.1.1.36"
                     /EC_number="6.3.2.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744237.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopantothenoylcysteine decarboxylase"
                     /protein_id="WP_011744237.1"
                     /db_xref="GI:500064320"
                     /translation="MLRGKNIIIAICGGIAAYKIPVLVRLLKKGGANVKVVLTASAAR
                     FVSELTLATVSQEQVYCSLFPPVERENVDYTRHISLGEWADIFVVAPATANTIAKLAA
                     GLCDDMLSACFLTLRPNKPVLLFPAMDGEMFTSSSVQRNLAMLLADGARIINPDSGEL
                     ASGQCGLGRMPEPEAIAALIEEELLKSCNKHSSLQGKSVVITAGPTREKIDDVRFISN
                     YSSGKMGFAIARAAAERGAKVTLLAGPVSLITPPLVERVDVESAKEMYDAARQLFETC
                     DVFVSAAAVADYRPDSPFQGKLKKNGEELSLTLRKNPDILAEFSKQKSPSQIAVGFAL
                     ECEDGLKNAIKKRIEKKLDLIALNFYDGKSSGFEVETNMLTLIGSDDTATVLPLLSKP
                     DAANRLLEAVEKLIQPDS"
     gene            complement(378181..382719)
                     /locus_tag="CPHA266_RS01770"
                     /old_locus_tag="Cpha266_0345"
     CDS             complement(378181..382719)
                     /locus_tag="CPHA266_RS01770"
                     /old_locus_tag="Cpha266_0345"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744238.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744238.1"
                     /db_xref="GI:500064321"
                     /translation="MEKSKKVFIGFLALLSAGVLLLSIVAAIVLNSGFLDRFAKDLAV
                     KLFNEEFYGHLELQKVKLNFPNKVTILSPRIYEPDEDLPALSADKVTLRFNFLTILKP
                     KIDKLSFRKIKVDSLLINVIERENGKRNIDLIFTSRKPDSTDAPIESFFSKVVTLRNS
                     SLNYSRTLPNETPLALTVQNISLDLNSLRLKIKKKEFGGTIEALALDIPQHSFRLKQG
                     SGQFFVSEKRADIIALKATSDKSNAELSLSLDKFNIFDPDQKKLLLAGKSFLDIQALN
                     IHTRDLNMIYPDIALPEGVYSLKGDARSQSNTIEIIKGVLAHNKSHLAVKGKLLNVQN
                     KNAFGYQLEIDSSKIDPDFFQAFFSDKNQKELIARIGAISFIGKAHGNLKELSTDVHI
                     LTKAGNASIKGEAAGEPGKQIKGKGAFSLEKTLPHLFTGTTTAKSMLNATGNFDGIVN
                     GSELAELHIESDLKDSFWQQQALKQGTLSLDYSRELVRAKAILQNGMESIDVSGQISW
                     KGGSADYQAEGKVARLNLAKSLASNDFVTDLNGVFALKGSGFDPASLNAALTARFSPS
                     SINNFRLRDKSELSAAVEQHAASSTVTLKSDFLDLAVQGNQSFKELLGAIELAGSGIS
                     GEIRTQSLWSSRPAGPRSDAFLSLKKPFTVSYRILVKDMEPLSPLLPFRDLALQGSAE
                     GQFFYENGRCALTSSLDLGSLAYGKAVALKKLSATAAMECSGNGIPKAAIKGKAASLV
                     FSGQTSNNLVFDATYSTGRLTASIDAGRFENDREFSTAFSLQRTGSAYDLGFTKLAIG
                     KGKNRWQTQGGSHIKIEKMAVQFNRFTIANGNQHLVLNGELSNSRPGSFQCNLSHLDL
                     AALGELSEKRLPSGMSGTIDASLTISGNPNTKTSTLSINGKSVGFDKIPLGNVQSNIR
                     HAGNKLSFDYKSFITEPVNKGNTTPSVNTIAGSGTMPLVLAYYPFELRIPQEQKIQAS
                     FRSDNLSARFLKVVLPFVEDAAGIMPTTLTVEGTTSRPEIYLLSRLRDTQIKLEATQV
                     TYLLNGDIQVTPRQLELRDLRIADLQNGTGSLNGLLKIENLKPKTITLGANLSKLLLF
                     HKKDTRDEKPFGTIIGSTRNLLLNGDISSPVVEGDITINSADFTMYRPGANESAKYIG
                     VEKFIEFVPRYPSQQSMVAQTDLDSDPVGFNYSLIDILQLKDLKIRSAEQLKFRVIFD
                     RTRGEELEAAISGMQLMVNKSQQRYRLFGSVALSDGKYRFSNTNFDLEDGGKIVWNNV
                     GIHEGIMQNLYGTKYISALSPETGDRDNVKLLLAISGTISEPNVEMGYYLNDQMQPFS
                     SKNLIGGKPSQIDPNAELNVISMLLTSQWYAPQGSSGLSKNLAVSSVGLSTGSGLISS
                     QLSRLVQNVAGFESFNVNLGMNSKGEISGIDLYMAVNVPGTNGKVRIIGEGSSHDVKN
                     KPLFNYYGTSQKVEYRVSPKVYIEAYRSYGQTENEAANTNLQSPTETWGASISYRERF
                     HTWDSFWKRIIPSSNKKK"
     gene            complement(382706..383209)
                     /locus_tag="CPHA266_RS01775"
                     /old_locus_tag="Cpha266_0346"
     CDS             complement(382706..383209)
                     /locus_tag="CPHA266_RS01775"
                     /old_locus_tag="Cpha266_0346"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744239.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-beta-D-heptose 1-phosphate
                     adenosyltransferase"
                     /protein_id="WP_041467478.1"
                     /db_xref="GI:752831176"
                     /translation="MNSKLLTRAKAKEQVIAWQSSGKKVVFSNGCFDILHAGHVQYLS
                     RARQLGDILLIGLNSDASIQRIKGPLRPVCAEQDRAAVLSALQMVDAITLFDEDTPEA
                     LIEALLPDILVKGADWDIERIAGAKAVLQSGGKVLTLPILEGRSTTGIIEKVIQIYGK
                     HTPRGKE"
     gene            383525..384421
                     /locus_tag="CPHA266_RS01780"
                     /old_locus_tag="Cpha266_0347"
     CDS             383525..384421
                     /locus_tag="CPHA266_RS01780"
                     /old_locus_tag="Cpha266_0347"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744240.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipid A biosynthesis acyltransferase"
                     /protein_id="WP_011744240.1"
                     /db_xref="GI:500064323"
                     /translation="MTDPSITNKQSSDRRIYKLFMLFSVLVRKMNRKTALFMADRLGD
                     LMFDILKIRKPLVEGNLSITFPEKSANEIRSIARRVYRNQARNFIEVLRLPLIASRED
                     AEELFDINASQLSDILQRSGVVLVSAHFGNWELLGFCAGIMVTPLTIVVKRLRNDDVD
                     RCINTWRTMKGNTVVKKSRALREGLKTLRNKGIVSFLADQSDPEGTFVTDFLGRPSSV
                     FLGPAYLALKTRVPLFVCMAYRKEDGRHTVDIEQIPTEDLKDSREDFEELARRYTRAI
                     DKAIRVRPEEWFWLHDRWKRTF"
     gene            384475..384669
                     /locus_tag="CPHA266_RS01785"
     CDS             384475..384669
                     /locus_tag="CPHA266_RS01785"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467146.1"
                     /db_xref="GI:752830844"
                     /translation="MPEFVNILSQELLLFSGELYFVREEEIHSMHITHMHAAKEGETC
                     ILSYSTLNIILIIADAIMKK"
     gene            complement(384737..386032)
                     /locus_tag="CPHA266_RS01790"
                     /old_locus_tag="Cpha266_0348"
     CDS             complement(384737..386032)
                     /locus_tag="CPHA266_RS01790"
                     /old_locus_tag="Cpha266_0348"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015466249.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467147.1"
                     /db_xref="GI:752830845"
                     /translation="MKVFGHDEVHYYTDFTFKLKEEGRWANYFLHKLLRHIPLQTHVI
                     LFLSSLWGVFYYISKNLTKESWYSIIIASVLLIETPNAYQSLWPATVLPTTISLLLLA
                     WMAQKDISYKVIYLVGGVLLFGMMQNYYFLLPLLFLGHYKFDKTSINSTIPLVTTHLL
                     FWITGAVSGLVVASLIVYIHTGQAGIIPAEWRLIMPAHDISTLLRNIIYVFQNLTEQL
                     VVFWKNSASNGFLYPLLLIIFTFARLKNSFSNLYISIILSAVFLSFFIFSIPLAPIIQ
                     TRSLVAFSSSLILLFFIESKQLLFPRWLSVFLLLWTGLNLSISGRSYLYEHKTQSEFV
                     LNKIEAAFSHHPANYTAVAVFGHVDNKYKEAFLFNNPERLRPIILTLGANHFIDGRVD
                     TQQKSLLTEAVNIDTTSANNKIKLFVTKKNVAVILLEKN"
     gene            complement(386294..386677)
                     /locus_tag="CPHA266_RS01795"
                     /old_locus_tag="Cpha266_0349"
     CDS             complement(386294..386677)
                     /locus_tag="CPHA266_RS01795"
                     /old_locus_tag="Cpha266_0349"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744242.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide synthesis protein GtrA"
                     /protein_id="WP_011744242.1"
                     /db_xref="GI:500064325"
                     /translation="MITISSEIIRYLITGIFNTLVGYGTFFVFYRFVNLSPELSNAIG
                     YGIGLISAFILNRLFVFKRTIFSFGAFLRFVLSFIISFILNLAILYYFHRSLHVIPEI
                     AQIAAMIAYTIIFYLLNKYFVWKHK"
     gene            complement(<386721..387659)
                     /locus_tag="CPHA266_RS01800"
                     /old_locus_tag="Cpha266_0350"
     CDS             complement(<386721..387659)
                     /locus_tag="CPHA266_RS01800"
                     /old_locus_tag="Cpha266_0350"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744243.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="WP_041467479.1"
                     /db_xref="GI:752831177"
                     /translation="MQLLSLVIPCYNEEAVIDETIKRLKTFCSERNDLDVELILVDDG
                     SRDRTRMLLKSYASDDTRIKVIVFARNFGHQIAVTAGIDAARGDAVVLIDADLQDPPE
                     VIHKMIAKWREGYDVIYGTRAVRIGESAFKQFSARFFYRFLNKLSDIPIPLDTGDFRL
                     MSRDVVDTLKAMPENDRFVRGMVSWVGFKQTALPYTRQERFAGESKYPLKKMLRFAND
                     GILSFSTKPLQISISLGLLSAALAFAGIIYALLVRIFTYNWVEGWAGIMIAVLFLGGI
                     QLISVGILGEYIGRIYNEVKKRPLYVVEEYVGFNSED"
     gene            complement(<387764..>389578)
                     /locus_tag="CPHA266_RS01805"
     CDS             complement(<387764..>389578)
                     /locus_tag="CPHA266_RS01805"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007042887.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467480.1"
                     /db_xref="GI:752831178"
                     /translation="SKPTASIIIPVYGNISYTIKCIESLLNLPDSTSFEIIIIDDHSP
                     DNSYETLNKISQIKLIRNDCNKGFIHSCNSGASLATGEYLIFLNNDTEVLNAWLDSLI
                     APFIIHDNVGLVGSQIIYPDGRLQEAGGVILSDGSGLNYGRLSDPNKPEYNFLREVDY
                     CSGCSIAIKKSLFDSIGGFDTLFIPAYYEDTDIAFTVRKMGYKVLYQPASKVIHHEGI
                     TSGTDLKKGVKKFQNTNKIKFYNKWETQLKSHNILPDNYSLAKCKYYKDTILFIDACT
                     PTPDKDSGSVDAFFHQYIFTKLNFKVTFIPDNLIFLDGYTQVLQQLGIECLYKPHITS
                     IENFLKTRGAEFKYVVLSRVGIAVKHINAIKKYCPNSILIFNLVDIHYIREARQARTL
                     NSIELLHKAKKTKATELSIMKRSDVNIIISESEVKHLSKIDPELKLFNLPLILDMHQR
                     TNNFENRKNIMFIGGFQHSPNVDAVLYFSREIWPLVKTRLVDAHFIIIGSEMPNEIIN
                     LHNQNGILSIGYIEDLSPFFNSCKFSIAPLRYGAGQKGKLARSGSYGLPSVATSIAVE
                     GMGLKHEKHILIADKPDDFANSIERLYHDSILWEKLSKN"
     gene            complement(391265..392671)
                     /locus_tag="CPHA266_RS01810"
                     /old_locus_tag="Cpha266_0352"
     CDS             complement(391265..392671)
                     /locus_tag="CPHA266_RS01810"
                     /old_locus_tag="Cpha266_0352"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743933.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_011743933.1"
                     /db_xref="GI:500064016"
                     /translation="MQLPYTNIHTDQPNQQALFPDCFEVSVAPVKGKKVVLDFQGGNA
                     TSDAGVLLLKEVESMTRIVPKLADCIADSRRTSSVMHSIPDLIAQRVYQIACGYEDGN
                     DSNSMRKDPALKMALNRLPESGDDLASQPTFSRLENMVTRPELYRMAVGFLDHFLDSY
                     TEAPRVIVLDFDDTEDVVHGKQQLALFNGYHQETCYQPLHVFEGLTGKLIASILRPGR
                     RPTGKEIVSYVKRIVRHIRSRWPETIIVYRGDSHYGVPEVYSFLAREQNCYSVTGLGG
                     NDVLLRSVKDIIEEVKKHGAGYRRYHTFQYQARSWKETRRVVAKVEMTEKGLNVRFIS
                     TDMQEAKAKTLYEQIYSARGNDELYIKAHKTFMKSDRTSCHRFLANQFRVFLHSAAYV
                     LVHAFQTNLLRGTALATATFETIRLKLLKIGAKVIEMKTRIKVHLPTSYPYKPILNKC
                     FAVLEHLRSVPWPSTAIP"
     gene            392896..394815
                     /locus_tag="CPHA266_RS01815"
                     /old_locus_tag="Cpha266_0353"
     CDS             392896..394815
                     /locus_tag="CPHA266_RS01815"
                     /old_locus_tag="Cpha266_0353"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744245.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_011744245.1"
                     /db_xref="GI:500064328"
                     /translation="MNLLLRMLRYLAPSKGKIALVVVVSIITSFLSVISIYSILPLLN
                     AVFETGPVTRTEATHTESDGKSRQEESMQKATPLKPAIGNGFVNFDELKKNALVTFQH
                     AFHAETKERSLLNICLFLIAAFAVKNIFVYLNGQLIFRIQTKTAKKLRDDVFRSIIEM
                     HLDYFNKNRVGNLMNYVYNDVENVNASISSTLVNFLQNPFSIFVYMVVLFALSWQLTL
                     FAAFTSLLIFFLIQLVGKNVKGLALTFQTRMGDMNSVLQEKFNGIKVIKATAFEDVEL
                     ERFKEFTRDFRTLGIKIQQMRNVISPLNETLLVAAIAGVLWFGGLQVFKGVMTANELI
                     VFAFTLYSTMGPIKMLGNANTSIQIGLISVERLFEVLDAEAVVVNGTRSITGFSHTIR
                     FEDVCFRYLKEPDAPNVLDHVTFEIKKGEMVALVGQSGSGKSTAVDLLLRFYDVDSGR
                     ITIDGVDIRDYDFKQLRRMIGVVSQEVILFNDSIDANIAYGVRDEIGHGRVEQAARLA
                     NAHQFISEKPDGYNTLIGDRGIQLSGGQRQRLAIARAMVKNPELLIFDEATSALDNES
                     EKVVQQAIDHALANRTALVVAHRLSTVKNADRIIVMERGQVAESGNHEELLQADGLYR
                     KLYEIQFAGKTERAS"
     gene            complement(394874..>396598)
                     /locus_tag="CPHA266_RS01820"
                     /old_locus_tag="Cpha266_0354"
     CDS             complement(394874..>396598)
                     /locus_tag="CPHA266_RS01820"
                     /old_locus_tag="Cpha266_0354"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012401677.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467481.1"
                     /db_xref="GI:752831179"
                     /translation="NDYNIWLNKYDLLTEKRRKNIIAEIATKRESPLISVFMRLNKRS
                     LSSLEQSVQSVKAQLYPHWELCIIAEASQHTEAETAIRKFVENDARITRHVKKETNTI
                     SEASNAALELAGGEFFALLESGDTIHPLALYHVAQEVMRYPEAGLLYSDEDSLDNNNK
                     RVNPFFKPDFNYDLFLCQNMVGNLAVFKTSLARQTGGFKRELDGAQDYDLALRFYEKL
                     KPEQIRHIPRVLYHKRISRSGTIAATETQISGNQEAALLAVNHHLKRTGIEATVEKAP
                     EYPECNRIRYTIPNTPPSVDIIIPTKDMANLLKICVLSILAKTTYNNYSITIIDNGSK
                     EQNTLDLLKQWKNDSRIRIIRDDETPFNYSKLNNRAVHSSSADFICLMNNDIEIITPE
                     WLNEMMGHAIQPGVGAVGARLWYPNATLQHAGVITGMYTGTGHAHKKYPKGNPGYFGR
                     ACLQQEYSAVTGACLLINRINYLHVAGLNEQELTVAFNDIELCLKLKKKGLRNIWTPY
                     AEMFHHESLTRGRNDTPEKKELAGKELAYMQNTWGIDKNHDPAYNPNLSITSDDFSLS
                     WPPRILDR"
     gene            complement(396890..398017)
                     /locus_tag="CPHA266_RS01825"
                     /old_locus_tag="Cpha266_0355"
     CDS             complement(396890..398017)
                     /locus_tag="CPHA266_RS01825"
                     /old_locus_tag="Cpha266_0355"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020258230.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="group 1 glycosyl transferase"
                     /protein_id="WP_011744247.1"
                     /db_xref="GI:500064330"
                     /translation="MKIVYIARSAIPSRDANSIHVMKMCQAFADNGHEVIFLLPDRSS
                     GCEPGINDIYAYYGVKRNFQIRKFEYQHLKVKFVSQIRQMQKSLHELDPDLVYGRCFL
                     GCTIACLSGYKTIYESHLPLWRSGNIKKLWFSLVTRNRNFKRLVVISEALKTLYSNEN
                     IISQDKLFVAHDGADKVIDFQSKAELSGEKERLHVGYSGHLYQGKGVEVIAGVAPLMT
                     EVNFHIIGGKENDIAYWKSVIKSDNVFFYGFKNQTELPKYLNSFDICLLPNQKVVLPC
                     GKRDEKRNISDFTSPLKMFEYMAHKKAIISSDLPVLREVLNESNALLVQCDDFQQWAD
                     AITALQDKNKREAIAQQAYEDFMTSYTWKIRAEQVLSNVIK"
     gene            complement(398040..398993)
                     /locus_tag="CPHA266_RS01830"
                     /old_locus_tag="Cpha266_0356"
     CDS             complement(398040..398993)
                     /locus_tag="CPHA266_RS01830"
                     /old_locus_tag="Cpha266_0356"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009379908.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744248.1"
                     /db_xref="GI:500064331"
                     /translation="MIINRLLQFFHLFILYRFGSAIGDQLCMTAIIENLFTEHRLKSV
                     VFSSYPEFFENNPNVCKNYSFKRMPKFFRNILLSLLRIAEGENIANFCFPKKKDGGLE
                     CFMRKSKAKISLIEAHSCYFKKKLILLQATPKIYFSDEELAVFSRKFSDLPDRFGIVQ
                     PVGKTTYTPNKEWGFANFQKVIDSAPHFPWLQTGMINELLLDHVIDFRGKTESLRELA
                     YIVSRADFILCLEGLLNHLAASVGTRSFCLFSGFHPVEIANYATTIPVVLDPQPDCSP
                     CWRLEKCPQKSKYCTEGILPEQVIKVITTAPSLNNQPAIKL"
     gene            complement(399085..400236)
                     /locus_tag="CPHA266_RS01835"
                     /old_locus_tag="Cpha266_0357"
                     /note="glycosyl transferase family 1; disrupted; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(400322..401470)
                     /locus_tag="CPHA266_RS01840"
                     /old_locus_tag="Cpha266_0358"
     CDS             complement(400322..401470)
                     /locus_tag="CPHA266_RS01840"
                     /old_locus_tag="Cpha266_0358"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744250.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 1"
                     /protein_id="WP_011744250.1"
                     /db_xref="GI:500064333"
                     /translation="MNIGIDFTHDLGYSGIGTYCRSLTEAMAQREPENIYNILTLHHK
                     IPEVQQHFSNLRAIVYSAPFPNPMLLGGKCNKMIRKYHQTIWKKKAANYDLVHFTHQG
                     YFVPGIENAAVTIHDLIKLYNKSYTAIETTHPLFLTTKKMINDAATIFVPSEFVRNEL
                     RNYFAGCEKKVKVTYEGIKPVYRQTPPDPAVLKKYDLLDNGRFFLYVGRYESRKNLDR
                     LILAYAQLPDTLKKDTLLVLICPTEKKSTKELQKKIAGAGLEKNVLHLVHVPDNDLVH
                     LYNAALALLFVSFSEGFGLPLVEAMNCGCPAIIANSSSLPEISGSSSLLVDPYDTESI
                     RQAMLAISEDSLLRNDLSKKCIVRAQRFSWQTTAQETLKGYHAMLNKP"
     gene            complement(401533..402627)
                     /locus_tag="CPHA266_RS01845"
                     /old_locus_tag="Cpha266_0359"
     CDS             complement(401533..402627)
                     /locus_tag="CPHA266_RS01845"
                     /old_locus_tag="Cpha266_0359"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744251.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 1"
                     /protein_id="WP_011744251.1"
                     /db_xref="GI:500064334"
                     /translation="MNILFVNSIGRDKFGGGEKWMINAAKELAKRGHNVVLGSKKNSR
                     TLHYAKANGVKTTIFEIRSDISPLSTLKVAAFLKRHAIDVLICNLNKDVRVAGLAAQI
                     VQTPIVLARHGMLLCDNKWKHKVTLTKLVDGIITNSNTIKESYKNYGWFGDNFVKVIY
                     NGIIIPEKIVAHDFSARFPGKKIIYSAGRLSEQKGFTYLIETAAILKQTRNDLVFAIS
                     GEGKLEIDLKKQVAHAGLADSFIFMGFTDNIYPYLKGCDLFVLASLFEGMPNVVMEAM
                     AMKKAVIATDVNGARELMVDGKTGIIVPPKQPAALACAIDKIIDNPDMLEEFGKAGYE
                     RVTHEFTMTAMGNKLEKHLQEKIVAKQRLK"
     gene            complement(<402735..403793)
                     /locus_tag="CPHA266_RS01850"
                     /old_locus_tag="Cpha266_0360"
     CDS             complement(<402735..403793)
                     /locus_tag="CPHA266_RS01850"
                     /old_locus_tag="Cpha266_0360"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744252.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl hydrolase"
                     /protein_id="WP_041467482.1"
                     /db_xref="GI:752831180"
                     /translation="MKIPFMNSSRTLGKKNKLFRKLFTRTLQLIVHKREPLRQFTGPL
                     NSIVILAQEKIGDSILLTPLLSNLRHYFPDLEIHLICFSEASVNFFRNDPHITAIHSV
                     KKNIVRYYKDVLSREFDLLFNTKDSPSTNFLIQTLLIRARFKAGHAHPYHEGIFNHLI
                     TIEYHTRMAVKNCSILPLLSIRVEEKKYRPYLPPAPVSSAIKRFSEKINNDVLTGLNI
                     SAGGPLRCWTEAKWSALIKGFPDMQFVIFSAPGDTHIKLRLEQHDNVTVSPPTANIYE
                     VGLLVKHLRLLVTPDTSLVHVASCYNIPVIGLYTSAPQDLSRFGPYLVDFEIITSSTS
                     QVSDIEVEAVTSVMQNKLQ"
     gene            403954..404157
                     /locus_tag="CPHA266_RS01855"
     CDS             403954..404157
                     /locus_tag="CPHA266_RS01855"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467148.1"
                     /db_xref="GI:752830846"
                     /translation="MSSVRKFMIGGGEYSEMLEFSKKTGEVDSPMVKGMSIILLFRQV
                     GIGLFSKSSSRLAGTPVSWFIPI"
     gene            404366..405319
                     /locus_tag="CPHA266_RS01860"
                     /old_locus_tag="Cpha266_0361"
     CDS             404366..405319
                     /locus_tag="CPHA266_RS01860"
                     /old_locus_tag="Cpha266_0361"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006366063.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="abortive infection protein"
                     /protein_id="WP_011744253.1"
                     /db_xref="GI:500064336"
                     /translation="MKAQKSLHAEPSLVRRPSFIMNTLILFGIMMLYQVMGSLLLLKI
                     TAIDLSLLFSLDDQARTISLMRIMQVASQLLLLALPVLLLAKRHTGGEHLFSAKTLAF
                     LGIRRNGSQALALWAVLGVFCLQPLMQTIAELQQLFLWPALGEAGKQVVENQKAMDRI
                     IAALAVMRSLPEAVAVVAVLAVTPAMCEEVLFRGYIQENYRQSIDPRGAVILTGFVFA
                     VFHLSAANFVPLTILGCYIGYVYLNAGTLFVPFAVHLFNNLAALALLSMGSGSGSADA
                     GASFSGVVGFWWWWLVVAGSLGLFFLCMVMFRAASFSQRRQ"
     gene            405372..406193
                     /locus_tag="CPHA266_RS01865"
                     /old_locus_tag="Cpha266_0362"
     CDS             405372..406193
                     /locus_tag="CPHA266_RS01865"
                     /old_locus_tag="Cpha266_0362"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744254.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidate cytidylyltransferase"
                     /protein_id="WP_041467483.1"
                     /db_xref="GI:752831181"
                     /translation="MGTLLSINLLQRIVVAVLGIPLLLWINREGGILFFLLVLLLSLL
                     ATVEFYRLAEHKAHPSPLWLVLPWTVLIQVNFYIGIADTAELLLLMVLFLFVLELFDK
                     EGSPLLNLGSLLTGLLYVNLCFGSLLRLRLSLHDGRGEAFVLLLLVCVWSADIFAYFG
                     GSTLGGKLIHRKLFERLSPHKTWEGFLSGFFGSLAASMVFARFVPDVSDSAALITGAL
                     IGLGSPAGDLIESMFKRDAGVKDSSGLIPGHGGVLDRFDTVMFVSPFIYLIITYL"
     gene            407105..407575
                     /locus_tag="CPHA266_RS01870"
                     /old_locus_tag="Cpha266_0363"
     CDS             407105..407575
                     /locus_tag="CPHA266_RS01870"
                     /old_locus_tag="Cpha266_0363"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744255.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS sugar transporter subunit IIA"
                     /protein_id="WP_011744255.1"
                     /db_xref="GI:500064338"
                     /translation="MKIESLLSESFIALNLDLASKSQVIDAMLDLVATHPSVCDKEKL
                     RQDVLKREREMSTGIGKAIALPHAKTSAVKHPVLALATLHKEINFDSIDNEPVRIIFL
                     LATPEEMLAEHLKLLGRITRLAGRMDFREQLLLLKTPAAVLDLFREEEKDFPQI"
     gene            407766..409055
                     /locus_tag="CPHA266_RS01875"
                     /old_locus_tag="Cpha266_0364"
     CDS             407766..409055
                     /locus_tag="CPHA266_RS01875"
                     /old_locus_tag="Cpha266_0364"
                     /EC_number="6.1.1.21"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BDE6.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidyl-tRNA synthetase"
                     /protein_id="WP_011744256.1"
                     /db_xref="GI:500064339"
                     /translation="MSQYQVVKGARDIFPDEIVRWHYVEDVVHRLASLYGYSEIRTPV
                     FEYTELFQRSIGTTTDIVGKEMFSFLPDPQGRSITLRPEMTAGVMRAVLQKNLLSTAP
                     IHKLFYLSELFRKERPQAGRQRQFSQFGAELLGVSSPAAVAEVITFMMQVFETLGIRG
                     LKLRINTLGDSSDRARYREILRAYLAPFYDRLDLASRERFEKNPLRILDSKNPDMQEI
                     IEGAPTLHDSLSHEALEDFEKVRFYLDSRSIAYDIDYRLVRGLDYYCHTAFEVTSPEL
                     GAQDAIGGGGRYDGLAKELGSSGDVPASGFAAGMERVLITMEKQGLFAALRPSGPKVY
                     VVAQQHALLDHALQVAYRLRREGISTEVDLAGRSMKAQMRDANRMRACFALFIGEDEV
                     VSGSYALKNLVTADQTAQSIETIIEMLNQYSGAEQGS"
     gene            409052..409312
                     /locus_tag="CPHA266_RS01880"
                     /old_locus_tag="Cpha266_0365"
     CDS             409052..409312
                     /locus_tag="CPHA266_RS01880"
                     /old_locus_tag="Cpha266_0365"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744257.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutaredoxin"
                     /protein_id="WP_011744257.1"
                     /db_xref="GI:500064340"
                     /translation="MTESLHTVTIYGAKGCCLCDDALERVLDVQGSVPFLLEKTDISG
                     SPELQQQYGEAIPVVCIDGVEVFRYRVNKTRLLQILRGQGGV"
     gene            409463..409666
                     /locus_tag="CPHA266_RS01885"
                     /old_locus_tag="Cpha266_0366"
     CDS             409463..409666
                     /locus_tag="CPHA266_RS01885"
                     /old_locus_tag="Cpha266_0366"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744258.1"
                     /db_xref="GI:500064341"
                     /translation="MLKFILFVIVVFLVLRMVMRFFTMAVFRKERDANAVRSHMSQNI
                     EEADYEVLDSRLAEKEEDGQKGV"
     gene            409789..410310
                     /locus_tag="CPHA266_RS01890"
                     /old_locus_tag="Cpha266_0367"
     CDS             409789..410310
                     /locus_tag="CPHA266_RS01890"
                     /old_locus_tag="Cpha266_0367"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BDE9.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744259.1"
                     /db_xref="GI:500064342"
                     /translation="MEEKIRRCVLQVLEATAGTKGEGVYLVSLSIKGSGKGTSIEVLV
                     DTDTGIRIDQCAFLSRRIRECLEVEEESDGMSGDDFNLDVASPGLGKAIILQRQYARH
                     VGRLFRVTFREEDGSMTEISGHLREILFPEEENASLVIEPLGKKKAGKKVSSENRTLR
                     LDRVIRAVPEAEL"
     gene            410366..411922
                     /locus_tag="CPHA266_RS01895"
                     /old_locus_tag="Cpha266_0368"
     CDS             410366..411922
                     /locus_tag="CPHA266_RS01895"
                     /old_locus_tag="Cpha266_0368"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744260.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination factor NusA"
                     /protein_id="WP_011744260.1"
                     /db_xref="GI:500064343"
                     /translation="MVRKQVKTEGQDRKAQIASAFGEIEQSKIFLDKRTESAAVKMDI
                     ADLLKDIIQKQLRKDYDPEVEANIFINPERGDFEVYILKKVVSEVDLESIEISIDEVR
                     KIDDSLELGDYYEEGPIKLEDYLSRKSIQIIKQSVQKKVRDLERLVVYEECLEKVGEV
                     VAGEVYQVRSNEVIFTYNTSKDHRVELVLPRAEMIKKDNPRRNPRMKLYVKRIEREKV
                     KVRLDDGGVVERDKPDGGMKVIVSRIDDRFLYKLFEHEVPEILDGLIVIKGIARVPGE
                     RAKVAVESTSARIDPVGASVGYRGKRIQSIVKELNNENIDVIYYTDEPQIYIARALQP
                     AKIDPLTVHADIKTRKARVMLKPDQIKYAIGKNGNNIHLAEKLTGYEIDVYRDVMDKS
                     MEDPTDIDIIEFREEFGDDMIYQLLDGGLDTAKKVLKAGVERIEEVLLGPSAPEEITF
                     FSKGRTRSPIKPRERKVTEEEKRYWKKIAENIFKTVKEQFTDADLHDLFDDGDEDSDD
                     QQAAESPADE"
     gene            411989..414964
                     /locus_tag="CPHA266_RS01900"
                     /old_locus_tag="Cpha266_0369"
     CDS             411989..414964
                     /locus_tag="CPHA266_RS01900"
                     /old_locus_tag="Cpha266_0369"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BDF1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-2"
                     /protein_id="WP_011744261.1"
                     /db_xref="GI:500064344"
                     /translation="MALEDMEKRYRISDLSRELQVSPQEVLQFIRMNGGKVGSTSSMV
                     NEEMRGMIFGNFSVEKKMVDEAMKIRAEKQRRLTRLEEQSRKTYEKEQQLRDSMHVAP
                     LVPVAPLHVAQDVIVEVAAPPSAQADHTVQAEPAVQTESAVQTESAVQTESAVQTEPA
                     VQTEPAVQTEPEVQTEPAAQTEPEVQTEPAAQTEPAAQTEPAAQTESAVQTEADLSDV
                     GEVSIVPENVEVIDVPELPMVPVMPVKEEPSVNDQLVSFDIPQNIGGLTVVGTLDMMN
                     PFDRSESGKMKARKKNFKEQADALKSEFDTPAGEEKLVDDKLVVKKKPVKAAGDGDTA
                     PAADDALAGKKKPGKKKKKPDVDEKVISANIRTTISGMDDSAGSVSRQKFRKMRRMER
                     EKEHEAAEAFRESQRAIVRVTEYASPHELAELMGVTAKEIIQKCFALGKFVTINQRLD
                     KESLELIALEFGFEAEFISEIEATAVVAEVDDAEDLLIRPPVVTIMGHVDHGKTSLLD
                     YIRNSNVVAGESGGITQHIGAYEVTVEGNRKITFLDTPGHEAFTAMRARGAQVTDIVI
                     LVVAADDSVMPQTIEAINHAKAAGVPIVVAINKIDKPAANPEKIKTQLSEAGVLVEDW
                     GGEYQCQEISAKQGIGIEELMGKLLTEAEIRELKGNFSEDVLASGIIIESELDKGKGV
                     ISTVLVQRGYLRVGDPFVAGNTMGRVRALMDERSKRIHEAGPSQPVRVLGFEALPQSG
                     DVLTVMASDRDARELAQKRQVIRREHEFRRSTRVKLDSIARQIREGLMKELSVIIKAD
                     TDGSIQALADGLMKIHNEEVKVQIIHQGVGQITETDVLLAAASDAIIIGFRVRPNVNA
                     KKLAEKEDLDVRFYSVIYHVLEDVEKALEGMLSPELHEESLGSLEIRQVFRVPKVGNV
                     GGCYALEGKVFRDSKVRLLRDGVQVYDGQLDTLRRFKDDVKEVDAGYECGLSLKNYDD
                     IKVGDIVEAYKIVEKKRKL"
     gene            414983..415333
                     /locus_tag="CPHA266_RS01905"
                     /old_locus_tag="Cpha266_0370"
     CDS             414983..415333
                     /locus_tag="CPHA266_RS01905"
                     /old_locus_tag="Cpha266_0370"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BDF2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome-binding factor A"
                     /protein_id="WP_011744262.1"
                     /db_xref="GI:500064345"
                     /translation="MSIRTEKVASLLQQELGMILEKEFPRGGPILTVVEVKVTADLGI
                     AKVYVSVIGSAKEQADTIEYLQQEKKNIRKILSSKIRHHFRRIPELEFYQDRLYEKAD
                     RIEQLLKEVRKEQE"
     gene            415378..416100
                     /locus_tag="CPHA266_RS01910"
                     /old_locus_tag="Cpha266_0371"
     CDS             415378..416100
                     /locus_tag="CPHA266_RS01910"
                     /old_locus_tag="Cpha266_0371"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744263.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA pseudouridine synthase B"
                     /protein_id="WP_041467484.1"
                     /db_xref="GI:752831182"
                     /translation="MHTPEVHEDSGCFHLVDKPVDWTSFDVVAKIRNTYKLIGQKRKV
                     GHCGTLDPKASGLLILATGRKTKEIASLELLDKVYEGSFKLGVVTDSHDRETPEYNQC
                     ATGHLEREQIIEAAASFVGTRQQQPPMYSAAWHNGKRLYELARKGDVVHDRKAKEIII
                     RRFEITAVELPLVRFILEVSKGAYIRVIAHELGALLGVGAYLASLKRVAIGPYELGSA
                     CSVPETIEAILKKRESVLFIEK"
     gene            416110..417075
                     /locus_tag="CPHA266_RS01915"
                     /old_locus_tag="Cpha266_0372"
     CDS             416110..417075
                     /locus_tag="CPHA266_RS01915"
                     /old_locus_tag="Cpha266_0372"
                     /EC_number="2.7.1.26"
                     /EC_number="2.7.7.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744264.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="riboflavin kinase"
                     /protein_id="WP_011744264.1"
                     /db_xref="GI:500064347"
                     /translation="MLVVEYQNNDVVAYPSGEPVIFSPVPSAVTIGSFDGVHRGHRSI
                     IARMNAIARSRQLRSVVVTFEPHPRRVLSASASPSPLVLSTLDEKVALLTSLDVDLLF
                     VIRFTDAFAARSSEDFIVGVLVKLLCAKSIIVGYDHGFGRNRTGSSETLLHLGKEFGF
                     DVEAITEVKIGNEHFSSTRIRKLLESGNLSDANQFLGYSYIVSGTVVGGDQRGRTIGF
                     PTVNIKPSDPQKLLPHSGVYLAMIELDGISYKAMMNIGVRPTVSQGNEKTVEAHIPGF
                     SGELYGAFLSFRLLVYIREEKKFATIDELKEQLEKDKKTVELYNE"
     gene            417123..417392
                     /locus_tag="CPHA266_RS01920"
                     /old_locus_tag="Cpha266_0373"
     CDS             417123..417392
                     /locus_tag="CPHA266_RS01920"
                     /old_locus_tag="Cpha266_0373"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B3EFB5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S15"
                     /protein_id="WP_011744265.1"
                     /db_xref="GI:500064348"
                     /translation="MSLTQEDKAGIISQFGGVQQNTGKAEVQVALFSRRITDLTGHLQ
                     QHPKDKHSRRGLLMLVGKRKKVLNYLKNVDIERYRTVIAELDLRK"
     gene            417486..418373
                     /locus_tag="CPHA266_RS01925"
                     /old_locus_tag="Cpha266_0374"
     CDS             417486..418373
                     /locus_tag="CPHA266_RS01925"
                     /old_locus_tag="Cpha266_0374"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744266.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467485.1"
                     /db_xref="GI:752831183"
                     /translation="MLESMTGYGSAEAVDNGVRVFVELRSVNNRFAEVSVKLPRQLLA
                     FELEVRELVRSTFQRGKISASIQVQADQEVDFPLRVNPLKVKACRELLDDVRMAAGID
                     APVSLEHVLRFSEIFETGNTVLDNTEWLWSFVKKLLQDAMHKLKEMRRKEGEELSLDF
                     TARIAQIERTLAEISSASQGNLQAARKKLASKAELIAGQDIAYSRDRLEMELVLAADK
                     LDITEEFTRFSSHNKFFLEELNNDESGTGRKLNFLLQEQLREANTIASKSQSAEISQK
                     IVHVKEELEKIREQLQNIE"
     gene            418378..418962
                     /locus_tag="CPHA266_RS01930"
                     /old_locus_tag="Cpha266_0375"
     CDS             418378..418962
                     /locus_tag="CPHA266_RS01930"
                     /old_locus_tag="Cpha266_0375"
                     /EC_number="2.7.4.8"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744267.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="guanylate kinase"
                     /protein_id="WP_011744267.1"
                     /db_xref="GI:500064350"
                     /translation="MTISRGPTGKLVVFSAPSGTGKSTIAKIVLERIPSLAFSVSATT
                     RPMRAGEEEGVHYYFLDKKKFEEKIRDGGFIEHEYFFNNYYGTLLDKTVDAVNSGHHL
                     LFDLDVKGALNLKTLFPLNSLLIFIRPPDMATLRERLLKRESEDADALNVRLERAELE
                     LGYVDQFDEVIVNDCLDRAADAVTAKVSEFLSNT"
     gene            418974..419324
                     /locus_tag="CPHA266_RS01935"
                     /old_locus_tag="Cpha266_0376"
     CDS             418974..419324
                     /locus_tag="CPHA266_RS01935"
                     /old_locus_tag="Cpha266_0376"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744268.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744268.1"
                     /db_xref="GI:500064351"
                     /translation="MSVNPVDLNKLRSAHANLYETVVAISKRAKKIHEEERAELEEKL
                     LPYKEMIRNPGSESESDKVFPEQIAISLEFESREKASQKAVAGYLQHRYDYTLGKIAE
                     PKVTPIEDDETDGD"
     gene            419302..419799
                     /locus_tag="CPHA266_RS01940"
                     /old_locus_tag="Cpha266_0377"
     CDS             419302..419799
                     /locus_tag="CPHA266_RS01940"
                     /old_locus_tag="Cpha266_0377"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744269.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase"
                     /protein_id="WP_011744269.1"
                     /db_xref="GI:500064352"
                     /translation="MMKLTGINQITLRVNDLGRAEEFYADILGFRIDHRVGVNICYLR
                     LNSDMLVLVKSETPSVPESRDFRVDHFGFRLASDAEVDEAADYLDAKGVHLITRPAHR
                     QEGRAFFVMDPDGNLVEFYSMHNGGIDKECRGCDPISPDALAAGNRSKIREENDQKKP
                     RRSRK"
     gene            complement(<419830..420531)
                     /locus_tag="CPHA266_RS01945"
                     /old_locus_tag="Cpha266_0378"
     CDS             complement(<419830..420531)
                     /locus_tag="CPHA266_RS01945"
                     /old_locus_tag="Cpha266_0378"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013119052.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467486.1"
                     /db_xref="GI:752831184"
                     /translation="MSLAVIIMAAGKGTRMQSELPKVLHKANGRPVIEYVLDTALHLK
                     PETIILIVGHQADKVIAATRQYPVICALQEPQNGTGHAVMQAEKALKTFSGDVLILSG
                     DVPLVKRSTLLQLIALHHNEQASATVLTARLDNPSGYGRIIRNKTGGEVMKIIEQRDA
                     SPEELSVDEINSGIYVFKAPVLFQALREITTENAQQEYYLTDVFDICFRNGNKVCACR
                     TENADEIRGINTPEQL"
     gene            complement(420548..420943)
                     /locus_tag="CPHA266_RS01950"
                     /old_locus_tag="Cpha266_0379"
     CDS             complement(420548..420943)
                     /locus_tag="CPHA266_RS01950"
                     /old_locus_tag="Cpha266_0379"
                     /EC_number="4.1.1.11"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BDG1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate decarboxylase"
                     /protein_id="WP_011744271.1"
                     /db_xref="GI:500064354"
                     /translation="MKLHLLKSKIHNARVTSGDLEYEGSITIDQELLLLAEMIPNEKV
                     LVVNNNNGERFETYIINGEPGSRVIQLNGAAARCALPGDEIIIMTFAVMDEKKARTFQ
                     PMVLIVDHLNNPKRRHRIGQEDEQLSSSI"
     gene            complement(420965..421459)
                     /locus_tag="CPHA266_RS01955"
                     /old_locus_tag="Cpha266_0380"
     CDS             complement(420965..421459)
                     /locus_tag="CPHA266_RS01955"
                     /old_locus_tag="Cpha266_0380"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744272.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744272.1"
                     /db_xref="GI:500064355"
                     /translation="MSGCGAPQSERRKPETGFIGEGHPQQESWDIHLNLTDAGIPKAS
                     IKAGYAAEFNKNSKKEYHLQKGVTVTFFNSEKEPSTILKAQEAVVHDNLDIEARGNIV
                     ITTDNTTTIKTESIKRTAKDKMIRSNDYVTITRPGETLTGYGFESDQALKKYRIFRAS
                     GESH"
     gene            complement(421522..422061)
                     /locus_tag="CPHA266_RS01960"
                     /old_locus_tag="Cpha266_0381"
     CDS             complement(421522..422061)
                     /locus_tag="CPHA266_RS01960"
                     /old_locus_tag="Cpha266_0381"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744273.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone Skp"
                     /protein_id="WP_041467487.1"
                     /db_xref="GI:752831185"
                     /translation="MYNRKGFMSVVRKIVMASLLGLMLGAPATVHAETVGVVDFGKIL
                     LQMPERKQAETTLQAMATPFQNELERMSQDLQKGLVAYEQQKASMAKPAREVKEKELN
                     TKAQAIQKYKLEKFGQEGLVAKKEQELLIPIRQKIVASVQTIAQKEGFTLVLDKGAMI
                     YGTPASDLTFKVMNQLNLK"
     gene            422399..423127
                     /locus_tag="CPHA266_RS01965"
                     /old_locus_tag="Cpha266_0382"
     CDS             422399..423127
                     /locus_tag="CPHA266_RS01965"
                     /old_locus_tag="Cpha266_0382"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744274.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FkbM family methyltransferase"
                     /protein_id="WP_011744274.1"
                     /db_xref="GI:500064357"
                     /translation="MGFFIRAKLYFRQLIGQEPRTNVEIACECRHIHEWCICPVGIDS
                     ASSVFSLGVGNDIGFDTGLIKDFNCSVYAFDPTPRWVEWIGSMSLPEKFKFYPYAIGG
                     TDGTMKLFPRIHKGRRSSKMLTLLNEGLHDDESIAVTMKRLSTLTAELSVPSIAILKI
                     DIEAAEYEVIDDFLADHVPVYQLLVEFHHRFASVPVKKTTDALAKLYKAGYRIFYVSE
                     KAREYSFIHEATYDGYRRQAGKSS"
     gene            complement(423140..424285)
                     /locus_tag="CPHA266_RS01970"
                     /old_locus_tag="Cpha266_0383"
     CDS             complement(423140..424285)
                     /locus_tag="CPHA266_RS01970"
                     /old_locus_tag="Cpha266_0383"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744275.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA processing protein DprA"
                     /protein_id="WP_011744275.1"
                     /db_xref="GI:500064358"
                     /translation="MSATPGCDSRILLLTLSQIPGIGPARINAIVSNLGSDISVLDAT
                     EGTFQHIPGIGVPLAKEIVSFLGNRQKRLAALEAADEQMLRLERYNAKLLTITDTEYP
                     RLLREITDPPPYLFVRGNLPGNHEPGIAIVGTRRASAYGKQAAAKFSGELALQGFPIV
                     SGLAYGIDMVAHTASIGSGGKTIAVVATGVDTIYTDPRGKVWPGIVENGAIISEEWIG
                     SNLVPAKFPKRNRIISGITLGTLVVESDRNGGSLITASFALEQNREVFAVPGSIFSHT
                     SRGTNMLIQLGQAKAALCVDDIISEVAPQSSRENIPRQNPIALDMHLSAEELNVLAIM
                     GKESVHIDTIASKTGLDVSTLLVRLFELEMKRAVIQHPGQFFQNRHS"
     gene            complement(424300..425298)
                     /locus_tag="CPHA266_RS01975"
                     /old_locus_tag="Cpha266_0384"
     CDS             complement(424300..425298)
                     /locus_tag="CPHA266_RS01975"
                     /old_locus_tag="Cpha266_0384"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744276.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyprenyl synthetase"
                     /protein_id="WP_011744276.1"
                     /db_xref="GI:500064359"
                     /translation="MNMSITQELVEKKYRLYHNLINEALASCFSAEAPVTLYAPAKYI
                     LDGKGKRIRPFLTLLASEAVCGSSEHALKVALAVEILHNFTLMHDDIMDQAELRHGRP
                     TVHKQWNANVAILSGDMMIAYAYELALQSPSSRQIELVHILNDANITICEGQALDIEL
                     EEKKHATIADYLDMIAKKSGRLISAALEAGGVAGNATDEQLNNLVTFGEKIGRAFQIQ
                     DDFLDIMADDGKSGKIAGGDVINGKKTYLLLRSIELTSGDDHRLLQSIIENNGISAER
                     VPEIRSIYQRCGVLDETRLLIRRDTENALSAVDKLPHAEGREYLKGFANILVKRDF"
     gene            complement(425301..426392)
                     /locus_tag="CPHA266_RS01980"
                     /old_locus_tag="Cpha266_0385"
     CDS             complement(425301..426392)
                     /locus_tag="CPHA266_RS01980"
                     /old_locus_tag="Cpha266_0385"
                     /EC_number="5.3.3.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BDG7.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isopentenyl-diphosphate delta-isomerase"
                     /protein_id="WP_011744277.1"
                     /db_xref="GI:500064360"
                     /translation="MNEKLSTPSNITIERKLNHVEICLHGNVSFEGTTTGLERYAIEH
                     QAVPEINYADINLSATLLGRTIGAPLMISSMTGGYHEAATLNRQFAQAAEHFRIPLGV
                     GSMRQALENNEHRESFAVVRKAAPSVPVFANIGAPEVAAGLESSQIETMLDLIQADGL
                     IVHLNAAQELFQPEGNTNFHGFLDQLASLTAKTPVPVIAKEVGSGISAEAARLLIDAG
                     VKVIDVAGAGGTSWQKVEEVRYIKRFGNENRFSPEALNELLNWGIPTATCLEEIGRLK
                     KNHPQYQPIEIIASGGIQSGIDVAKTILLGASVAASAGRLLKALHEGKLLQTIEMWLN
                     DLKAVMFLTGSLSLEQLQKKRMTLKHLPT"
     gene            426500..427768
                     /locus_tag="CPHA266_RS01985"
                     /old_locus_tag="Cpha266_0386"
     CDS             426500..427768
                     /locus_tag="CPHA266_RS01985"
                     /old_locus_tag="Cpha266_0386"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744278.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_011744278.1"
                     /db_xref="GI:500064361"
                     /translation="MLKTLFDIALRHLLGRRRQTLTTIFGVAVSTMVLITTISLTRGL
                     LDSFIDTIVNVAPHITIKGEKLNPVPVNIINRAGETRVSMVEDNIRKQEKEEVRNYRQ
                     ILGMFSSSLYEKEVTASSPYVESQVMAVKGNRNQPILLKGVIIDRENEISGIAGKIQQ
                     GDLSVFRNSSNALLVGRTVARDMHLELNDEVVIIPASGKSRQCKVAGIFFSGVNAVDN
                     SVFVSLKLGQIIEGLPANKVSGIALKVRDPLNNTPLAREMERITGYKCPTWQEENASI
                     LSLFARIGYIVFSLVAFVGVVSGFGVANILVTTVFEKSRDIAIMKSFGFSALHLVAMF
                     VLEGFLVGLAGALLGGVLAIGSINLFASIPVENSQGPLTKTGFSMSLNPIYFFYVIGV
                     TVFISTISAILPSARAAKLEPVKVLRDSSL"
     gene            complement(427866..429725)
                     /locus_tag="CPHA266_RS01990"
                     /old_locus_tag="Cpha266_0387"
     CDS             complement(427866..429725)
                     /locus_tag="CPHA266_RS01990"
                     /old_locus_tag="Cpha266_0387"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744279.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="xenobiotic ABC transporter ATP-binding protein"
                     /protein_id="WP_011744279.1"
                     /db_xref="GI:500064362"
                     /translation="MNRQKEQTTDTSAQEQTSKRSVSAKSFRTQKDETLEKGKKGSAD
                     WYIASRLIAYIKPYKALVAASAGITLAGSILGPLRPYLTKIAIDDYIAHGDMKGLATI
                     SLLLAAVVLLDGIKQFIATWLTQIIGQKAVFSIRMDVFRHLQQLPARFFDRNPIGRLL
                     TRTTNDIESLNEMLSSGIITILGDIMQLLFIVGLMLWIDWQLALVVLAILPLMLYATM
                     MFKKRVRIAFQDVRTHLARLNTFLQEHIAGMTIVQLFNHQKSEYTKHSDINADHRDAN
                     IRTVFYFSVYYPFIEVLSSLTAGMVIWYSAVRVLNADLTLGVVVSFVQYIWLFFRPLQ
                     HLSDRFNVIQTAIASSDRVFRLLEEKGGEGDAGAEPEPFVFRSRITFSNVWFAYDTDN
                     WILKDLSMEVRRGEKIAIVGATGSGKTTIINILSRLYPYAKGSIRIDNVELPDIASRS
                     LRKMIGVVMQDVFLFSGTIRENLAFGNPDLPDEAIFEAARIVGADRFIDQLPGGYAYR
                     VQENGAGLSAGQKQLIAFVRALLYDPQILVLDEATSSVDTETEMLIDAATAKLMQNRT
                     SIIIAHRLSTVQKADRIIVLHKGVIKESGSHQELLKEKGLYYKLYLLQHPEGR"
     gene            complement(429732..431144)
                     /locus_tag="CPHA266_RS01995"
                     /old_locus_tag="Cpha266_0388"
     CDS             complement(429732..431144)
                     /locus_tag="CPHA266_RS01995"
                     /old_locus_tag="Cpha266_0388"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744280.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglucosamine mutase"
                     /protein_id="WP_011744280.1"
                     /db_xref="GI:500064363"
                     /translation="MSLMISVSGIRGIVGESLTPQNLTAFAMAFASWIRNKRDPSTLI
                     SSPKRPLIVIGRDTRPTGSCISNLVSNALALSGCDVIDIGIATTPTVELATVTEKADG
                     GLIVTASHNPVEWNALKMLNDRGEFLSAPDVEELLAIVEKAHVHAARWDDIGTVTSTS
                     RHDDLHIDKIMNLSFINTEAVRKQHFRVMIDCVEGAGFSIVPRLCRMLGMDELTLVAC
                     EGSGLFPRNPEPVEENLADTISAMKQARCDFGLIVDPDVDRLALICEDGSLFGEEYTL
                     VACADFYLNINNGPVTNNLSSSRALADIARQHGVACFSAKVGEANVIELMKEVGAVIG
                     GEGNGGVILPDLHYGRDALVGIALFVQAFTSWRMKNRGGTISSFRREFPEYVMSKQKI
                     KLGSMSPRILENLFNEIARRYPLAKTNMTDGLKLDFDDCWVHLRPSNTEPIIRIYAEA
                     HTKKRAEEIALELMNELQKD"
     gene            431233..431421
                     /locus_tag="CPHA266_RS02000"
     CDS             431233..431421
                     /locus_tag="CPHA266_RS02000"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467149.1"
                     /db_xref="GI:752830847"
                     /translation="MERIVNVIPNAERDLYGIGDDAPDLCRIPLYLCRTGWSIESLEL
                     FPFEFFLIVVYYLPFVYL"
     gene            431461..431736
                     /locus_tag="CPHA266_RS02005"
                     /old_locus_tag="Cpha266_0389"
     CDS             431461..431736
                     /locus_tag="CPHA266_RS02005"
                     /old_locus_tag="Cpha266_0389"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BDH1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S20"
                     /protein_id="WP_011744281.1"
                     /db_xref="GI:500064364"
                     /translation="MPLHKSAEKRLRQSEKRNVRNRARKKELKVLLKNMQKLIDTSAD
                     KNVVEEAYRSAVQKLDRLGVKRYLHPNKASRKKAQLTKMLNNYVKVD"
     gene            431842..432444
                     /locus_tag="CPHA266_RS02010"
                     /old_locus_tag="Cpha266_0390"
     CDS             431842..432444
                     /locus_tag="CPHA266_RS02010"
                     /old_locus_tag="Cpha266_0390"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BDH2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase RuvA"
                     /protein_id="WP_011744282.1"
                     /db_xref="GI:500064365"
                     /translation="MFAYFKGSLVTALPEEAVIDVSGVAYRMLISATTFRQLPDEGSQ
                     VLLYAHLSVREDALQLYGFFKEEERQLFRLLLLTSGVGPKLALAVLSGLQVPEVHEAI
                     MANEPERLYGVSGVGKKTAARIILELRDKILKLPLVTPAAGKAAMPSHHVKDDAVHAL
                     VTLGFSRLLAQKAVSALLEEKPEQSVEEVIKYALATIHNS"
     gene            432457..433743
                     /locus_tag="CPHA266_RS02015"
                     /old_locus_tag="Cpha266_0391"
     CDS             432457..433743
                     /locus_tag="CPHA266_RS02015"
                     /old_locus_tag="Cpha266_0391"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744283.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="folylpolyglutamate synthase"
                     /protein_id="WP_011744283.1"
                     /db_xref="GI:500064366"
                     /translation="MNYQEALDFLYPLHRFGIKPGLERVFGLLAVLGSPHRRLGTIVH
                     VSGTNGKGTTAAAIAAIFQAAGKKTALYTSPHLVDFTERMRINGGCIPHELVATYCSL
                     IKSRVEESHTTFFEATTAIAFAWFASEHVEVTIVETGMGGRLDATNVVHADYVAITSI
                     GQDHTAWLGSTPALIAAEKAAIIKKGSQVFSAVTDSEAAMPVRTAAECCEAPLSVLGI
                     DAHCHVDSEEIGRLELSVRTAKHQYERLTVPLTGAFHASNISLAVMVAETAGIDESSI
                     RNGLANLLQTGYRARLEKIAANPDVLLDVSHNANGIEETVNTLARFRNRYRNLFVLIG
                     LASDKNATAIVKHLKRLSCRLVAVSIPSERSIPALELGGIGEAEDIPTMVFSSPLDGL
                     GYLSGIAEAEDLVLVTGSFYLAGEVLSNGGWNKEMS"
     gene            complement(433778..434023)
                     /locus_tag="CPHA266_RS02020"
     CDS             complement(433778..434023)
                     /locus_tag="CPHA266_RS02020"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467150.1"
                     /db_xref="GI:752830848"
                     /translation="MTLVSKKSDGRKSRKDDALMTKAKGNPLVATAEYSVYIMKTEKE
                     DNWGCVSVIESGPMQGKKRPGSITHKSWRTSVVIINI"
     gene            434054..435343
                     /gene="rho"
                     /locus_tag="CPHA266_RS02025"
                     /old_locus_tag="Cpha266_0393"
     CDS             434054..435343
                     /gene="rho"
                     /locus_tag="CPHA266_RS02025"
                     /old_locus_tag="Cpha266_0393"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006366034.1"
                     /note="An RNA-DNA helicase that actively releases nascent
                     mRNAs from paused transcription complexes; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination factor Rho"
                     /protein_id="WP_011744285.1"
                     /db_xref="GI:500064368"
                     /translation="MSNNSLAKGLDINVLQKKKVFELHALAKEIGVTAAGLRKEELIF
                     KIIEAQSRNNADSESGNVMINTGVLQVIPEGYGFLRSANYNYLSSPDDIYVSPSQIKR
                     FNMRTGDTVSGQVRAPKEGERFFALLKINTIDGNDPEITRERPYFENLTPLFPHDRIK
                     LEIKQSEYCGRIMDIFTPIGKGQRGLIVAQPKTGKTMLLQMIANAIIQNHPEIYLIVL
                     LIDERPEEVTDMARSVEAEVVSSTFDEDPERHVQVADMVLEKAKRLVEVGRDVVILLD
                     SITRLARAHNTIIPHSGKILSGGIDANALTKPKRFFGAARNIEEGGSLTIIATALVDT
                     GSRMDDVIFEEFKGTGNMELLLDRRLSERRIFPAIDILRSGTRKEELLFSREELSRTW
                     LLRKYLADKNPIECMEFMREKMADTKDNKEFFKYMNA"
     gene            435664..435858
                     /locus_tag="CPHA266_RS02030"
     CDS             435664..435858
                     /locus_tag="CPHA266_RS02030"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467151.1"
                     /db_xref="GI:752830849"
                     /translation="MTEGEFGMTEGEFGMRDREYGMRVGGSTDSVSALGLKEMDCFEN
                     NFRKPGRVCGFKKSSYIISL"
     gene            436026..436098
                     /locus_tag="CPHA266_RS02035"
                     /old_locus_tag="Cpha266_R0009"
     tRNA            436026..436098
                     /locus_tag="CPHA266_RS02035"
                     /old_locus_tag="Cpha266_R0009"
                     /product="tRNA-Lys"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:436059..436061,aa:Lys,seq:ttt)
     gene            436115..436196
                     /locus_tag="CPHA266_RS02040"
                     /old_locus_tag="Cpha266_R0010"
     tRNA            436115..436196
                     /locus_tag="CPHA266_RS02040"
                     /old_locus_tag="Cpha266_R0010"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:436149..436151,aa:Leu,seq:gag)
     gene            436605..437195
                     /locus_tag="CPHA266_RS02045"
                     /old_locus_tag="Cpha266_0394"
     CDS             436605..437195
                     /locus_tag="CPHA266_RS02045"
                     /old_locus_tag="Cpha266_0394"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011357065.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer surface protein, putative"
                     /protein_id="WP_011744286.1"
                     /db_xref="GI:500064369"
                     /translation="MKKVLMSLFVAGMCAAPAYAAGPYVSASAGLGLLGNSDFKGVVE
                     VKDVIEYNSGLVLNGAIGYDADMFRGEFAVGYQSNGVDTLGGVSIDNLDVSILSFMAN
                     AYVDFEMKDSALTPYLMAGLGLASVDFSDDGGDDFEAESVFAWQIGAGIGVKAADNLT
                     VDLGYRYFVPSDVEIDDVDKITLASSNIMLGLRYGF"
     gene            437613..437945
                     /locus_tag="CPHA266_RS02050"
     CDS             437613..437945
                     /locus_tag="CPHA266_RS02050"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467152.1"
                     /db_xref="GI:752830850"
                     /translation="MTRRGIRMTRRGIRMTRRGIRMTRRGIRMTRRGIRMTRRGIRMT
                     RRGIRMTRRGIRMTRRGIRMTRRGIRMTRRRIRMTRRRIRMTRRGIRMKKRGIGMTRR
                     QGHSNYWF"
     gene            438134..438742
                     /locus_tag="CPHA266_RS02055"
                     /old_locus_tag="Cpha266_0395"
     CDS             438134..438742
                     /locus_tag="CPHA266_RS02055"
                     /old_locus_tag="Cpha266_0395"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744287.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467153.1"
                     /db_xref="GI:752830851"
                     /translation="MGKLQVDILGLSASPHTNGAYALILYELEGKRKLPIIIGGFEAQ
                     AIALKLENIKPPRPFTHDLFKSVADAFSLHVKEIFIDELHNETFYAKIICELGGELHE
                     IDARPSDAIAIAVRFNAPVFVTEEIMNEAGIREEQKESEEEGEEDNTSSFIQEEPQPG
                     GMPAQSAALLELQGRLDDAISRENYEEAARIRDEINRIKNQG"
     gene            complement(438858..439589)
                     /locus_tag="CPHA266_RS02060"
                     /old_locus_tag="Cpha266_0396"
     CDS             complement(438858..439589)
                     /locus_tag="CPHA266_RS02060"
                     /old_locus_tag="Cpha266_0396"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744288.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744288.1"
                     /db_xref="GI:500064371"
                     /translation="MKKSLSLLAVLAVVGFASTPVQAADHYVSGMAGISWMQDSSIDL
                     PLNLNEVFGVGIDLGYSSGFTAVGAVGCDYGSTRLEAEVGYQTNDIDSITGSFDGDSA
                     SLALSGNAKVLSLMANGFYDFDLGGVELYAMAGIGVAQVSINDLTLADTNDLGISADD
                     IDDANEYLSRRLGAPVDLNALGLNVNETTLAYQVGAGLAVPIGDGIMLDARYRYFATT
                     DFTMPLDLNTNISSHSALLGLRVNL"
     gene            complement(439729..442221)
                     /locus_tag="CPHA266_RS02065"
                     /old_locus_tag="Cpha266_0397"
     CDS             complement(439729..442221)
                     /locus_tag="CPHA266_RS02065"
                     /old_locus_tag="Cpha266_0397"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744289.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744289.1"
                     /db_xref="GI:500064372"
                     /translation="MKKMQKLITLVLVALAVNATGQTAEAKSKPVKQSVTATQAKTPA
                     EKKDLYTISAISFTGLQSLNEQELIASLPIKIGNNIAVPGAELSATMQYLWNLQVFKN
                     ITLEKSNPGTKNVALHFIVEEQPLLEEVVFKGNEKFDLDKLQKTADIQTGKKLSEQEL
                     LTAANKIEKLYADKGYLTAGAEYKLEAIGKNKVKAVFTITEGRKVVIEKIRFHGNNAF
                     SQGKLRGVFKETTQNSWWRKIFGAPKLDKDKFATDKDLLVDFYRENGYRDAKVVSDSI
                     SYTPDNKGLFLDITIEEGPKYHIGTITWTGNSKDFATTEILEKTFGIKTGDLYNAKLI
                     QERLNFSQDNSDVSSIYLDRGYLSYRANLDEVVVNPDTVNLLISIREGEQYQLNLVNI
                     TGNTKTKDHVIRRELYTIPGEMFSRKNVIRSIRELNMLNYFDAEKLAPEIQPNEENNT
                     VDLTYSVSEKQSDTFNASIGYGGSSGFTGTLGVTFNNFSLQDIFDADAYRPLPHGDGQ
                     KLSFQWQFGSDNYRTLALSFTEPWAFGGPTTVGFSAFKTHRTYDYTGTDSSIENKTID
                     QYGTILTIGRRLTWPDDYFAVGLKLKYLHNKGGFVSFINETGINVPDEADEYSITGTI
                     SRNSIDSPIYPRRGSKNTLTAQLAGGPLPGTIDFYKFTGNSTWFFPLSRKLVLNMSAQ
                     AGYLSTFNKSDYIPYTEYFYMGGSGMSSLPTVPMRGYDDRSFGALLETDSDLYGGTIY
                     TKFTTELRYPITLSPSVSVYGLAFFDAGNLWQDSESVDFSDLKKSVGVGLRVYLPIIG
                     MVGLDYGYGMDTVPGDMEKGWGFMFTFGTSTE"
     gene            complement(442245..443093)
                     /locus_tag="CPHA266_RS02070"
                     /old_locus_tag="Cpha266_0398"
     CDS             complement(442245..443093)
                     /locus_tag="CPHA266_RS02070"
                     /old_locus_tag="Cpha266_0398"
                     /EC_number="2.5.1.31"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744290.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP pyrophosphate synthase"
                     /protein_id="WP_011744290.1"
                     /db_xref="GI:500064373"
                     /translation="MARIRTMDLSPTFRSPWFTTVSDTEDKKIQADLKASCELPLHIA
                     IIMDGNGRWAKLKGKTRIEGHIAGVDSVRDIVEASRQLGISYLTLFTFSTENWNRPEK
                     EISALMRLLIKVLRKEARALHDNNIRLNVIGNTALLPEKVRTVLDETVVLTGHNNGLV
                     MSIALSYSGKWDIVEACRSLAVEVKAGRVSPEMIDEHLFQSCLSTASIPDPELLIRTS
                     GEFRISNFMLWQSAYSEIYFTKTYWPDFRRAQFYAALRDYQNRERRFGQTSEQIQKKN
                     TANSKI"
     gene            complement(443116..443298)
                     /locus_tag="CPHA266_RS02075"
     CDS             complement(443116..443298)
                     /locus_tag="CPHA266_RS02075"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467154.1"
                     /db_xref="GI:752830852"
                     /translation="MFPIGTSTIARPGIVNSVSFATAAAPGNFEGDRIMIEKAQHNPV
                     NIGTRGFRDAFSIKPS"
     gene            443441..444871
                     /gene="gatA"
                     /locus_tag="CPHA266_RS02080"
                     /old_locus_tag="Cpha266_0399"
     CDS             443441..444871
                     /gene="gatA"
                     /locus_tag="CPHA266_RS02080"
                     /old_locus_tag="Cpha266_0399"
                     /EC_number="6.3.5.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BDI1.1"
                     /note="allows the formation of correctly charged
                     Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation
                     of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms
                     which lack either or both of asparaginyl-tRNA or
                     glutaminyl-tRNA synthetases; reaction takes place in the
                     presence of glutamine and ATP through an activated
                     phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl-tRNA(Gln) amidotransferase"
                     /protein_id="WP_011744291.1"
                     /db_xref="GI:500064374"
                     /translation="MHFSSYQDLRSSLLAGQTTCEEVTKSYLERIDRHCDDNIFLAVF
                     HEQALSRARSLDRRFSEGGTPGLLFGMPMAIKDNISIKGARLTCASRILENYESVYDA
                     TVIERLLNEDAVFIGKTNMDEFAMGSSNENSAFGPVANPFDKTRVPGGSSGGSAAAVA
                     AGLALVALGSDTGGSVRQPAGFCDIVGLKPTYGRISRYGLVAFASSFDQIGVLARNSD
                     DAALVLGVMAGADERDATSSRHAVSNYAEEMAAVSPDGLKIGVPKEFFHESLNPDVAR
                     LVKAKLEELREKGAELVDITLPASDYAIAAYYILVTAEASSNLARFDGARYGYRSPNC
                     DNLSAMYVNSRTEGFGKEVKRRIMLGTYVLSAGYYDTYYKKAQQVRRVFQDRYREALE
                     KVDVIAGPTSPFPPFGIGDKMDDPLEMYLADVFTVPASIVGMPAISVPIGYDSLNLPV
                     GMHLICNFFEEGKLLGIAGLMQHSIV"
     gene            444915..445814
                     /locus_tag="CPHA266_RS02085"
                     /old_locus_tag="Cpha266_0400"
     CDS             444915..445814
                     /locus_tag="CPHA266_RS02085"
                     /old_locus_tag="Cpha266_0400"
                     /EC_number="6.2.1.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744292.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinyl-CoA synthetase subsunit alpha"
                     /protein_id="WP_011744292.1"
                     /db_xref="GI:500064375"
                     /translation="MSVLVNKDTRLVVQGITGGEGTFHTSQILEYGTNVVAGVTPGKG
                     GTIYHGNERDHFCRPVPVFNTVKDAVDKAEANATVIFVPAPFAADAIMEAADAGLKVI
                     ICITEGIPVNDMMKAYAFVKEKGAVLVGPNCPGVITPGEAKVGIMPGFIHMKGTIGVV
                     SRSGTLTYEAVHQLTAVGLGQSTCIGIGGDPIIGTRFIDAIKLFAKDDETEGLVMIGE
                     IGGSAEEEAAEYIKRYFKKPVVGFIAGRTAPPGRRMGHAGAIVSGGKGTAEDKIHAME
                     AAGIHMVDNPGDIGTAMLKALGR"
     gene            complement(445899..446798)
                     /locus_tag="CPHA266_RS02090"
                     /old_locus_tag="Cpha266_0401"
     CDS             complement(445899..446798)
                     /locus_tag="CPHA266_RS02090"
                     /old_locus_tag="Cpha266_0401"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744293.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-arabinose 5-phosphate isomerase"
                     /protein_id="WP_041467488.1"
                     /db_xref="GI:752831186"
                     /translation="MADRLDDNFARAIALILSCKGKIIVSGMGKSGIIGQKIAATMAS
                     TGTTALFLHPADAAHGDLGIVCSGDIVICLSKSGTTEELNYIIPALKKTGASIIALTG
                     NSRSYLAKSADIVLDTGIEQEACPYDLAPTTSTTAMLAMGDALSMTLMQAKNFTPVDF
                     ALTHPKGSLGRRLTMKVSDIMASGDTMPVVNEDAAVTDLILEMTSKRYGVSAIINKKG
                     VLTGIFTDGDLRRLVQKGDDFLNLTARSVMTANPKTVGAERLATECLEILETYRITQL
                     IVCDIDQRPAGIIHIHDLISLGL"
     gene            447003..447350
                     /locus_tag="CPHA266_RS02095"
                     /old_locus_tag="Cpha266_0402"
     CDS             447003..447350
                     /locus_tag="CPHA266_RS02095"
                     /old_locus_tag="Cpha266_0402"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744294.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744294.1"
                     /db_xref="GI:500064377"
                     /translation="MSWVILFSFSLAFFFVLMFLLNRFVSYMKKEQNLEIESFKDSLI
                     DKDNPVGLRGEELEKLKQQQSEAQRHLREVIAKIPVIQKDGRFQLDEEALRQRKEAEN
                     RNGTSGSVTKDRA"
     gene            447357..448871
                     /locus_tag="CPHA266_RS02100"
                     /old_locus_tag="Cpha266_0403"
     CDS             447357..448871
                     /locus_tag="CPHA266_RS02100"
                     /old_locus_tag="Cpha266_0403"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744295.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide biosynthesis protein"
                     /protein_id="WP_011744295.1"
                     /db_xref="GI:500064378"
                     /translation="MLSKLKLLARDTVIYGASTILSRSLNYLLVPLYANKLSTFDNGV
                     QTLVYANIALANVLFSYGLETAYLKSASDSLREGKDGKGFFSTAFFSLLVTATLFSLI
                     IVFFSADISVLLGMTPAEYAFVRYAAIILWIDTILVIPFAELRLKRKAVQFAIARVTG
                     VVAVVIAAMILVIPFHAGLQGAFIANIIGSAVSGLMVFPVFMQLRPFFSFHQFRELIQ
                     IGLPYVPAGIAGLLIHLIDRNILIRISSSDIERIYGEGYVASDILGIYGRVVAFGIIL
                     QLFIQVFRFAWQPFFLQHASDPDAKRLFRYVLSISTLFTMVLALASTFFVPDLVRYHY
                     ADRFYLLPPRYWIGLSVLPWIFLSYVFDMISTNLTAGLLITGNTRSLPMVTFSGALVT
                     SLVCWALVPVNGMEGAAYAIVAGTFVMCLVMAYYSLKFYPNRYDWLKLSLLLAVGGVF
                     AGIGLWFETIAAGMVLIVLVKIALLVLFFLLVVFAFNEEVRLVAEKIAHKLKKR"
     gene            complement(448922..449428)
                     /locus_tag="CPHA266_RS02105"
                     /old_locus_tag="Cpha266_0404"
     CDS             complement(448922..449428)
                     /locus_tag="CPHA266_RS02105"
                     /old_locus_tag="Cpha266_0404"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744296.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744296.1"
                     /db_xref="GI:500064379"
                     /translation="MDFLASKRFVTTSLVILVLLNLTLLGILWMQNFSGKQAPVQVKI
                     TRQYNRQIYFTAPLALSEKQAISFQELRREHFRRVRPEMQAISLLKEQLVKEAIRDNP
                     DSLKIVKLAESIGKHQTSVERQLAEHFHELSEVCTPSQRDSLQKILTHMGKRQMHIRK
                     DTIENLTR"
     gene            complement(449575..450156)
                     /locus_tag="CPHA266_RS02110"
                     /old_locus_tag="Cpha266_0405"
     CDS             complement(449575..450156)
                     /locus_tag="CPHA266_RS02110"
                     /old_locus_tag="Cpha266_0405"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006367380.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744297.1"
                     /db_xref="GI:500064380"
                     /translation="MNKKTVTMITAMLLGFSSIASATDYSSYSDAKLSEMRGTMRTAS
                     QEERQAYQTECQKRTALTSPDQRSNRAGITRHKTKGSSPMILKEQLGLSDTQSRQLQE
                     MRQKHAGLATKERSRLAELQRQLMDASMTSNPDKQRIAVLAQQIGKEQSDLAIMRSAS
                     IQEVASVLTPKQREKMKTFMLQISPRKQGGMKM"
     gene            complement(450212..450796)
                     /locus_tag="CPHA266_RS02115"
                     /old_locus_tag="Cpha266_0406"
     CDS             complement(450212..450796)
                     /locus_tag="CPHA266_RS02115"
                     /old_locus_tag="Cpha266_0406"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467155.1"
                     /db_xref="GI:752830853"
                     /translation="MTTMLKKGAGMKKRALAASLAATIMTFGNSAGAADYRDSYAVEQ
                     NRYRNESRQEQSDERFTRDERQRNGYQDRQRQAPVIHDDFRTVKAALELDDRQLDRFV
                     AIRENYREHTGSVYREIALLKEIRQNEEMRKQRNFRTIAKLNRKISALQDELNRYRIR
                     SIRNYRDVCNNQQRERFDRFAAHNNPTFALMFRF"
     gene            complement(450871..451269)
                     /locus_tag="CPHA266_RS02120"
                     /old_locus_tag="Cpha266_0407"
     CDS             complement(450871..451269)
                     /locus_tag="CPHA266_RS02120"
                     /old_locus_tag="Cpha266_0407"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012505002.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467156.1"
                     /db_xref="GI:752830854"
                     /translation="MKQEIKMKHNIDTKEEEVRKIMQLLDEMQPLKVSPLFRVHLMEK
                     VEAVSNNRRSETFHSFNPRLAFAALLVVINISSAMLFFSSTEQQAKETASNATETVND
                     DYTSPALAYYTETGTEFSGSELNDNQNSNR"
     gene            complement(451326..451934)
                     /locus_tag="CPHA266_RS02125"
                     /old_locus_tag="Cpha266_0408"
     CDS             complement(451326..451934)
                     /locus_tag="CPHA266_RS02125"
                     /old_locus_tag="Cpha266_0408"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744300.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase subunit sigma-24"
                     /protein_id="WP_011744300.1"
                     /db_xref="GI:500064386"
                     /translation="MEKRGEAAVTIPATHEALLDSRATSKDDQFRKLVLEHQEMVLNT
                     CFRFVFNREDAEDLAQDVFVEVYRSLDQFREESKLSTWIYRIAVTKSLDYLRRLKRKK
                     RFSSLKRVIGIEDPSEDLPDTAGSNPLQSLAGKENANLLLDALNALPENQKTAFLLSK
                     QDGYSNQEIADILQSSVSAVESLIHRAKKNLHDKLYKHFKQT"
     gene            complement(452555..453937)
                     /locus_tag="CPHA266_RS02130"
                     /old_locus_tag="Cpha266_0410"
     CDS             complement(452555..453937)
                     /locus_tag="CPHA266_RS02130"
                     /old_locus_tag="Cpha266_0410"
                     /EC_number="5.4.2.8"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744301.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphomannomutase"
                     /protein_id="WP_011744301.1"
                     /db_xref="GI:500064387"
                     /translation="MQVKFGTDGWRAIIAKDYTYENLKLAALASARYFQSQPGRSKGV
                     CIGYDTRFMSKEFAEYTAEVLSSAGIRVFLSDSFVSTPAVSLYTKAKQLAGGIVITAS
                     HNPPNYNGFKVKAAYGGPANPEAIAEIESNLLEIDPKTEIKPDMKLIESVDMKSFYMN
                     YLKTHVDLQLIRESRIKIAHNAMYGAGQDIITRLFDESMVNCYHCTINPGFGGINPEP
                     MPQYIEEFVDFFKEVETDVAIINDGDADRVGMLDEKARFVDSHKLFAIILKYLVEERH
                     QTGEVAKTFALTDVINKICRKNNLVLHELPVGFKYVSKLMSTNDILIGGEESGGIGIT
                     SFLPERDGVYIGLLILEIMTRKEKSLSGLVEELYDEYGYFAFTRNDLHVSEAKKQAII
                     AKAAAGNLETVAGYKVLGFSDLDGYKYHFEGGWLLIRPSGTEPVLRLYCEADTDEKVS
                     KVLAFAAKLA"
     gene            454044..455186
                     /locus_tag="CPHA266_RS02135"
                     /old_locus_tag="Cpha266_0411"
     CDS             454044..455186
                     /locus_tag="CPHA266_RS02135"
                     /old_locus_tag="Cpha266_0411"
                     /EC_number="2.4.1.182"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744302.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipid-A-disaccharide synthase"
                     /protein_id="WP_011744302.1"
                     /db_xref="GI:500064389"
                     /translation="MPKKLFVLAGEVSGDLHAAGVVAELLKARPDVRVFGIGGEKLRA
                     LGAELFYDTRRMSIMGFLEVLKHAGFLQRVIREMKELVRQEKPDLAFLVDYPGMNLLM
                     ARFFHEEGVPVIYYISPQVWAWKEGRVKAIGRYVDRLLVIFDFEVEFFRRHGIRAEFV
                     GHPVIEELSAVSLPPRELFFRRHHILPGQRLVGMLPGSRRQEIALVFPEMLKAARMLA
                     ADYDVVFLLGRSPQMDEKHFSLVSAFDDIRIVECTAYEVMRFSELELVTSGTATLESL
                     CFGVPMIVLYKTAWLNYAVGRLLVRLTSISLANIVTKGLGSKDQVVPELLQHEATASG
                     IYMIARRLLDHPQLLAEMRQELLDAREKLASASPSQIISEILQEYL"
     gene            455202..>455402
                     /locus_tag="CPHA266_RS02140"
     CDS             455202..>455402
                     /locus_tag="CPHA266_RS02140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012507265.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467489.1"
                     /db_xref="GI:752831187"
                     /translation="MEKAADLLLGNPVLLLIAVIAAVMVLFSCLRNMFRLALFAAALF
                     VLYIAYLSLTGGDAPAAVREIQE"
     gene            complement(455497..457476)
                     /locus_tag="CPHA266_RS02145"
                     /old_locus_tag="Cpha266_0413"
     CDS             complement(455497..457476)
                     /locus_tag="CPHA266_RS02145"
                     /old_locus_tag="Cpha266_0413"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744304.1"
                     /note="these proteins belong to a family of
                     oxidoreductases related to the NADPH-dependent glutamate
                     synthase; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH-ubiquinone oxidoreductase subunit 3"
                     /protein_id="WP_011744304.1"
                     /db_xref="GI:500064394"
                     /translation="MNALTLTINGLKTTVQPGTSILDAAASCGITIPTLCFQQSLDVQ
                     GACWICIVEIKGKNRFVPACSTKVSAGMVIETETEELHMMRRRTLERLIEQHCGDCLG
                     QCELACPAGCNIPGFISEIAAHHDDEAIAIIKNTIPLPGILGRVCPAPCEDACRRHGV
                     DDPVSICALKRYAADRDMEASERYIPAIAEKSGKHVAVIGAGPAGLTAAYYLLALGHE
                     VTIYDEHPAAGGMMRYGIPRFRLPESVIDKDVEPLEQMGATFRFNTRFGKDISTASLQ
                     SAFDAIFLAVGAQQAAAMHIPGEHETGVLSGIEFLRQANEGVAEHPGANVVVVGGGNT
                     AVDAARTALRLGATTVTILYRRTKEEMPANQQEINEAIAEGITLHVLALPVSMRRMNG
                     FTEITAIAMRQGEPDESGRKKPVPINGSEFTIAANTVISATGQQVDCSIAMAAGIGTS
                     PEGTFDVNQATLQSNIAGIFSAGDCVTGPDLAITAVSEGRRAAHSIHLFLQGKPVVGK
                     PQQFNSSYGPRDQAPEAFYSKANPFEKIALPEISLLERSGTFREVVLGLSPEDAAQEA
                     LRCLQCRCNAIDNCRLRELAALYLPSGSCKLEEKLDFEIISGTDIRIEREKCVDCGIC
                     VRTLEQYGTEHEPDYQKLSTSCPTGALSEAMLNKK"
     gene            complement(457509..458495)
                     /locus_tag="CPHA266_RS02150"
                     /old_locus_tag="Cpha266_0414"
     CDS             complement(457509..458495)
                     /locus_tag="CPHA266_RS02150"
                     /old_locus_tag="Cpha266_0414"
                     /EC_number="1.17.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BDJ5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxy-3-methylbut-2-enyl diphosphate
                     reductase"
                     /protein_id="WP_011744305.1"
                     /db_xref="GI:500064395"
                     /translation="MKINLDRTSSGFCIGVQGTIHVAEEKLNNPDKLFSLGDVVHNEA
                     EVNRLEHLGLTTIDESGFHELKNAQLLIRAHGEPPSTYRIAEKNNLVITDTTCPVVSR
                     LQRTARLLHELGYQIIIYGKPSHPEVIGINGHCKNSAVIIKHPDLSDPSETGQIDLKR
                     KTALISQTTMDVPGFYELKANIRNLFAADSEEIRNENDHLWMAIRDIDLTASLTGIRD
                     MPRYVYKDTICRQVSSRNQMLHDFAIANSCVIFVAGKKSSNGQVLFGICKAANPCTYF
                     IEDIDEIDDAWLTGSDGRTVESVGICGATSTPMWLLEKVAAHLQRRYNHDPA"
     gene            complement(458654..459472)
                     /locus_tag="CPHA266_RS02155"
                     /old_locus_tag="Cpha266_0415"
     CDS             complement(458654..459472)
                     /locus_tag="CPHA266_RS02155"
                     /old_locus_tag="Cpha266_0415"
                     /EC_number="5.1.1.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BDJ6.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate racemase"
                     /protein_id="WP_011744306.1"
                     /db_xref="GI:500064397"
                     /translation="MQHHKATPESPIGIFDSGVGGLTVVRAIQAEMPAERIIYFGDTA
                     RVPYGTKSPATIRKYAHEDTAILMSHLPKIIIVACNTVSALALDVVEKTAGSIPVIGV
                     LKAGADLAVQVTRNKHVGVIGTQATVSSNAYADAITLLDANIEVVSKACPLFVPLAEE
                     GFTEHAATRLIASDYLAAFDGHDIDTLVLGCTHYPILRHVITETLHRDIRIIDSAEAV
                     AGRTRKLLADAKLLSTEKHAPPPHLLVSDLPQKFSMLYKLFMESDLPDVELVEV"
     gene            complement(459501..460592)
                     /locus_tag="CPHA266_RS02160"
                     /old_locus_tag="Cpha266_0416"
     CDS             complement(459501..460592)
                     /locus_tag="CPHA266_RS02160"
                     /old_locus_tag="Cpha266_0416"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010872577.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein YchF"
                     /protein_id="WP_011744307.1"
                     /db_xref="GI:500064399"
                     /translation="MSLRCGIVGLPNVGKSTLFNAITAKQAEAANYPFCTIEPNVGTV
                     LVPDERMQQIANVVKTPTLVPATLEIVDIAGLVKGASKGEGLGNQFLSHIREVDAIVH
                     VVRCFDDSNIIHVEGKIDPADDIATIETELMLADLDSMEKRIERLRKNSRKEKDLLQL
                     VDLAEKIIAGLAEGIPARSVIETPEEQETAKQFFLLTSKPILFAANVAEEDLQNGNDY
                     TRTVAEIAEKAGSKMLIISAKAEADIAELPEEERPMFLESLGLSMSGLDRLIRTAHEL
                     LGLQTYFTAGEKEVHAWTIRKGAAAPEAAGAIHSDFEKGFIRAEVMFYKDLLELGSEQ
                     KVKEAGKLRSEGREYIVRDGDIIVFRFNV"
     gene            460716..461429
                     /locus_tag="CPHA266_RS02165"
                     /old_locus_tag="Cpha266_0417"
     CDS             460716..461429
                     /locus_tag="CPHA266_RS02165"
                     /old_locus_tag="Cpha266_0417"
                     /EC_number="2.7.4.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744308.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytidylate kinase"
                     /protein_id="WP_011744308.1"
                     /db_xref="GI:500064401"
                     /translation="MKQRNQEKRIIIAIDGPAASGKSTTARKVADRLGYTYIDTGAMY
                     RSVTLKAIESGLMDTLRSSPERVVDLLAGLSVCFSGDRIMLDGRDVTLAIRENRVSRE
                     VSFISSLKPVRDTMRQMQQDMGRGRGVVMDGRDIGTVVFPDAELKVFLTADVRQRAMR
                     RYAELAVKSGDPSELPCLEDLEREILDRDRADAEREHAPLKKHPDARELDTSSLTIDV
                     QTDMVCSMAEDILKKKQNG"
     gene            461536..463311
                     /locus_tag="CPHA266_RS02170"
                     /old_locus_tag="Cpha266_0418"
     CDS             461536..463311
                     /locus_tag="CPHA266_RS02170"
                     /old_locus_tag="Cpha266_0418"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744309.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S1"
                     /protein_id="WP_011744309.1"
                     /db_xref="GI:500064404"
                     /translation="MAETLTLEKKVQERLARKKVKYFAHYEPAELEQMEMLYTSTLCE
                     ITEDEIVKGRIVSISNKDVTIDVGFKSEGIVSLLEFRDDDDVAVGDEVEVYLENIEDK
                     MGQLILSKKKADVLRIWDKIYDSIENDTIINGKIINRVKGGMTVSLSGVEAFLPGSQI
                     DVKPVRDFDALVGQTMDFRVVKINPVTQNIVVSHKVILEEAYAARREEMLANIKVGMV
                     LEGTVKNITDFGIFVDLGGLDGLVHITDITWGRINHPSEVVDLDQPIKVVVVGFDENT
                     KRVSLGMKQLEAHPWENIEIKYPVGSKARGRIVSITDYGAFVEIEKGIEGLVHISEMS
                     WTQHIKHPSQFVSLNQEVECVILNIDKDHTKLSLSMKRVNEDPWIALSEKYIEASLHK
                     GTVSNITDFGVFVELEPGVDGLVHISDLSWTKKIRHPSELVKKNQELDVKVLKFDVNA
                     RRIALGHKQINPDPWDDFEQKYAVGAETPARISQIIEKGVIVILPGDVDGFVPVSHLL
                     QGGVKDIHSSFALGDELPLRVIEFDKENKRIILSALEYFKDKSKEEIEAYLQAHPNEK
                     KEIEDATAELEPQVKSAEKKSGEAK"
     gene            complement(463386..464303)
                     /locus_tag="CPHA266_RS02175"
                     /old_locus_tag="Cpha266_0419"
     CDS             complement(463386..464303)
                     /locus_tag="CPHA266_RS02175"
                     /old_locus_tag="Cpha266_0419"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744310.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTPase Era"
                     /protein_id="WP_011744310.1"
                     /db_xref="GI:500064406"
                     /translation="MDASSFSCGFAVIIGAPNAGKSTLLNKLLDYKLSIVTPKPQTTR
                     KRITGIYHKDQCQIIFLDTPGIMKPQQKLHESMLEITRATLKDADVVLALLPYSRQSG
                     SVDLEFTEDLFSSWLNPSGKPVIAVLNKSDLVSAEAKRTCESVIQNSFHPKAVLSISA
                     QLGNNIEGLISALKPFLPLKEPLYPEETLSTDPERLFVTEIIREKIFLLYGNEIPYAS
                     EVIIDEFKEQHENDPSRKDLIRCSIIVERDSQKQILIGSKGAALKKLGQAARLDIEEL
                     LGRPVFLELFIKVRNDWRKKNNLLKSYGY"
     gene            464415..465641
                     /locus_tag="CPHA266_RS02180"
                     /old_locus_tag="Cpha266_0420"
     CDS             464415..465641
                     /locus_tag="CPHA266_RS02180"
                     /old_locus_tag="Cpha266_0420"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744311.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell cycle protein"
                     /protein_id="WP_011744311.1"
                     /db_xref="GI:500064407"
                     /translation="MTDKQSNVDFWLLVPMIGLIVFGLMAIFSATHGAGETTLFYRQF
                     AWGVIGAVVMLFVYFNDYRVIRDNAYLLYLISIFLLVVVLLFGTKIAGQTSWVKIGFF
                     SFQPSEIAKMATILALARFLSDDETDITFTPHLLIALGIPLFPALLIMLQPDMGTTLT
                     SLSFIIPMFIMSGFDLYIVIPYLLPIILMLSGFFNVFYIVGLAVLLFLALWLQKKKFK
                     MHQLLVTAAGLGAALFTNRFAAELLKPHQLKRIQTFLDPMSDPRGAGYNVIQAKIAIS
                     SGGFFGKGYLEGTQTQLRFIPAQWTDFIFCVIAEELGFVGSFVLLLLFLVLILRLLWI
                     ISSIKNKFVELTLAGFVSLLLIHVIINIGMTIGLIPVIGVPLPFVSYGGSSLLGNMIM
                     VALALNFVHNKRSIGY"
     gene            complement(465769..466218)
                     /locus_tag="CPHA266_RS02185"
                     /old_locus_tag="Cpha266_0421"
     CDS             complement(465769..466218)
                     /locus_tag="CPHA266_RS02185"
                     /old_locus_tag="Cpha266_0421"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744312.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744312.1"
                     /db_xref="GI:500064408"
                     /translation="MAKTEMGSPDKYDLFAEKIDQFKLLVEEKKNLQEQIMLLQEEFN
                     EKIKPFENQLSTVVRKLELELARVEGKTSEKPAPLKYSRGRLGISIKELLGNSPDRAF
                     KPKEIADALSTKGTTVSLWLNKYGSSDQEIERIPSENGGKRFLYKIK"
     gene            466369..467709
                     /locus_tag="CPHA266_RS02190"
                     /old_locus_tag="Cpha266_0422"
     CDS             466369..467709
                     /locus_tag="CPHA266_RS02190"
                     /old_locus_tag="Cpha266_0422"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744313.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA modification protein"
                     /protein_id="WP_011744313.1"
                     /db_xref="GI:500064409"
                     /translation="MPKITAITLGCKLNYAESSAILDLLSKKGWEISSYEKNEDLIII
                     NTCAVTKQAEQKCRQKIRKIIRDNPGSRIVVTGCYAQLSPEVLCKIDGVNAILGSSDK
                     YALPLYEVIGNIESSLPLISVSEIKKEKTIFPGYSLPATFASERTRAFLKIQDGCDYG
                     CAYCTIPFARGRSRSFSPDDIIAQASALVASGYREIVLTGVNIGDYRYRGVRLAALLR
                     MLEKVPVARIRISSIEPDILDDALIAVVAASEIIAPHFHLPLQSGSDAVLRAMCRRYD
                     TAGYRQRILRAVEAIADCSVSSDVMVGYPGESADDYRNMYRFLEGLPISSLHVFSCSV
                     RPGTQLAEQVATKKREVVDPDECRQRSSELIKLGNLKKSRFMEGYVGMECMVLFEESQ
                     KGANGTRKYSGYTRNYLRVTVTVSESSVHLAGSILPVFIEGIDDDLNLMGRLLF"
     gene            467760..468293
                     /locus_tag="CPHA266_RS02195"
                     /old_locus_tag="Cpha266_0423"
     CDS             467760..468293
                     /locus_tag="CPHA266_RS02195"
                     /old_locus_tag="Cpha266_0423"
                     /EC_number="2.4.2.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BDK4.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenine phosphoribosyltransferase"
                     /protein_id="WP_011744314.1"
                     /db_xref="GI:500064410"
                     /translation="MTIKSRIRSIPDYPKKGIMFRDITTLIKDPVGFRLVIDNLTQHY
                     LQNGVDFDVIVGIEARGFIIGGALSYALGKGFVPVRKPGKLPADVASQKYELEYGSDT
                     IEIHIDALEEGSRVLLVDDLLATGGTALAAAALVEKVGGVVAEMAFIVNLPDVGGEQR
                     ILDKGYSIFSLTDFEGD"
     gene            complement(468916..469224)
                     /locus_tag="CPHA266_RS02200"
                     /old_locus_tag="Cpha266_0424"
     CDS             complement(468916..469224)
                     /locus_tag="CPHA266_RS02200"
                     /old_locus_tag="Cpha266_0424"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744315.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_011744315.1"
                     /db_xref="GI:500064412"
                     /translation="MGTTTTKADLVNVIAHRTGLTKNETEAVVDCLFESIIDSLKSGK
                     RIEIRGFGSFNIRHKNLRQARNPRTGEKVTVDPKNVPTFKISKEFKHAVSESLKNGQE
                     "
     gene            complement(469269..469634)
                     /locus_tag="CPHA266_RS02205"
                     /old_locus_tag="Cpha266_0425"
     CDS             complement(469269..469634)
                     /locus_tag="CPHA266_RS02205"
                     /old_locus_tag="Cpha266_0425"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744316.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="WP_011744316.1"
                     /db_xref="GI:500064414"
                     /translation="MQFMIMFITGIAGGILAGMFGVGGGIIIVPVLVLLVGMTQHSAS
                     ATSLVALLLPVGILGVMEYYRSGRITTEHLWFGLIIALGLFIGAYFGAKIAISLSSDT
                     LRKAFAVFTGIVAFRLWFK"
     gene            complement(469677..471635)
                     /locus_tag="CPHA266_RS02210"
                     /old_locus_tag="Cpha266_0426"
     CDS             complement(469677..471635)
                     /locus_tag="CPHA266_RS02210"
                     /old_locus_tag="Cpha266_0426"
                     /EC_number="3.6.4.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744317.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsH"
                     /protein_id="WP_011744317.1"
                     /db_xref="GI:500064416"
                     /translation="MPENKKERPVKKDSSNKFKPVRNDDQPQGWLPGKTGGGQGKFPV
                     VLVFMLLAFLMLFLFQRFFSSSDSPEVTYNSYRSLLVSDLVRDVTVKTFSDKSAIING
                     KLKSVTKLELTNSMTLESDRFSVRIPAFSVEQADLLAEKGIRVKVEDGTPAFTAFLML
                     FAPWIIFGLLYFFIFRRMSSQNGNAAKNIFSFGKSRAKMVSEFDVKTSFKDVAGVDEA
                     IEELQETVEFLTNPERFEKIGGKIPKGVLLLGPPGTGKTLLAKAIAGEAKVPFFSISG
                     ADFVEMFVGVGASRVRDLFEQAKKNAPCIVFIDEIDAVGRSRGAGVGGGHDEREQTLN
                     QLLVEMDGFTTSENVILIAATNRPDVLDSALLRPGRFDRQITIDKPDIRGREAILKIH
                     TRKTPLGSDVDLTVLAKSSPGFSGADLANLVNEAALLASREGKEEITALDFEHARDKV
                     LMGPERRSMYISDEQKKMTAYHEAGHVLVASYTKGSDPIHKVTIIPRGRSLGLTAYLP
                     LEDRYTHNREYLLAMITYALGGRVAEELVFNEISTGAANDIEKASDIARRMVRQWGMS
                     EKLGPINYGDSQKEVFLGKDYSHIREYSEETALQIDVEVRNIIMSCMDNAKKILIEKK
                     SILQKLAETLIEKESLDAGEIRKIIGND"
     gene            471873..473381
                     /locus_tag="CPHA266_RS02215"
                     /old_locus_tag="Cpha266_0427"
     CDS             471873..473381
                     /locus_tag="CPHA266_RS02215"
                     /old_locus_tag="Cpha266_0427"
                     /EC_number="6.1.1.17"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BDK8.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl-tRNA synthetase"
                     /protein_id="WP_011744318.1"
                     /db_xref="GI:500064421"
                     /translation="MVAQRYRTRFAPSPTGYLHVGGLRTALYNYLFVKKMKGDFVLRI
                     EDTDRSRRVEGAQQNLLKTLEWAGIVPDESPELGGDFGPYIQSERLEIYKKYCDELLE
                     GKYAYYCFATSEELEENRQLQLKQGLQPKYNRKWLPEEMGGSMPSSEIRKKMEQNAPY
                     VIRMKVPDYVSVWFEDLIRGPVEFDSSTIDDQVLMKSDGFPTYHFASVIDDHLMEFTH
                     IIRGEEWLPSMPKHLLLYEFFGWEPPKFAHLPLLLNPDRSKLSKRQGDVAVEDYIRKG
                     YSAEAIVNFVAMLGWNEGEGTEQEVYSLEQLVERFSLERVGKAGAIFNVDKLNWLEKQ
                     YIKSRSADRIIAVIKPLLMAELEKRPTAMHESVITSDLYLEQVIELMRERVGFEHEFV
                     TFSPYFFFDPETYEEEGVRKRWTAETNTLLREFVTVLASLDAFTAEAIETELKAFVAP
                     KGLKAAALIHPLRILCSGVSFGPSLYHMLEVLGKDAVIRRISRGIETVVCLS"
     gene            473467..473542
                     /locus_tag="CPHA266_RS02220"
                     /old_locus_tag="Cpha266_R0011"
     tRNA            473467..473542
                     /locus_tag="CPHA266_RS02220"
                     /old_locus_tag="Cpha266_R0011"
                     /product="tRNA-Phe"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:473500..473502,aa:Phe,seq:gaa)
     gene            473682..474812
                     /locus_tag="CPHA266_RS02225"
                     /old_locus_tag="Cpha266_0428"
     CDS             473682..474812
                     /locus_tag="CPHA266_RS02225"
                     /old_locus_tag="Cpha266_0428"
                     /EC_number="4.2.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744319.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxyneurosporene dehydrogenase"
                     /protein_id="WP_011744319.1"
                     /db_xref="GI:500064423"
                     /translation="MNITTERSQELWHDLQEPGAYEWWYFDAEDKKNGLSIVLIWFGG
                     FPFSPYYMQHYEEWKKGKTAGPPFPSNYSGFSFQLYENGKETVNFIREGSNGLFESNR
                     EEIGVRFEQNRFTYDQEQDEYRISVDFSFPARTRKISATLVFKPLRRVIYSKKDGNNS
                     GHVPRHQWLLSVPRAAVEGSIDITEGRSDISRRIHVEADGYHDHNLGTMPMQEYIKKW
                     YWGRAFSEEFDLIYYVIFFKNDHYQPVSLLMLHDNRSNQMRIMEDVAFSEHNFSRGVF
                     SPLHGRVLELRHGNVLLSIHQHKVLDAGPFYLRFASTISLRADGEHLNGISGISEFLN
                     PSCLRSKVMRFFIKSRIWRDGVPSIMYNQYNYIKNHFDWFRK"
     gene            474993..475541
                     /locus_tag="CPHA266_RS02230"
                     /old_locus_tag="Cpha266_0429"
     CDS             474993..475541
                     /locus_tag="CPHA266_RS02230"
                     /old_locus_tag="Cpha266_0429"
                     /EC_number="1.10.99.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744320.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome B6"
                     /protein_id="WP_011744320.1"
                     /db_xref="GI:500064425"
                     /translation="MAQQGNFKSPSRMGGLGEGAPLSSSGAVQAGKPREQGLKGVDFE
                     RRSFLGKVVGGVGAVVAVSTLYPIVKYIVPPPVKEAAIVSELIVGKASEVPENSGKIY
                     QFNKDKVLVVNDNGKLTACSAVCTHLGCLVHWEDKDNLIFCPCHGAKYKQTGEIISGP
                     QPLPLAPFNVRVEGENLIISKA"
     gene            475569..476864
                     /locus_tag="CPHA266_RS02235"
                     /old_locus_tag="Cpha266_0430"
     CDS             475569..476864
                     /locus_tag="CPHA266_RS02235"
                     /old_locus_tag="Cpha266_0430"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744321.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome B"
                     /protein_id="WP_011744321.1"
                     /db_xref="GI:500064428"
                     /translation="MAENNQNAATGNTPVKPKPAAPGAAKPAAPGAAKPAAPAAAKPA
                     APVAAKAQPSTSTGGGVYKPPVDRPDPNPYKDSRLSPLGSWFQERFYVMMPVIDYLKK
                     KEVPQHRLSFWYYFGGLTLFFFIIQIVTGLLLLQYYKPTAAEAFASFVFIQQEVPFGW
                     LIRQVHAWSANLMVMMAFIHMFSTFFMKSYRKPRELMWVSGFVLLVLSLGFGFTGYLL
                     PWNELAFFATQVGTEVPKVAPGGAFLVGILRGGEEVGPETLTRMFSLHVVLLPGLLML
                     VLSAHLLLVQVLGTSAPIGYKESGMIKGYEKFFPTFLAKDAIGWIIGFGLLVYLAVVF
                     PWEIGVKAEALTAAPVGIKPEWYFWAQFQLLKDLTFEGGELVAIALLTVGAIVWILVP
                     FIDRQASSEQKSPLFTIFGLLVLAFLLINTYRVYAEYGW"
     gene            complement(477037..477279)
                     /locus_tag="CPHA266_RS02240"
     CDS             complement(477037..477279)
                     /locus_tag="CPHA266_RS02240"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467157.1"
                     /db_xref="GI:752830855"
                     /translation="MKWAPCSGKKPEGAFRLFLQRLSDRSGSGDTRYPYSDFSESRIY
                     GLFRYIRTPLALSAQIDRDKDTERLAIKQVLQVKRE"
     gene            complement(477245..480748)
                     /locus_tag="CPHA266_RS02245"
                     /old_locus_tag="Cpha266_0431"
     CDS             complement(477245..480748)
                     /locus_tag="CPHA266_RS02245"
                     /old_locus_tag="Cpha266_0431"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744322.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-amylase"
                     /protein_id="WP_011744322.1"
                     /db_xref="GI:500064430"
                     /translation="MTSNNYQPAPPGKEHFYLNRQARELFKQRDPEFLVLFDRSGDSL
                     AHAREQTAIINSFLKKKKGDQAKLILPAQFHGMKLLHEVFHALIAQSVASRKPDFFKT
                     VDDNFHRELSQNRANEYEKRFLDDFPPDALFRGVQSTEEYLSIPEKREQLIEESFLVW
                     LNNQNPALGQFEDLITDRNLVKDDAYLQLIRSLKGSIHDMGAVGPGDIDLLELLWLPI
                     RHSPDSILEQLRYIRLHWADLLEDSPFWSLLADAIILIQDEDRYIFVEQLSKHQDSRH
                     PDFWMEKETHVPDYGDPGEAGAHYSADSSWMPEVVMLAKSTYVWLDQLSKIYHRHIAR
                     LQDIPDRELDLLSERGFTALWLIGLWQRSEASETIKRIQGNPEAKASAYALEQYNISR
                     DIGGYEGYLDLRNRAMQRGIRLASDMVPNHTGIDSELVRNNPDWFLSASSAPYVNYSY
                     NGPNLSSDARYGIFLEDGYWNRSDAAVTFKRVDYLNGDTRYIYHGNDGTTMPWNDTAQ
                     LDFLSAEVREGVIQQILHVARMFPIIRFDAAMVLAKRHIQRLWYPLHGQTAGVPSRSS
                     FSMSMEEFNAAIPEEFWREVVDRIQAEVPGTLLLAEAFWMLEGYFVRTLGMHRVYNSA
                     FMHMLKKEDNASYRYLIKNTLEFDAEILKRYVNFMNNPDEDTAIAQFGRGDKYFGVCM
                     MMITMPGLPMLGHGQVEGFTEKYGMEYAKAYYDEQPDQHLVDRHYREIFPVMKKRPLF
                     AEVENFFLYDVYSPEGSVNENIFAYSNRLGEEKALVIFNNCAVQAAGWVSTSVGYRKG
                     DEIRQTSLADGLFLSREDNLYVIFRDQCSGMEFIRSNRIIAEQGLFVALEGYRYNLFL
                     DFREVKPSRLTPYDRLCAELNGNGTASIEHDVLFMSLEPLHRLLSEFLAPDNLAPLHG
                     TTENELIFPVFKTMIATLLQEVAVKYGNLLEKPVDVPATLADETVSRFRHACQMVEEM
                     ANLPESDRFNAALGTTEREKSGFSTILLHWLALDSLQEMLRANELLSSNLIDDWLMSN
                     TLQQLYSQKGLNGIPGDNIPDLLYCLLSEKPATLPADEESALYALLALLDASHSEHVA
                     RILQFENRHEKTWFREHRFSVLAAWLSVEAMLKKENLPVEQESGKTEHPVAGWVAAAR
                     KLDMQAFLSGYEMGALLRQKA"
     gene            complement(480951..481340)
                     /locus_tag="CPHA266_RS02250"
                     /old_locus_tag="Cpha266_0432"
     CDS             complement(480951..481340)
                     /locus_tag="CPHA266_RS02250"
                     /old_locus_tag="Cpha266_0432"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744323.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744323.1"
                     /db_xref="GI:500064436"
                     /translation="MITNNEPLNSIEARIEELHNTIAEKEEQIKTRTRQLKDDIQTEL
                     DPATVVRRHPFEIAGSIFVTGILIGRSVKSMVGSSRKHQSNTASASDSVPAKAPTQLS
                     VLGIDILRSVKDLGFTYLTHYLDKKIK"
     gene            complement(481324..481722)
                     /locus_tag="CPHA266_RS02255"
                     /old_locus_tag="Cpha266_0433"
     CDS             complement(481324..481722)
                     /locus_tag="CPHA266_RS02255"
                     /old_locus_tag="Cpha266_0433"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744324.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744324.1"
                     /db_xref="GI:500064439"
                     /translation="MGSSPVQKSGTAAPKRTHSGIPKMLDDTVTSTYEDVVSIVDAKI
                     ELLKLDLTKKISIVVAIVILALMLLLATAYLITTVALLLGELTGHLFIGYLLVSLIFL
                     GCFVFFAKFRPDLLQNLIQKTLLSAHDYKQ"
     gene            complement(481753..482040)
                     /locus_tag="CPHA266_RS02260"
                     /old_locus_tag="Cpha266_0434"
     CDS             complement(481753..482040)
                     /locus_tag="CPHA266_RS02260"
                     /old_locus_tag="Cpha266_0434"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744325.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744325.1"
                     /db_xref="GI:500064441"
                     /translation="MEQEVPVTIHQGETVEAEAAETMPKPDAAYIPELIKEIASTVSE
                     TFSGFRESESYGQLIKAAEEVRTYIKNNPAQALLYSLGAGAALGFLFKKRR"
     gene            complement(482133..482882)
                     /locus_tag="CPHA266_RS02265"
                     /old_locus_tag="Cpha266_0435"
     CDS             complement(482133..482882)
                     /locus_tag="CPHA266_RS02265"
                     /old_locus_tag="Cpha266_0435"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744326.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_011744326.1"
                     /db_xref="GI:500064443"
                     /translation="MTVSGNKVCFMTGATGGLGSELALSIARQGYSVFFTWNASRLKA
                     EKTLEKIRRISPESDMIRCDIAKPKEIQQAFNAFLEKFSRLDLLLASASNFYRTGLPD
                     VSETEWDNLVDTNLKGTFFTMQEAVKIMRNQSFVSRIITMTDVSADLVWRHFAPYTVS
                     KAGIQHLVKIFAREFAPQVLVNAIAPGTITSNADLQRDEHSVEEKKLIEKIPLQRLGN
                     PLDISRAVLFLLESDYITGQIISIDGGRVLG"
     gene            complement(482952..483377)
                     /locus_tag="CPHA266_RS02270"
                     /old_locus_tag="Cpha266_0436"
     CDS             complement(482952..483377)
                     /locus_tag="CPHA266_RS02270"
                     /old_locus_tag="Cpha266_0436"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744327.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_011744327.1"
                     /db_xref="GI:500064444"
                     /translation="MNISARNIFKGTIASIIIGAVNAEVNLALEDGTTLCSIITIGAV
                     KQLGLQEGMAAYGIIKASSIILGSNMQDARISARNIMSGTIRKIVDGPVSTEVDIEIG
                     AGNTLSAVITHESARKLGLKEGGDACAIFKASSVMLGVN"
     gene            complement(<483834..484418)
                     /locus_tag="CPHA266_RS02275"
                     /old_locus_tag="Cpha266_0437"
                     /note="transcriptional regulator; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(484431..485300)
                     /locus_tag="CPHA266_RS02280"
                     /old_locus_tag="Cpha266_0438"
     CDS             complement(484431..485300)
                     /locus_tag="CPHA266_RS02280"
                     /old_locus_tag="Cpha266_0438"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744329.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTPase"
                     /protein_id="WP_011744329.1"
                     /db_xref="GI:500064447"
                     /translation="MIILSITKTLSGAEGPFELSLDLSLQPETLHTLFGRSGSGKTTT
                     LRILAGLTQPDSGHIEVNGRVWLDSAAKINLPPQKRKVGFVFQDYALFPTMTIKENLL
                     FAQKTKNEQKVNELLELTHLSVLHNRYPTKLSGGQQQRVALARAILREPDILLLDEPL
                     SALDQSTRLRLQDEIMSFHKRFRLTTVLVSHDKQEVFKLSDRVTVIDRGRIIRTGSPL
                     EVFLDRTTSNKFSFASTILSIRKVDCIYLAVIGAGNELVEVVLSRHDFETLKVGDEVL
                     VASKAFNPLVIKL"
     gene            complement(485334..485729)
                     /locus_tag="CPHA266_RS02285"
                     /old_locus_tag="Cpha266_0439"
     CDS             complement(485334..485729)
                     /locus_tag="CPHA266_RS02285"
                     /old_locus_tag="Cpha266_0439"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744330.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_011744330.1"
                     /db_xref="GI:500064448"
                     /translation="MNRLSAVISSIDQYESLFMLELDASGITLEMLLFDLQPFFRTGS
                     SVQVLFKETEVALAKGLAEETSFSNIFPAIITAIKKGRILAEISLQSKAGSMGSIITM
                     KAAMRLGLQIHDEVTVLVKASQLSLEALP"
     gene            486186..488390
                     /locus_tag="CPHA266_RS02290"
                     /old_locus_tag="Cpha266_0440"
     CDS             486186..488390
                     /locus_tag="CPHA266_RS02290"
                     /old_locus_tag="Cpha266_0440"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744331.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-denpendent receptor"
                     /protein_id="WP_011744331.1"
                     /db_xref="GI:500064449"
                     /translation="MKKTALLVFLLAFPALASASEISEAYPSAEEVTVTGKKGDILQQ
                     VTGRESELLNPSQMSVYKAINLMPSLSQQSVDPYGLADIVNYHESFRFRGVEATSGGV
                     PATTVNVEGLPVTGRPGGGATIYDLENFSNINIYTGVMPASAGLGLADVGGKINMEIR
                     RPEESFGVLFKQGFGSNDFRRTFLRVDTGALPGDVKSFISFSDAAADKWKGEGDSQRR
                     NVMAGVTKTFGDNVKLEAFVTYSKGDIHAYRPFSYAQIGNLESAYTIDYGTNPDSYDY
                     YGYNRNEFEDWMVMANLEVKTGEHSKLDIKPYYWSDKGYYLETITLANNQNRIRRWDI
                     DHDLKGVLAEYTTTIGSVDLDFGYLYHTQVRPGPPTSWKNYKVVNGKPVFDQWNILSN
                     SSSHELHSPFLEATYRFGSWKLEGGLKYINYTLPSIITYNTAGLGDLSYDEALAGNPS
                     INAKASALDTKSFSRLFPNLTLTRFIGDNISLHAAYGENYVTHVDIYPYFISQSANFI
                     QKGISFQQLWDAREMETSQNFELGMRVKGSNWSIAPTIYYALHNNKQAVLYDPVLDAT
                     YPMNNADAEGYGFELEAEYKPLENLSCYGSFSWNRFSFSQDINSDAPGGGIIKVKGEQ
                     VPDAPEFLAKGMVSYKAGDFLITPIVRYTSVRYGDVLHNEKIDSTTLFDLDLTWQKKM
                     LGFKEVEISLSLLNIFDKQYVSMISTSDYKTLKTSYQAGMPFTVMATLAVHY"
     gene            488490..489215
                     /locus_tag="CPHA266_RS02295"
                     /old_locus_tag="Cpha266_0441"
     CDS             488490..489215
                     /locus_tag="CPHA266_RS02295"
                     /old_locus_tag="Cpha266_0441"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744332.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_011744332.1"
                     /db_xref="GI:500064450"
                     /translation="MTRKLFPPLFLLFSLFSVTLRAETIIIASGAGYKRPLMEIAGKY
                     EKKTGRHIDAVFGNMQQIITQAQMSGNVSIIFGDKSFFDQSAISFAGYYPVGEGKLVL
                     AWRKGLQVKRITDIREKRIARLGIPDEKKAIYGRVASEYLEKSGLSGAVKGKLLVVST
                     VPQVSAYLVSGEIDAGFINITDAIGIQENIGGYLVAGQSLYTPIHIQAGVVKGFEGRS
                     DIRDFLQFLKEKESVAVLHHYGL"
     gene            489215..489895
                     /locus_tag="CPHA266_RS02300"
                     /old_locus_tag="Cpha266_0442"
     CDS             489215..489895
                     /locus_tag="CPHA266_RS02300"
                     /old_locus_tag="Cpha266_0442"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744333.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdate ABC transporter permease"
                     /protein_id="WP_041467158.1"
                     /db_xref="GI:752830856"
                     /translation="MESCISMLSVRELADPVLLTLETAAITMILHLLAGVVSGYLLTG
                     KQSVFGLIADALITLPLVFPPIATGFLLLLILGRTGFIGAPLQQMGVEIIFSRSGVFI
                     ASFTAGLPLVVKSVQSAIAAMSGSLSEAAWTLGKSRVQTYFFVVLPAIRHALFTGLIL
                     SLGRSLGEVGITLMLGGNIIGKTETVSLAVYNAVFEGNFEKAALLSTLLGILSLAMFY
                     GLKKMGST"
     gene            490096..490854
                     /locus_tag="CPHA266_RS02305"
                     /old_locus_tag="Cpha266_0443"
     CDS             490096..490854
                     /locus_tag="CPHA266_RS02305"
                     /old_locus_tag="Cpha266_0443"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744334.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrin-III C/tetrapyrrole
                     methyltransferase"
                     /protein_id="WP_011744334.1"
                     /db_xref="GI:500064452"
                     /translation="MTQENIHNPVSIVGTGPGDPDLLTVRASRIIRSADVILYDCATA
                     KPALSIASETAIIHEVNRQASAGKPSILELIEMYYHEGRKVVRLKVGDPMLFGGEIDE
                     CRALKALNIPFEVVAGITAGSSAASSYALPISLKYQSNSVTYIIADEPGADFALFRDA
                     SRLLRHGSTIVLYMATKNLENIFRVFVEEGVPETMAVFAVGKSGWPDESSAEGTMRDI
                     VAQIELRQLKEPIIFFLGRHLTKEKHFPVMSACS"
     gene            490938..492941
                     /locus_tag="CPHA266_RS02310"
                     /old_locus_tag="Cpha266_0444"
     CDS             490938..492941
                     /locus_tag="CPHA266_RS02310"
                     /old_locus_tag="Cpha266_0444"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744335.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-denpendent receptor"
                     /protein_id="WP_011744335.1"
                     /db_xref="GI:500064453"
                     /translation="MKKIVLLVLLLAATETVFAAELPSDLPVSGIKVFTAGEVTVSGK
                     KDHAKETVAATEMEMLDKKNIAQAVNMLPGINVSNVGGRNEGMVYVRGFDMRQVPLYL
                     DGIPLYVPYDGYIDPNRFTTFDLSEINVSKGFTSVLYGPNTLGGAINMVSRKPAERFE
                     GSLKGGLTFSDEGLASEFASLNLGSNQGTWYVQGSLSILDRDFMQLSDSFLATKSEDG
                     SKRDNSDSRDFRGSLKVGYTPNSTDEYSLSIISQQSSKGVPVYTGINPTQTVRYWRYG
                     DWDKSSIYFIGKKALGSKSYLKARAYYDNYYNTLQSYDDASYATQKTKKAFSSRYDDK
                     TFGGSIEFGTEILSGNTLKIALHDKYDMHNEIGNTGEMPKEFEDNTVSVAAENTWKAS
                     DNISVIAGVRQDFRHTIKAEDLVGGVITSFPLEDNQATNLQLAVVGRLSESQELTAYL
                     TRTTRFPTLKDRYSYRLGNAFPNPELKPEQSLNYGLDYAIRPADQLKFQASVYQSKLS
                     DVIQQVNNIAYVKGIWVYQFQNTGEATFTGFECSVDWQPVSWLRAYSGYSYIDRKNDS
                     NPSLRFTDIPRHKFTGYLQFLFNKDRWAIVESEYYSRRYSTSDGKYTAGAYGLINLRA
                     STVLYDTLSLQASVENVFDRNYEVAEGYPEAGRQYVVSLAWAL"
     gene            493033..494043
                     /locus_tag="CPHA266_RS02315"
                     /old_locus_tag="Cpha266_0445"
     CDS             493033..494043
                     /locus_tag="CPHA266_RS02315"
                     /old_locus_tag="Cpha266_0445"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744336.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter permease"
                     /protein_id="WP_011744336.1"
                     /db_xref="GI:500064454"
                     /translation="MSARLLIVTSLFVLAAAAILSLFVGRYQVSPAALFRYLATGYSS
                     DANLETVLLDIRLPRLIASVAAGGALSLAGSAYQGMFRNPMVSPDILGVSSGAGFGAA
                     LAILLSLPPAGIQLFSFSGGVTAVLVALGIARTIGRSHDATLVLVLSGIIISSLFGAL
                     LSLLKYAADPDDKLPAIIYWLMGSFADSSMKDLGLIIPLLLAGVIPLMLVGWRLNVLS
                     FGDEEARSLGINTGLMRVLVIACATLVSACMIAVSGIIGWVGLVVPHLARFVAGPDHR
                     VLLPVSFLFGGTIMLCADVLARSLLPVEIPVGIITAITGAPFFLWFLKQSTAAAWDSK
                     RG"
     gene            494022..494822
                     /locus_tag="CPHA266_RS02320"
                     /old_locus_tag="Cpha266_0446"
     CDS             494022..494822
                     /locus_tag="CPHA266_RS02320"
                     /old_locus_tag="Cpha266_0446"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744337.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter ATP-binding protein"
                     /protein_id="WP_011744337.1"
                     /db_xref="GI:500064456"
                     /translation="MGFKKRVTLDITHADFGYQGRAVLRDVTFRMDSGDIVCVLGANG
                     AGKTTLFKTLLGFIRPISGALMLNGIELSQYKPRELARLIAYVPQAHHVPFSYTAGDV
                     VLFGRAVHLGLFASPGKNDRIIASRSLELMEISHLADKPFTELSGGERQMVIISRALA
                     QEAPLLILDEPTSNLDYGNQIRVISKIKELQKAETGVLMATHMPDHAFMLASKAVIMH
                     KGSLSFSDVSETIVTPEVLKQLYGVDVRIFDTPFDGHAGRKVCAPVLD"
     gene            494843..495475
                     /locus_tag="CPHA266_RS02325"
                     /old_locus_tag="Cpha266_0447"
     CDS             494843..495475
                     /locus_tag="CPHA266_RS02325"
                     /old_locus_tag="Cpha266_0447"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744338.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type 11 methyltransferase"
                     /protein_id="WP_011744338.1"
                     /db_xref="GI:500064457"
                     /translation="MYSMDAKEFNDKIMNGHFRKIYPVIARQIVDRTGISEGCCVDLG
                     GGPGLLGISLAKITRLQVTVYDLMPECVALALQNSVEHGVDDQVTAQQGIAECMPFDE
                     NSLDLVVSRGSIFFWENQMQGLAEVYRVLKPGGWAYLGGGFGTSELLREIELLMADEA
                     DWNRKRQERMVKNPPEQFESMLRQLGIEGRVEQDDAGMWVVFCKQKSAKA"
     gene            495472..496581
                     /locus_tag="CPHA266_RS02330"
                     /old_locus_tag="Cpha266_0448"
     CDS             495472..496581
                     /locus_tag="CPHA266_RS02330"
                     /old_locus_tag="Cpha266_0448"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744339.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_011744339.1"
                     /db_xref="GI:500064460"
                     /translation="MSGGFIGSYIAVVRIAAVLILFFTTACSPHEDRRYTRIVTDMAG
                     RTMGVPDTIKRVYVNRPGALMLYALAPELLVNRSFRMTDSGRRFMKESWLTLPYVDGS
                     AEEIIRLKPDVIISCFTIDAKSMADARRLEEKTGIPVFQVPLDMSRYEKTFMVLGTLL
                     DRKEQAERMTGFLHAYLDELLSKAREIPPSRKVRVYYAEGDRGLQTDPSGSFHSEILE
                     RVGARNVAEVPITGGKGMSSVSMEQILFWDPDVILVWTGMGPSLTTLLEIESDSLWAK
                     ARAVRQKRLFQIPLQPFGWFDRPPGTNRILGAIWTAQLLYPDLYRFDITRITREYFRI
                     FYHHELTESELREVLDPHAEPLPEKGARTNKSKGL"
     gene            496578..497285
                     /locus_tag="CPHA266_RS02335"
                     /old_locus_tag="Cpha266_0449"
     CDS             496578..497285
                     /locus_tag="CPHA266_RS02335"
                     /old_locus_tag="Cpha266_0449"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010933417.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467159.1"
                     /db_xref="GI:752830857"
                     /translation="MMQSVNRNDSKSDVLALCGAVPMHRKSTGNGVPLLKKGAINLYM
                     NMPCPLKVVTKMVITEFAEIYNASHAVPIYSPMLHDGYVKDGKNNIPAYELQNISRAM
                     TRGIELTASIKLPYGLTVSDELTFLDSEDKSKGQDLLYVPDVTNTLKLAYGAERSGFN
                     GNIRVVSVGTQWVENNVRADGYTLVNAYLAKKVSSDTSLFFGVDNIFNEDPAAYGNIG
                     GAGSTGTCFYGGLTFTL"
     gene            497306..497857
                     /locus_tag="CPHA266_RS02340"
                     /old_locus_tag="Cpha266_0450"
     CDS             497306..497857
                     /locus_tag="CPHA266_RS02340"
                     /old_locus_tag="Cpha266_0450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744341.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744341.1"
                     /db_xref="GI:500064635"
                     /translation="MKNSTKGGKTLSRLLFVLSFFSAVAQAKPSGTLSETVRVSGLVE
                     KPFTISTTSVGTMNVAERENTAIICDSGQTRKSLKSFRGVLLRDILDSAKVVLSNPGQ
                     RGEYYVLVRSTDNYNVLFSYNELTYGTAGESTWLVFEENGKPIDDDGRFVVFCASDRA
                     TGPRHVKWVNGIEVSKIILPVSN"
     gene            497883..498281
                     /locus_tag="CPHA266_RS02345"
                     /old_locus_tag="Cpha266_0451"
     CDS             497883..498281
                     /locus_tag="CPHA266_RS02345"
                     /old_locus_tag="Cpha266_0451"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744342.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C"
                     /protein_id="WP_011744342.1"
                     /db_xref="GI:500064638"
                     /translation="MHRFYLSILLFGFCFLKTEILFAATDNATGQQLFDRHCSVCHSM
                     EPPPKTAPPVLGIALHYREAFGDKTLATEYMVKFMQKPDPPLSKLEPAAIRRFGLMPP
                     MSMSLQELKKVAAWLWDSYDPQFKTPGNCR"
     gene            complement(498301..499356)
                     /locus_tag="CPHA266_RS02350"
                     /old_locus_tag="Cpha266_0452"
     CDS             complement(498301..499356)
                     /locus_tag="CPHA266_RS02350"
                     /old_locus_tag="Cpha266_0452"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744343.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdate ABC transporter ATP-binding protein"
                     /protein_id="WP_011744343.1"
                     /db_xref="GI:500064640"
                     /translation="MNLLIDAEKKQGDFLLRVNTGVSGERIGIFGQSGSGKSTLVHLI
                     SGLLQPDRGEIFLNDECLFSTTKGINLSPERRRIAIVFQQAMLFPHLSVKANLLYGYR
                     RCRTENRHIKPETLIALLKLQPLMQRGVNNLSGGEKQRVALGRAVLANPRLLLMDEPL
                     SALDDTLRFQIIPYLKSVSEEFAIPYLFISHSILEMQLMADRILVLKKGSIAETTTPD
                     QLARNCMAHNPKGYLNLLHLADPVLHKGLYAYPWGHNTLLISDGEPSGTSLFELSSRD
                     IILFKQHPEAISARNLLKCTVSELFRSDGRVGVVLLSNGEKFVAEIVRSAAEDLNITA
                     GSTLFAAIKASSFRRLG"
     gene            complement(499353..500039)
                     /locus_tag="CPHA266_RS02355"
                     /old_locus_tag="Cpha266_0453"
     CDS             complement(499353..500039)
                     /locus_tag="CPHA266_RS02355"
                     /old_locus_tag="Cpha266_0453"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744344.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum ABC transporter permease"
                     /protein_id="WP_011744344.1"
                     /db_xref="GI:500064642"
                     /translation="MTLTPEDIAAIWLSLKVALTATALALPLGFALAWLIVFKRFRGK
                     VVLEVLINLPLTLPPVVIGFFLLLLLGKNGWIGKLLDGSGIQIIFTWKAAVIASATVG
                     FPLLVRSIRLGMESIDQQLIEASRSLGAAWYDTLATIILPLSLRGIMAGSSLMFARSL
                     GEFGATIIVAGNIPGITQTIPLAIYDYASSPSSTTMALSLCVVSVLISVVVLIVHELL
                     GKKLDRRSAL"
     gene            complement(500076..500822)
                     /locus_tag="CPHA266_RS02360"
                     /old_locus_tag="Cpha266_0454"
     CDS             complement(500076..500822)
                     /locus_tag="CPHA266_RS02360"
                     /old_locus_tag="Cpha266_0454"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744345.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_041467490.1"
                     /db_xref="GI:752831188"
                     /translation="MISMRKTLLLFFALLTISVPAMAGELSLSVAASLKEVINELSAS
                     YSKKNPGTTFVKNFGPSGTLAGQIENGAPVDLFIAANNQWMDYLKEKKLVDGANSGML
                     AYNSLVFAGTTTKKVTSMNDLLKLEKIAIGSPKSVPAGEYAMTAFKNAGIDKQLAGKL
                     VMAKDVRECLMYAELGEVDGGFVYRTDAMLAQKAKLLFAVPQKLYPRVTYPMALTAKA
                     AQNKEAKAFFLYLRGAEAKNVLGKYGFVLK"
     gene            complement(500853..501698)
                     /locus_tag="CPHA266_RS02365"
                     /old_locus_tag="Cpha266_0455"
     CDS             complement(500853..501698)
                     /locus_tag="CPHA266_RS02365"
                     /old_locus_tag="Cpha266_0455"
                     /EC_number="2.4.2.19"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744346.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyrophosphorylase"
                     /protein_id="WP_011744346.1"
                     /db_xref="GI:500064651"
                     /translation="MLYQLPDTDIERFIEEDMPYGDLTTSLLGIGNAQGSITFTSRHL
                     TVLSCTEEACRVLERCGARVTSSMPSGTSVEAGVMFLSAEGSAASLHAGWKVALNLLE
                     YASGIATRTAAIVNSARAVNPAVSVVTTRKSFPGTKKVAIKAIMAGGAMPHRLGLSES
                     ILVFRHHTAFQGGLESFLETLSSLKQRAPENRVIVEADTAKEALQIAAAGADVVQVDK
                     MPSEELAILVAGIHRQFPGVKVSAAGGINADNAAIYASTGVDILVLSSVYFGKPSDIA
                     ALINP"
     gene            502184..502366
                     /locus_tag="CPHA266_RS02370"
     CDS             502184..502366
                     /locus_tag="CPHA266_RS02370"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467160.1"
                     /db_xref="GI:752830858"
                     /translation="MGRGRDDRGGGVAGYKFGLWITGFWIPDFEFWIEGGEPQALYRL
                     SCAARSPLPALRTQNL"
     gene            complement(502390..502815)
                     /locus_tag="CPHA266_RS02375"
                     /old_locus_tag="Cpha266_0456"
     CDS             complement(502390..502815)
                     /locus_tag="CPHA266_RS02375"
                     /old_locus_tag="Cpha266_0456"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744347.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744347.1"
                     /db_xref="GI:500064653"
                     /translation="MKKLSILFLALIIVAAATVSASAKCKYPGIEISEKQGVGHYLTD
                     DNGMALYWFTKDSPGTSTCAGPCLEKWPAFYHEKFVKPKALSMEEFGTIMRADGKPQL
                     TFRGYPLYLFAGDKAAGNTNGQGVNNVWFVVNPGNFPPK"
     gene            complement(502812..503117)
                     /locus_tag="CPHA266_RS02380"
     CDS             complement(502812..503117)
                     /locus_tag="CPHA266_RS02380"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467161.1"
                     /db_xref="GI:752830859"
                     /translation="MRFSDYHNPQYPGFRCAAEAKEEFWTQAAPLKNINGFTVKKQKF
                     RSLRNRNACQKASGIILAVVTMICSADLQLLGCHEGFLKKETDNITYHPKLQDRSNR"
     gene            503165..506314
                     /locus_tag="CPHA266_RS02385"
                     /old_locus_tag="Cpha266_0457"
     CDS             503165..506314
                     /locus_tag="CPHA266_RS02385"
                     /old_locus_tag="Cpha266_0457"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012508868.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal transduction protein"
                     /protein_id="WP_011744348.1"
                     /db_xref="GI:500064655"
                     /translation="MADISARVVKILIASPSDIKEERDIAELVIHRLKIQSEDSVRLV
                     LEPKRWELDAASEMGLSPQEIINRQMVDECDCAICIFWTRIGTPTEIAPGGAVEELEL
                     MLKREKLVMPYFSDVKVSLSGIDRDQWNRLEEWKKTLVTEKRGFIKSYRDIYEFKEML
                     THDLEKQLRARFCQPASGGDDTVDKSKKKGSRVIDDSVFRYQTTLKRQLETITLAGSP
                     AFESLPVKLSEIFVSLRIANRSTGETSLNGHEEEEAHRSLSPEKIMQQAFKQHNLLLV
                     IGDPGSGKTTLLKYYALSCLDDERYKELGFNEPVPVIFLSLRDLVQLDNGYAPLPENL
                     RELFRKHSFGRHDEEDLSRWLDDNTTLFLLDGLDEISDTEDRKKVCRWIDDTARRFAK
                     ACFVVTSRITGYRKSDGIELEFSHFRADIMDFTDSQQEEFLHRWFAAVGEQDVGSSQQ
                     ANASQTAESIILFLRQSANEGLRTLARVPLLLQIMAILWKNCGYLPNSRTELYDAALN
                     YLLDYRDRQRGKNPLLPKKEARLVLGPVSLWMQESVERDEVGKDAMHRRMQSQLDDLR
                     NPPSAEDFCENLVDRAGLLVEIGDDDYRFCHKTFREYLAGVQLVMEHSDEQLNTLVAH
                     FGDDWWQEPLRFFMAHVDAKLFDAFMQRLFASPVSKTLTPKQQSLLKLLVEEASGRKI
                     DALKSKLHDPNTVSDRKTDDDLKEADNQKRYVLECLKTIGSPEAIAAIREFVHAEPKL
                     TGDREIIRLAARISGDLVDDAPADIGATIPRKDIPSVLQSSHEQNAHYILIKGGSFIY
                     SVTKKAQQVSDLYVATYTVTNALYRRFITFLQTGVVPGFDHLPVSVFSDALHELASRH
                     ETKGFTEYLKEKSDPAERFRSPYDDDKQFNGDDQPVVGVSWYDATAYCLWLSLMESKG
                     VDAKRYRLPSEIEWEWAAGGRRDMPRKLLKVRSYPWGEEEPSPQRANFNLNEGQTTPV
                     GRYPEGATPEGLYDMAGNVWEWTNSWYDEVKKESFSLRGGSWGNKSANLSCSARVVVN
                     PDLRNGVIGFRVVRPSHLL"
     gene            506372..506692
                     /locus_tag="CPHA266_RS02390"
                     /old_locus_tag="Cpha266_0458"
     CDS             506372..506692
                     /locus_tag="CPHA266_RS02390"
                     /old_locus_tag="Cpha266_0458"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744349.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744349.1"
                     /db_xref="GI:500064657"
                     /translation="MLIVKRAYDFSKWLLHHTGKFPKSYRFTVAVRLENAVLEFTELV
                     AVANRRHHKEPLLKEADEVLVRLRLLVRLSFDMQFINENSYEYASRQIAELGKMLGGW
                     LKKL"
     gene            complement(506678..506929)
                     /locus_tag="CPHA266_RS02395"
     CDS             complement(506678..506929)
                     /locus_tag="CPHA266_RS02395"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467162.1"
                     /db_xref="GI:752830860"
                     /translation="MSCPEAVRSSLKKRHQLELLPHHKTGMIGTNNTKTDIVVPVVRI
                     VVVPGRARQIGRFVVPRTPAQRKGAQLPAFFHNGKLQFF"
     gene            507049..508080
                     /locus_tag="CPHA266_RS02400"
                     /old_locus_tag="Cpha266_0459"
     CDS             507049..508080
                     /locus_tag="CPHA266_RS02400"
                     /old_locus_tag="Cpha266_0459"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744350.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-directed DNA polymerase"
                     /protein_id="WP_011744350.1"
                     /db_xref="GI:500064659"
                     /translation="MKTEKNLFESVTAFENVLSAARNAAKGKRETRSVLLFYAQLEDN
                     LWQIIAELKSKTWQPGSFKSFSIYKPKPRLISAAPFRDRVVHHALINVVGPLLEQTFI
                     HDTYANRMGKGTHKAIRRYQHFLCRFDYALKCDIKKYFPSVDHEILKTSLRRRVACND
                     TLWLIDTIIDNSNSQDDHLHYFQGDDLFTPVERRKGLPIGNLTSQFFANYYLNFLDHF
                     VKERLHCKGYVRYVDDFVLFSDSRAELWRWKEEIERYLEEFRLVLNAQRTELFPTTEG
                     RCFLGQKVFQSYRLLPAENVRRAKKRVQASDVANPAAMKKMHSGWIGHARQANTGNLL
                     HAMGLDKHR"
     gene            <508439..511012
                     /locus_tag="CPHA266_RS02405"
                     /old_locus_tag="Cpha266_0460"
     CDS             <508439..511012
                     /locus_tag="CPHA266_RS02405"
                     /old_locus_tag="Cpha266_0460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012508868.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467491.1"
                     /db_xref="GI:752831189"
                     /translation="RYRSSLHEELCWIRMPGLPGGIESIQVNLDDDTFVQLRFSESSS
                     EGEPSMSDDLLKQRNELSAERLPHEIIQRAFTSNRRLLLVLGDPGAGKTTLLQYYALC
                     ALDQKRYRKLGFTKPPKVFYLPLRELTNHGSTLPENLSQHAKKWYQQDIDSRIIDKWL
                     QNETVTSLVLLDGLDEISDTVKRQEACKWIDRILTGFQHVHIVVTSRRTGYGREDALK
                     PQVVLTSDHKRASVQDFSREQQELFLKNWFNAAFLREERPDNVDEKIWKEQQLAKAKN
                     RSDRIIAVLKEEKHKALRQLAAVPMILQLMALLWKNNEFLPGSRMELYHSVLNYMLEL
                     RDKQKEIDSQLSAERARKVLAPVALWMQEELKQDEADKQLMQKQMQQWLDTLVDRQYV
                     PPTADDFCDHLVLRAGLLAKIGESRYVFRHKSFREYLASIELVKKTLRSTCYIDTLIS
                     SFGDPWWNEPMRFFIAQTDAVQFDCFMDKLVASVGEEEFSPDKMPLLYTLIEEAPQKK
                     VQALSERLLAEATTASCQRVILDCLNAIGQPIALETLQSFVNLKRAKNSSVASRAEEV
                     MLALLPAAGVTSSSGSAADAHSENSGSYRNRFEQYAEYIRIPGGSFRYSVTGGIENVS
                     ELRVARYPVTNKRYRAFISYLQSRKPEDEALNKFYRKVLGEIARDHTWDSGFSDYYHK
                     GSKDLAGLFRSKLDEDRKFGGDDHPVVGVTWYAAKGYCLWLSLLESEGRERQLYRLPT
                     DLEWEFAAAGEEGRNYPWGNEEPTPQRANFNENIGATTPVENYPEGATPEGLYDMAGN
                     VWEWTNSWYDEVKKESFSLRGGSWLNLSANLSCSARIFVNPVSRNYGFGFRVVRPSHL
                     L"
     gene            511666..512001
                     /locus_tag="CPHA266_RS02410"
                     /old_locus_tag="Cpha266_0461"
     CDS             511666..512001
                     /locus_tag="CPHA266_RS02410"
                     /old_locus_tag="Cpha266_0461"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744352.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ArsR family transcriptional regulator"
                     /protein_id="WP_011744352.1"
                     /db_xref="GI:500064666"
                     /translation="MQRSLSVVEYSGNEEALAGIAKALGHPVRIRILRLLSKEACCFT
                     GELTELIPMAQSTISQHLKALLESGLIQGEINPPKVRYCINRESWRKAQLLFGDFFGE
                     ESGVGRGQC"
     gene            512217..512453
                     /locus_tag="CPHA266_RS02415"
                     /old_locus_tag="Cpha266_0462"
     CDS             512217..512453
                     /locus_tag="CPHA266_RS02415"
                     /old_locus_tag="Cpha266_0462"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744353.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744353.1"
                     /db_xref="GI:500064669"
                     /translation="MKRVKVLGSGCAKCGQLMDAVKAVIAAEGLDASVEKVEDMQQIM
                     AYQVLSTPALVVDEVVLSRGRVPSRDELKDLLTR"
     gene            512465..512863
                     /locus_tag="CPHA266_RS02420"
                     /old_locus_tag="Cpha266_0463"
     CDS             512465..512863
                     /locus_tag="CPHA266_RS02420"
                     /old_locus_tag="Cpha266_0463"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744354.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfurtransferase"
                     /protein_id="WP_011744354.1"
                     /db_xref="GI:500064671"
                     /translation="MKQVVDVCPTTALGMIERGALLVDVREPDEVAGASFAIPDVMLV
                     PFSEFEERFREIPVERDLIIGCMVGERSLRAASFLMHHGYERVFNMQDGIVRWAEKGY
                     PLRGSLTGTSHACCCGGTSHGAANNGGKCC"
     gene            512914..513966
                     /locus_tag="CPHA266_RS02425"
                     /old_locus_tag="Cpha266_0464"
     CDS             512914..513966
                     /locus_tag="CPHA266_RS02425"
                     /old_locus_tag="Cpha266_0464"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744355.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011744355.1"
                     /db_xref="GI:500064673"
                     /translation="MNRFQNHVPERSALLWFAGVAAAALLWLFLYSNLQVFADLFLLA
                     AGLGRSDRFGEAVHFFVFEVPKVLLLLIAVVFLMGVVHTFVSPERTRALLSGRRTGVG
                     NVMAASLGVVTPFCSCSAVPLFIGFLQAGVPLGVTFSFLISAPMVNEVALALLFGMFG
                     WQVALLYMAMGLLVAIVSGLVIGRLRMERYLEEWVQKLQESGVSVDVENEVMRWPLRF
                     REGVNHVREIVGKVWFFIVLGVGLGAGIHGYVPENFMAALMGSEVWWSVPLAVVIGVP
                     MYSNAAGILPVVQALLGKGAALGTVMAFMMSVIALSLPEMIILRKVLRPQLIAVFAGV
                     VAAGIMLVGFVFNAVF"
     gene            513997..514425
                     /locus_tag="CPHA266_RS02430"
                     /old_locus_tag="Cpha266_0465"
     CDS             513997..514425
                     /locus_tag="CPHA266_RS02430"
                     /old_locus_tag="Cpha266_0465"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744356.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein tyrosine phosphatase"
                     /protein_id="WP_011744356.1"
                     /db_xref="GI:500064679"
                     /translation="MKQSILILCTGNSCRSQMAEGFLRSFDPELEVFSAGTSPASSVH
                     PLAVQVMREEWIDISGNRPKLVDEFLQRPFDYVVTVCDGAKESCPAFTGTVKNRVHIG
                     FDDPAGATGSREEQLDVFRRVRDEINTRFRQFYNETEKGE"
     gene            514430..515491
                     /locus_tag="CPHA266_RS02435"
                     /old_locus_tag="Cpha266_0466"
     CDS             514430..515491
                     /locus_tag="CPHA266_RS02435"
                     /old_locus_tag="Cpha266_0466"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744357.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arsenic resistance protein ArsB"
                     /protein_id="WP_011744357.1"
                     /db_xref="GI:500064680"
                     /translation="MGMSTKQLSFLDRYLTLWIFLAMGIGVLWGYLFPGIAGFWNHFQ
                     RGTTNIPIAIGLIVMMYPPLAKVKYEELGDVFRNTRVLGLSLLQNWVVGPLLMFVLAV
                     IFLSDMPHYMAGLIMIGLARCIAMVIVWNELAKGDTEYAAGLVAFNSIFQVLFFSLYA
                     WVFLTVLPEWLGMTTVAVDITIGEIAGSVFIYLGIPFIAGFLTRFFLLRLKGREWYEG
                     EFIPRISPLTLISLLFTIVVMFSLKGEYIVTIPMDVVRIAIPLLIYFVIMFLLSFYMA
                     RKAGADYPKTATLSFTAASNNFELAIAVAVSVFGINSGEAFAAVIGPLVEVPALIALV
                     NVSLWFRGRFFATQESGFQ"
     gene            515696..517575
                     /locus_tag="CPHA266_RS02440"
                     /note="protein-disulfide reductase; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            517656..518948
                     /locus_tag="CPHA266_RS02445"
                     /old_locus_tag="Cpha266_0468"
     CDS             517656..518948
                     /locus_tag="CPHA266_RS02445"
                     /old_locus_tag="Cpha266_0468"
                     /EC_number="1.-.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744358.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C"
                     /protein_id="WP_011744358.1"
                     /db_xref="GI:500064682"
                     /translation="MRQQVSRRDFNKLLLSGLAGSALGALAPFQRASAVSKRVIIIGG
                     GFGGAAAAKYLRKLDPSIAVTLIEPKAVYYTCPFSNWVIGGLRRIEDIAQTYTVLRNR
                     YQVTIIGDVAVALDPLRSTVRLKSGKVLNYDRLIVSPGIDFKWDAIEGYSQSVAESRM
                     PHVFQGGAQTVLLRKQLVSMKDGGTVLVCPPGGQFRCPAAPYERASLMAYYLKQHKPK
                     SKIIILDDKEKFSKQELFMQGWDRRYPGMIEWRSAAAGGKVSAVHAAAMTVSTEFGDE
                     KGAVINVIPPQKAGKIAFDGGLTDASGWCPVNPVTFESTIHPGIHVIGDSALAGAMPK
                     SGFAASSQGKVAAAAIVNLFQGRVPSSPTLVSTCYSLIGPAYAISVAGVYRLGVDGIV
                     EIKGAGGLTPLDADNDHLKEEADYAAGWYDNISRDNWG"
     gene            519409..519960
                     /locus_tag="CPHA266_RS02450"
                     /old_locus_tag="Cpha266_0469"
     CDS             519409..519960
                     /locus_tag="CPHA266_RS02450"
                     /old_locus_tag="Cpha266_0469"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744359.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="redoxin"
                     /protein_id="WP_041467492.1"
                     /db_xref="GI:752831190"
                     /translation="MIPSRTVAFALCIALCTVICQPLLAGAAEKRDKAALKVTSAPGF
                     AARSVQGAPISSDKLRGKAYIVNFFGSWCPVCRKELPDMVALQEKYEKKGFTFIGMAY
                     KDNAQSLPDFIWEHSINYPVVVADQTIVTAFGRQISGGLRAVPALFAVNSEGKLLSVV
                     VGAQSKAAFEELILNTLASGKKK"
     gene            complement(520137..520394)
                     /locus_tag="CPHA266_RS02455"
                     /old_locus_tag="Cpha266_0470"
     CDS             complement(520137..520394)
                     /locus_tag="CPHA266_RS02455"
                     /old_locus_tag="Cpha266_0470"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744360.1"
                     /db_xref="GI:500064690"
                     /translation="MNKKTTKALTLAAAVTSLGASLGVVTRHAEARTTLSQGTADTLR
                     QSDQIKLSNQQKLSTQGKISTQSKTHVQTGTSNQIKWQNSK"
     gene            complement(520419..521084)
                     /locus_tag="CPHA266_RS02460"
                     /old_locus_tag="Cpha266_0471"
     CDS             complement(520419..521084)
                     /locus_tag="CPHA266_RS02460"
                     /old_locus_tag="Cpha266_0471"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744361.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744361.1"
                     /db_xref="GI:500064692"
                     /translation="MIPVLRTKLDRQTPFGFSCKQCLQCCTAKKIQVNPYEIARLARN
                     LDISTTAFIARYTVHNGSFLQTTHNKTCLFLGAEGCLVHADRPLVCRLYPLARHVNHK
                     GDEWFSELQPEQGCRGIHKKTGTIENYLEEQGATPYMLAANSYLNLLWEMMTILESTT
                     QDDKDGTEEPENTMVENGQLMDMDAALNIYCQERELRVPRSVEKKMQMHLEALYLWTK
                     EKP"
     gene            complement(521178..521363)
                     /locus_tag="CPHA266_RS02465"
                     /old_locus_tag="Cpha266_0472"
     CDS             complement(521178..521363)
                     /locus_tag="CPHA266_RS02465"
                     /old_locus_tag="Cpha266_0472"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744362.1"
                     /db_xref="GI:500064700"
                     /translation="MLNKITKNYRKTEQYGGLHEWPEFLQAGWLHQAEIVQRDKPKDM
                     ALKKNFSVEKERPEKKN"
     gene            521449..522165
                     /locus_tag="CPHA266_RS02470"
                     /old_locus_tag="Cpha266_0473"
     CDS             521449..522165
                     /locus_tag="CPHA266_RS02470"
                     /old_locus_tag="Cpha266_0473"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744363.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_011744363.1"
                     /db_xref="GI:500064702"
                     /translation="MGTTMFRLEHIRRELALSRDVRQTIIPDLSLEIEAGEFVAITGP
                     SGSGKSTLLYMMGGLDKPTFGNVWLDGEELTEKDESEMNRIRNEKIGFIYQFHFLLPE
                     FTALENVSMPMMINGRFNKKEIKDRAKMLLDTVGLENKYTNKPSQLSGGQQQRVAIAR
                     ALANEPKVLLGDEPTGNLDSKSAKNVYELFDRLNQEKNQTIVVVTHDEDFANRAGRRI
                     HLVDGMIESDSPLRVMAGRS"
     gene            522244..523782
                     /locus_tag="CPHA266_RS02475"
                     /old_locus_tag="Cpha266_0474"
     CDS             522244..523782
                     /locus_tag="CPHA266_RS02475"
                     /old_locus_tag="Cpha266_0474"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744364.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744364.1"
                     /db_xref="GI:500064704"
                     /translation="MSSLLLQIKESYPMVYEAFSALPDGERHLRGIMELDRYWEHLHQ
                     PVPEVVKPGSELPEGVEVNGDFDLIYAGGTLSLLHAAVMARQYDRKVLVFDRHTPAQS
                     TRDWNISRGELLKLADTGVFSLSELESVILRAYKTGWVEFYKPDGSQKRLYIRNVLDC
                     AVDADLLLSMAREVVLSMPENRVLSQTSFTACYRFADHIVVEVTDSEGKSYHYRGKVL
                     VDMMGVRSPVAMQLNEGAPQTHVCPTVGTIASGFMDADFDTGEILASIAPADIASGTG
                     KQFIWEGFPAKGSEYITYLFFYDEVDSQNDKSLLGLFETYFRTLPEYKKIGPDFSIHR
                     PVYGIIPAYFHDGFSRTREIADDRIILFGDAASLGSPLTFCGFGSLVRNLHHLTADLD
                     LALDSNALSKKDLEKISAYEPNVASMANLMKYMCFNAETDEPNFVNDLMNEVMVVLDE
                     LPERYRQAMFRDEMKIEELVVVMLRVAWRYPKVLKATWDKLGVAGSTGFLKNLVGWVF
                     SSAR"
     gene            523801..525831
                     /locus_tag="CPHA266_RS02480"
                     /old_locus_tag="Cpha266_0475"
     CDS             523801..525831
                     /locus_tag="CPHA266_RS02480"
                     /old_locus_tag="Cpha266_0475"
                     /EC_number="6.5.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BDQ5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent DNA ligase LigA"
                     /protein_id="WP_011744365.1"
                     /db_xref="GI:500064706"
                     /translation="MSDAVNVRKAIEELRREINRHNTLYYVDARPEISDYEFDRLMER
                     LIELEKAFPDFVTPDSPSHRVGGAITREFPSVRHREPMLSLSNTYSLAEVEDFYSRVK
                     KLLLVEGVREQDMAAELKFDGVAISLLYRDGLLVQGATRGDGTEGDDITTNLKTLSSV
                     PLRIPLTSLPVIEGIERDIEIRGEVFMQKDDFARLNEARPEEDRFANPRNATAGTLKL
                     QDSGEVARRRLNFVAYYLRLSSQDSFLLTQYDRLELLGQLGFFTGKHYRLCRDMKEIG
                     DFIGYWAVERWNLPYETDGVVLKLNDVALWPRIGATAKSPRWAIAYKYPAQQAKTVLQ
                     GVAFQVGRLGTVTPVAELEPVRLAGSTVSRSTLHNFDEIERLGLMLHDRVIIEKSGEV
                     IPKVIRVVLDERPENAEPVGVPSVCPECGASLEKPENEVSYYCPDQDSCPAQIRGRLL
                     HFASRNALDIQSLGESLVAQLVQKGLVRDAGDLYLLQQPQLEALERMGRKSAHNLLRA
                     LQESREKSYERLLYALGIRHVGQATARELARAYETVEALQNASEEELATVPDVGPVVA
                     HSVKDYFSKSSTQMLLRKLRDAGFPLRFTGPQKLINRNFEGVNVLFTGALERYGRQQA
                     SELVQQRGGRVVGSVSRSTGVVVAGSEPGSKLDKARKLGVKVISEDEFNAML"
     gene            525843..526499
                     /locus_tag="CPHA266_RS02485"
                     /old_locus_tag="Cpha266_0476"
     CDS             525843..526499
                     /locus_tag="CPHA266_RS02485"
                     /old_locus_tag="Cpha266_0476"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744366.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744366.1"
                     /db_xref="GI:500064707"
                     /translation="MDAYYRVAMFGSARIQEGDQDYRDVFHIAKGLAEAGFDIVTGGG
                     PGLMQAANAGSKSAQSGSYSIGLNIRLPREQGPNAFLDIKGEFDRFSSRLDTFMALSD
                     AVVVAPGGIGTLLELFYAWQLVQVEHICDTPIILYGEIWTSLLLWLETEVMPRHFFNK
                     ADMHMLFHVMDPVHVVELVKKIHKDKLQDEHPCKNFSKYRRALQSVNGTNSGNFTSLL
                     "
     gene            526577..526879
                     /locus_tag="CPHA266_RS02490"
                     /old_locus_tag="Cpha266_0477"
     CDS             526577..526879
                     /locus_tag="CPHA266_RS02490"
                     /old_locus_tag="Cpha266_0477"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744367.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744367.1"
                     /db_xref="GI:500064709"
                     /translation="MTPATCDFGVTIQDKVLHFLAFYLLSLLVDFAFPKTPFGAVKIM
                     GLLGYGLAIEIAQSFMPYRCCSLYDLLADVCGIALYLISIPLWKHVPLLRERWEEE"
     gene            complement(527206..527931)
                     /locus_tag="CPHA266_RS02495"
                     /old_locus_tag="Cpha266_0478"
     CDS             complement(527206..527931)
                     /locus_tag="CPHA266_RS02495"
                     /old_locus_tag="Cpha266_0478"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744368.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dimethylmenaquinone methyltransferase"
                     /protein_id="WP_041467493.1"
                     /db_xref="GI:752831191"
                     /translation="MSHPKETAKSLNQTKSRSSIREMFDEVAPTYDFLNHLLSLGIDN
                     YWRAAATGRAKKLLKNVPQPRILDVATGTGDLAASIAKLPGAKVTGLDLSPEMLELAR
                     KKYPAITFLEGYAEKLPFDTASFDAVSAGFGVRNFENLQQGMSEFHRVLKPGGYTFII
                     EPMIPRNPLMKKLYLIYFKKVLPKIAALFSKSTFAYDYLPHSVEQFPQAEAFSEILKK
                     AGFRAVSYFPMTFETSILYVAGK"
     gene            complement(527939..528352)
                     /locus_tag="CPHA266_RS02500"
                     /old_locus_tag="Cpha266_0479"
     CDS             complement(527939..528352)
                     /locus_tag="CPHA266_RS02500"
                     /old_locus_tag="Cpha266_0479"
                     /EC_number="3.5.4.19"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BDQ9.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosyl-AMP cyclohydrolase"
                     /protein_id="WP_011744369.1"
                     /db_xref="GI:500064712"
                     /translation="MSENEDLQKSFLDTVKYDEKGLVPAIVQDHETGKVLMMAWMNHE
                     SLLMTLEKKKACYWSRSRQKLWLKGESSGNMQDVHDILIDCDGDTILLKVSQKGGACH
                     VGYHSCFYRKVKETLDMEICDTLMFNPDDVYGKKS"
     gene            528519..529610
                     /locus_tag="CPHA266_RS02505"
                     /old_locus_tag="Cpha266_0480"
     CDS             528519..529610
                     /locus_tag="CPHA266_RS02505"
                     /old_locus_tag="Cpha266_0480"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744370.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RND transporter"
                     /protein_id="WP_011744370.1"
                     /db_xref="GI:500064713"
                     /translation="MQTLQKVLPKYTIALALVFFVTVAYLLTRGNTVDVEAGEVTYAE
                     LVQAIYATGFVEAEAVANLSSELSGTVNYIGALEGQQVTAGQTIISLDNAQPGISVRE
                     AQAAFLEQQAVNQEKTMKYSRARNLFREGALARQDLDEAKRISSQAEELLEQKRLQLK
                     SREDELKKIAITAPFAGVLTLQSVKKGDYVTANMLVARVVDTSKYVVSVEIDELDVPR
                     IRPGQAAVVVLDALPTERYDAVVSRIVPQTDTITKTSRVYLTFRKAVTGIQAGMTITA
                     NIVYHIKPHTLLVRKSSVFDDNHKSYVWEIEKGKLKKQLIVTGASDLTFVEVLSGLQQ
                     GDRVALLPEERFREGMDANVLVAKAGKAE"
     gene            529662..530669
                     /locus_tag="CPHA266_RS02510"
                     /old_locus_tag="Cpha266_0481"
     CDS             529662..530669
                     /locus_tag="CPHA266_RS02510"
                     /old_locus_tag="Cpha266_0481"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744371.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferrochelatase"
                     /protein_id="WP_011744371.1"
                     /db_xref="GI:500064714"
                     /translation="MGEKKTIAVVLVAHGEAETSGFLENYRVSRHTLEHAARVMPIAK
                     PLQTLISLSSSLKKKIRPGNSGKGSPQNGITRKQAEVLQNHLDVLSDETDLAFRVIAA
                     FSASPPFMENIIEETRAFDGQILVNMSPMDNSLTCGLLCGYIADTYTGPELTKVKVIS
                     GFWRDENLYALYLSHLFEQIAMRPVVEHENRVLLLLFHGTLVADAKGRPPAFRTGHEE
                     VVVFSESIRSAVVKDVRNPYSEVLVAYLNHEVGGEWTKPSFEQVCRQLRQSGARRIDL
                     FAGGYFADGNETIYRAGELAALAETANVVSFPCVNALPAFGRYLAHKIFNTAEQLVTL
                     M"
     gene            530847..531710
                     /locus_tag="CPHA266_RS02515"
                     /old_locus_tag="Cpha266_0482"
     CDS             530847..531710
                     /locus_tag="CPHA266_RS02515"
                     /old_locus_tag="Cpha266_0482"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744372.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744372.1"
                     /db_xref="GI:500064715"
                     /translation="MDIKRAAVYIDGANLFFTQRSLGWQIDFSRLITFFLDRYASVEA
                     RYYVPVSEPASEEQAAFTRVLAAHGYILTSKPVKKIVNKTTGEIIIKGNLDVELAVDA
                     LVGEIAYDTFILFSGDSDFLPLLRALKEKGKEVLVYSTEGISAWELLIEPGIDFHDLA
                     GLRDRIGHAKPGEGGRRETGGQALQQENAFLRLPVVGEVFTGTVLSVKSYGVFLANTY
                     HAKCLLPLSFLGISRHITDLTEVVRMADVFDVVVFKVDTSHEVPEITVKLADKEKSHE
                     LSERVAGSPLS"
     gene            531800..532246
                     /locus_tag="CPHA266_RS02520"
                     /old_locus_tag="Cpha266_0483"
     CDS             531800..532246
                     /locus_tag="CPHA266_RS02520"
                     /old_locus_tag="Cpha266_0483"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744373.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744373.1"
                     /db_xref="GI:500064716"
                     /translation="MDMLNDLFSGVTAMMRGLWPQLQEKPCLINGKLRFCPGSPNCVS
                     SESGSPGEKVDPLEFTGSSADAWLRLKGLIVESGGVIEDEQPEFLWSTFTVPVFGFVD
                     DVEFRLDRAANLIHVRSASRLGFSDLGVNRSRVDQLREAFGKVRKN"
     gene            complement(532296..533018)
                     /locus_tag="CPHA266_RS02525"
                     /old_locus_tag="Cpha266_0484"
     CDS             complement(532296..533018)
                     /locus_tag="CPHA266_RS02525"
                     /old_locus_tag="Cpha266_0484"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744374.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobalt ABC transporter ATP-binding protein"
                     /protein_id="WP_011744374.1"
                     /db_xref="GI:500064718"
                     /translation="MISIQNLSFTYPDGTTALLNITIDIPNNSSTGIVGANGAGKSTL
                     VNHFNGYFLPQTGSISIEKDVINKKNLDVIRKKVGLVFQNPDDQLFTARLYDDIAFGP
                     ENLGMPPTEIARVVEASLRDINLWELRDKPPSHLSQGQKRFAAFAAVLVMNPTILVMD
                     EPTSDLDPGNRRKLITLVNSLVKTKITVSHDLDFIWDTCQRVCLMNNGRIVADGPTGK
                     ILGCRELLEANNLELPLRLQDL"
     gene            complement(533031..533801)
                     /locus_tag="CPHA266_RS02530"
                     /old_locus_tag="Cpha266_0485"
     CDS             complement(533031..533801)
                     /locus_tag="CPHA266_RS02530"
                     /old_locus_tag="Cpha266_0485"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744375.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobalt ABC transporter"
                     /protein_id="WP_011744375.1"
                     /db_xref="GI:500064720"
                     /translation="MTNRVTRFFPCNANEKQNPEKGALLLGSDRSALLITGIFTLFVV
                     SIPKFDLNGVIAFGAFPLFMMIATGISFTTVLKKILLLSPFVLFMAAGNMLLDRTPVI
                     TVEGITITGGLLSGSVIVAKTIITVTALLCLGLSIPFYRLFKALGELRVPEVLVTQLI
                     LLYRYSSVLGEEAISMQKGRAMRSFKGRGKGVFSTANLLGSLLLRTTNRAERLYRGMF
                     ARGFDGRIARYRPTATSNLERLALSVWSLVFIALRLVF"
     gene            complement(533801..534814)
                     /locus_tag="CPHA266_RS02535"
                     /old_locus_tag="Cpha266_0486"
     CDS             complement(533801..534814)
                     /locus_tag="CPHA266_RS02535"
                     /old_locus_tag="Cpha266_0486"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobalamin biosynthesis protein CbiM"
                     /protein_id="WP_011744376.1"
                     /db_xref="GI:500064722"
                     /translation="MHMSDALLSPIVGGAFWIISGTLIGYSAKKIIEENDHAKTPLMG
                     VMGAFIFAAQMINFSIPGTGSSGHLGGGLLLAALLGPYRAFITLSSVLIIQSLFFGDG
                     GLLALGCNMFNLAYFPAFLAYPLIFRKIIGNNPSQQRLAAGSISAAIAGLLMGAFSVV
                     IETVLSGISELPFGSFMLFMMPIHLAIGIVEGLVTWAVLSFVAKTDPALLPSNQNAAR
                     PRAAILGVLTIAALLTGGVLSWFASSSPDGLEWSISRTSGSEELLNRGEPIHELLGSI
                     QEKTAFLPDYSFKTADATSPSGDSPVNPAATVSGLAGSFSVLIMAGLAGLILAKKRTR
                     GNH"
     gene            complement(534939..535730)
                     /locus_tag="CPHA266_RS02540"
                     /old_locus_tag="Cpha266_0487"
     CDS             complement(534939..535730)
                     /locus_tag="CPHA266_RS02540"
                     /old_locus_tag="Cpha266_0487"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744377.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744377.1"
                     /db_xref="GI:500064724"
                     /translation="MLKKSIFLVTALLFGEPAFAAHPLITDDAGTQGKGHVQLEINSE
                     FSRNRETEKGTGIRETGSEITAALSYGLSETIDLVVGLPFVWYKIEENGITVADESGI
                     GDISLEMKWRMYESKDGNFSLALKPGLSLPSGNENKGLGSGKVSGGVVLIATKEGQLG
                     AIHGNIGFTHNEYKLEEESDNTRKDIWHASLAAEINLAENLRGVANIGIETSDEPHAE
                     NHPAFLLGGLIYSLSDDLDLDLGIKTGLNDAETDTTLLAGIAARF"
     gene            complement(535856..536260)
                     /locus_tag="CPHA266_RS02545"
                     /old_locus_tag="Cpha266_0488"
     CDS             complement(535856..536260)
                     /locus_tag="CPHA266_RS02545"
                     /old_locus_tag="Cpha266_0488"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BDR8.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD+ synthetase"
                     /protein_id="WP_011744378.1"
                     /db_xref="GI:500064725"
                     /translation="MSEIYRFGVSLDKSLIEAFDRHIQSRHYHNRSEALRDLIREELV
                     RKKWTEGGTVAGAVIMTYDHHKRELVNRLLDIQHDFQKTIIASSHVHLDHDHCLEVIA
                     VKGNAADVEQLSLKLKSLVGVKHLSLSISSAE"
     gene            complement(536306..537754)
                     /locus_tag="CPHA266_RS02550"
                     /old_locus_tag="Cpha266_0489"
     CDS             complement(536306..537754)
                     /locus_tag="CPHA266_RS02550"
                     /old_locus_tag="Cpha266_0489"
                     /EC_number="1.97.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744379.1"
                     /note="NADH-dependent; catalyzes the conversion of
                     pyrimidines to 5,6-dihydro compounds in pyrimidine
                     degradation; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydropyrimidine dehydrogenase subunit A"
                     /protein_id="WP_011744379.1"
                     /db_xref="GI:500064726"
                     /translation="MNEKTISNKERLAIPRQKMPAQDPNERVTNFREVNLGYTPELAR
                     MEALRCIQCKDPVCIAGCPVNIKIDQFIKMVADGDFLGAAKKIKEDNVLPAICGRVCP
                     QEDQCEKVCVIGKKHEPVAIGHLERFVADYERQTGHVEIPEVKPPTGKKIAIIGSGPA
                     GLSCANDLVRLGHEIVVFEALHELGGVLMYGIPEFRLPKEIVRQELDGLKQMGVSFQT
                     NVVVGRSVTIDELIEEEGFNAVFIGVGAGLPWFMGIPGENLAGVLSANEFLTRVNLMK
                     AYDFPESDTPVFQCKNRNIAVFGGGNTAMDAVRTAKRLGAEHAYIIYRRSEAEMPARH
                     EEIHHAKEEGVEFLLLMNPIAFIGNDQQQLTGVRCLRMELGEPDDSGRRRPVPIEGSE
                     FLLPLDMAVISIGNGSNPLIKQTTPDIEVSKRDTVVVDINTMATSKNMVYAGGDIVTG
                     GATVILAMGAGRTAAKAIHEKLMGESHGFDEW"
     gene            complement(537873..538718)
                     /locus_tag="CPHA266_RS02555"
                     /old_locus_tag="Cpha266_0490"
     CDS             complement(537873..538718)
                     /locus_tag="CPHA266_RS02555"
                     /old_locus_tag="Cpha266_0490"
                     /EC_number="1.97.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744380.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin-NADP(+) reductase subunit alpha"
                     /protein_id="WP_011744380.1"
                     /db_xref="GI:500064727"
                     /translation="MYTIVSAIFLAENIKKIEIEAPRIAKKRKAGQFVMIRVSETGER
                     VPLTIADADPEKGTITLIVQGMGKSTRELNQKKAGDSISDIVGPLGTPSHIENFGTAI
                     SIGGGVGTAIAYPTAVALKEAGNYVITINGARSKELVVLEHEMQAVSDEAYITTDDGS
                     YGFHGFVTQKLQELIDSGRRIDYVLAIGPIPMMKAVAEVTRPYNIKTVVSLNPIMIDG
                     TGMCGGCRVTVDNQIKFACVDGPEFDAHLVDFKNLSDRNRVYLPEEKKSEEAFTHKCR
                     IEKQG"
     gene            538882..539487
                     /locus_tag="CPHA266_RS02560"
                     /old_locus_tag="Cpha266_0491"
     CDS             538882..539487
                     /locus_tag="CPHA266_RS02560"
                     /old_locus_tag="Cpha266_0491"
                     /EC_number="2.4.2.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744381.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="imidazole glycerol phosphate synthase"
                     /protein_id="WP_011744381.1"
                     /db_xref="GI:500064735"
                     /translation="MVFIADYGAGNLRSVQKAFDYLGVNSVVSSDPGKLVGCKKVLLP
                     GVGAFGQAIDSLNRSGFTDAVREHVDKGGHLLGICLGMQLLLSESEEMGSHSGMNLVP
                     GKVRHFRSATDKIPQIGWNSIQMQKESLLFRGMPDGSFFYFVHSYYCEPEDNDAVAAV
                     TWFAGNNFCSAIEKNGIFAVQFHPEKSSEAGLQVLKNFAGC"
     gene            539510..540280
                     /locus_tag="CPHA266_RS02565"
                     /old_locus_tag="Cpha266_0492"
     CDS             539510..540280
                     /locus_tag="CPHA266_RS02565"
                     /old_locus_tag="Cpha266_0492"
                     /EC_number="5.3.1.16"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BDS2.1"
                     /note="catalyzes the formation of
                     5-(5-phospho-1-deoxyribulos-1-ylamino)methylideneamino-l-
                     (5-hosphoribosyl)imidazole-4-carboxamide from
                     1-(5-phosphoribosyl)-5-[(5-
                     phosphoribosylamino)methylideneamino]
                     imidazole-4-carboxamide; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-(5-phosphoribosyl)-5-[(5-
                     phosphoribosylamino)methylideneamino]
                     imidazole-4-carboxamide isomerase"
                     /protein_id="WP_011744382.1"
                     /db_xref="GI:500064737"
                     /translation="MLIIPAIDIKDGRCVRLTRGDFNQQKIYLDNPCDMAIIWRKQNA
                     KMLHVVDLDAALTGEMVNFLKIEQIVRELDIPLQVGGGIRSLDAVKRYLDIGVGRVVI
                     GSAAVTNPGLIEEVLKIYRPSKIVVGIDAENGIPKIKGWTESCGMKDYELGLEMKQMG
                     IERVVYTDISKDGMMQGFGYESTKRFAEMTGMKVTASGGVTSSDDLMKLVGLQQYGVD
                     SVIIGKALYECNFPCQELWYNFEEDICIDHNFSTARKK"
     gene            540334..540942
                     /locus_tag="CPHA266_RS02570"
                     /old_locus_tag="Cpha266_0493"
     CDS             540334..540942
                     /locus_tag="CPHA266_RS02570"
                     /old_locus_tag="Cpha266_0493"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744383.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="condensin subunit ScpB"
                     /protein_id="WP_011744383.1"
                     /db_xref="GI:500064739"
                     /translation="MAPEEDIVLKQQVEALVFASEEAVTLSTIRHIIGCSLGLAGLDA
                     IVEQLNSEYASSGRSFRIRKIAGGYRFFSESEFDALLKKLMAPKIRKRVSQSMLEVLA
                     VIAYQQPVTKAEILQVRGVSPDYSLDRLLERGFIEVRGRADSPGKPLQYGTTKEFLDL
                     FSLFSLRDLPKLREIEEIIQENEEQEYLASRGGDKDYNGRND"
     gene            540958..541689
                     /locus_tag="CPHA266_RS02575"
                     /old_locus_tag="Cpha266_0494"
     CDS             540958..541689
                     /locus_tag="CPHA266_RS02575"
                     /old_locus_tag="Cpha266_0494"
                     /EC_number="5.4.99.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744384.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal large subunit pseudouridine synthase
                     B"
                     /protein_id="WP_011744384.1"
                     /db_xref="GI:500064741"
                     /translation="MKETEDEGGIRINRYLAMCGIASRRAADKLVADGRVTVNGKIAD
                     EPGLRILPFKDEVIVDGRKFVVPEAKKVYILLNKPRNVITTSHDEKDRETILDLVSVE
                     ERVYPVGRLDRKTTGVILLTNDGILAHRLMHPSSNVKKEYVAELDKRFPQGLLSQLVG
                     GMKLKDTGEKVSPCQAKLLDDGMRIWISIHEGKNHQVRRMLETLGFDVTKLERVAYAG
                     LKAGDLRRGAWRHLSKNEVRELYRL"
     gene            541774..543801
                     /locus_tag="CPHA266_RS02580"
                     /old_locus_tag="Cpha266_0495"
     CDS             541774..543801
                     /locus_tag="CPHA266_RS02580"
                     /old_locus_tag="Cpha266_0495"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006365635.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467494.1"
                     /db_xref="GI:752831192"
                     /translation="MFLSVLLLFVCGLTLLPAPGYGRDELQRFLEQREFDGDIEQLAL
                     QLEDLRSNPLVLNAIDPEELRVLPWLASADIQAVALYRREKGRIRSKSQLEEVLGKEK
                     AAATLPFITFSDRDVPREAGSAWKPSGTLYSRVSWDTTLRDGIRDGRYAGENYKLYNR
                     LQVGRPHLKISLVHDKDIGEPDFADFISLSVNGYDFGALKSFVIGNYELNFGQGLLMG
                     QGRFFSKGSDPANSVRLASKRLTAYASSSEYGFMQGLAASVVLDPFELTAFYSDNLVD
                     ARITRQKNTEFYFITSLDDAGYHRTNTEIRRKDNVHEKVSGANLVVHVNNGLLRGSAG
                     GTLLHYAYDEERILPDGTTTSFANLFGFETEFSLGDLSVFAEAVFSEKPDDFSWIAGA
                     EYELIKGLDLQTAIRNYGVNYFSPFAGAFAERGDDASNEEGFYIGLEAKFSKKLRAAA
                     YVDWFRFPSLSGDDDYPYASEGYDTRFYLTWKQTPSVVWNLQLQHKEKEEARKQCPIV
                     NGVLVPCKDSKRVYSALPVVSDRARLYCDVMPSRKFHLRTLGEVKRVVNDFRAGDERL
                     FGYLLYQQVHYESGPLSFKGRVTLFNTDDFDSAIYVYEDDLPLVFNTAMFSGRGKALM
                     LLASWDVMQSMTLGAKYEVAWYTDRAVFSSGADQRDTSAPGTVTLGCSLRF"
     gene            complement(543798..544769)
                     /locus_tag="CPHA266_RS02585"
                     /old_locus_tag="Cpha266_0496"
     CDS             complement(543798..544769)
                     /locus_tag="CPHA266_RS02585"
                     /old_locus_tag="Cpha266_0496"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744386.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation factor Sua5"
                     /protein_id="WP_011744386.1"
                     /db_xref="GI:500064745"
                     /translation="MQTLLTDSPEEAARIINQGNIVAFPTETVYGLGAAICFPEAVKK
                     LFLAKGRPTDNPLIVHIHNAGEMSKVASEISPEATLLIEHFFPGPLTLVLKKKATVPD
                     AVTAGLDTVGVRCPENQIARAFLRHCCAPVAAPSANLSGKPSSTTWEAVFHDLNGKIP
                     CILRGEPSIVGLESTIVDCSEHEPILLREGAVTLEELQRILPAMKARKTGMKDEKPKS
                     PGLKYPHYAPKAAIRLCRRGERPPESTLSSAYIGLSNPPEGIRMVSICQSIEEYARSL
                     FSFFRACDREGISVIYCELPEQKGLGRAIHDRLMRASGEHESKNGTT"
     gene            complement(544787..545464)
                     /locus_tag="CPHA266_RS02590"
                     /old_locus_tag="Cpha266_0497"
     CDS             complement(544787..545464)
                     /locus_tag="CPHA266_RS02590"
                     /old_locus_tag="Cpha266_0497"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744387.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidate cytidylyltransferase"
                     /protein_id="WP_041467495.1"
                     /db_xref="GI:752831193"
                     /translation="MNKTSNAAETHDRLGLKYEVARKAIHLSSLSIVVIYCHISRDFA
                     LMLLLPLFLGFFLVDILKNFFPPVTAWYHRNFGAMLREHELIGGKPHLNGATCITMSA
                     LLLVLFFPKIIAITAFSMVAISDTVAAIVGKIYGRHRFGEKSIEGSAAFLISALIVAA
                     MVPNLDIRAGIVMAVTATVIEAFVIRIGWFKVDDNLTIPLLSASTGWVTYLLFLPLQI
                     EALSFCR"
     gene            complement(545520..545879)
                     /locus_tag="CPHA266_RS02595"
     CDS             complement(545520..545879)
                     /locus_tag="CPHA266_RS02595"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467163.1"
                     /db_xref="GI:752830861"
                     /translation="MRAAAFIDRTFIKADRHVTNRLRNLNTFQLSVSAVFRAERCGAH
                     DQATNRLSERSSLNCTVYMKYSASGKITTRQRGEKKPDMLPDHQNFSRTADESMSGLS
                     AGKLDLPHTAFSMYIPL"
     gene            546143..547708
                     /locus_tag="CPHA266_RS02600"
                     /old_locus_tag="Cpha266_0498"
     CDS             546143..547708
                     /locus_tag="CPHA266_RS02600"
                     /old_locus_tag="Cpha266_0498"
                     /EC_number="3.6.1.11"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744388.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatase GppA"
                     /protein_id="WP_011744388.1"
                     /db_xref="GI:500064753"
                     /translation="MGSDALRVAAIDLGTNSFHMVVVEIDRVKGIIEIDRVKDMICIG
                     RGSISSKMLDESAMLSGIAALRNFLVLAGQHGVKSEQVIAFATSAIREAKNRDVFIRR
                     VREETGLKVRVISGKEEAEFIYYGVRNAVKLGNSFDLLFDIGGGSVEFVIANNKEVKL
                     LESRKIGVARMHERFIGTDPVSAHEIKLLEQFYAAEMVSSLEKATLLGVRRGIASSGT
                     AQNIARMIRSFEARESDVSLNNSVVTRREFQRLYKAVVPLGSVDRRRMTGLDEKRVDL
                     ILPGLILVDMIFRKFNLEEIVISDYALREGMVLNYLQRGFHPLSDNGGQPDIRRESVY
                     ELGFRCGWNREHSEHVAKLAMQFFDQLRLLHGLGPEYRELLEYAALLHNIGIFISNSS
                     HHKHSQYIIMNGELRGFSPSETEIIGHVARYHRKSPPSEKHSPYNQLKPKYRNVVDVL
                     SGILRLANGLERGHRQNIYAVSTAISDRVISVRLESHLEPDIEIWAADQLKSWLEMVL
                     SRSIVIRPRSEHA"
     gene            547701..549548
                     /locus_tag="CPHA266_RS02605"
                     /old_locus_tag="Cpha266_0499"
     CDS             547701..549548
                     /locus_tag="CPHA266_RS02605"
                     /old_locus_tag="Cpha266_0499"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744389.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="para-aminobenzoate synthase"
                     /protein_id="WP_011744389.1"
                     /db_xref="GI:500064755"
                     /translation="MRDRESCRIQRLLLHEGTVWLDESYGARHEGESLLFSEPLEMLA
                     LFSASGIREFFTLLEQKLDSGYWLAGWMGYEAGYGFESERFLANCDPERAAPLAWFGV
                     YRPPERFASIVSERMFSQVAVDEPFMISDFRFNRTPAEYFQDVERVKREIAKGNVYQV
                     NVTGRFRFSFHGSAQALFGALYPQQPSVYSAFINTGRHQVLSFSPELFFRRRACTIEA
                     MPMKGTAPRSGVVEEDNRLKRQLSLCEKNRAENLMIVDLLRNDLGRICRSGSVEVSGM
                     FATETYPTLHQMVSTIRGELKDENGLFETFRALYPCGSITGAPKISAMQLIRELEPGL
                     RGCYTGTIGYINPRRDMVFSVAIRTLELSGNEGVYGSGGGIVWDSDPEEEYQECMLKA
                     KILDDVTAESVELFESMLFSGRFLWMQEHLGRLAASARVLGFAFDAAEAAARLAALAD
                     ILFKAGGRFKVRLALEKNGRMAISYESLLSDTGRVPLKLSLADGFIDSSNSLRFHKTS
                     SRKRYERYYRKALESGYDEVVFLNERQEVTEGAISNIIILKSRRYVTPSLGSGLLDGI
                     YRRYFLSLHPNASEQVLTLKDLFEADQVFICNSVRGLRPVVFDGFVISM"
     gene            549630..550088
                     /locus_tag="CPHA266_RS02610"
                     /old_locus_tag="Cpha266_0500"
     CDS             549630..550088
                     /locus_tag="CPHA266_RS02610"
                     /old_locus_tag="Cpha266_0500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744390.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744390.1"
                     /db_xref="GI:500064756"
                     /translation="MRDHTPDFKMHELSIENKGLIRQTVQQLLEKLAGDGKLACDSLL
                     EFWVEVPGVQHPRGTFQGGFLMPDSFIYITDYFTCGVQALKPLPAYEESDGGVDRVWD
                     DLFDELFYQIEIFTSTAVSPKGITLELWAGNRLRPEGEWVYAVDRKIELF"
     gene            complement(550085..550735)
                     /locus_tag="CPHA266_RS02615"
                     /old_locus_tag="Cpha266_0501"
     CDS             complement(550085..550735)
                     /locus_tag="CPHA266_RS02615"
                     /old_locus_tag="Cpha266_0501"
                     /EC_number="3.2.2.-"
                     /EC_number="4.2.99.18"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744391.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease IV"
                     /protein_id="WP_011744391.1"
                     /db_xref="GI:500064757"
                     /translation="MQRSPKEKITFIKKALGSVYPEPKSELQYASAFQLLIATILAAQ
                     ATDKKVNEATKELFLLCPDALSMSRTEPDTIKQLVRTLNYFNNKAANILAVSCRLVEE
                     FNGEVPPNREALESLPGVGRKTANVVLANAFGQPVMPVDTHVHRVSNRIGLCATSKPE
                     QTEEALTNIIPEPWMIDFHHYLLLHGRYTCKAKKPACADCVLKEICAFKDKNPIAD"
     gene            complement(550738..551235)
                     /locus_tag="CPHA266_RS02620"
                     /old_locus_tag="Cpha266_0502"
     CDS             complement(550738..551235)
                     /locus_tag="CPHA266_RS02620"
                     /old_locus_tag="Cpha266_0502"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BDT2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen utilization protein B"
                     /protein_id="WP_011744392.1"
                     /db_xref="GI:500064758"
                     /translation="MKTYRRQIREKILQALYTLELRDTDIESAANWLLTKEIQEDPNA
                     MKFFNLLLKNIKEHREEIDQYIARHTFNWDMSRIAIIDKNILRMALAELLYCEDIPPK
                     VSINEAIEIAKKFSSTDKSSKFVNGILDAIFNELKAEGKIHKNGRGLIDHSAIKLQKE
                     SETPE"
     gene            complement(551255..551947)
                     /locus_tag="CPHA266_RS02625"
                     /old_locus_tag="Cpha266_0503"
     CDS             complement(551255..551947)
                     /locus_tag="CPHA266_RS02625"
                     /old_locus_tag="Cpha266_0503"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744393.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_011744393.1"
                     /db_xref="GI:500064759"
                     /translation="MLKKLVLFDIDGTLLKVGNINRQVLADALMAVYGTEGNVRHHDF
                     SGKMDNRIIYEVLQHVGLSLSAISEKFDAVKATYIDMFRKNTTPDDVRLLEGVPALLH
                     ELSSRTDQISGLLTGNFEASGRHKLILPKINHYFSFGAFADDAHHRDELPSIAVERAY
                     LLTGKKFSASDIVIIGDTRYDIQCAKVLDARSIAVATGNYSFEELQKHSPDVLFENLA
                     ETALVIEKIFNN"
     gene            complement(551964..555503)
                     /locus_tag="CPHA266_RS02630"
                     /old_locus_tag="Cpha266_0504"
     CDS             complement(551964..555503)
                     /locus_tag="CPHA266_RS02630"
                     /old_locus_tag="Cpha266_0504"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744394.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome segregation protein SMC"
                     /protein_id="WP_011744394.1"
                     /db_xref="GI:500064760"
                     /translation="MYLSKIELFGFKSFAHRVTIKFDKGLTAIVGPNGCGKTNVVDAI
                     RWVLGEQKSSLLRSEKMENIIFNGSKNLKPLSLTEVSLTIENTRNVLPTEYTEVTVTR
                     RLYRNGDSDYLLNQVPCRLKDILDLFTDTGMGSDAYSVIELKMIEEIISNKSEERLKL
                     FEEAAGITRYKQRRKQTFRQLESASRDLSRVDDVIAEVEKKVRNLKLQVKKAEKLREI
                     KNKLRELDLILSQNQFAACQTKLEPLRRQLSREEMLDHERAAAIAQKDSAVQDAEVMQ
                     LNKEQELASSQKKLNDLNNRIHELEKQLLQDEEQRKSLSSGIGRIKTTAGDKQKKSLA
                     FELTAKALGHEKPALQKECDKQLAEYKKLSAEHEELNSRLQEHRQELAEKRKKNTELE
                     KTLNRLSFTRHSLETKIEHRKTTSDRLGQQKLEIARLLDQSSSDEREISEKINARSEL
                     VNESRKSDENIKNQIKILRQSIETQKEKLLGFRSERDQLRNQIMLANAVLDNFEGLPE
                     GIAFLEKQNKPKSGIGCLSDLVSLDRKHRKAVNAALGELLGYYICRTLDDAKQSIAAL
                     SRSDKGKVHFLVLELVQESVPKNRAVPENEALRVIDLLQFPPELDNVLALMLHETYLV
                     RDLNAAETLAMQHPQASFVTPEGEKFSGKGVLFGGSSTINEGLRLGKKAERDRLLQEQ
                     QALEKTVQEAERMLTELNREIEGQQKKQQRSETEKHRSELELLEKSLTRIDAERNSRR
                     QTSERMEAEIREILDGQQQLEQEAAELIPEIHEHESLFNTALEMVQKAQENLAALETR
                     HHQLSLELQKTQNIYRDSLLEVEKLDFRIGAAEQNRKLLLDEIKALASESAHLTDKAE
                     KLECHHAKIKRECEELLIRSAGEQEQLKTLELDYREMQSANHDAHSKLRDLRRQHEIS
                     QQILASLHAEERETAQSLDHLITAIKVKYNTDLTLFETPPPEEPFDQNQATEKLALLE
                     NQREQFGAVNELALEEYEVEKERLDFLLEQKADLESAALQLRNTIDEINKTALLKFRQ
                     TCTSVRKNFITIFHELFDPEDEVDLIVHTIDDPLEARIEIVAKPKGKKPLSIEQLSGG
                     EKALTALSLLFAIYLVKPSPFCILDEVDAPLDDANVGRFIKLLKKFENNTQFIIVTHN
                     KNSMASCHALYGVTMEEEGVSKLIPVRLQKTGL"
     gene            complement(555596..556507)
                     /locus_tag="CPHA266_RS02635"
                     /old_locus_tag="Cpha266_0505"
     CDS             complement(555596..556507)
                     /locus_tag="CPHA266_RS02635"
                     /old_locus_tag="Cpha266_0505"
                     /EC_number="2.5.1.15"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744395.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydropteroate synthase"
                     /protein_id="WP_011744395.1"
                     /db_xref="GI:500064761"
                     /translation="MKSVTDKPDQYLINCSGVTLDLRKAPVVMGIVNVTPDSFYDGGM
                     FVQKKDKPDYDRALNHALQLIRSGATIIDIGGESSRPGAEPIPTEEEIRRTVPLIGML
                     RKKTDALISIDTWKSEVAEAAIRAGAQLVNDISGFTFDADLPEICRKYQAAVILMHTP
                     TKPQSMQWSTGTSSTSNDIITTVTAYLQRSILTARHHGINDIIIDPGFGFGKTVEENY
                     RLLGAMNKLQKLQRPLLAGVSRKSFLGHVIAEPRQPTPPPSERLSATLAAETIALLNG
                     ASIIRAHDVKAAMQTIAVVMASRAASA"
     gene            complement(556504..557532)
                     /locus_tag="CPHA266_RS02640"
                     /old_locus_tag="Cpha266_0506"
     CDS             complement(556504..557532)
                     /locus_tag="CPHA266_RS02640"
                     /old_locus_tag="Cpha266_0506"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744396.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M50"
                     /protein_id="WP_041467496.1"
                     /db_xref="GI:752831194"
                     /translation="MNGTNQSRATILAEQNYPLHIALFLLTALCTLWAGSFWSGHPVR
                     LDNVNLFFFDLFRGLPYAASLLLFLSVHEFGHFFTALHYRMRATLPYYIPVPPLPFLL
                     SLGTMGAVIKIKDRIPNTNALFDTGVSGPLSGFIVSLGLLLFGFYHLPPASWIFTVHP
                     EYIASGGIPNPAPEGTLTLGKNLLWIVLEQVIAPKNLPPMTEMYHYPFLFTGWLGCFV
                     TALNLIPVGQLDGGHVTYAMFGKQGYKKTAKTFMFIIGILGFPSLLELTFSLILPAQT
                     IRIPGELLQWSWPGWMLWFLILSRFIGTDHPPTSHDCSLSASRRAIGWVAIVIFIITF
                     VPVPFGVQ"
     gene            complement(557735..558184)
                     /locus_tag="CPHA266_RS02645"
                     /old_locus_tag="Cpha266_0507"
     CDS             complement(557735..558184)
                     /locus_tag="CPHA266_RS02645"
                     /old_locus_tag="Cpha266_0507"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744397.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C"
                     /protein_id="WP_011744397.1"
                     /db_xref="GI:500064766"
                     /translation="MNLKKLLGGTVLVLAAIQLVPYGRDHLNPPVTGEPAWDSPRTQE
                     LFSRACKDCHSNNTVWPWYSNVAPASWLAALDVSVGRKKFNVSEWGRAEKNEGDEAAG
                     EVREGKMPPWFYLPAHPEAKLNDQEKKELADGLAATFGEKKKSEEKK"
     gene            complement(558304..559212)
                     /locus_tag="CPHA266_RS02650"
                     /old_locus_tag="Cpha266_0508"
     CDS             complement(558304..559212)
                     /locus_tag="CPHA266_RS02650"
                     /old_locus_tag="Cpha266_0508"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744398.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase type 12"
                     /protein_id="WP_041467497.1"
                     /db_xref="GI:752831195"
                     /translation="MLQLRTAGFQALQKLERERDFPPAWNSMKELEVVTNNFHQRFLD
                     ERFEQSKSLGGFFLLNELLDRALRSSETENMDNENLSGDEKLTLVKALDRQNEMMGLY
                     NRYPAIILPLAEEIARKENRSIRLLELASGSGGLALALAHAAKIKNIPLSVTGSDIVP
                     AYQDEANRLADEKQLPVTFRIINAFDMDRSITEPFDLVVISQSLHHFTPGQLAMIIAQ
                     AGKQASTLFIGIDGYRDPLLMAGVPLTASLQGIPSFTLDGFISARKFYSNIELDIIAG
                     IAKGRGSHSVQCSWPMSVMTVDFKPE"
     gene            559546..>559956
                     /locus_tag="CPHA266_RS02655"
                     /old_locus_tag="Cpha266_0509"
     CDS             559546..>559956
                     /locus_tag="CPHA266_RS02655"
                     /old_locus_tag="Cpha266_0509"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744399.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Rrf2 family transcriptional regulator"
                     /protein_id="WP_041467498.1"
                     /db_xref="GI:752831196"
                     /translation="MKVLTKNTDYAIRALLFLGARKGSYVSAKTIAAEQEIPYQFLRR
                     LMQDMIGHGLVVSKGGASGGFMLLKEPDGIRINDLIEIFQGKIQVSECMFRKKLCSNR
                     ATCVLRHEIMRIEQVVHQEFEKVTIGKLMRDLDEA"
     gene            560037..560918
                     /locus_tag="CPHA266_RS02660"
                     /old_locus_tag="Cpha266_0510"
     CDS             560037..560918
                     /locus_tag="CPHA266_RS02660"
                     /old_locus_tag="Cpha266_0510"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744400.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin"
                     /protein_id="WP_011744400.1"
                     /db_xref="GI:500064772"
                     /translation="MKRQIIAIDEKKCTGCGDCIPGCPEGALQVIDGKARLVSDLFCD
                     GLGACTGHCPTGAMTISSREVEPYDERRVMHERIVSGGADVIAAHLKHLLDHGQTAWY
                     AEALAYLEEQGVHDRSEVVVKVDQKPALPASSGHGSGCPGSRMMSFGSDTRPSAAIDS
                     PPNSVCDTELRQWPVQLHLVTPTAPYYEGSDLLLAADCTAFAAGDFHQRFIKGKSLAI
                     ACPKLDSDMDVYVEKLAAMIDKAEINTITAVIMEVPCCGGLMALAAEAQKKVSRKIPV
                     KRVVMSVRGEVLSDEWV"
     gene            560937..561341
                     /locus_tag="CPHA266_RS02665"
                     /old_locus_tag="Cpha266_0511"
     CDS             560937..561341
                     /locus_tag="CPHA266_RS02665"
                     /old_locus_tag="Cpha266_0511"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744401.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744401.1"
                     /db_xref="GI:500064774"
                     /translation="MLKDALGAYRGGIHETTRVIGMRPDSADAWNDRANARNCLGNFS
                     EAVSDYTRALELGLRFREALTALGNRGLARIVLGDLDGAHDDFSEIILRKPTNKLLLR
                     SAFVQRASVKEKKGDSEGAAADRNMAVMLSVR"
     gene            561372..562994
                     /locus_tag="CPHA266_RS02670"
                     /old_locus_tag="Cpha266_0512"
     CDS             561372..562994
                     /locus_tag="CPHA266_RS02670"
                     /old_locus_tag="Cpha266_0512"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744402.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxylamine reductase"
                     /protein_id="WP_011744402.1"
                     /db_xref="GI:500064776"
                     /translation="MSMYCDQCQESVHGSGCTMRGVCGKDEVTAKLQDVLVYAAEGLA
                     ICAEGSSGDALRKYGRRMSEALFVTVTNTNFDEDAIVAEIIKTLLLRDELKASDPRYF
                     VCDATEWSGISREDFLIKAESVSTEDLSPNEDLSSLKRLVLYGIKGLAAYTDHAAVLG
                     YHDDDIYSFYCKGLASLQKDLSLDELTALVLETGATAVKAMALLDRANTETYGNPEIT
                     MVKTGVGQKPGILISGHDLRDMEELLKQTEGTGVDVYTHCEMLPAHYYPAFKNYGHFV
                     GNYGGSWWKQDREFDSFNGPILMTTNCIVPVRESYRSRMFTTGMAGYPGLKHIAARPE
                     GGAKDFSELVSLAKTCQSPKELENGEIVGGFAHNQVLALADKVVAAVKFGAIKRFVVM
                     AGCDGRHTSRQYYTDVAEALPMDTIILTAGCAKYRYNKLALGDIGGIPRVLDAGQCND
                     SYSLAVIALKLQEVFELEDINDLPISFDIAWYEQKAVTVLLALLSLGVKGIRLGPTLP
                     EFLTPNVAKVLVETFDIKPISSVRSDVEAMMA"
     gene            563166..563564
                     /locus_tag="CPHA266_RS02675"
                     /old_locus_tag="Cpha266_0513"
     CDS             563166..563564
                     /locus_tag="CPHA266_RS02675"
                     /old_locus_tag="Cpha266_0513"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744403.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX hydrolase"
                     /protein_id="WP_041467499.1"
                     /db_xref="GI:752831197"
                     /translation="MGDVVCAIIERNGRFLIARRPEGKTLALKWEFPGGKVESGESPR
                     DALHRELAEELGIVVEILQRLSPVVYSYSDFSLRLIPYRCLIVSGEPVPVEHTALEWI
                     SVDDAVFYDFPEADIPILEEYRMLVSGESF"
     gene            563847..565085
                     /locus_tag="CPHA266_RS02680"
                     /old_locus_tag="Cpha266_0514"
     CDS             563847..565085
                     /locus_tag="CPHA266_RS02680"
                     /old_locus_tag="Cpha266_0514"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744404.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_011744404.1"
                     /db_xref="GI:500064780"
                     /translation="MHKEHASVRDIFSLPVIVAALGYFVDIYDLVLFSIVRVPSLKSL
                     GLEGKQLIDYGVYLLNMQMIGMLLGGILWGWLGDRKGRLKIMFGSILLYSLANIANGF
                     VTSLPAYALMRFIAGIGLAGELGAGITLVSEVLHTKIRGYGTMLVASIGVSGAILANF
                     VANTYEWHNAFFIGGGLGFLLLFARVKVAESGMFKAMEEKAGVNRGNMLALFTDRNRF
                     FRYLNSILIGVPIWFVVGVLITFSPEFAVSFGIPEPVSAGNAVMFCYLGLVFGDLSSG
                     LLSQLFQSRRKVILLFMLLSVAAVALYFMQGSSSPAFFYGVCSLLGFASGYWAVFVTV
                     AAEQFGTNLRATVATTVPNFVRGMVVPITMLFQFTKGLFGLENGALLVGTLCIVVAFF
                     SLGALEETFHKDLDYYEEFL"
     gene            565197..565802
                     /locus_tag="CPHA266_RS02685"
                     /old_locus_tag="Cpha266_0515"
     CDS             565197..565802
                     /locus_tag="CPHA266_RS02685"
                     /old_locus_tag="Cpha266_0515"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744405.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chitinase"
                     /protein_id="WP_011744405.1"
                     /db_xref="GI:500064782"
                     /translation="MAINRSFFFDHVRLYLFDGKLKQSQVQGLDAILDYWGNKMEACD
                     DRWLAYALATAHHETDRSMQPIKEYGSTAYFMRMYDCSGGRPLVAKNLGNTHPGDGAK
                     YYGRGYVQLTGRRNYTDWSKRLDHDLVGNPDLALDPAIATRILFEGMRQGTFTGRKFA
                     DYFNPQKEDWLNARRIINWIDKANLIEGYGKRYYGGISYTT"
     gene            complement(565905..566627)
                     /locus_tag="CPHA266_RS02690"
                     /old_locus_tag="Cpha266_0516"
     CDS             complement(565905..566627)
                     /locus_tag="CPHA266_RS02690"
                     /old_locus_tag="Cpha266_0516"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744406.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744406.1"
                     /db_xref="GI:500064785"
                     /translation="MMKETLEKTGHEKTDPACQLCGNKKTSQLKRAIFVGPSVAQVII
                     KETGGWDETGWICSDDFLKYQQKYVEKLLAEEKGELTTLDREVLRALHEQEIFSKNPD
                     IDYDANLGFADRLSDKLASFGGSWTFIIMFGFFIFGWMAINTWILFSKPFDPFPFILL
                     NLVLSSLAAIQAPVIMMSQNRQEARDRKRAIHDYQINLKAELEIRQLHQKIDHILSHQ
                     WERLIEIQKIQMELIDEIRNNN"
     gene            complement(<566691..569519)
                     /locus_tag="CPHA266_RS02695"
                     /old_locus_tag="Cpha266_0517"
     CDS             complement(<566691..569519)
                     /locus_tag="CPHA266_RS02695"
                     /old_locus_tag="Cpha266_0517"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744407.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="excinuclease ABC subunit A"
                     /protein_id="WP_041467500.1"
                     /db_xref="GI:752831198"
                     /translation="MEFNHITIKGARVHNLKNISLDIPRNRFVVITGISGSGKSSLAF
                     DTIYAEGQRRFMETLSPYARQYIGNIERPDVDFIEGLSPVISIDQKSTSRSPRSTVGT
                     VTEIHDFIRLLYAKAGRRYDPVTGQMLQKQSEESICEAILSLPEGTKVQIISPLVTGR
                     KGHYRELFEKLLQKGFLRVRIDGEYREMHKNMQLERYKSHAVALVIDRLLINPESADR
                     LKKAVNLAIGMSEHKSSVICDPVESDCKEMVFSTRYAYSDGSVPLDTLAPNNFSFNSP
                     YGACPSCSGLGTIMQLSADLMIPNPSLSLKEGAIEPFGKAGKRNLWQVIKAIGKVYGF
                     SVDTPISKIPKKALDILLYGSGSETFDISYSYAGRENSYPQLFEGALPYVEEIRLKTN
                     SMKLREWAESFMIHQPCPECNGARLRKESLLVKLNDLNIAEVEALPIPEALDFFITLL
                     PTLTAKELLVATPVVHEITKRLEFLLNIGLSYLSLGRSSQTLSGGEAQRIRLASQLGS
                     QLSGVLYVLDEPSIGLHQRDNHKLIESLIRLRNLGNTVLVVEHDKDTMLMADQVIDIG
                     PGAGEYGGEIVAQGRAEELGKHSLTAAYLQGKKEVYFPPETKKSPDQAKFLVIRGCRG
                     NNLKNIDIRFPLSSLISITGVSGSGKSTLINETLYPALARHFYRSKLLTYPYDSIEGI
                     ELIDKVVNVDQSPIGRTPRSNPATYTGVFTFIRDFYTRLPEAQIRGYKAGRFSFNVKG
                     GRCEVCQGAGTRKIEMNFLPDVYVQCEHCKGERYNRETLQVKYRGKSIADVLDMPVEE
                     ASVFFTDFPRIKRILATMESVGLGYLKLGQPSPMLSGGEAQRIKLSAELAKIQTGQTL
                     YILDEPTTGLHFQDIQHLLEVLRKLVDKGNTVIIIEHNLDIIKNSDWVIDLGPEGGSG
                     GGQFIGEGTPREIAQLEHSHTGRYLAVEL"
     gene            complement(570003..572753)
                     /locus_tag="CPHA266_RS02700"
                     /old_locus_tag="Cpha266_0518"
     CDS             complement(570003..572753)
                     /locus_tag="CPHA266_RS02700"
                     /old_locus_tag="Cpha266_0518"
                     /EC_number="2.7.9.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744408.1"
                     /note="catalyzes the formation of phosphoenolpyruvate from
                     pyruvate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate phosphate dikinase"
                     /protein_id="WP_041467501.1"
                     /db_xref="GI:752831199"
                     /translation="MPTSERPKEKSDSKQYLYSFSGGIAEGDASMKNLLGGKGANLAE
                     MANIGLPVPPGFTISTEVCTHYYDHQRTYPENLFEKGIPEALCKIEDALGKKFGDPEN
                     PLLVSVRSGARASMPGMMDTILNLGLNEKTVDGLARKSGNPRFAWDCYRRFVQMYGDV
                     VLDLKPTDKKQIDPFEEILEAKKHERQIQLDTEFTVEDLQDIVSEYKAAILKKTGRTF
                     PEDPHEQLMGAIGAVFNSWNNERAIVYRKLNHIPGYWGTACNVQAMVFGNMGEDCGTG
                     VAFTRDAATGDNIFYGEFLMNAQGEDVVAGTRTPLKIEQLKAENPGIYDQLEEIRSIL
                     EKHYRDMMDIEFTIENNKLFMLQCRVGKRTGFAAVKIAVEMFNEGLIDEKEALMRIEP
                     EQLNQLLRPVFNMKEKQAAIAEGRLLATGLNAGPGAATGKIYFNAVDAHDASKRGEPV
                     ILVRIETSPEDIKGMAVSEGILTERGGMTSHAALVARQMGKVCVAGCGALSIDYQKGE
                     MRVNGKDIVLCEGDYLSIDGSTGEVIAGKVATKNSEIIEVLIDKTLLPEEAATWNIYK
                     QLMEWADKYRKLSIRTNADQPDQAETAIMFGAEGIGLCRTEHMFFGGERIDAMREMIL
                     ADDVEGRKKALEKLLPYQREDFYGLFKAMGSRPVTIRLLDPPLHEFLPHTDSEIEILA
                     GKMNKSFAQVKERISDLHEFNPMLGLRGCRLGILHPEITVMQVRAIIEAACKLKQEGA
                     EVVPEIMVPLVCTVKELEITSEIIHKTARSVFAEQGIGVSYLVGTMIEVPRAAITSDQ
                     IATAADFFSYGTNDLTQMGLGMSRDDSGQFLPAYQQQDIFSRNPFESIDKDGVGKLMS
                     ISAKDGRSVKPDLKLGICGEHGGDPATVEFCHQTGLNYVSCSPFRVPIARLAAARAAL
                     KN"
     gene            572905..573786
                     /locus_tag="CPHA266_RS02705"
                     /old_locus_tag="Cpha266_0519"
     CDS             572905..573786
                     /locus_tag="CPHA266_RS02705"
                     /old_locus_tag="Cpha266_0519"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744409.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_011744409.1"
                     /db_xref="GI:500064792"
                     /translation="MVIEPTVFVLQVLRISVPYILTSVGATFSERGGVINLALEGMIL
                     LGAFGAALGQYLTGSAFVGIVSALCCGLLVAALHAFVTVSLKADQIVTGIAINILVMG
                     GTRFGLILMFGSAMNSGRIAGVQGTTVFTDPLFLAALVSVLAGQFILFKTPYGLRLRA
                     AGESAETADSLGINVTRMRYSGVLVSGALAALAGAFLVFQQHTFTDNMSAGRGYIALA
                     AMIIGRWTPAGAALAGFLFASAEAFELWMQTDWLPIQLVQSLPYIVTLLVLAGFAGKS
                     AAPRQVGVPFEKNRRSK"
     gene            complement(573778..574434)
                     /locus_tag="CPHA266_RS02710"
                     /old_locus_tag="Cpha266_0520"
     CDS             complement(573778..574434)
                     /locus_tag="CPHA266_RS02710"
                     /old_locus_tag="Cpha266_0520"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744410.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isoprenoid biosynthesis protein"
                     /protein_id="WP_011744410.1"
                     /db_xref="GI:500064794"
                     /translation="MKKTGVLLSGCGFLDGSEIQEAVLTLLALDKAGVEAICLAPDIP
                     QHHVINHCTGQVMPSENRNVLVESARISRGSIVNLDRIDTLDLDALILPGGYGVAKNL
                     SNYASKGTSCEVHPDVRSAIQSFYHAGKPLGFICIAPVIAARVLGNESIELTIGSDTE
                     SADHIELMGAKHVDCPVYNIHISKQGKVVSTPAYMLGQSIGEVAMGIEKLVNAVVALL
                     "
     gene            <575030..575257
                     /locus_tag="CPHA266_RS02715"
     CDS             <575030..575257
                     /locus_tag="CPHA266_RS02715"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010216578.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467502.1"
                     /db_xref="GI:752831200"
                     /translation="NGFSDWHLPGKEDLNRLHGCNCLAGGFPDAEFWSSEQAYQDYAW
                     GQYFGDGYQYYANKSNRYKVRAVRNFQVPVS"
     gene            complement(575239..575745)
                     /locus_tag="CPHA266_RS02720"
     CDS             complement(575239..575745)
                     /locus_tag="CPHA266_RS02720"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467164.1"
                     /db_xref="GI:752830862"
                     /translation="MKNKQNDFKALYQKTDVLHNLNKIQHYATRRESSRRTKRKGRYS
                     LCASKPDHSVFPYINRNSIHHAPGCRATLNRGILKACNTSTSEKECCLPFIRHRACKE
                     ECKKKEQCERFVSSLSRKAGSAFQGKSGEKAVPAGNSFRVYYTHHVHTSIINRSTGCA
                     LTRQETGT"
     gene            575861..577087
                     /locus_tag="CPHA266_RS02725"
                     /old_locus_tag="Cpha266_0522"
     CDS             575861..577087
                     /locus_tag="CPHA266_RS02725"
                     /old_locus_tag="Cpha266_0522"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011357343.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-70 factor"
                     /protein_id="WP_011744412.1"
                     /db_xref="GI:500064798"
                     /translation="MKQKICPVCGLPVTERSHWHIYHPEEDYTITYEAVGDDILHGQA
                     VTDHDVVLDYMDNELFQSVCDELKMRGTKFSVVINLKHIRGVTLAYKKDFANLVYNWG
                     PIFTRLVIYNVHPDIYSIIEGFTVICPENVEAVIVDDYRDAIARASVSEDNPETDGCF
                     GQEPVYDFRTASKKAFLADLAQLFWIDMLDQPVLLPPAEDDTYIFFGALEEMRKDMLA
                     KKKEHQDEVERLKESYELKQKHYLIQMKSLIDQHKEMITQFEKEKLLLQNILKVNAAE
                     MVVAGEINTTSIDGLTSLIDSAAMSQPLKEPLLNSCKRIAQTGKIENQHSAGASEAEQ
                     IFLSLLEQKHPGLSWRDRRIILWIKSDYSNSEIAGLMGISTRGMESIRYRLHKKLALQ
                     KHQTIKSYLSSLESDA"
     gene            577162..577833
                     /locus_tag="CPHA266_RS02730"
                     /old_locus_tag="Cpha266_0523"
     CDS             577162..577833
                     /locus_tag="CPHA266_RS02730"
                     /old_locus_tag="Cpha266_0523"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744413.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744413.1"
                     /db_xref="GI:500064800"
                     /translation="MVCLWILTEQLLKNAVLLVFFLLVALGCADDRKKNGAEVSIGDQ
                     VWMNRNLEVDRYRTGDPVREAQTVAEWQDAAVHEEGAWCWYDGERDNERVYGKLYNWF
                     AVNDSRGLAPAGWHIPSDDEWKRLAVFLGGEGIAAGKLKTLNFRVLPGVDVDNSTGFS
                     AVPAGSRNCLDGFFGKEMAAFFWSSTQSGDFEAWNRELGSASNAIQRVSVNKSLGLSV
                     RCIKD"
     gene            complement(578072..578578)
                     /locus_tag="CPHA266_RS02735"
                     /old_locus_tag="Cpha266_0524"
     CDS             complement(578072..578578)
                     /locus_tag="CPHA266_RS02735"
                     /old_locus_tag="Cpha266_0524"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744414.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein-S-isoprenylcysteine methyltransferase"
                     /protein_id="WP_011744414.1"
                     /db_xref="GI:500064802"
                     /translation="MNKKNQRTREFMKGKRGEYLVIIQFLLLFIFIFLPVYPSFSETE
                     TFAATTGIRWAVIVLLWTAALLLGGLGSRHIKKYLTPLPYPVDHNELVTTGIYALVRH
                     PLYSSQLFAAFGWAIFSMSLTHLFLTMAAFFFFSYKAAKEEKWLTERHPEYADYAKRV
                     KMFIPWVY"
     gene            578698..579240
                     /locus_tag="CPHA266_RS02740"
                     /old_locus_tag="Cpha266_0525"
     CDS             578698..579240
                     /locus_tag="CPHA266_RS02740"
                     /old_locus_tag="Cpha266_0525"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744415.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isochorismatase hydrolase"
                     /protein_id="WP_011744415.1"
                     /db_xref="GI:500064804"
                     /translation="MISPQETLLLVIDVQGKLASSVFHAERVEKNIDKLIRACRILDV
                     PVLYTEQYPKGLGSTVEPLRRLLSGQVPVEKLSFSCCGSEEFMRQLRAFKRNDILVTG
                     METHVCVYQTSLELLDFGYSVHLVTDAVSSRSEENRQLGIRCIERAGATPTSTEMAVF
                     ELLRIAEGEQFKEISKIIKE"
     gene            complement(579252..580319)
                     /locus_tag="CPHA266_RS02745"
                     /old_locus_tag="Cpha266_0526"
     CDS             complement(579252..580319)
                     /locus_tag="CPHA266_RS02745"
                     /old_locus_tag="Cpha266_0526"
                     /EC_number="2.4.1.182"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BDV6.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tetraacyldisaccharide 4'-kinase"
                     /protein_id="WP_011744416.1"
                     /db_xref="GI:500064807"
                     /translation="MSFDLPDIILRPASLLYKNIIRIRNRLYDQQIFHTWHSPLPIVS
                     IGNISAGGTGKTPLVDWIVKYYLSLGCKPAIVSRGYGRNTKGVQLVSDGKTVLMKSNA
                     CGDETAMLAWNNRDAIVIVAEKRKDAVTFIIRRFAEAMPDVIILDDAFQHRQIARNLD
                     IVVINEKEPYFRADMIPKGRLREPLINLARADLLVLSKITGGSTTAAISMDLEQTGKP
                     VIKAGIAAGNLVCLSGMFNTAKESPVHAGIKALAFAGIGSPQSFIDTLEGQGIQIVSH
                     RFFRDHESYTAKKIAALRLEADEKKLTLVTTEKDYFRMLGQPELQEILHTLSCCYLKI
                     RPEFTEGEKLLKTMLNAVINR"
     gene            complement(580309..580944)
                     /locus_tag="CPHA266_RS02750"
                     /old_locus_tag="Cpha266_0527"
     CDS             complement(580309..580944)
                     /locus_tag="CPHA266_RS02750"
                     /old_locus_tag="Cpha266_0527"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744417.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467503.1"
                     /db_xref="GI:752831201"
                     /translation="MSLIRRILRPIVTRFILPITLKLLYKSLRITVSAFEETTCTEKK
                     QLLFAFWHGKMITGWVLARKLFTQSIIHAVVSLSEDGQLLSGTLSNIGFSLIRGSSSK
                     GADEVKSAILKALQSGDIVAITPDGPRGPVHQFKYGIVRIASEQQIPILFAEISYNDA
                     WKLKSWDDFEIPKPFSRVAVTLKTVTVPEFNNETMLRNFASQLSRSFTHVV"
     gene            581100..582383
                     /locus_tag="CPHA266_RS02755"
                     /old_locus_tag="Cpha266_0528"
     CDS             581100..582383
                     /locus_tag="CPHA266_RS02755"
                     /old_locus_tag="Cpha266_0528"
                     /EC_number="6.3.4.13"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744418.1"
                     /note="catalyzes the formation of
                     N(1)-(5-phospho-D-ribosyl)glycinamide from
                     5-phospho-D-ribosylamine and glycine in purine
                     biosynthesis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylamine--glycine ligase"
                     /protein_id="WP_011744418.1"
                     /db_xref="GI:500064810"
                     /translation="MNVLIIGSGAREHAMAWAAARNDAVQQVYVAPGNGGTALMGGKV
                     QNVALKATALDELLEFAVLKAVDLTIAGSEQPLELGIVDLFRSAQKKIIGPSQAAAQL
                     ETSKVFAKDFMSRYGIPTAGYHVFREFQTASLYLASLDESRYPQVIKASGLCAGKGVI
                     VASDGMEAFRATRAMFEDRVFGDAADEVVIEDFLEGEEASVFVLTDGEKYRMFYSAQD
                     HKRIGEGDTGKNTGGMGAYAPAPLVTSGVMKKIEEQIVVPALEGMAADGTPYTGFLYV
                     GVMIDKGEPSVVEFNARMGDPETQVVLPLLKDDFIDALQASLQGTLDLVPFEMLEQCA
                     TTVVIASKGYPDLYETGREITIDSELFDMRDVLLFHAGTEIEKGTLRTSGGRVFSVTA
                     LGKTLMDSIELAYRAVDHISFEGACFRRDIGAKAL"
     gene            582406..582837
                     /locus_tag="CPHA266_RS02760"
                     /old_locus_tag="Cpha266_0529"
     CDS             582406..582837
                     /locus_tag="CPHA266_RS02760"
                     /old_locus_tag="Cpha266_0529"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744419.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744419.1"
                     /db_xref="GI:500064811"
                     /translation="MKLLRRHFEIIQEQAFREQPYECCGLLAGVSHVDHRGNIENVVY
                     EIAPCRNCLYYGKEHGFEIGRGEFHDIEQEARALGYEIVGSYHSHINSPAVPSCNDID
                     FSSPGHSMLIISLIDGVPKEVTAWLRRDSGGFHQEPIRITP"
     gene            582925..>584397
                     /gene="carB"
                     /locus_tag="CPHA266_RS02765"
                     /old_locus_tag="Cpha266_0530"
     CDS             582925..>584397
                     /gene="carB"
                     /locus_tag="CPHA266_RS02765"
                     /old_locus_tag="Cpha266_0530"
                     /EC_number="6.3.5.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013684200.1"
                     /exception="unextendable partial coding region"
                     /note="four CarB-CarA dimers form the carbamoyl phosphate
                     synthetase holoenzyme that catalyzes the production of
                     carbamoyl phosphate; CarB is responsible for the
                     amidotransferase activity; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbamoyl phosphate synthase large subunit"
                     /protein_id="WP_041467504.1"
                     /db_xref="GI:752831202"
                     /translation="MPKREDIKSILVIGAGPIVIGQACEFDYSGTQACRALKEDGYRV
                     VLVNSNPATIMTDIEMADATYIEPITPDYVRKIIEKEKPDALLPTMGGQTALNTAVTL
                     AESGILERNGVELIGAKLRAIRKAENREFFSDAMKKIGLEMAKGFFVRNEKEAKEALE
                     EIGLPIVIRPSFTLGGTGGGFAESKADYYDAVRRGLAESPISEVLVEECLVGWKEFEL
                     EVIRDLADNVIIVCSIENVDPMGVHTGDSITVAPAQTLTDRQYQELRDASVRIIREIG
                     VETGGSNIQFAIHPRTGRIVVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLDE
                     ILNDITRTTPASFEPVIDYCVVKVPRWDFEKFKNVDARLGVQMKSVGEVMAFGRNFRE
                     ALQKSLRGLEIGRAGLGADGKDIMNVIDMTQQQKQFAKEDILDKIRIPKADRMFYLRY
                     AFLAGATIDEVYQATGIDPWFLDNIRQIVEFESGLRELAAQ"
     gene            584409..585185
                     /locus_tag="CPHA266_RS02770"
                     /old_locus_tag="Cpha266_0531"
     CDS             584409..585185
                     /locus_tag="CPHA266_RS02770"
                     /old_locus_tag="Cpha266_0531"
                     /EC_number="4.1.1.48"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BDW1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="indole-3-glycerol phosphate synthase"
                     /protein_id="WP_011744421.1"
                     /db_xref="GI:500064813"
                     /translation="MTYLSRILEEKRQAVLALKQQRPLQHYLEQETELSPCRDFQGCL
                     KRSVDRIKLIAEIKKASPSRGLIVSDFKPLEMARRYMDLGASAFSVLTEEVFFQGSPD
                     YLKEVRRAFSLPVLRKDFILDECQIFESRLMGADAILLIVAALDPHQLQDYLDLARQT
                     GLHVLVEVHDHRELDIALNAGSMIIGINNRDLRDFSVNLHTSIKLRPYIPEGIVSVSE
                     SGVKTAADAALLDNASFDAVLIGEGLHVSEDLKRVIWTET"
     gene            complement(585166..585831)
                     /locus_tag="CPHA266_RS02775"
                     /old_locus_tag="Cpha266_0532"
     CDS             complement(585166..585831)
                     /locus_tag="CPHA266_RS02775"
                     /old_locus_tag="Cpha266_0532"
                     /EC_number="5.1.3.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744422.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribulose-phosphate 3-epimerase"
                     /protein_id="WP_011744422.1"
                     /db_xref="GI:500064814"
                     /translation="MPGKTTLLAPSILSADFTALASSIAVAENAGADWIHCDIMDGVF
                     VPNITFGPFIVQAISRCTTMTIDTHLMIIDPDRFIADFIKAGSNQVTVHQEACPHLHR
                     TIQLIKSLGAKAGVSINPGTTLATLESILPDLDLVLLMSVNPGFGGQSFIPSSIDKIA
                     ALDRMRCDRNPEMIIAVDGGITEDNAGVVVDAGADALIAGTAFFKAADPAEAARKLKS
                     QSR"
     gene            complement(585881..588112)
                     /locus_tag="CPHA266_RS02780"
                     /old_locus_tag="Cpha266_0533"
     CDS             complement(585881..588112)
                     /locus_tag="CPHA266_RS02780"
                     /old_locus_tag="Cpha266_0533"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744423.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744423.1"
                     /db_xref="GI:500064815"
                     /translation="MLFFKIVFRVILQCLALSLFCGIALPAAAKSKMADTTEALPASM
                     YVNKIRFSGNKAVSSDELLQIITTSPHSSFLGLGLFGGPKKPFIAEEFKKDLSLIKKL
                     YTYKGYFFTEIASSISPRNNGKKIDIAINIRENEPSRIDSLAYDGLESITDDLRTAYL
                     QKSVIKTNTIFSVERLIKERDRTMDFFREEGYAFFHEDSIRIKVDTVGTQAGVLFKLR
                     LPEKLTYGGVQAVVQNPFRSDTTGSKTTFLQDSVTVVIYGRQNINPALLSKLTTMRPG
                     RLTKDSREKETLQNLGATNVFSSISIKPDSVRSGKLYTSINLEPAPKHQIEPKLLIDN
                     RYGSLFFGGALTYENRNLFGGAEQFKAATEFGTQAGYSKTFLSDLSEDQYEKVVPFEF
                     SLKSSLIMPVITKPGNSYSAYVEYSAAKLPILLSTQIGLIRGTYSAKTGNASRINFDF
                     FDFEWVKKDSLKGFRQLFKNDLASNIGIDPTDDAAVNAGIDSLLDARVNQSIRLRYNT
                     TNRASAAPGKNIWNLDILLEEAGGIAWLIDKYIDTKQYDGFSDKDPQIFGTTYSQYVK
                     LETKLGMTRNLSDNHQLAGRIHLGYMIPYGKAGATPEERRFYAGGANSMRGWMYNTLG
                     PGRSNSEAAANFGANIKLELGLEYRLKFFEFLGQASGVTFFTDIGNIWDNTGPYAFNL
                     TSLTRDFAWDFGAGLRIGSPIGPLRFDFAYKLHDPGDEHPWKISDFDPLDFTFHFGIG
                     ETF"
     gene            complement(588131..588358)
                     /locus_tag="CPHA266_RS02785"
                     /old_locus_tag="Cpha266_0534"
     CDS             complement(588131..588358)
                     /locus_tag="CPHA266_RS02785"
                     /old_locus_tag="Cpha266_0534"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009416034.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744424.1"
                     /db_xref="GI:500064817"
                     /translation="MYWNLDLARYIADAPWPLTKDELINYANRTGAPQQVIENLHDLP
                     DSDELYESIDEVWPDYPTDEDFCYGDEELLT"
     gene            complement(588391..589134)
                     /locus_tag="CPHA266_RS02790"
                     /old_locus_tag="Cpha266_0535"
     CDS             complement(588391..589134)
                     /locus_tag="CPHA266_RS02790"
                     /old_locus_tag="Cpha266_0535"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744425.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M23"
                     /protein_id="WP_011744425.1"
                     /db_xref="GI:500064819"
                     /translation="MFSKNRFFLLSEHGRNLKKAGKSAFFAGLVFICSSFPSSPLISS
                     AIAEEKPSASAEGLLASTEEMIEHLILQIDRQSDNSPEIKENYQESGKNFFSSIPNIK
                     PVPGAITSHFGQRFHPVYNTMLFHAGVDFSAAIGTRVQATGSGVIAFSGYDKGYGEKV
                     VINHGYGFETVYAHLSKSLVRQGQRVNRGEIIALTGNSGVSTGPHLHYEVRKHNVKVN
                     PTAYFFNGGNPSKFITNETISAEANGSNS"
     gene            complement(589218..592058)
                     /locus_tag="CPHA266_RS02795"
                     /old_locus_tag="Cpha266_0536"
     CDS             complement(589218..592058)
                     /locus_tag="CPHA266_RS02795"
                     /old_locus_tag="Cpha266_0536"
                     /EC_number="2.7.7.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744426.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase I"
                     /protein_id="WP_011744426.1"
                     /db_xref="GI:500064821"
                     /translation="MSIDNQFDFFQAGCGQPSEATKKNIPEKKPALFLIDGMAMVYRA
                     YYALQSARMKTRDGLPSGAVFGFTSALLKIFETYKPDYLAVAFDSREKTFRHDLYDLY
                     KANRPSPPEDLISQLDAIYQLVTLLGIPIIKTAGFEADDLIGSLARKFEKSCAIYIVT
                     PDKDLAQLVNDEVYILKPGKIQNELELLGIKEITIQFGVRPEQFTDFLALAGDASDNI
                     PGAKGIGPKTAASLIGKYGSIASILLNLNEISPKNRQSLEEFQPRLKLIRQLVTIRTD
                     LDLHVSLQNLATTTPDVEKILPFLKQYELKSIAARLPAIFPEMNLQPESLPADNENNE
                     KNDSPELTAPGSAKDGADYRIVTRKEELQALVEQLNHAAALAVDTETTSLDTFQAELV
                     GISLSIKPKQAWFVYFGKGGVDRRVALDMLKPVLENPSLRKTGQNLKYDLLVLKKYGI
                     DINPVAFDTMLASYVLDPEAKHNLDDLALRHLSIKTTTYDELVADGKKKMSILDVPPG
                     ELSDYACQDADLALRLQEVFKEKLLQEKDLLWLCENIEFPLVPVLATMEYHGISIDTD
                     HLKKTETTVSKQIGQLSEKIFEASGRVFNLDSPKQLAHILFDILGLPSGKATKTGFST
                     NVQVLEDLAPIHPVAQDLLEYRSLQKLRNTYIEALPKMINPLTGKLHTSFNQHVTATG
                     RLSSSHPNLQNIPIRTLIGKEIRRAFIPSNPENLLLSADYSQIELRVAAEISGDEKLM
                     EAFRNREDIHSATARTIFNTTEITPEMRRKAKEVNFGVLYGIMPFGLSRRLNISRNEA
                     KNIIDTYTEKYPGIFNALQQIISDGKERGYVSTLLGRRRYIPDLNSRNKNMQKAAERA
                     AMNTPIQGTAADIIKCAMNLCSTQLRLHKMKSVMLLQVHDELLFETPENEKHRLKTLV
                     EEVMIDAAKRCGLHNVPVEVDTGIGKNWLEAH"
     gene            complement(592055..592894)
                     /locus_tag="CPHA266_RS02800"
                     /old_locus_tag="Cpha266_0537"
     CDS             complement(592055..592894)
                     /locus_tag="CPHA266_RS02800"
                     /old_locus_tag="Cpha266_0537"
                     /EC_number="4.2.1.51"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744427.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prephenate dehydratase"
                     /protein_id="WP_011744427.1"
                     /db_xref="GI:500064823"
                     /translation="MTNCLIAYQGEPGAYSEIAALRIGQPKPCESFEEVFAAVEKHEA
                     DYAVIPIENSLGGSIHQNYDLLLQHPVVIVAETFVKVEHCLLGLQGSSVQHAEKVLSH
                     PQALAQCRNFFSSHKHLKAEVAYDTAGSAKIIAAEKKPKQLAIASKRAGELYGLEILQ
                     ENLADEEWNITRFFCIAHADNPDTSFLKNLSDTTQQKTSIVFTLPNVQGSLFKSLATL
                     ALRDIDMTKIESRPFRKKAFEYLFYVDFTGQQNERNIYNALRHLREFATMVKVLGSYG
                     VIA"
     gene            593014..593766
                     /locus_tag="CPHA266_RS02805"
                     /old_locus_tag="Cpha266_0538"
     CDS             593014..593766
                     /locus_tag="CPHA266_RS02805"
                     /old_locus_tag="Cpha266_0538"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BDW8.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_011744428.1"
                     /db_xref="GI:500064825"
                     /translation="MSGHSKWATIKRKKAATDQKRGNLFTKLVKEITIAAKMGGADPG
                     GNPRLRLAIDTARSNSMPMENILRAVKKGTGELEGVTYDEITYEGYGPAGIALIIETA
                     TDNRNRTVADIRHIMSRNNGSLGESGSVSWMFHRKGSLDVSKSAVSEDMLLEILLDAG
                     LEDLESDDAIYYTVITDLKDLETVKKALDAAAIPFENARIDMIPENYIELEAEDASKV
                     IRIIDALENNDDVQAVYSNMEISEKAMNSLNE"
     gene            593770..594333
                     /locus_tag="CPHA266_RS02810"
                     /old_locus_tag="Cpha266_0539"
     CDS             593770..594333
                     /locus_tag="CPHA266_RS02810"
                     /old_locus_tag="Cpha266_0539"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BDW9.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="crossover junction endodeoxyribonuclease RuvC"
                     /protein_id="WP_011744429.1"
                     /db_xref="GI:500064827"
                     /translation="MVVLGVDPGSLKTGYGVVRQDSSGFSVLTCGVIRLHSGKSHAER
                     IGQIYRELEEIINSTKPRRVALETVFLSKNAQSALKLGQVRGAVIALSMNTDLELHEY
                     APREVKSAVTGRGSASKEQVAFMVTRMLQVTGHITSYDVTDALGLALCDLLRIGNRAA
                     QEPAQGISRGNKNWTGFVRAFPEMVVR"
     gene            594433..594987
                     /locus_tag="CPHA266_RS02815"
                     /old_locus_tag="Cpha266_0540"
     CDS             594433..594987
                     /locus_tag="CPHA266_RS02815"
                     /old_locus_tag="Cpha266_0540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744430.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CDP-alcohol phosphatidyltransferase"
                     /protein_id="WP_011744430.1"
                     /db_xref="GI:500064828"
                     /translation="MNGKIFNLPNSLSFLRILLIPWFLYYFHTGNLTVSVTLMIIAIL
                     SDWFDGQTARWTNEVSEMGKILDPLADKLCLASVALYFLWVGQLPLWFVLFVVSRDAL
                     IFLGAAYVKFRHRVVTTSLWPGKWAVGFLSMMFIAMVVPHPFFERYALKESFMYLSVV
                     MLFYSFVEYCLRFYRIQKGLDYKA"
     gene            complement(595389..596792)
                     /locus_tag="CPHA266_RS02820"
                     /old_locus_tag="Cpha266_0541"
     CDS             complement(595389..596792)
                     /locus_tag="CPHA266_RS02820"
                     /old_locus_tag="Cpha266_0541"
                     /EC_number="3.5.1.-"
                     /EC_number="4.2.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744431.1"
                     /note="catalyzes the zinc dependent deacetylation of
                     UDP-(3-O-acyl)-N-acetylglucosamine to
                     UDP-3-O-(3-hydroxytetradecanoyl)-glucosamine in the second
                     step of lipid A biosynthesis and catalyzes the dehydration
                     of beta-hydroxyacyl-ACP to trans-2-acyl-ACP in fatty acid
                     biosynthesis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxymyristoyl-ACP dehydratase"
                     /protein_id="WP_011744431.1"
                     /db_xref="GI:500064830"
                     /translation="MLIHQRTLQKEVSLRGTGLHTGKECRITFKPAPVNYGYRFIRSD
                     IENSPEIPALIDNVVDVLRGTTIGINGVNVHTTEHVLAALYGLQIDNCSIEMSGPEPP
                     VMDGSSLPFAEALLSAGIAKQDEPKNYLVIDETVEFHDTVNTVDIVALPLDSFRVTVM
                     VDYKNPALGSQHSGLFDLEKEFLKDFAPSRTFCFLSEVETLANQGIIKGGDIDNAVVI
                     VDKSMNNEELQSLAGKLDLEHDHLAIGENGILNNRALRFQNEPARHKLLDLLGDIALL
                     GMPLRAQVLAARPGHASNVEFVKQLKKYADRNKLARQYQHEKKAGVIFDINAIQNILP
                     HRYPFLLIDKIVEFKLDEKIVSIKNVTMNEPFFQGHFPGNPVMPGVLIIEAMAQTGGI
                     MMLNGTENIQEMLVYFMGIDKARFRKPVLPGDTLVIEAVMTNKRRSVCQFDAKAYVRG
                     ELVCEASLMATVMPKTK"
     gene            complement(596919..598754)
                     /locus_tag="CPHA266_RS02825"
                     /old_locus_tag="Cpha266_0542"
     CDS             complement(596919..598754)
                     /locus_tag="CPHA266_RS02825"
                     /old_locus_tag="Cpha266_0542"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013433009.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-type branched-chain amino acid transport
                     systems periplasmic component-like"
                     /protein_id="WP_011744432.1"
                     /db_xref="GI:500064831"
                     /translation="MQAKFLTLCCILLFSICPADGEAASPIKAVTAPPPAPVHAQKPE
                     ETLRSGKNLFRIKEYSKAQTIFETLLKENGNPQSKIRHSTLLWLSKSLFMQKQPEKAA
                     QLLEELLKNPSINGIDPATIVEAHYDLAACRYKLGTPLSAALDFLNVALSATPAGMQA
                     MQEQALINTKLIACTSLDGNAIASLERIARTPDLQTFLLNARMQNYLQKNNTNTFLST
                     IPLVDQLLRSPSISRDSQQLMESLKKQAAQLSLATFKERKIGILLPVEIPVYRAAERS
                     SASNQMFKGIHQRLLRYQMERPDILISYSVAKPSEGAENDLFGSTKQLLETSSPLVLI
                     GPMFSNDAIEAARAAKNSKVPLITPTATDNLVTDNNPWAFQLNPTHEERGRIAARELL
                     KTGKPQRAAAIAEKTDNLEEMAKGFLDELKQAGSKSVIYASFSGKPEDQNNLAESLGT
                     PPGTLLDALYLPMDSPETIETTLLFLEKNRIGYKRLLGSGVWSDRKVVERFRKKISKG
                     ITFFNDYSFSGSAIETVETAKSHQKLWNTALSSNFWYGYDTMDFLLHTIDKSPDLKHS
                     ELAKAIRNAPVYNAHYTKYRFEGNNVNHYLNVILIQPDTARQPIN"
     gene            complement(598767..599558)
                     /locus_tag="CPHA266_RS02830"
                     /old_locus_tag="Cpha266_0543"
     CDS             complement(598767..599558)
                     /locus_tag="CPHA266_RS02830"
                     /old_locus_tag="Cpha266_0543"
                     /EC_number="3.1.3.25"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744433.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inositol monophosphatase"
                     /protein_id="WP_011744433.1"
                     /db_xref="GI:500064833"
                     /translation="MSKELQTAIHAAKTAGNITLRKFGELSQSEIRSKESKDFVTEVD
                     QACEAAISAVILEAFPHDSLLCEEGTTAKGGSGRTWIVDPLDGTLNFIHSFPVFSISI
                     ALCNKDGELLCGVVYQPLLDELFSAEKNKGAFLNGKPIHVSLRSDPESYLIATGMPFK
                     EYHYIESYFGMLAEVIRDSAGVRRAGSAAIDLAYTACGRFDAFWEYKLFPWDFAAGVL
                     LVREAGGTVTDFEGNGNIFNKQSIIAGNHATHPLLLEKALKHFKP"
     gene            599791..600270
                     /locus_tag="CPHA266_RS02835"
                     /old_locus_tag="Cpha266_0544"
     CDS             599791..600270
                     /locus_tag="CPHA266_RS02835"
                     /old_locus_tag="Cpha266_0544"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744434.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CrtK"
                     /protein_id="WP_011744434.1"
                     /db_xref="GI:500064834"
                     /translation="MNNTAVKLLACISLCFLFAFAGSTFTPVPGSEWYYSILNKPSWN
                     PPDWLFPPVWSLLFLMMSLSLFLVVKKGLDSWTTKRAVVIFVLQLVLNLAWSASFFGL
                     HDPLLALVVIFFLWSALVVTIMMFKQLSKAAAYLLVPYLLWVSFASYLNFVIWQLNR"
     gene            600846..601301
                     /locus_tag="CPHA266_RS02840"
                     /old_locus_tag="Cpha266_0545"
     CDS             600846..601301
                     /locus_tag="CPHA266_RS02840"
                     /old_locus_tag="Cpha266_0545"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744435.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_011744435.1"
                     /db_xref="GI:500064838"
                     /translation="MKTENKEFLAATHKKFATLKELVEQVGMNEAWEKMLVGFPEQQK
                     KRMTPFLAAPTLFEGFTRSIPFFESVGMEMEVVDISNDDCDAVLEIQKYCPYLEICNE
                     YGFETPCHVICEMDVEATHRAFPEMRAEILSRQAFDSCVCIFKYERPMK"
     gene            601546..608001
                     /locus_tag="CPHA266_RS02845"
                     /old_locus_tag="Cpha266_0546"
     CDS             601546..608001
                     /locus_tag="CPHA266_RS02845"
                     /old_locus_tag="Cpha266_0546"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017314620.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid adenylation domain-containing
                     protein"
                     /protein_id="WP_011744436.1"
                     /db_xref="GI:500064845"
                     /translation="MKEGITTVENRYGVETPLHYYDISHCLHELFKKQASLNADNPAV
                     IDGTGSLTYRVLDEEADNIAQAIVQRGINRGSFIGLCTTRSSQVISGMLGILKAECAY
                     VHLDPEYPSDRLGYIIDDAGISLILTQQRFTQTFSFCLPSLLLFMDCDQPESYTASIP
                     FSPVEASVSGDPAYVIYTSGTTGKPKGVCCHHKGVVNLLDEFQQRRYLGSEDRCSWWT
                     NLNFDVSVYEIFSSLLAGSALLIVPESVRIDGHAFMDWLHVNDITSAYLPPMMVADFL
                     EWVERNPGKSRMRRLLTGVEPIPENLLLNIQRCVPQLTIINGYGPTETTICATLYTVN
                     SASHHHETTPVGKAVQNMHLHLLDEAGDPVAAGETGEVYIGGVGVSRGYLNQPELNEC
                     LFISDPCYKEEGYRMYRTGDLAVFLPDGELAFVGRKDFQVKYMGYRIELGEIEMVLKS
                     HAAIRDAVVMLREDDPGLKKIVAYCVLEISGNVSPKELQLFAGRLLPAYMIPAVFVFL
                     KKIPMTPNGKSDRNALPPPGKESFLAGKDDGYTAPESVMERDVAAVLSGILGISAIGV
                     DDNLFSLGAHSLMATRLCSQIRMRWNVNIPLAFVFENPTVKQIADEIVRKERIGDVPC
                     RITASDAHRTVFPVSLIQKGLWLFQQFQEEGTLFNIPVVVYFSGAIQEQLIKKSFDFL
                     IDRHECLRTVFELEGEELVQRVLPAMQVELMVKDLSGCNQDTKFAELDRIRKEEGLHR
                     FELDKGPLIKLHLVILGESATHLFITFHHLIIDGWGASVLFRELAASYDAFSRGNMPA
                     LPDKKISFGDFCLWQLERIKSARLSMQIQYWIEQLKGCSFIQNIPHDYSRPSMPSFSG
                     ARCAFSFSPEITKALNEYCLRNNCTMFMYLMTVFQIFIQRYSGRSEIVTGTTIANRNL
                     SDTENIVGLLANSLAIRTDFSGDPKFTELLMQVRKVSLEAFDNQDVPFEIVVENVVQK
                     RERSYHPVFQNLFIFQNTPPPFLHAGDMDFVYEEIGNETAKLDLLLNVEFRKESLFCW
                     IEYNTCLFNADTIERVARDYIWIASHALHETGDPVSSWHFPSIPARNYYATKDNPLAL
                     SCCHYLFELQAERTPDNIAVCCDDVQMTFRELNKKANHLAHRLIQRGVGPDIPVGLCL
                     TRSVYLAVGILGILKAGGSYVPLDSQYPEERIRYMAHDSGIRLAVTDEASAHVLSFDR
                     EMLLVLLDKSDAVESEHSCDNPVFRAGAENTAYIMYTSGTSGRPKGVMVPHRGVSNLA
                     VSAVNNYALKSSDRVLQFFSVSFDGSVEEIFMTLAVGATLVIRTFNAAISVTDFLFHL
                     EKNEITVLDLPTAFWKELVHGVSRTGIKIPNSLRLVIIGGEQASVTDFQKWQKVCGGR
                     VRLINTYGPTECSAVSVFSEPEKINCSYDFNRGLPIGRPMDNTTLYVVDEHCCLVPFG
                     MPGELLIGGAGVAKGYLNLSLLTEDRFIDDVFQESEPKGRLYRTGDIVRSLSDGNLQF
                     LGRKDNQVKIRGFRIEPGEIESVLNQHELIKQSVVIDLTNDQGETALVGYFVTEKNAL
                     SSSELRHYLAQKMPEYMVPSYFVPIKKVPLLPNGKIDRSALPVPDTVVEKKATYVGPR
                     DETEKTLVEIWQEVLGVHPIGVTDDFFELGGHSLLAVRLCSQIQEKVNKKVTLSGLFQ
                     SLTIEKLARTITDEVWVPESSPAVCIQCVDFGKSLPPLFFIHILGTGLKFCRPMVKYL
                     SPELPVYGLSVHLNEKDHFEEFSVEELATRYVREVRRIYPQGPFLFAGISFGGLIAFE
                     MARKMSEDGEDIRMVALIDSILPEAFHKMTGKEGAHAHREKFRSEGVSYLIRKVLERA
                     RHEGFVMREKSSHCYSKILLQYYMVRDRVDRMPVSLYEFAARLQNDDALQKYHPKIYT
                     GKVTLFKSRERFYGVSFIQDPLSGWGAFSSGGVEVIDCPGDHLGMLADPHVETLGMKL
                     MQSIETCLHMARPIATSQTGEVVIRSVKRGESRLFRDISLRSIRESPDAFVATLDQVQ
                     HEPLTYWEQLLDFIVDSPLDTIFLACIDQRCIGFAAARIYSNDPYLTELRWMWVDRDF
                     RGKGLGGSLLEKVIEWAQSRGSQKINLWVSESQNSAIQLYTSKGFVDTGDRGFLRPGS
                     ALHARKMIRDNADYLRHGG"
     gene            <608089..>608529
                     /locus_tag="CPHA266_RS02850"
     CDS             <608089..>608529
                     /locus_tag="CPHA266_RS02850"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010933849.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467505.1"
                     /db_xref="GI:752831203"
                     /translation="LSSDEQSRAAHLSFARDKRSFIVRRALLRMILGSYCSVHPHQLR
                     FRQQQSGKPFIAFPGHTGIHFSHAHSVNMGLYAFSPDQAVGIDVEKIRSLPDLLVVAR
                     RFFSYREYVILKGLSTRNRESVFFRMWSMKEALIKANGWSLEKGL"
     gene            complement(608742..609735)
                     /locus_tag="CPHA266_RS02855"
                     /note="aldo/keto reductase; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(609777..610328)
                     /locus_tag="CPHA266_RS02860"
                     /old_locus_tag="Cpha266_0549"
     CDS             complement(609777..610328)
                     /locus_tag="CPHA266_RS02860"
                     /old_locus_tag="Cpha266_0549"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744438.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744438.1"
                     /db_xref="GI:500064849"
                     /translation="MFITIHARLLLVPVIALFILQGCGNPSQNGKEEKLAVQQAQQIT
                     IIEPSHLVTQQDAEKILGEPVKKAVRTEKPIVGLKLCMYNPVNEQSTSFLQITLTQNG
                     FMLPEGTSTASIYNRLKKNFESTRTDIRDLGDDAFIATGGLYILKENCYIMIAAGNIN
                     SEATRTILMDAGKTALDNLSRLK"
     gene            complement(610511..612460)
                     /locus_tag="CPHA266_RS02865"
                     /old_locus_tag="Cpha266_0550"
     CDS             complement(610511..612460)
                     /locus_tag="CPHA266_RS02865"
                     /old_locus_tag="Cpha266_0550"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744439.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA synthetase"
                     /protein_id="WP_041467506.1"
                     /db_xref="GI:752831204"
                     /translation="MEESISSVMTEKRKFPPPVEFSNSAHVSSMEEYEKLYAAAAEDP
                     ETYWAGLAEQFHWFKKWDSVLEWKTPYAKWFNGGKTNICYNAVDVHMNSWRKNKAAIL
                     WEGEEGDQRVLTYGELHRQVSKFANVLKIAGIKPGDRVAIYMGMVPELVIAVLACARV
                     GAVHNVIFAGFSAHAITERVNDSRAKMVICCDGTRRRGSTINLKKIVDEAIVNTPSVR
                     NVIVLKVTSETVSMHDGMDHWWHDLMGLAMDVSEPVEVDSEHPLFVLYTSGSTGKPKG
                     ILHTTAGYMVHAASSFKYVFDIKDEDIYWCTADVGWITGHSYMVYGPLLNGATLLMYE
                     GAPNYPQWDRFWDIINRYKVTILYTAPTAIRAFIRAGNEWVTKHDLSSLRLLGTVGEP
                     INPEAWMWYHRVVGQEKCPIVDTWWQTETGGIMVSPFPGATPTKPGTATRPLPGIMVD
                     VVRKDGVSCNANEGGYLVIKKPWPSMLRTIYGDNERYEKTYWSEFNDMYFTGDGARKD
                     EDGYIWIMGRVDDVVNVSGHRLGTSEVESALVSHEAVAEAAVVSRPDDIKGNSLVAFV
                     TLKDEYEGDMKLRESLRNHVAKEIGPIAKPDEIRWAKGLPKTRSGKIMRRLLRELATS
                     NEVKGDVTTLEDFGVLENLRDQEDE"
     gene            complement(612695..615145)
                     /locus_tag="CPHA266_RS02870"
                     /old_locus_tag="Cpha266_0551"
     CDS             complement(612695..615145)
                     /locus_tag="CPHA266_RS02870"
                     /old_locus_tag="Cpha266_0551"
                     /EC_number="6.1.1.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BDY0.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="leucyl-tRNA synthetase"
                     /protein_id="WP_011744440.1"
                     /db_xref="GI:500064854"
                     /translation="MRYDFSTIEKKWQSFWLKNNSFSSGESTDKPKYYVLDMFPYPSG
                     SGLHVGHLEGYTATDIVARYKRSCGYNVLHPMGWDAFGLPAEQFAIKTGTHPKNTTEK
                     NISSFRETLQAMGFSYDWSREINTTSPDYFRWTQWIFIKLYELGLAYVSEVDINWCEE
                     LKTVLANEEVEEKVKEGYTVIRKPLRQWVLKITAYAERLLDDLDELDWPENVKQMQRN
                     WIGRSEGMEIDFELRCHNRKLRVYTTRPDTLFGATFLVISPEHPLALKLATAQQLVAV
                     TQYIKEAKLKSELERTGLQKDKTGIFTGSFAINPATGDPLPVWISDFVLTSYGTGAIM
                     SVPAHDSRDWEFAKKFGLPIIEVIKSPDGVDDAAFEGKESVSINSSNPEISIDGLHFS
                     EAFQIMAHWLETKGLGERKVTYKLRDWIFSRQRYWGEPIPVKHYEDGSIRTESNLPLQ
                     LPEVEAYQPSETGESPLATMHDWLYGADEFGSFRRETNTMPQWAGSCWYYLRFIDPEN
                     NAQLIDPAKEKYWMNVDLYIGGAEHAVLHLLYARFWHKVLYDLGVVSSREPFKKLFNQ
                     GMILGEDNEKMSKSRGNVIPADQVLKDYGADAVRLYEMFLGPLEQVKPWNTNGIEGIS
                     RFLGKVWRLVYPDSENPDQRDQAAVLDENPLPEILQRRMHKTIKKVTEDTDHLKFNTA
                     ISEMMVFVNELQKNGCRQKSAVENLLLMLAPYAPHITAELWQAIGHTSPISAEPFPVF
                     DPAIAEDPVVTIAVQVNGKLRGRFTAPAKSPEESLVDMAKHVDTVIKFLEGQTIVKEI
                     VIQDKLVNFAVKQSIPNH"
     gene            complement(615226..617424)
                     /locus_tag="CPHA266_RS02875"
                     /old_locus_tag="Cpha266_0552"
     CDS             complement(615226..617424)
                     /locus_tag="CPHA266_RS02875"
                     /old_locus_tag="Cpha266_0552"
                     /EC_number="2.7.7.8"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BDY1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polynucleotide phosphorylase"
                     /protein_id="WP_011744441.1"
                     /db_xref="GI:500064860"
                     /translation="MIINKAIDLGKGKILSIETGKMAKQADGAALVRLGDTMVLATVV
                     SSKTPPPANQDYFPLQVEYREKYSAAGKFPGGFFKREGRPSEKEILTARLIDRALRPL
                     FPDGYLFETQIIVTVFSSDQINDADVLGGVAASAAIMVSDIPFHNSMSEVRVGRINGE
                     FIVNPNINELQGSDIDICIGGTANTICMLEGEMKEISEAEMLDAIKFGHEAIRKICAL
                     QDEMAAEIARPQRSFAPVKAPAKLKEVIAGLSETRLKELAYTPLCKEDRAEKTASVYK
                     ETLQSTLELFKALLTPEEIAAEPEKALCLNAHIIEEEIHAVEKKVMRHMILDDGKRLD
                     GRTLDEIRPISIELGIIPRAHGSALFTRGETQALVTITLGTKKDAQSVDTLTDSADKR
                     FMLHYNFPPFSVGETGRVGGTGRREIGHGNLAERSIKMVSPSETDFPYTIRIVSDILE
                     SNGSSSMASVCGGTLALMDGGVPIRKPVSGIAMGLIKEGDAYSVLSDILGNEDHLGDM
                     DFKVAGTEDGITACQMDIKIDGLDYHILETALEQARKGRLHILDKMEVAIPISRGELA
                     QYAPRLTSIQIPVDAIGLIIGKGGETIRSITEETGAEINIEDDGTVTIACSSPEGTNA
                     AVETIKTLISKPEIGNTYLGKVRDIRDELGAFVEFLPKTDGLVHISEISKERVTKVSD
                     HLKVGDRVKVKLVDIRKDPRTGKNRFALSIKAVESEPEKSDENKAGTEGN"
     gene            complement(617598..618449)
                     /locus_tag="CPHA266_RS02880"
                     /old_locus_tag="Cpha266_0553"
     CDS             complement(617598..618449)
                     /locus_tag="CPHA266_RS02880"
                     /old_locus_tag="Cpha266_0553"
                     /EC_number="6.3.2.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BDY2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pantoate--beta-alanine ligase"
                     /protein_id="WP_011744442.1"
                     /db_xref="GI:500064862"
                     /translation="MQIITDPIQMQAIAEKLRLNRQLIGVVMTMGALHEGHLSLIKEA
                     RKIAGTIILTIFVNPRQFAPHEDFHRYPRPFEQDAAHAKAAEVDYVFAPPVDAMYTGN
                     FQTTVHPGPLGEQFEGKQRPGHFSGVATIVTKLLQITRPHIAVFGEKDAQQLAVIKQL
                     VKDLNIDVRIIEAPIIRDENGLAVSSRNIYLSAKERDAATVLYKGLCHAERRIAEPCL
                     DLDAIVPEVENIIKSALSCHPEYICFVDDETFLPASKAEKGKTYRLLLAVQAGTVRLI
                     DNRKFMV"
     gene            complement(618433..619167)
                     /locus_tag="CPHA266_RS02885"
                     /old_locus_tag="Cpha266_0554"
     CDS             complement(618433..619167)
                     /locus_tag="CPHA266_RS02885"
                     /old_locus_tag="Cpha266_0554"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744443.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA methyltransferase"
                     /protein_id="WP_011744443.1"
                     /db_xref="GI:500064864"
                     /translation="MQHETGNTGCLYVVATPLGNLEDITLRAVKTLQNAGAIACEDTR
                     RASILLKHFDIIGKKLISYHNYNEARAVLQITRLLEEGVDVCLTTDAGTPIISDPGYS
                     LIHALREKGFPVIPIPGPSALTAALSVCPLPVNNFFFAGFLPHKKGRKSRLAFLSSLN
                     TPVVFYESPHRIIKLLDEFKEAFPDSELFIAREMTKIHEEYRTGTLDALRERLEHETI
                     RGEFVVVVNPACKKNKKTEQDNADHY"
     gene            619263..620246
                     /locus_tag="CPHA266_RS02890"
                     /old_locus_tag="Cpha266_0555"
     CDS             619263..620246
                     /locus_tag="CPHA266_RS02890"
                     /old_locus_tag="Cpha266_0555"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744444.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_011744444.1"
                     /db_xref="GI:500064867"
                     /translation="MKDQNQLVTARDVTVFFSLKKNGFFAKPYKVTAVNGVSFDIKRG
                     ETLGLVGESGCGKTTLGRAMIRLGHGVTGGHIEFNGRDISSMGKREFRALRKDIQMIF
                     QDPFGSLNPRLTIGQMLAEVLKVHRLARGESARKRILELLDIVGLQKEYFNRYPHEFS
                     GGQRQRIGIARALAVSPSFIICDEPVSALDVSIQSQIINLLKDLQKEFGLTYFFIAHD
                     LSVVEYISDRVAVMYLGKIVEIADSRSLYEAPRHPYTEALLSAIPIPVPGGKKHRILL
                     KGDQPGPLNIPSGCGFHPRCPKAMPECSIREPVLKSPQGEPDRLVSCLLYP"
     gene            620290..622095
                     /locus_tag="CPHA266_RS02895"
                     /old_locus_tag="Cpha266_0556"
     CDS             620290..622095
                     /locus_tag="CPHA266_RS02895"
                     /old_locus_tag="Cpha266_0556"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744445.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptidase"
                     /protein_id="WP_011744445.1"
                     /db_xref="GI:500064871"
                     /translation="MKDVNKKSGCWRIGCFSFVVVPILIAVSAFFYFRSSYVLPDKFV
                     LSVPIQGNLDEVHSLSSSLPLLSSAEPLSFQDLLFLFDHAAGDKRIGSILLEIGGVHA
                     NPAKLTELRYSIEKMKASGKKVVAFLRSAEDSDYLLATACDSIVVEEGGFLMLDGLKA
                     ETLFYTKSLNKIGITFQASQWKTYKSGIEPFVRTGASSEYLEQIGELLDDVYDDYLGY
                     ASKRRGISRDSLQAVIDNMALLSAKKAVQLGLADGIASSWALNRSLAGKITGREPERG
                     DDVMVSAERYRDSVEPNYNADGRDAIALITLSGPIYRSGGASGMGVAEGFDEKLLQRS
                     LEVALDNRDVKALVLRIDSPGGDALASADMLEMLYFAAKKKPIVVSMSGVAASGGYMA
                     ALAGNKIFAEPLTITGSIGVYALKPEISGLVEKTGLQREVVTRGRYADATSLFKPLDK
                     DAYDKFVAASGDVYHDFVSKVATSRKMRWAAADSVAGGRVWSGKRALQAGLIDSLGGL
                     HDAIREAQILGKIDKTKKPRILFYPERKSWMESLAEGDFSGFSRSVTIALKQRLIHEL
                     VPEGQSSSITAFYDMLMVSGQLHLIAALPGEVVIR"
     gene            complement(622165..623577)
                     /locus_tag="CPHA266_RS02900"
                     /old_locus_tag="Cpha266_0557"
     CDS             complement(622165..623577)
                     /locus_tag="CPHA266_RS02900"
                     /old_locus_tag="Cpha266_0557"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744446.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744446.1"
                     /db_xref="GI:500064873"
                     /translation="MYIQVFHATCIRRNKPLKAHTSMNRKRTLPYALMLAGLLLAPPA
                     VTAAETLEERVIRLEKELAELKTLVGRKPAAPAQVAAIPVTPATPEAKPAAKSPLTVS
                     LGSGVKAQLYGFARFDASYDTGKINPGNIALWVRPEGLNNNDAEWNLTAGATRLGLNL
                     TGPDTDSIKLSGNIEFDFLSNVGAENNASPRLRHGYLKAFWPASDFSILAGQTWDVIS
                     SQIPFTDDPAIMWAAGNIGSRHPQLRLTKGFSVGEKGRIELVAAASRTIGESNTLAET
                     WNTDPGKDADMPAIQGRIAFSAPLLVDTQPATIALSGHYGQEEWDSDKTGNHATLDSW
                     SCNVEIAMPLSEKITLGGEYFTGSNLDDYWGGIGQGVNKDVSGDLKEIRSQGGWAALR
                     YTMNPSTTFSLGAGIDDPNDNDLAADGRSLNQSFFANVINRITPNFILGVQLSQWRTD
                     YRNAPESDAFRAQSSMTYKF"
     gene            complement(623904..625460)
                     /locus_tag="CPHA266_RS02905"
                     /old_locus_tag="Cpha266_0558"
     CDS             complement(623904..625460)
                     /locus_tag="CPHA266_RS02905"
                     /old_locus_tag="Cpha266_0558"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744447.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium chelatase"
                     /protein_id="WP_011744447.1"
                     /db_xref="GI:500064876"
                     /translation="MLSTLYAASLYGIDAVKVDVEINVTGGIPSFTVVGLPDNAIRES
                     RERILTAVRNSGFDLPPKKITVNLAPADLKKEGTAFDLPIAIGLLGSLKLIKNRFPDT
                     LIMGELALDGSIRRINGALPVAIMAVKEKIKRLIVPLANAAEAAVAISASKADTLVFG
                     VETLNETADLLNGKTKPSPVEVNVAELFQKEPEYPVDFADIKGQQAAKKALEIAAAGG
                     HNLLMIGPPGSGKTMLAKALPSILPPLGFEESLETTKIYSVASLLEKDHPLMVTRPFR
                     NPHHTTSNVALIGGGTTAKPGEVSLAHNGILFLDELPEFTRNALEVLRQPLEDREVTV
                     ARISVTTKYPAGFMLVAAMNPSPAGALKDRDGNLTASPQQIQRYLSKISGPLLDRIDI
                     HIDVPKVENTELFSASAAESSRAIRERVIRAREIQHQRFAAVTSPRIYTNAQMQSKLI
                     RTFCKLDPESSQKLMDAMNRLNLSARAHDRILKVSRTIADLEGSETIEMRHLIQGIQY
                     RNLDRDFWSF"
     gene            complement(625602..628370)
                     /locus_tag="CPHA266_RS02910"
                     /old_locus_tag="Cpha266_0559"
     CDS             complement(625602..628370)
                     /locus_tag="CPHA266_RS02910"
                     /old_locus_tag="Cpha266_0559"
                     /EC_number="4.1.1.31"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744448.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate carboxylase"
                     /protein_id="WP_011744448.1"
                     /db_xref="GI:500064879"
                     /translation="MITTTSSVINFEKAERDFTFLLQCFQEMLHDLGEKELAEHLPWK
                     RASMRLDDYPDIERAIQAYSIFFQLLNMAEENSGAQYRRTIETEKGLSELKGLWGKNL
                     HRLKKNGITEEEILSELSRVTVDVALTAHPTEAKRKTVLEQHRQLYILLVKRENQMWT
                     PLEQEDIRKEIKVVMERLWRTGELLYDKPAVSAERRNIVHYLYNIFPEVLPMLDKRLL
                     HAWQECGFAPEKLADPQTLPLLRFGSWVGGDRDGHPLVTAKVTRETLLEMRRKALALI
                     AFHLTRLASKLSLSEKHQLPPDALEERIRTLANHLGEDGEVALIRNRHEPWRQFINLM
                     IASLPKNPRNEHDTGNQNDIFSYGSSRELLDDLELLRQSLLNVGARHIADSDVAPVYR
                     IVQTFGFHLASLDIRQNSEFHDLALSQLMSAAGLNGSAFLTWNEEERTAFLDRELQSP
                     RPFTHPDMKAGPEAEAVLDCYRVLLDHCKEYGSEGIGSLIVSMTRNASDLLVVYLFMR
                     EVGLMTPFKEHDACMLPVVPLFETIEDLEKSPDIMRTFLSHPLTRRTLGMQQEMNGWE
                     KPAQQVMIGYSDSNKDGGIFASIWNLYRAQESLLEAGKKSETEILFFHGRGGSISRGA
                     GPTHRFLRAQPHGSFQAGIRFTEQGETIAQKYANRISALYNLELFMAGVTGELLKHRN
                     KEKTSHELEPLMDMLSRTSNLAYRRLIEAEGFIDFFREATPIDIIEATRIGSRPSRRS
                     GKKSLADLRAIPWVFSWNQARFSLSGWFGIGSALEQLQHEHPEACDNIRRQDASWAPL
                     RYIISNADASLATVDTEIMREYAALVENSELRSRIFGIIENEYHKTRTMIESLYGAHL
                     EEQRLNVSRFISLRQEGLRELHRQQIRLLKKWRKLHQTGQNKKADNLLAELFLTVNAI
                     SGGLRTTG"
     gene            628707..629348
                     /locus_tag="CPHA266_RS02915"
                     /old_locus_tag="Cpha266_0560"
     CDS             628707..629348
                     /locus_tag="CPHA266_RS02915"
                     /old_locus_tag="Cpha266_0560"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744449.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C"
                     /protein_id="WP_011744449.1"
                     /db_xref="GI:500064881"
                     /translation="MDNKSNGKLIALAIGGAVLMGALFFGVSFLTGYKVPAENISNIL
                     TPLKSFTGWFSLIFFASLIIMTLGKMSSRISDKWFLSFPLGALGIVALMFAILWIRPS
                     GFLLPTTGRTTTLDGKYIRSVGELKAFLDKPAEGSKVPKAPAGFDFDGAKALADGRCN
                     KCHTLDSVQDALRTKFKKTGKVDVVVNRMQAYPGSGITVDEANTIMIYLVEKY"
     gene            complement(629489..629839)
                     /locus_tag="CPHA266_RS02920"
                     /old_locus_tag="Cpha266_0561"
     CDS             complement(629489..629839)
                     /locus_tag="CPHA266_RS02920"
                     /old_locus_tag="Cpha266_0561"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BDZ0.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="7-cyano-7-deazaguanine reductase"
                     /protein_id="WP_011744450.1"
                     /db_xref="GI:500064882"
                     /translation="MKKEILEVFDNTFPGRDYTIEIVNPEFTSVCPITALPDFGTIII
                     RYIPDKSCVELKSLKYYFLEFRNAGIFYENITNTILDDLTSVLQPREMTVITQWKARG
                     GITETVSVTWPQKQ"
     gene            630014..630724
                     /locus_tag="CPHA266_RS02925"
                     /old_locus_tag="Cpha266_0562"
     CDS             630014..630724
                     /locus_tag="CPHA266_RS02925"
                     /old_locus_tag="Cpha266_0562"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744451.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase type 12"
                     /protein_id="WP_041467507.1"
                     /db_xref="GI:752831205"
                     /translation="MLISADKQSREMAELYDALSGEYDLRESPFTFADQTFSFLSVLD
                     SYALLDRITQEEFVKDEQMPYWAEIWPAAIALSSFIAEDLMLEGRRVIEIGAGVGMVS
                     VTAARFGAGVLATDYSTEALRFVRYNALLNRVSLETARLDWRSVMCSEQFDFLFAADV
                     LYERVNLLPVVTAIDKLLKPDGVAYVADPRRRLAEQFLELAAENSFIITPELHEFRIG
                     RPPVAVTIYRITRCQQLS"
     gene            630721..631581
                     /locus_tag="CPHA266_RS02930"
                     /old_locus_tag="Cpha266_0563"
     CDS             630721..631581
                     /locus_tag="CPHA266_RS02930"
                     /old_locus_tag="Cpha266_0563"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744452.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744452.1"
                     /db_xref="GI:500064894"
                     /translation="MNNGTMRFTRRWSFHAGEGALVWQLVFPQTGEVVGQKLLRESRR
                     SLFFSLDSATGRVLFDDLPLIGDDGSLNTPDGWYTGIETTAHHLVYCYCYQRESPEHL
                     GLWAIDPGSGQVVWARRDVVFVANLEETFLVYTPSSFGGFPERHYLLLDPLAGSTVRT
                     IGFDSMTANALRREMTPEEDRQGLLLPQFVSEGMVEETLALRRAGIDAPQHCECIVLG
                     PLLVAARYEPSSVSGRWNTVLGVWFDAVRVYEEVMEKDGEKPCLNNFLIRDLSLYYIK
                     EKEELISVSL"
     gene            631578..632564
                     /locus_tag="CPHA266_RS02935"
                     /old_locus_tag="Cpha266_0564"
     CDS             631578..632564
                     /locus_tag="CPHA266_RS02935"
                     /old_locus_tag="Cpha266_0564"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744453.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase XerC"
                     /protein_id="WP_011744453.1"
                     /db_xref="GI:500064896"
                     /translation="MKKHDAYGTTDSGEDGCYREAERFLGYLKTSKNVSRHTITAYRN
                     DLDQFFSFMQRHLELQHMSLFDPEQVTVASVRLFMGDLLQRGLQPKSIARKLASVKSF
                     YRYLQETGVIKSSVLSLVSTPRYPRHVPGFLTEQQTEKIFEQEDSGLFGSDDTFEFHR
                     DISVLEMLYGCGLRISELIDLCPDDINFLQGYVKITGKGQKQRIVPLGTQAAEAVRKY
                     FEVRRNFFRINKLMDEKELNHVFVTKRGKKLYPMLVQRITKKYLMSVTEQKEKNPHLL
                     RHTFATHLLNNGADLKSVSEMLGHSSLATTEIYTHVTFGRLKEVYRKAHPKA"
     gene            632641..632964
                     /locus_tag="CPHA266_RS02940"
                     /old_locus_tag="Cpha266_0565"
     CDS             632641..632964
                     /locus_tag="CPHA266_RS02940"
                     /old_locus_tag="Cpha266_0565"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744454.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744454.1"
                     /db_xref="GI:500064902"
                     /translation="MKTAVNDTISNVQVTLRHSSNHNSIEEYARSAVQVLGRVYPGII
                     SCHIILDHQKNDFEKNKLAEITVHVPQNVLVAREAGTAYEQTIDSCVESLGRQLKKYK
                     EKFVP"
     gene            633049..634017
                     /locus_tag="CPHA266_RS02945"
                     /old_locus_tag="Cpha266_0566"
     CDS             633049..634017
                     /locus_tag="CPHA266_RS02945"
                     /old_locus_tag="Cpha266_0566"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BDZ5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HPr kinase"
                     /protein_id="WP_011744455.1"
                     /db_xref="GI:500064903"
                     /translation="MTLEQKGLKKQSITVAYFFDTIGKEHDIKLRRLNSVDEQKRRIF
                     ERDLHRPGLALAGFTNLFTYKRVQILGNTEMRFLNQHEEDARKNAFGNFVRFKIPCII
                     LTSTNKLQPELLAMATEAGIPVFSTRHSSTKTMYLITEFLDNQFSLYQQYHGSMVDVY
                     GVGVLLKGRSGLGKSEVALDLVERGHGLVADDVVVIHRKGESMILTAKRNKNIEHFME
                     IRGLGVVDVKANFGIRAIRDAKEVQVVVELLEWNKEMEYERLGLDTKTTKILGVEVPL
                     VQLPIFPGKNITVIIEVVALNFLLKHYYDYVPAEALTKRIRTAIDQ"
     gene            634030..635856
                     /locus_tag="CPHA266_RS02950"
                     /old_locus_tag="Cpha266_0567"
     CDS             634030..635856
                     /locus_tag="CPHA266_RS02950"
                     /old_locus_tag="Cpha266_0567"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744456.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_011744456.1"
                     /db_xref="GI:500064904"
                     /translation="MTMFTKREVTVPACSNSRPFRFSLSALILFMTVLASTSCSEKKQ
                     GDDIGSKGRAAKDSTLVIAMLGDADYLNPVLGTTVTSNNIFSLIYPGLLQSEFDTTTG
                     LLNFIALEKRLRQTGTGTGKKTPRAALAKTWRMAPDHKSITYILRNNAFWNDGKPIVS
                     GDFKFSYKLYGNPVIASARQQYLSELIGAETGQVDFRRAIETPDDTTLIFRFHKPVSE
                     QLALFHTSLTPLPSHYWRSVKPEDFRSSPLNQLPLGAGPYKLQVWRQQQEIVLASNKR
                     SNLPKPGNIPYISYRVVPDYTVRLTQLQTNAVDVVENIKPEDFQGVLKSNAAIEIKTV
                     GLRVFDYVGWSNIDQAEYHKTGKIKPHPLFGSAQVRLALTTAIDRESIIDGYLKSYGV
                     LCNTDISPSLKWAYNRAILAHQFDPAKASALLKAEGWLPGPDGILRKNGRKFSFVLYT
                     NSGNARRNYASVIIQQNLKAIGIDCKLDVQESNVFFENLQSRKLDAWMAGWSIGLEID
                     PLDVWGSDLKKSRFNFTGYQNPRIDGLCELAKQKMDPLEAKAYWMEYQQILHRDQPVT
                     FLYWIRETQGFNKRIQGEELNISGTFYNIDDWTLNPSATVAL"
     gene            635866..636831
                     /locus_tag="CPHA266_RS02955"
                     /old_locus_tag="Cpha266_0568"
     CDS             635866..636831
                     /locus_tag="CPHA266_RS02955"
                     /old_locus_tag="Cpha266_0568"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006365489.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="WP_011744457.1"
                     /db_xref="GI:500064905"
                     /translation="MLTYIIKRLLIAVPLIFGVLTLTFFIIRLAPGDPAAYFIQPGIS
                     PHVAEQIREQYGLNDPLPVQYIKWISSVLHGDFGRSFSRAQQPVFDVIAEALPVTVTI
                     ALLTLIANFIFGIIIGIISAVRQNSVLDRVLTVIALFFYSMPEFWFALMMIIMFSLKL
                     PLFPASGLNEIGAESFGTVGFILDRLWHLVLPVTVLSINGAAGIARYVRGSMLEVIRQ
                     DYIRTARAKGLKERVVIFKHALRNALLPVITLMGSSLPFIFSGALFIEVIFAFPGMGR
                     VTVEAIFSRDYPLIIANTFISGSLIVLGNLVADVFYAVADPRIKL"
     gene            636859..637899
                     /locus_tag="CPHA266_RS02960"
                     /old_locus_tag="Cpha266_0569"
     CDS             636859..637899
                     /locus_tag="CPHA266_RS02960"
                     /old_locus_tag="Cpha266_0569"
                     /EC_number="3.1.22.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BDZ8.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Holliday junction DNA helicase RuvB"
                     /protein_id="WP_011744458.1"
                     /db_xref="GI:500064911"
                     /translation="MKIELLNTPADALEIRYEEQIRPLKMDDFTGQQRLTDNLRVFIS
                     AAKIRGDALDHVLLSGPPGLGKTTLANIIASEMGGNIKVTSGPMLDKAGNLAGLLTSL
                     RKGDVLFIDEIHRLPAAVEEYLYSAMEDFRIDIMLDSGPSARAVQLRIEPFTLVGATT
                     RSGLLTSPLRARFGISSRFDYYPPELLERIILRASGILGIGVTTEAAGEIAGRSRGTP
                     RIANRLLRRARDFAQVADSFVINHDIAMTTLASLEIDEEGLDDMDKKIMDTIVNKFNG
                     GPVGVASLAVSVGEEQDTIEEVYEPYLIQAGYLARTPRGRVATRLALKRFSSGSGINS
                     SEGPLFDAAPAR"
     gene            <638078..639655
                     /locus_tag="CPHA266_RS02965"
                     /old_locus_tag="Cpha266_0570"
     CDS             <638078..639655
                     /locus_tag="CPHA266_RS02965"
                     /old_locus_tag="Cpha266_0570"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006365487.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467508.1"
                     /db_xref="GI:752831206"
                     /translation="KGEFITASFRAAKGDYWGAIDHYRRVIKQEPDNAAVNYFMAKAF
                     SVLDVSDSAMVYSEKAVSLSPDNLYYLKLLAGISHRLKDYKRAAEILTRVAALEPGHP
                     ENLALLALAYLSSEQPEKALDVFQEMLRLDPENERTQAQVLLLEIKLRHYQEAIGTLK
                     ELIGAGDEKEKLRLTLGELYLQTGQRDLAVAAFRSLVKDDPLFVPAWLALFEVSVQAG
                     DQPGFIRDLHGFYTTKGVNVQNKIDLAQLFFVRSVHDSVYAEPYKAMMSALEKNYPGE
                     SRVYELKASASMQQKKYLQAIADFKQALALDAANFDAWEGLVSAYIVQNDPGAARKAL
                     MLAKRKVKGNRTRLLMLEGYLFYHIGETKKAVVVLEKALSTKDAKKEKMFYMQASVTL
                     ALCFDRLGIPAKSIRIYETILLLDPDNALAMNNLAYILSQQGSQLDKAKTLALGAVAK
                     DPESMVYLDTLGWVYYKLGEYDKAEKALEKAFEYAVEKNQVDPEIMHHLIMVYEKLGY
                     TEKIRVLREKTGEKKSP"
     gene            complement(639741..643301)
                     /locus_tag="CPHA266_RS02970"
                     /old_locus_tag="Cpha266_0571"
     CDS             complement(639741..643301)
                     /locus_tag="CPHA266_RS02970"
                     /old_locus_tag="Cpha266_0571"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744460.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate-flavodoxin oxidoreductase"
                     /protein_id="WP_011744460.1"
                     /db_xref="GI:500064915"
                     /translation="MSRTFKTMEGNEALAHISYRTSEVISIYPITPASPMGEYSDSWA
                     SEGKTNIWGTIPKVDEMQSEAGAAAAVHGALQTGALTTTFTASQGLLLMIPNMYKIAG
                     ELSPCVIHVSARSLAAQALSIFGDHGDVMSVRGTGFALLASSSVQEVMDMALIAAAST
                     LESRIPFLHFFDGFRTSHEISKIEVIPDETIKAMISDDLVIAHRNRRMSPDAPIIRGT
                     SQNPDVYFQGRETVNSYYNACAGITERAMIKFGELTGRHYELYQYYGSPDAEKVIVLM
                     GSGVETARETVAYLNKQGEKVGVINARLFRPFSIEHFIKAFPATVKSISVLDRVKEPG
                     SSGEPLYLDTVNAIHEGFQKGMLGSMPNITGGRYGLSSKEFTPTMIKAVFDNMSSSAP
                     KNHFTIGIKDDVTSISLDYDKDFSIEPDDMFRALFYGLGSDGTVGANKNTIKIIGENT
                     PNFAQGYFVYDSKKAGSITTSHLRFGPREIRSAYLISEAQFIGCHHWIFLEMIDLLKN
                     LKSGGTLLINSHYSAEDVWDKLPKIAQEHLIRKQARLYTIDAYKVAQASGMGQRINTI
                     MQSCFFAISGVLPREEAIENIKNSIRYTYGKKGDEVVNQNIQAVEHSIANLHQVTIGS
                     IADSKKELRSPIVGEAPDFVCNVLAKIIAGEGDDLPVSMIPADGTYPTGTSKFEKRNL
                     ADNIPGWEPDLCIQCGKCCMVCPHAAIRAKVYDPKYLKNAPNTFKNTDAKAANWEGMK
                     YTIQIAPEDCTGCEMCAHVCPARDKSGSGRKALNMHVQSPLREAEIDNWNYYLNIPEL
                     DRNLINPRLVKEQQLQEPLFEFSGACSGCGETPYVKLMTQLFGDRLVIGNATGCSSIY
                     GGNLPTTPYTTNASGLGPTWSNSLFEDTAEFALGFRISIDKQREYARELVQKLAAQTG
                     ETLASEILEATELTEPDIFEQRKRVAILKDKLRQIDTPDAKNLLSVADMLVKKSVWGV
                     GGDGWAYDIGYGGVDHVTASDKNINLLVLDTEVYSNTGGQASKATPKAAVAKFAAAGR
                     TVTKKDLGLISMSYTNAYVASVAFGARDEQTLKAFLEAEAFDGPSIIIAYSHCIAHGI
                     NMSTALDNQKAAVDSGHWLLYRYNPDRLKEGKNPLILDSKKPKIPVSQFLDMENRFRM
                     LKKSHPALADHYYAAIQKEVDARWAHYDYLAARSFDEIKS"
     gene            643595..644353
                     /locus_tag="CPHA266_RS02975"
                     /old_locus_tag="Cpha266_0572"
     CDS             643595..644353
                     /locus_tag="CPHA266_RS02975"
                     /old_locus_tag="Cpha266_0572"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744461.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA methyltransferase"
                     /protein_id="WP_011744461.1"
                     /db_xref="GI:500064917"
                     /translation="MEKEKDMEQQEKVVYGRNAVLELLLKKPDSIEKIYFQFNTSHPK
                     LKEILVSARRQKLVTGKARLERLSLMAGTTKHQGVCALVSAVSYYTIEEVLDKPRNTF
                     PLLLILQGLEDPHNIGAIIRTAEAVAADAVLLIEGKGSPVNATVHKASAGALSHMRVC
                     KVKSLVRCLEFLHERKFLIIAADMDAEINYTDIDLTKALAIVLGAEGSGLAPEAVKFC
                     DHTVRIPMAGCVESLNVSVTAGVLLYEAMRQRLA"
     gene            644478..644861
                     /locus_tag="CPHA266_RS02980"
                     /old_locus_tag="Cpha266_0573"
     CDS             644478..644861
                     /locus_tag="CPHA266_RS02980"
                     /old_locus_tag="Cpha266_0573"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BE02.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine cleavage system protein H"
                     /protein_id="WP_011744462.1"
                     /db_xref="GI:500064918"
                     /translation="MNIPEDLRYTKDHEWVKLLDDGSTALAGITDFAQSELGDIVFVE
                     LKAPGTKLKAHEVFGTVEAVKTVADLFAPIAGELVGINEALDAAEVVNTDPYGEGWLV
                     KIKVDDAKAVEELLDAASYRQLIGA"
     gene            644897..646231
                     /locus_tag="CPHA266_RS02985"
                     /old_locus_tag="Cpha266_0574"
     CDS             644897..646231
                     /locus_tag="CPHA266_RS02985"
                     /old_locus_tag="Cpha266_0574"
                     /EC_number="1.4.4.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BE03.1"
                     /note="acts in conjunction with GvcH to form
                     H-protein-S-aminomethyldihydrolipoyllysine from glycine;
                     forms a heterodimer with subunit 2 to form the P protein;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine dehydrogenase subunit 1"
                     /protein_id="WP_011744463.1"
                     /db_xref="GI:500064920"
                     /translation="MPFIVNTDQDTREMLSVLGAASFDELIPDIPEEIRLKKALDLFP
                     AMSEQEVKRLLEGLASSNTSTSDYVSYLGGGAYDHFIPSAIKTIVSRSEFYTAYTPYQ
                     AEVSQGTLQAIYEYQSLMCRLYDMDVANASMYDGATALAEAVLMAISVTGRQEVIVAG
                     KLHPHYCEVLKTYLEAGGHSAVVQNTLENGVGTLDGLGALLTDRCAAVIVQQPNFYGS
                     LEDVEAIGELAHSKGALFVVSADPVSLGLLAAPGSYGADIAVGEGQPLGNAQSFGGPY
                     LGIFTVKQDLVRKIPGRLVGMTKDRNGDDGFILTLQTREQHIRREKATSNICTNQALN
                     ALHAAIYLSLLGKQGIIDVAEQSALKSHYLAEQIADIPGFSLKYSAPFFREFVVETPM
                     AAREVISNLLEKKIFAGCDLSVYDEAGLLVAVTEKRTKAELDAFVEYLGALK"
     gene            complement(646224..647114)
                     /locus_tag="CPHA266_RS02990"
                     /old_locus_tag="Cpha266_0575"
     CDS             complement(646224..647114)
                     /locus_tag="CPHA266_RS02990"
                     /old_locus_tag="Cpha266_0575"
                     /EC_number="4.2.1.52"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BE04.1"
                     /note="catalyzes the formation of dihydrodipicolinate from
                     L-aspartate 4-semialdehyde and pyruvate in lysine and
                     diaminopimelate biosynthesis; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrodipicolinate synthase"
                     /protein_id="WP_011744464.1"
                     /db_xref="GI:500064922"
                     /translation="MSTRYIAGSAVALVTPFRKNNTIDTDALKKLVQFHIEAGTDIII
                     PCGTTGESPTLTSDEQFRIIRIVSEEADGKIMVAAGAGTNATAHAVELAKNAEKAGAS
                     AILSVAPYYNKPSQEGFYQHFRHIAEAVSVPIIVYNVPGRTGSNLSASTILRLARDFA
                     NIAAVKEASDNMNQIMELLEERPENFSVMTGEDMLILPFMAMGGDGVISVAANQIPST
                     VKQLVIAAKQGNLDEARALNRKYRRLFKMNFIESNPVPVKYCLSLMGMIEENYRLPLV
                     PLSDENKAVLKKEMEFLGLI"
     gene            complement(647180..648886)
                     /locus_tag="CPHA266_RS02995"
                     /old_locus_tag="Cpha266_0576"
     CDS             complement(647180..648886)
                     /locus_tag="CPHA266_RS02995"
                     /old_locus_tag="Cpha266_0576"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744465.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RecN"
                     /protein_id="WP_011744465.1"
                     /db_xref="GI:500064924"
                     /translation="MVTTLYVRDFALIAELTVSFAPGLTIITGETGAGKSILIGALSL
                     VLGERASVDLVRSGANKAIIEAVLKNLPLQKISPILIGAAIDISDEMILRREISASGQ
                     SRCYINDTPCTVTLLKQIGELLIDLHGQHEHQLLLRTDTHEAMLDSYAQTGSEVSAYK
                     ETLKRVATLKKQLTLLQKKAVETKENKDLLTYQLNEINALELKAGEPEAIDKEIILLE
                     NAETLFSLCSGLCTELYDKDQSAYSAITTSVHILEKLALIDPQFESHLEENRTAASII
                     EELYHFSRRYTTQVEFNQEKLDELRQRQMQLHRAQKKYGKTLDELIVFREELLARLAM
                     EETIDDEISLILEEIALEKTTLSIRAQTLSSKRQASAQKLERIIRKELGELGIPNAFF
                     KISIIHEEHPDGEITLAGKNFIACSGGYDRIEFLVSANPGEKPKPLVKVASGGEISRI
                     MLALKSALAASTDLPVLVFDEIDTGISGSVAAAVARSLKRLSKLHQIIAITHLPQIAA
                     MADLHLSASKSVQQERTVTEVTALHGDARLHALASLVSGKQLSPSSLKLAGELLEGAK
                     SV"
     gene            complement(649264..649461)
                     /locus_tag="CPHA266_RS03000"
                     /old_locus_tag="Cpha266_0577"
     CDS             complement(649264..649461)
                     /locus_tag="CPHA266_RS03000"
                     /old_locus_tag="Cpha266_0577"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BE06.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit TatA"
                     /protein_id="WP_011744466.1"
                     /db_xref="GI:500064926"
                     /translation="MFGLGGQELVLILLIILLLFGAKKLPELARGLGRGMKEFKKAQT
                     EIEEEFNKVVEEPPAKEKTTT"
     gene            complement(649572..650210)
                     /locus_tag="CPHA266_RS03005"
                     /old_locus_tag="Cpha266_0578"
     CDS             complement(649572..650210)
                     /locus_tag="CPHA266_RS03005"
                     /old_locus_tag="Cpha266_0578"
                     /EC_number="4.1.1.65"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BE07.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidylserine decarboxylase subunit beta"
                     /protein_id="WP_011744467.1"
                     /db_xref="GI:500064928"
                     /translation="MPTSYGYTTLLKTTLVCCLLTALVSIFLPALLPLTATGSAAVII
                     FTLYFFRDPERRIPLDQQVIVAPADGKILLIQPLDHAFTGNDSTLVSIFMSPFNVHVN
                     RIPLDGTIVHLRYVPGKFLMAFDNRSMESNEKMEIGIDNGSLRVLFIQVAGFLARRIV
                     CPLHRNESVLSGKRFGMIKFGSRVDMILPAAVKIMVQSGQKTCAGETIIGRY"
     gene            650316..651293
                     /locus_tag="CPHA266_RS03010"
                     /old_locus_tag="Cpha266_0579"
     CDS             650316..651293
                     /locus_tag="CPHA266_RS03010"
                     /old_locus_tag="Cpha266_0579"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744468.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA(Ile)-lysidine synthetase"
                     /protein_id="WP_011744468.1"
                     /db_xref="GI:500064930"
                     /translation="MNVLEKKFLEQIRIRQLVSKEDHVLLAVSGGSDSMALLHLFCAI
                     RRAVPCRISAVHCNFRLRAEESDEDERFVQEACLALGVTCYTVGFDTLKMAGEWKTSI
                     EETARILRYRYFDTLLSEHGMKVVATGHHVNDNAETMLFNLFRGTSLLGLRGIRAKRG
                     KIIRPLLLVHKVEILGYIDEKHIAFRIDATNFGIDPDRNFIRNRIIPLIEERFSHKLL
                     PSLQRLSEQAGELEEFLELYFENLLADKPGLSASNGMLEVKDLVLLSLFEQKEVFKRA
                     LREHDVKCDSKTLDQLVRLLKTQPGRMVRLSAQIVVLWKGGTLHILRQS"
     gene            complement(651356..652393)
                     /locus_tag="CPHA266_RS03015"
                     /old_locus_tag="Cpha266_0580"
     CDS             complement(651356..652393)
                     /locus_tag="CPHA266_RS03015"
                     /old_locus_tag="Cpha266_0580"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744469.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744469.1"
                     /db_xref="GI:500064933"
                     /translation="MQSSAEEPQVRPEKRSLKKGAGLLISISILSMLCFLAVVVWINW
                     EKPRVQTEPLSPEVRGLIERFPGKSDALIYLGLKDIRQSGFWKEIIPDSLKKAPVLIT
                     ERKLDDLIRVSGINLSEDLDTLIISFRRKSYNRQDYLGIASGPFAEKLPESLLLKESS
                     SSEPLNGHTCYELDNSVWICPIGHRRVALASNRELLEQFLSPKGSFFQRDSLASALID
                     KAEFKSHLWFALPSAAWTSGALQSLTSANKDMKAVGNLNRIQHLALSVKFTDGINAGT
                     EWIYKTRRAAYFASTFIWGAVKLSGITGTRTSEQKKELLEKLKIEQNLESVIIHMNLP
                     PEIFRKTPANK"
     gene            complement(652406..652846)
                     /locus_tag="CPHA266_RS03020"
                     /old_locus_tag="Cpha266_0581"
     CDS             complement(652406..652846)
                     /locus_tag="CPHA266_RS03020"
                     /old_locus_tag="Cpha266_0581"
                     /EC_number="3.1.26.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BE10.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease H"
                     /protein_id="WP_011744470.1"
                     /db_xref="GI:500064936"
                     /translation="MQKKIIVYTDGACSGNPGKGGWGALLMYGASTREISGYSPATTN
                     NRMELSAAIEALETLKEPCIVHLYSDSSYLVNAINEGWLKRWTANNWKTAAKKSVENI
                     DLWQKILTLIKLHDVTFHKVKGHSDNPYNNRCDELARQAIKNNR"
     gene            complement(652925..653143)
                     /locus_tag="CPHA266_RS03025"
                     /old_locus_tag="Cpha266_0582"
     CDS             complement(652925..653143)
                     /locus_tag="CPHA266_RS03025"
                     /old_locus_tag="Cpha266_0582"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B4SE11.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L28"
                     /protein_id="WP_011744471.1"
                     /db_xref="GI:500064938"
                     /translation="MSKVCVLTGKRPKYGNTVSHANNHVRTRFEPNLHTKKIWIEEEK
                     RFVKVKLSAKAMKIIAKTGTAQLAKLLK"
     gene            complement(653217..654209)
                     /locus_tag="CPHA266_RS03030"
                     /old_locus_tag="Cpha266_0583"
     CDS             complement(653217..654209)
                     /locus_tag="CPHA266_RS03030"
                     /old_locus_tag="Cpha266_0583"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744472.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bacteriochlorophyll/chlorophyll a synthase"
                     /protein_id="WP_041467509.1"
                     /db_xref="GI:752831207"
                     /translation="MNGRNTIYPEMQQSISEKLHSSGISAARQKAIQQALENVNKPGF
                     RIEPSAIIPLMKPVTWFPPMWAFACGVVSTGENIAENWSILLRGVILAGPLMCAMSQT
                     MNDYFDREVDAINEPDRPIPAGKISKSASWLITFGLIISGFLVALSIHPYVVAIAFVG
                     VLMSHAYSGPPIRAKRNGWFGNLIVGLAYEGVAWLTGSFAITQGVPSSETIALAIIFS
                     LGAHGIMTLNDFKSIVGDNIRQVASIPVQLGEKKAAILASIIMDFAQLLAISILIVKG
                     SLITTVIAILLLAAQIPMQKILIANPGEKAIWYNAFGTLLYVLSMMVCAVGIRP"
     gene            complement(654284..655339)
                     /locus_tag="CPHA266_RS03035"
                     /old_locus_tag="Cpha266_0584"
     CDS             complement(654284..655339)
                     /locus_tag="CPHA266_RS03035"
                     /old_locus_tag="Cpha266_0584"
                     /EC_number="2.4.2.18"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BE13.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anthranilate phosphoribosyltransferase"
                     /protein_id="WP_011744473.1"
                     /db_xref="GI:500064942"
                     /translation="MPQKKLLNMLMAGKDLAREEMTLCMNNIMDGAFSDIVLAALLAL
                     LQKKGVTADEAAGAYASIMARATLCKLDEDAVDTCGTGGDNTGTFNISTAAAIIACGA
                     GVSIAKHGNRSMTSQCGSADVLEALGFAIDLPPSATEELFRQTGFAFLFAPMYHPSMK
                     AVAHVRRELGIRTIFNMLGPLLNPAGVKRQLVGVFEPELMDLYGTVLLATGCRHSLIV
                     HGETETGAAFDEPSISGPTHILELHEGVMARHIVHPEDFGFIRCPIEDLAGGNREENA
                     IIIRNILDGSATRAKTEAALYAAAMTCYVSGKASCIDEGVCMASDSLESGQASCKFTA
                     ILQLNRELSGKHKALIN"
     gene            655461..656555
                     /locus_tag="CPHA266_RS03040"
                     /old_locus_tag="Cpha266_0585"
     CDS             655461..656555
                     /locus_tag="CPHA266_RS03040"
                     /old_locus_tag="Cpha266_0585"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744474.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M24"
                     /protein_id="WP_011744474.1"
                     /db_xref="GI:500064944"
                     /translation="MQPDYFRPYRQAAIESILLKISLQALDSCIVTDLSVIRWLTGFS
                     GSSARLLITQARTFLFTDFRYREQALCEVDLAEIIIPPDGFIDALASGNYPMGMVAGL
                     QSDDITWHEASRLIDALSGKVKIVPVGSFFDEFRMIKNGIEIMKMQQAAAISEQVLDK
                     IISMISPAVTELDLAAEITYQHKKLGADKDSFDPIVAGGPRSAMPHARPANLHFVPGE
                     FIVLDIGCVYEGFASDQTRTVALGTVSREAKKVYHIVQTAQALGIRSAAIGMKACELD
                     GLIRRYIDDHGYGEAFGHGLGHGVGLDVHEEPRISPKGRHELQENMVFTIEPGIYLPG
                     KFGVRIEDTVLMTPDGAKPMQRFTKELIEL"
     gene            656575..>656886
                     /locus_tag="CPHA266_RS03045"
                     /old_locus_tag="Cpha266_0586"
     CDS             656575..>656886
                     /locus_tag="CPHA266_RS03045"
                     /old_locus_tag="Cpha266_0586"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744475.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation tolerance protein CutA"
                     /protein_id="WP_041467510.1"
                     /db_xref="GI:752831208"
                     /translation="MSSYCIVITTAPDRKLAEKLAEGILGNRLAACVQMTDIRSFYLW
                     EGALRKEIEVILYIKTTEARYPDLEAWITKVHSYAVPEIVKLPITAGLPGYLNWLDST
                     TG"
     gene            complement(656942..658108)
                     /locus_tag="CPHA266_RS03050"
                     /old_locus_tag="Cpha266_0587"
     CDS             complement(656942..658108)
                     /locus_tag="CPHA266_RS03050"
                     /old_locus_tag="Cpha266_0587"
                     /EC_number="2.7.7.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744476.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed DNA polymerase"
                     /protein_id="WP_011744476.1"
                     /db_xref="GI:500064950"
                     /translation="MSWNTIIGHKQQIKVLQKALETGRLAHAYLFTGPEACGKESVAF
                     ELARILNCRTADPVSGSCETCKECISLNAFMHPNVEYIFPVESALLDPGDTAKKENKR
                     FTEAKERYDLLLEEKKQNPFFSPAMERSMGILTEQVIALQHKASFMPSQGTRKIFILS
                     QAEKLHPSAANKLLKLLEEPPAHILFILVSSRPEAVLPTIRSRCQVIRFSRVSSRELR
                     LWLHENRPEITDPLLSFIVSFSRGNLRLAWEFINNIGSDTAETATIILRNQAIDYLRK
                     ALVPGKLHEAITASEEQVKNLSRTELTLFIGALLLFFQDVNHRRINPSFQGLNNPDIV
                     DSIDRFAKNFPDPDFFRISTIAEEAIRAIERNANPTLVMAAFTAELKGLLQRVT"
     gene            complement(658124..659035)
                     /locus_tag="CPHA266_RS03055"
                     /old_locus_tag="Cpha266_0588"
     CDS             complement(658124..659035)
                     /locus_tag="CPHA266_RS03055"
                     /old_locus_tag="Cpha266_0588"
                     /EC_number="2.6.1.42"
                     /EC_number="2.6.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012507506.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid aminotransferase"
                     /protein_id="WP_011744477.1"
                     /db_xref="GI:500064951"
                     /translation="MNKSAKIWMNGELIDWNDAKIHIMSHVVHYGSSIFEGIRCYDTE
                     KGSAILFLDEHIKRLRDSSKIYRIEIPYSEKELKEAIISTIKTNEHKSCYVRPLVYRG
                     QGALGVNPYRASIEVAIATWEWGTYLGDDVLENGVDVRVSSWSRLAPNTLPSWAKAGG
                     NYLNSQLIKMEALMDDYAEGLALDINGYVSEGSGENIFVVRDGIIYTPMSAQSILPGF
                     TRFAVMHIAKKLGYEVRESLIPREALYVADEVFLTGTAAEITPVRSIDKYPVGNEKRG
                     PVTEVLQHNYLKIVQTGEDPYNWLTFI"
     gene            complement(659232..660437)
                     /locus_tag="CPHA266_RS03060"
                     /old_locus_tag="Cpha266_0589"
     CDS             complement(659232..660437)
                     /locus_tag="CPHA266_RS03060"
                     /old_locus_tag="Cpha266_0589"
                     /EC_number="2.7.1.11"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744478.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6-phosphofructokinase"
                     /protein_id="WP_011744478.1"
                     /db_xref="GI:500064952"
                     /translation="MKKIGILTSGGDCGGLNAVLKGAALMAQSKNLEMYIIPNGYAGL
                     YNLIDQNRLVRLDSERLDRFDASFAGSEAGHSRVKIKAISNPEKYARIKAGMKKFELD
                     ALIISGGDDSGSVMIDLNHNGIQCIHAPKTMDLDLQTYSVGGDSTINRIAQFVHDLKT
                     TGKTHNRVLVTEVFGRYAGHTAFRSGIAAEADCILIPEIPVDWNAVYEHLAERFTRRI
                     RESDVHSGTYTIVVAEGMKNADGTDIVDESAGLDAFGHKKLAGAGKYTCQQIQKNMKA
                     DPAMPIFMKETGMFVEGIYEIPEVREIHPGHLVRSGNSSAYDINFGFEAGAAAVLLLL
                     DGKTGVTISKVKGRKVEYIESSKAIMQRYVDLEHVAMYEALGICFGRKPVAYDPILRE
                     VDGVYERIY"
     gene            660615..661889
                     /locus_tag="CPHA266_RS03065"
                     /old_locus_tag="Cpha266_0590"
     CDS             660615..661889
                     /locus_tag="CPHA266_RS03065"
                     /old_locus_tag="Cpha266_0590"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744479.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744479.1"
                     /db_xref="GI:500064954"
                     /translation="MTLFDQIRIAYVHLKERKRQTMLTALGVAVGSAMLVTTISVARG
                     SSSNVITKVIDTAPHVLVSADRIEPLVPENLIGYSSSRVAMVTRNVTSNDKEVIKNYT
                     EVVENIRKIKGLESISPFVLSKVLARNKSRFTSCIARGVSPPLEADIAGLKKNLIEKN
                     ALEELAYTPDGILVGYLLAEKLDAGYHDRIVLVTKNSESYPVTIVGSFSSGFNAKDER
                     EAYVNLALAQRMEGIAANSVSGIGLRTSDVNRASGVAAQVADITGYKSESWDETNRNV
                     IDFYNRNAVITLVLVGFVFVVAGLGVSSVMTTVVLQKVKDIAILRSMGLQRESITRIF
                     MFEGLFIGILGVLIGSPAGHAICHFVSMIRFEASTAGVLKSDRINLVETPEAHLIVIV
                     FGVLIAVISSFSPARKATSYLPVSILRGEVGA"
     gene            complement(661886..662362)
                     /locus_tag="CPHA266_RS03070"
                     /old_locus_tag="Cpha266_0591"
     CDS             complement(661886..662362)
                     /locus_tag="CPHA266_RS03070"
                     /old_locus_tag="Cpha266_0591"
                     /EC_number="4.6.1.12"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BE20.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
                     synthase"
                     /protein_id="WP_011744480.1"
                     /db_xref="GI:500064956"
                     /translation="MRTGIGIDVHPFAEGRKLVIGGVEIPSAKGLDGHSDADVLLHAV
                     SDALLGAAALGDIGLHFPNTSQEFKDIDSMILLKHVKKLLDKEGFRIVNIDAMLLLEA
                     PKIASYINEMRKNIARCLGLELNAVSVKATTNEKLGYIGREEGAAAHAVCLIQVKP"
     gene            662649..663755
                     /locus_tag="CPHA266_RS03075"
                     /old_locus_tag="Cpha266_0592"
     CDS             662649..663755
                     /locus_tag="CPHA266_RS03075"
                     /old_locus_tag="Cpha266_0592"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744481.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744481.1"
                     /db_xref="GI:500064958"
                     /translation="MTFSQLQRFFWICSGTPEHFIEKYPTEHSKYLGIGATIFFTALF
                     AALSGGYALYFVFAGNPFAGLWGLLFGLMWGLAIFNLDRYIVSSINKTSKGLKQFYQA
                     SPRLVFAILIALVIARPLELKIFDKEIHDRLKQRYLNDQNEQIKKVQSAFNEKYALEL
                     SQIKKYQDEYDLLSADVNRLREELKEEVFGSRTSTTSGVPGYGSYAKNKELVVVAKQT
                     RLEYLAGQLADLHATMNRQKTAEGINNQMMLSETLLDKKAATAGFADRNWALGALAHA
                     SDDVSSSSANAILFITLLFIVFECAPLIVKLLSDLGPSDVETKETEKRIIAQLTNTAY
                     FSRNRAIREYRIMGSKIGGRRAKKYLSNKRGWGR"
     gene            complement(663774..664718)
                     /locus_tag="CPHA266_RS03080"
                     /old_locus_tag="Cpha266_0593"
     CDS             complement(663774..664718)
                     /locus_tag="CPHA266_RS03080"
                     /old_locus_tag="Cpha266_0593"
                     /EC_number="1.3.3.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744482.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroorotate dehydrogenase"
                     /protein_id="WP_011744482.1"
                     /db_xref="GI:500064960"
                     /translation="MTDHIPVEKTSITGISLGRGLELRSPVLLASGTVSYGEELNTLC
                     DLGKIGGLVTKAISLEPRTGNPPQRIAETPSGMVNAIGLANVGVKKFITEKAPFLRKL
                     NTAIIVNIAGRSIDEYAEVIARLDDVEGIGGYEINLSCPNVKGECMIMGVSRSATHEI
                     VSVLRKITNRHLMIKLTPNVTSISSIALAAEEAGADSVSLINTLVGMAVNYKTRKPLL
                     RNVTGGLSGPAIKPIALAKVWEVFNAVNIPVVGMGGITGFEDAMEFLLVGATAIQIGT
                     MNFVYPDIGEKTAVALEKHFSMPDAPNIKEYIGSLITE"
     gene            complement(664816..666927)
                     /locus_tag="CPHA266_RS03085"
                     /old_locus_tag="Cpha266_0594"
     CDS             complement(664816..666927)
                     /locus_tag="CPHA266_RS03085"
                     /old_locus_tag="Cpha266_0594"
                     /EC_number="2.4.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744483.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-glucan phosphorylase"
                     /protein_id="WP_011744483.1"
                     /db_xref="GI:500064962"
                     /translation="MRKQITPCKELTRNLWWSWDTEAKEVFRELSPIIWERVNHNPVE
                     LLRHISNDELRARCQCDLGEKIERVNQRFADYISDKNTWAAEHAPELVKQPIAYFSAE
                     FGIHESVRIYSGGLGVLAGDHIKSASDLGLNFVGISLFYKEGYFRQYLNHDGWQMEEY
                     PLQYSENLPIEKVTGPDGKDLIISINIAQSEVFAQAWALKVGRATLYLLDTNIPDNES
                     HYRDICCRVYGGDQNMRINQEILLGIGGVKLLDALNLSPAVYHMNEGHSAFLTLELLS
                     KEIALGTSLEEAREKVKSRCVFTTHTPVPAGHNRFSRDMMHYTFDKYLSQNGIDFEEL
                     MLLGSEDRSNTFGLFTMTVLALNLSRSANGVSKLHGEVSRAMWQSLYADKPVSEVPIG
                     HITNGIHTQSWVYGITDRFWRKHTDNIDNMTISREAAEAVLAQVSDEELWCLRYRLKR
                     NLVDFISRYLANQLFHQHTFPVFSENDQSRTEKHTLSPDILTIGFARRFATYKRAPLI
                     FRDLDRLNRIINHPNMPVQIVFAGKAHPHDDAGKDYIRQIIEHSRRPQFTGKVIFLEN
                     YNLGIAKRMVSGVDIWLNNPVRPMEASGTSGEKIVMNGGLNFSVLDGWWPEAYNGENG
                     WSIGNGESFENHEEQDSFDAEKMYSVLENQIIPTYYERNEFNIPVQWLKKIRNAIATI
                     APIYNTHRMVKEYTTRYYLNR"
     gene            667078..667944
                     /locus_tag="CPHA266_RS03090"
                     /old_locus_tag="Cpha266_0595"
     CDS             667078..667944
                     /locus_tag="CPHA266_RS03090"
                     /old_locus_tag="Cpha266_0595"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744484.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metallophosphoesterase"
                     /protein_id="WP_011744484.1"
                     /db_xref="GI:500064964"
                     /translation="MIESSIKIAHISDLHLAGRNDRRLLQYLDGMLEHFKKVKVDHLI
                     ISGDLTDTAEPKDWQILKDRLIAHDLYEWQKVTVIAGNHDLINLEEEMRFYNVLNPLP
                     GIRNRSFSGKVSRFCTMFSELIVSEDASVAGFPFVKILKVDGFSFALVAVNSVWPWHP
                     ADNPLGARGCISPSELRVLRIPDVVDVLRESFVVGLCHHAYKVYSTESVIDQAFDWTM
                     ELTNRNEYLEVLKLLGARIALHGHFHRFQSYRVDDISFFNGGSFKYSPERYSELIVRC
                     DGSFSQQFLNLA"
     gene            complement(668001..668495)
                     /locus_tag="CPHA266_RS03095"
                     /old_locus_tag="Cpha266_0596"
     CDS             complement(668001..668495)
                     /locus_tag="CPHA266_RS03095"
                     /old_locus_tag="Cpha266_0596"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744485.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferritin"
                     /protein_id="WP_011744485.1"
                     /db_xref="GI:500064966"
                     /translation="MLSTSLQQAFNEQINHEMASAYLYLSMAAYAESRSLPGFANWMK
                     LQTKEEMGHAMKLYKFVNERGGRVILTAMDTPKADFSSPTELFEEVLKHERQITALIN
                     KLYEATLEAKDYAAQVLLHWFIQEQVEEEASASEILETLKMAGEKGHALIMMDRQLAR
                     RGQG"
     gene            complement(668754..669224)
                     /locus_tag="CPHA266_RS03100"
                     /old_locus_tag="Cpha266_0597"
     CDS             complement(668754..669224)
                     /locus_tag="CPHA266_RS03100"
                     /old_locus_tag="Cpha266_0597"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744486.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744486.1"
                     /db_xref="GI:500064968"
                     /translation="MTKSLHDHLEESIKLEVNLAKLYTVFNDLFPEDEEFWFQLAMEE
                     RGHAALLQQEKKQPHPIDFFPENLLAKDLQSLIDANKRVLNYITVYSENMPSRKTAFE
                     TALSLENSAGEAHFQHFLDSPNNSLSATIFKQLNLEDRDHAERIEEYMLNNGLS"
     gene            complement(669257..669451)
                     /locus_tag="CPHA266_RS03105"
     CDS             complement(669257..669451)
                     /locus_tag="CPHA266_RS03105"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467165.1"
                     /db_xref="GI:752830863"
                     /translation="MKQRKILLQREPLESACHYYSAGTVLSKRVVPRRVGISPDRINK
                     AALLFRLFFYDQPLHSGISQ"
     gene            complement(669448..669720)
                     /locus_tag="CPHA266_RS03110"
     CDS             complement(669448..669720)
                     /locus_tag="CPHA266_RS03110"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467166.1"
                     /db_xref="GI:752830864"
                     /translation="MIFFSIQFQRKTPITPSYITRKPLCPKDKARLLTLNKKRDEKIT
                     RLMQTAPFLIASDKKLKFRKKSETSIDTQHRVVTKTQKKLTQVPLY"
     gene            669704..670183
                     /locus_tag="CPHA266_RS03115"
                     /old_locus_tag="Cpha266_0598"
     CDS             669704..670183
                     /locus_tag="CPHA266_RS03115"
                     /old_locus_tag="Cpha266_0598"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744487.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744487.1"
                     /db_xref="GI:500064970"
                     /translation="MLKKIMSGGQTGVDRAALDAAIAAGLAHGGWCPKGRLSEDGMVP
                     SYYLLDETPRSGYLQRTAWNVRDSDGTLIIARRGLSGGSRYTRECALYAARPVMIVQP
                     EDRDVSSAIYGWIVRHGLATLNVAGPRASSDPDIYAEARSIVEAFIGCDRRNTPEGF"
     gene            complement(670143..>671984)
                     /gene="carB"
                     /locus_tag="CPHA266_RS03120"
                     /old_locus_tag="Cpha266_0599"
     CDS             complement(670143..>671984)
                     /gene="carB"
                     /locus_tag="CPHA266_RS03120"
                     /old_locus_tag="Cpha266_0599"
                     /EC_number="6.3.5.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012964844.1"
                     /exception="unextendable partial coding region"
                     /note="four CarB-CarA dimers form the carbamoyl phosphate
                     synthetase holoenzyme that catalyzes the production of
                     carbamoyl phosphate; CarB is responsible for the
                     amidotransferase activity; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbamoyl phosphate synthase large subunit"
                     /protein_id="WP_041467511.1"
                     /db_xref="GI:752831209"
                     /translation="VELSQEVLDLARKLPEEMLLKAKKHGFSDYQIAHIFKTTETVVR
                     NLRKHLGVISVFKTVDTCAAEFDAKTPYHYSTYEEENESVSSDRKKVIILGGGPNRIG
                     QGIEFDYCCVQAVFALKEAGYETIMVNCNPETVSTDYDIADKLYFEPLTFEDTIRIIE
                     HEKPLGVIVSFGGQTPLKLSTKLEEAGVTILGTSSTGIDLAEDRKKFGALLEKLAIPH
                     PDYGTAICFEEAQMITRRIGYPVLVRPSYVLGGRAMKIIYSDDSLKEYVDQALFISEK
                     YPLLIDRFLETAVEFDIDAIADSSDCVISGIMQHVEAAGIHSGDSTSILPYHNISPEV
                     IATMKTYTQILAANLHVVGLMNVQYAVQNDHVYVLEVNPRASRTVPFVGKATAVPVVK
                     IATRVMLGEKLSDLRQQYDLKDCDELGMKHLAIKEPVFPFSKFVKSGVYLGPEMRSTG
                     EAMSLADQFPEAFAKAYQAANMELPLSGSVFISVNNQDKNQRIITIARELFRMDFDLV
                     ATAGTHQFLIDNGIECKKVFKVGEEGRPNIFDIIKHGKIDFVINTPRGEKALHDEEAI
                     GAASVLSNVPFVTTIEAAEASVQAIDCIRRQEFGVKSLQEYSSYRNR"
     gene            672350..673639
                     /locus_tag="CPHA266_RS03125"
                     /old_locus_tag="Cpha266_0600"
     CDS             672350..673639
                     /locus_tag="CPHA266_RS03125"
                     /old_locus_tag="Cpha266_0600"
                     /EC_number="3.5.4.25"
                     /EC_number="4.1.2.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744489.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
                     /protein_id="WP_011744489.1"
                     /db_xref="GI:500064974"
                     /translation="MDKKIFDTIEAAVEDIRQGKLVIVIDDEDREDEGDFIAAADVVT
                     TEMVNFITKEARGLLCVALTMGRARELQLDPMVQRNTSQHETNFTVSVDAIAVGVTTG
                     ISVSDRTMTIKMLGDPLSMADDFSRPGHIFPLRAMDGGVLRRVGHTEAAVDLARLAGC
                     SPVGLLCEILNDDGSMARLPELIRLKEKFGLKLITIKDLVAYQMQRNKLVFRAVETKL
                     PTIYGDFRLIAYESFIDHQNHMAFVKGDVSTDEPVLVRVHSQCATGDTFASLRCDCGN
                     QLASALTMIENEGRGVLVYLMQEGRGIGLINKLKAYNLQDEGFDTVEANEKLGFKADL
                     RDYGIGAQILKDLGVKKMKLLTNNPKKIVGLEGYGLEITERVSIEIAPNSINKSYLDT
                     KRDKMGHMIGRSCGNESLFFEQITENHLNKSQQPPNQ"
     gene            673670..674992
                     /gene="glyA"
                     /locus_tag="CPHA266_RS03130"
                     /old_locus_tag="Cpha266_0601"
     CDS             673670..674992
                     /gene="glyA"
                     /locus_tag="CPHA266_RS03130"
                     /old_locus_tag="Cpha266_0601"
                     /EC_number="2.1.2.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BE30.1"
                     /note="catalyzes the reaction of glycine with
                     5,10-methylenetetrahydrofolate to form L-serine and
                     tetrahydrofolate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine hydroxymethyltransferase"
                     /protein_id="WP_011744490.1"
                     /db_xref="GI:500064979"
                     /translation="MDTDILQMQDKEVFEAVVNETVRQTETLELIASENFTSRAVMQA
                     CGSVMTNKYAEGYPGKRYYGGCEFVDVAENLARDRAKKLFNCSYVNVQPHSGSSANMA
                     VLFSVLKPGDRIMGLDLSHGGHLTHGSPVNFSGQLYEAHSYGVRRETGCIDMNMVEEL
                     ANKVRPKLIICGASAYSQGFDFKAFREIADRIGALLMADIAHPAGLIVAGLLSDPVPH
                     CHFVTTTTHKTLRGPRGGMIMMGSDFENPLGITIKTKTGSRVKMMTEVMDAEVMPGIQ
                     GGPLMHIIAGKAVAFAEALRPEFRDYALQVKKNAAVMADKFSSLGYTIVSGGTKNHLM
                     LLDLRNKNVNGKVAENLLHQAGITVNKNMVPFDDKSPFVTSGIRIGTPAMTTRGMKES
                     DSERIVELIDRVVSAAETPAVDDVCRLVRQEIRELCLQHPMDGYEMTP"
     gene            complement(675077..676972)
                     /locus_tag="CPHA266_RS03135"
                     /old_locus_tag="Cpha266_0602"
     CDS             complement(675077..676972)
                     /locus_tag="CPHA266_RS03135"
                     /old_locus_tag="Cpha266_0602"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744491.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA primase"
                     /protein_id="WP_041467512.1"
                     /db_xref="GI:752831210"
                     /translation="MIPQNIIDDIRRSTDIVDLIADYVKLHPSGRNYKALSPFTQEKT
                     PSFVVSPDKQIFKCFSTGKGGNVYTFVMEMEKISFPEAVELLAKRTGIDISRFTKQQK
                     IQNEENESQTGTLRWAARTFHNTLESPKGVQGLSYLTEARGLSRAIIQQFGIGYAPDQ
                     WDNLINEAKQASIPLANLTELGLTTHHKERGSWYDTFRNRVIFPIFSIGGQVAGFGGR
                     TLDSDPRTPKYLNSPENPLFEKSKLLYGLHAAKDEIRRSESALLVEGYMDVLALHQAG
                     ITTAVASCGTSLTRYQAKILQRYTNRVLFVYDADPAGKKSMMAGIDTLVTEGITPFVL
                     ELPSGDDPDSFVQRAGKEEFLRYSEKNKQSFIDFQIRFFTQSGNFAQTDVKAKAIRAI
                     THTIALIPDRIRQELYLQELSEKLGISFSSLKELLVIESTMRREKNIPGENSMRARPT
                     PVPEKKMSVLERTFLKALLESSFYGNAVLEFAASHENMLTLPNPLAQNIFTHLIRRYH
                     SLSGSPNDHLDIISEISMFSEPEARNLASGLLLDQPVSKKWHEQTDLNAENARQCLAS
                     FLDAFKSLVLEPLIRQKEILTEQIRNENDAALETELLREKITLDRKIRKTSDDLRAMI
                     RSIIDNR"
     gene            677325..678071
                     /locus_tag="CPHA266_RS03140"
                     /old_locus_tag="Cpha266_0603"
     CDS             677325..678071
                     /locus_tag="CPHA266_RS03140"
                     /old_locus_tag="Cpha266_0603"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744492.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor protein MotA"
                     /protein_id="WP_011744492.1"
                     /db_xref="GI:500064983"
                     /translation="MKQSFFTSLLILATYVVSLGFYAWMGTTPSDSMFHAIWKGGPIV
                     SVLMALILMVIAYIVERIIALNKAAGKGNIPQFVQSLKQDIDNGYVDQAIAKCDEHQS
                     CLSAVLRSVLDRYKKMGSLNITDRDKRISEMEKAVEEATIMEMPLLEKNLVAISTIAS
                     ISTMIGLLGTTLGMIRAFAAMATSGAPDAVQLSLGISEALFNTALGIVGGIMGIVTYN
                     VFISKVDHFSYMIDEAAFYIIQTLGNSKSE"
     gene            678078..678611
                     /locus_tag="CPHA266_RS03145"
                     /old_locus_tag="Cpha266_0604"
     CDS             678078..678611
                     /locus_tag="CPHA266_RS03145"
                     /old_locus_tag="Cpha266_0604"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744493.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biopolymer transporter ExbD"
                     /protein_id="WP_011744493.1"
                     /db_xref="GI:500064985"
                     /translation="MSRIKAKRVGFRIDMTPMVDVAFLLLTFFMLTTKFRPPEIAEVD
                     LPSSHSQLKLPESDVLTVTVSGDNTFFMGVSSRQAKEKIFNTAVKPKLQAAKISEAEI
                     RDSLKSFRLAESFPVGKDELDKFVLMARFANPKLRPVIRADDDAGFDAVNHAIKVYKK
                     ANMLTFNLVTVLEREVR"
     gene            678613..679137
                     /locus_tag="CPHA266_RS03150"
                     /old_locus_tag="Cpha266_0605"
     CDS             678613..679137
                     /locus_tag="CPHA266_RS03150"
                     /old_locus_tag="Cpha266_0605"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744494.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biopolymer transporter ExbD"
                     /protein_id="WP_011744494.1"
                     /db_xref="GI:500064987"
                     /translation="MGMVDSPNERRAKKGRKRIRKRIGFHLDMTPMVDVAFLLLTFFM
                     LTTTFAKSNTMEISMPPEMEEVKIAEANVMTLRISGEGMAYCSLGNEAPRRLSLYESG
                     DASRFALSAELRQILKQQTTANKKLVIVLKISEKAKYKYLVDVIDELNLMKIDRFSLD
                     DFTDQDELEIKRAV"
     gene            679168..679968
                     /locus_tag="CPHA266_RS03155"
                     /old_locus_tag="Cpha266_0606"
     CDS             679168..679968
                     /locus_tag="CPHA266_RS03155"
                     /old_locus_tag="Cpha266_0606"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744495.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="energy transducer TonB"
                     /protein_id="WP_041467167.1"
                     /db_xref="GI:752830865"
                     /translation="MPSKLDKIHEDARRKAMGSWSIREDFLDTDCLRNVHYGNLVLRR
                     QAHLFLSHGVLTAMVLLSFVWLLSANWQSITAVFGFFQKDDKPLTESYEFVTCVTQLP
                     PPPPIAAPPPAVAKAAPAPANVGKIKKVKADEVPLQQTFATQKEISHAIQSQPADGAD
                     CGSASGSDEGATFVAREKDPVLLSMKKSYPEMARTAGIEGRVFISVLVGEDGRAVQAK
                     ILKRIPADCNVFDAAAMKAVMEAKYAPGIQNGNPIKVWFTVPIRFQLD"
     gene            complement(<680049..680699)
                     /locus_tag="CPHA266_RS03160"
                     /old_locus_tag="Cpha266_0607"
     CDS             complement(<680049..680699)
                     /locus_tag="CPHA266_RS03160"
                     /old_locus_tag="Cpha266_0607"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744496.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467513.1"
                     /db_xref="GI:752831211"
                     /translation="MTAYEKEFYVNRHEKTIHAANTILSMLLDRIPTVHSAVDVGCGT
                     GTWLSVLQQKGVNEIQGFDGSWMDRNLLAIPYSCFTEIDLTRSMIRSITKYDLAISLE
                     VAEHLPSDCAEEFIFSLTELSDYVLFSAAIPFQGGQHHVNEQWQHYWVELFRKMDYLV
                     YDIIRPKIWNDNRIPFWYRQNILLFVRKQKTTSTLNGWPYVELSSSPIDIVHPDLYL"
     gene            complement(680704..680919)
                     /locus_tag="CPHA266_RS03165"
     CDS             complement(680704..680919)
                     /locus_tag="CPHA266_RS03165"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744497.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467514.1"
                     /db_xref="GI:752831212"
                     /translation="MPLGVINYSMIALGVLVIAGSYAGMYLEKEVNGFFSLFIAPFAL
                     VSAYVGIAFAVLYRRKSAESNRNRSNK"
     gene            complement(680963..682156)
                     /locus_tag="CPHA266_RS03170"
                     /old_locus_tag="Cpha266_0609"
     CDS             complement(680963..682156)
                     /locus_tag="CPHA266_RS03170"
                     /old_locus_tag="Cpha266_0609"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744498.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetylornithine aminotransferase"
                     /protein_id="WP_041467515.1"
                     /db_xref="GI:752831213"
                     /translation="MKQMPITPESEQALFFHNYARLPIAITHGDGSWLVSDTGIRYLD
                     MIAGIGVNALGYGDKRLINAINEQAAKIIHASNLFLLQPQFALAEKLLEISGLSKVFF
                     ANSGTEAIEASIKMARKWAASSGNDRKKEILSLSNCFHGRTYGAMSLTAKAKYTDGFE
                     PLLPDTGMINFNDPLDLEKKVSERTAAVFIEIIQGEGGIHQISAPFIEKLNELRQRHN
                     FLIVADEIQAGCGRTGKFFSYLHFDFEPDLVCLAKPLGGGLPLSAVLGSESLSDVFSY
                     GNHGTTFGGNPVACAAGLAMIEAIYEDNLMAHAVEIGSFIKTGLLQLAQKHSQITAIR
                     QYGLMIGMTVDKEAKFYVEKALKKHVIINATSQNVIRLLPPLNISQGEAQQCIMVLDE
                     IFNEE"
     gene            complement(682248..682457)
                     /locus_tag="CPHA266_RS03175"
                     /old_locus_tag="Cpha266_0610"
     CDS             complement(682248..682457)
                     /locus_tag="CPHA266_RS03175"
                     /old_locus_tag="Cpha266_0610"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744499.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744499.1"
                     /db_xref="GI:500065012"
                     /translation="MGKITPSMAIGLLLGTAFAGLSLYLLFFYRAPSEAIRDDLHLYA
                     LLMGAYGLWRVARVFLQWRNEEKKV"
     gene            complement(682450..683757)
                     /locus_tag="CPHA266_RS03180"
                     /old_locus_tag="Cpha266_0611"
     CDS             complement(682450..683757)
                     /locus_tag="CPHA266_RS03180"
                     /old_locus_tag="Cpha266_0611"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744500.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent pyridine nucleotide-disulfide
                     oxidoreductase"
                     /protein_id="WP_011744500.1"
                     /db_xref="GI:500065016"
                     /translation="MKQRVVIIGGGFTGLNTAKLLGNKQNIEVTLIDRKNYHLFQPLL
                     YQVAMAALGEGDIAAPLRNMLANYDNITVFKGIVESADIANKTIFTDFGDIPYDYLVL
                     ACGVQHHYFGNNQWEKFAPGLKTLAQAKEIRRRVMEAYECAERTKDPVERKKLLTFVI
                     VGGGPTGVELAGSIGEMSRYTLSKFYRNIDPKLTRIFIVEAAPRILGSFSPELTSKAT
                     RSLEKLGVQVWTSSMVTDVDANGVQIGNERIEAATVLWAAGVTAIAIGKNMGLETDHL
                     GRILVNEDLSIPGHPELFAGGDLAHFELENGKTLPGLAPVALQQGRAIGRNILLDLKK
                     KARKPFRYRDKGQMATIGKNKAIVEIGSLKFDGILAWFTWLLVHIYFLTSFRHRVFVL
                     LQWGWSYFTFSYGARLIVNKEWRFYPDIAKNNNSNKTTTNCDG"
     gene            complement(683983..684489)
                     /locus_tag="CPHA266_RS03185"
                     /old_locus_tag="Cpha266_0612"
     CDS             complement(683983..684489)
                     /locus_tag="CPHA266_RS03185"
                     /old_locus_tag="Cpha266_0612"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744501.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744501.1"
                     /db_xref="GI:500065018"
                     /translation="MQKAEFWITHLALQQHPEGGFYRETYRNRGGYDFTGSTSFGAHR
                     SYATAIHYLLKEGQQSKLHRIQSDELWFFHTGSPLVVHIFSELEANYSSFTLGLDPVS
                     GQLLQASVPAGSWFGACFPDSIVTDRYTLVSCVVAPGFDFIDFEFANKNILSDIFPRH
                     KALIDRLT"
     gene            complement(684476..685003)
                     /locus_tag="CPHA266_RS03190"
                     /old_locus_tag="Cpha266_0613"
     CDS             complement(684476..685003)
                     /locus_tag="CPHA266_RS03190"
                     /old_locus_tag="Cpha266_0613"
                     /EC_number="4.1.1.21"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744502.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N5-carboxyaminoimidazole ribonucleotide mutase"
                     /protein_id="WP_011744502.1"
                     /db_xref="GI:500065020"
                     /translation="MTQTISDQFKPVVGILMGSDSDFDIMKAATTVLDDFAVPYEVSV
                     ISAHRTPHDLETYATSAQERGLKIIIAGAGGAAHLPGVTAALTLLPVIGVPVFSKKLS
                     GLDSLYSIVQMPAGIPVATVGIDNARNAALLALQMLALSDEVLMQAIKAFRLGLAEES
                     RLKNENIKHKLRAKS"
     gene            685133..686551
                     /locus_tag="CPHA266_RS03195"
                     /old_locus_tag="Cpha266_0614"
     CDS             685133..686551
                     /locus_tag="CPHA266_RS03195"
                     /old_locus_tag="Cpha266_0614"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744503.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="coproporphyrinogen III oxidase"
                     /protein_id="WP_011744503.1"
                     /db_xref="GI:500065022"
                     /translation="MAANLAVKYSNPGPRYTSYPTIPSWSTDGVTQEQWKEAMVKGFN
                     DSNESTGISLYIHIPFCENYCYFCGCNAHRTQDHSFEAPYLDALLKEWQMYLDVFPGT
                     LNVKEMHIGGGTPTFFSPENLIKLVDGLYKHVNTMDDYIFSFETNPRSTSREHLEALY
                     SVGFRRMSFGIQDFDPIVQQEINRPQSFELVREKVELAREIGFTSLNFDLVYGLPKQT
                     LATITDTIQKVMELKPDRLAFYAYGHNPHMYEGQRKFKESDLPVGDVKQELYDKGRAM
                     LESIGYHEIGMDHFAIEGDALYEAAKNGTLHRNFMGYTENTTQMMLALGASSISDTWY
                     AFAQNERHDDAYIKAVNEGRFPLLRGHLLTDEDLVLRRHILNLMCKQETSWEDPKLYC
                     DELDIARYRLEDMESDGMVVLLEHGVRVTDVGIPFLRNICMAFDARLWRSDSLSKAYN
                     VSRDIQKTYIEKARQAKAQQVE"
     gene            686612..687751
                     /locus_tag="CPHA266_RS03200"
                     /old_locus_tag="Cpha266_0615"
     CDS             686612..687751
                     /locus_tag="CPHA266_RS03200"
                     /old_locus_tag="Cpha266_0615"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744504.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_011744504.1"
                     /db_xref="GI:500065024"
                     /translation="MKKKVKIGFLGSGWARIAQAPAFSLMDDVKLSAVASPTEKHRRK
                     FMEMFGISKGFDDWRDMLETDLDLVCVTTPPFLHAPMVRALLESGKSVLCEKPFAVNV
                     AEALAMTEVAQSSPGLALVDHQLRFHPAVRCMKQMIDSGEIGKVYEVRAVVNLSSRNK
                     PDHRYSWWSDAEKGGGALKAIGSHLIDLNRYLVGEIHEVSCNLATALPFRPDESGNPC
                     PVTSDDSFAMMMKFGPSSIALGSPSLMHVTTVGAYTWFSFEVVGSMRTIRLDGAGRLW
                     EVDNDHSKGGRSLIDAPRWKQHEPILPWDELVLQEKIRQSSLAVHGVFAVGFAFLAHR
                     IVKAIHNGEKTLHDAAGFTDGLMIQKILQAGSDSDRLRRWIKIQS"
     gene            687763..688080
                     /locus_tag="CPHA266_RS03205"
                     /old_locus_tag="Cpha266_0616"
     CDS             687763..688080
                     /locus_tag="CPHA266_RS03205"
                     /old_locus_tag="Cpha266_0616"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744505.1"
                     /note="member of the SMR family of proton-dependent drug
                     efflux transporters; quaternary ammonium compound efflux
                     pump; confers resistance to cetylpyridinium,
                     cetyldimethylethyl ammonium and cetrimide cations; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug transporter"
                     /protein_id="WP_011744505.1"
                     /db_xref="GI:500065025"
                     /translation="MAWVFLVIAGVFECFWAVGLKYTDGFARPVISLVTLIFMVASFW
                     LLSAAMKTIPVGTAYAVWTGIGAAGVALAGILLFQESRDITRILCILLIVTGVIGLRV
                     FSR"
     gene            688486..692682
                     /locus_tag="CPHA266_RS03210"
                     /old_locus_tag="Cpha266_0617"
     CDS             688486..692682
                     /locus_tag="CPHA266_RS03210"
                     /old_locus_tag="Cpha266_0617"
                     /EC_number="2.7.3.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744506.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_011744506.1"
                     /db_xref="GI:500065027"
                     /translation="MKKNYTISLLTAGFLFVGYLLVWLSVYRADHQLREQLLKDVYAV
                     ARNMDKEQIKALSGTSADRLNPHYIDLKAKLSSGCKSRTKCRFLYLLGRKSDKTIFFL
                     VDSELTGSSEISPPGQVYDEASSVLQRVFRTGHADSEGPLPDRWGVWVTGFVPLVDQQ
                     SEKVVAVLGMDVDAADWTLDIAARSALPIGVVIIIIIVIVTILQSTRHREITSSPFLR
                     RLLPVLLAVLFFLFFGFGVLLWWLQERRIEEVVHQTEKEVFTVFQNALMVQSEGLEIA
                     LNMICTDNTVADELKSRNSEILYSKYEPLFRHLQDKHGVSFFCFMDSSRKCLLRLHKP
                     EKSGDRISRFTLLEAQKTGLFSNGLELDPKGLLTLRVVMPVFQKGRIVGFIDVAKEIE
                     AVINRVHYQPGLGIALIVDKKFLHRGDWEKAMHALGRKTEWDRFRDEVQIYNTFGYFP
                     EAFDFSLASSDSVAFYRSRAVTWQGKSWRLNFLPLEDASGRTIGRMLVIQDVSFYQAG
                     IFRMITLAGIALLVILSLLFGFLFVVLKRIDRGVINREQELIDSREQYRLAVNGSNDG
                     IWDWDMRSDTLYLSPKWKKTLGYEDDDLSNIYKTFEDLVHPEDKPVFRTYLDRYLNGE
                     IPLFNIEFRIRHKDGAYVWILGRGEVLRDKSGSPYRMAGSMSDITGRKKDEDELKRRS
                     AFQLVVMDLAIGFVNTPLDELDRSIERALALVGEFLQVDRSYLFRYDFANGTMSNTHE
                     WCSEGIAPEKNNLQNLLNSIIPDWVATHLAGRIVHISSVDALDDESALKMILASQGIK
                     TLISLPLIYHEHCFGFVGFDAVREVKKWGDDEISLLRVLAELFTNAELRFRHETALVD
                     ARYAAESANRAKSEFLANMSHEIRTPMNGVIGMANLLLDTDLSDEQRDFADMLLASGE
                     SLLTVINDILDFSKIEAGKLELEHIVFDLRKLLESFGAVMGLKAVEKNLEFNCVVSPE
                     VPVFFKGDPGRIRQILNNLAGNAIKFTQNGNVTVAVSMQSENNGDAVLRFSVKDTGIG
                     IPEAKLDRLFKSFTQVDASTTRKYGGTGLGLAISRQLVELMGGKIGVISHEGNGSEFW
                     FTIFLKKQPFYSTIETQPTSAFAGIRALVVDDNAANRKMLKALLSSLDIRVTEASGGD
                     AALGELRSAFKSGDPFALAIIDMQMPDMDGFMLGQTIKEDLLLRNTELFLMSPVGTLN
                     QREEYHRAGFSANLSKPVGQLELVAAINKVVFNHDNQSGSRNPSISYPVTEEGEPPMV
                     PVGKLEHYRILLAEDSRVNQMVVIGVLTKFGYGVDVVSNGQECVDVLQKRTYDLVLMD
                     VQMPVMDGLNATGIIRDPASKVLDHNIPVIALTAHAMQGDRESCLYAGMNDYISKPID
                     ASVLTETISKWLPVKPDSPA"
     gene            complement(692743..694701)
                     /locus_tag="CPHA266_RS03215"
                     /old_locus_tag="Cpha266_0618"
     CDS             complement(692743..694701)
                     /locus_tag="CPHA266_RS03215"
                     /old_locus_tag="Cpha266_0618"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744507.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_011744507.1"
                     /db_xref="GI:500065028"
                     /translation="MFEARNLSLSVGTKELLTDTSFRIGDKDHVSLVGLNGTGKTTLL
                     RLINGPAADSALITTGQFLKSADTTIGYLPQEISFDADLEKTALQYALQANIRLFELA
                     DKITRMEHELALPEQDYESEAYHHLIERFSDAMHEFEHLGGYTMQSNAEKVLAGLGFS
                     EIDFHKKVKAFSGGWQMRLHLTKLLLQNPTLLLLDEPTNHLDIDSLRWLENYLLNYEH
                     SYIIVSHDRFFLDKLTTKTLEIAFERINEYKGNYSYYEKEKAERYELMMGKYENDLKK
                     MEELKAFVDRFRYKATKARQAQSRLRQMEKMEKNLQSPEEDLSRISFRFPKANPSGRE
                     VMRLEGVKKAYLLPDGTKKQVLAGIDLEVMRGDRIAIVGSNGAGKTTFCKILAGEIDF
                     DGKLTMGHNVSLNYFAQHQTENLSQEKSIYMEMMDSAPSSEAQKKVRDILGCFLFSGD
                     AVNKKIRVLSGGEKSRVALAKILLQASNLLIMDEPTNHLDMRSKEMLIDSLEYYDGTL
                     LIVSHDRYFLDSLVNKVVEIKNGTLQLHLGTYAEYLETAEKAIEAERKQEAAMKQKSQ
                     AAPVKNTEKEKEQAKKSAAAKKDKKRVEEIELKINRLEQKKESIEIIMANEDFYKKSK
                     EETSKTLDGYHALCKELNDLFIEWEKSS"
     gene            <694971..695297
                     /locus_tag="CPHA266_RS03220"
     CDS             <694971..695297
                     /locus_tag="CPHA266_RS03220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006366238.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_041467516.1"
                     /db_xref="GI:752831214"
                     /translation="LEGLGSDRFILDRMSVYGRSKGAAHYFTKVFDNEIKGGAVQIGL
                     LSPGMVVTDLFQETVADDVETVAVFLAEKMLASHKSFERIQWLTKQKVIFRLLFGSFR
                     RKNYWS"
     gene            695460..696728
                     /locus_tag="CPHA266_RS03225"
                     /old_locus_tag="Cpha266_0620"
     CDS             695460..696728
                     /locus_tag="CPHA266_RS03225"
                     /old_locus_tag="Cpha266_0620"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744508.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_041467517.1"
                     /db_xref="GI:752831215"
                     /translation="MFEFCGVILLVCFFTSGSAFAEEMLTWQQCINEARKAHPDLYAA
                     QALMQQTDADERIAASARSPQLSLSVSSQESFMTAKNNGSRLSSAHSYSLSAQQLLYD
                     GNKTSSQIASAKEAVKGAQNNYNVVAADLRFALRTAFTQLLKAQELVGLAGEIAERRQ
                     NNVRLISLRYRGGREHLGSLRQSEADLAEAEFDVSQAKRGLVLAQTLLASALGRDTHK
                     PLRVQGAFKVADLSVTKPDLALLVKNNPLFQQLDTKSKAARFDLDAARSAFSPELYLT
                     SSIGNGSVDSLPFNNLDANAGFTVSVPIYEGGAGRVRVIKAMAVLSQHNAEEKSGYLQ
                     LFNALEESWKSYQDARQMVVVKRKFLDAALERSTIANAQYSNGLISFDDWVIIENNLV
                     SAKKEFLNAGADMLIAEAQWIQAKGEGFDG"
     gene            696721..697689
                     /locus_tag="CPHA266_RS03230"
                     /old_locus_tag="Cpha266_0621"
     CDS             696721..697689
                     /locus_tag="CPHA266_RS03230"
                     /old_locus_tag="Cpha266_0621"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744509.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RND transporter"
                     /protein_id="WP_041467168.1"
                     /db_xref="GI:752830866"
                     /translation="MVNRKKMVWGVMVMLAVFGVGGFIYFNANKSTTKSYEELRVSRG
                     TISSSVSTTGAVEPKTRVKIQSSVAGRIEEILVAEGEYVTRGAVLAMLSSTERAALLD
                     AAKLQGKSEQAYWNNVYKKTAVIAPMDGQVIVSSVDPGQTVTTSDSLFVLSDRLIVKA
                     YVDETDIGRVKVGQKAVIGLDAYPDIRVNGVVGHIYYESHLQNNVNIYNVDVLPERIP
                     DVFRSGMSANIEIIVQQKSNVLLLPVGAVQTRNGKTVVMQSNGNKQDAVRYTAVETGL
                     QDERHVEILKGLSENAVVLIADTSFVLPGKKGGTNPFMPQRNRTQK"
     gene            697686..699659
                     /locus_tag="CPHA266_RS03235"
                     /old_locus_tag="Cpha266_0622"
     CDS             697686..699659
                     /locus_tag="CPHA266_RS03235"
                     /old_locus_tag="Cpha266_0622"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BE50.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="macrolide ABC transporter ATP-binding protein"
                     /protein_id="WP_011744510.1"
                     /db_xref="GI:500065035"
                     /translation="MNPLLELLDVHRTYQIGETTVNALRGVSLTIDRGEFVAIMGASG
                     SGKSSLLQILGLLDNPDKGEFKILGNNVNTLSEDEQAGVRNNVAGFVFQQFHLLKRMT
                     IVDNVRLPHIYSGLKGDFRQEAIARLKLVGLEERIDHTPNQLSGGEQQRVAIARALVR
                     DPLIIFADEPTGNLDSKNSAEIMKIFTALHEEGKTIIMVTHENDIAAYACRVIIMKDG
                     LIVSDERKAEMQPSRAVTGESAFDISGSGKGSIWQDGRFTGFMAQAFQSILANKMRTF
                     LSVLGIFVGVASVIAMMALGEGAKSAMQEQLKSMGSNMLSIRGGSAKIRGAAQGAGAV
                     ARFSFNDVNDIASLGKLVKNASGVVNGSARIVYGNKNWSSTLTGVGFDYGTMRASIPA
                     IGRWFTREEIQIREKSAIIGVTVVKEIFGSSNPIGKTIKINRINFKVIGIAPAKGFSG
                     PQDEDDVVIIPVTTAMYRVLGKDYLSSIFVEVASPGLMGQAKTAITELIRKKHRLEEG
                     DDSFNIRDMTEIQKMLSSTTQTMSLLLGSIAAISLLVGGIGIMNIMLVSVTERTREIG
                     LRKAIGARKNDIMLQFLIESVGMTISGGLIGVFAGVGISLILAFFAGWAVKTSLLSVV
                     LATTFSALIGVFFGLWPARKAAALKPVEALRYE"
     gene            complement(700083..701261)
                     /gene="sucC"
                     /locus_tag="CPHA266_RS03240"
                     /old_locus_tag="Cpha266_0623"
     CDS             complement(700083..701261)
                     /gene="sucC"
                     /locus_tag="CPHA266_RS03240"
                     /old_locus_tag="Cpha266_0623"
                     /EC_number="6.2.1.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BE51.1"
                     /note="catalyzes the interconversion of succinyl-CoA and
                     succinate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malate--CoA ligase subunit beta"
                     /protein_id="WP_011744511.1"
                     /db_xref="GI:500065037"
                     /translation="MNIHEYQGKDILRKFGVAVPKGIVAFSPEEAKQAAIQLFEEQNS
                     PVVVIKAQIHAGGRGKAGGVKLAKSPEEVFDIAQQMLGITLVTHQTGPEGKEVRRLLV
                     EEGMNIDKEFYVGITLDRSTSQNVLMVSTEGGMEIEKVAEETPEKLLKIQVNPLFGLQ
                     AFQARQAAFFLELEGEQFKNTVKFITALYNAYTSIDAAIAEINPLVVTKEGRVLALDA
                     KINFDSNALFRHKDFLELRDISEEDPFEVEASKSNLNYVRLDGNVGCMVNGAGLAMGT
                     MDMIQLAGGRPANFLDVGGGASPQTVEEGFKIILSDKNVKAILVNIFGGIVRCDRVAG
                     GIIEAAKKVDLHLPVIVRLEGTNASIAQKMLDESGLNLIAAKGLHDAAKKVHEALEPA
                     "
     gene            701399..701860
                     /locus_tag="CPHA266_RS03245"
                     /old_locus_tag="Cpha266_0624"
     CDS             701399..701860
                     /locus_tag="CPHA266_RS03245"
                     /old_locus_tag="Cpha266_0624"
                     /EC_number="3.5.4.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744512.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenosine deaminase"
                     /protein_id="WP_011744512.1"
                     /db_xref="GI:500065039"
                     /translation="MNFTHYMAIAFKEALKAVEKKEVPVGAVVFDSNGNIVGKGYNQV
                     EELSDATAHAEMIALTSAMATLNTKYLDDCTIAVTMEPCPMCAGALVNAKIGRLIFGA
                     YDPKMGAAGTVLNITGCRELNHNPEVFGGIMEQQCSGLLQDFFRELRGRSR"
     gene            complement(701917..702939)
                     /locus_tag="CPHA266_RS03250"
                     /old_locus_tag="Cpha266_0625"
     CDS             complement(701917..702939)
                     /locus_tag="CPHA266_RS03250"
                     /old_locus_tag="Cpha266_0625"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744513.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744513.1"
                     /db_xref="GI:500065040"
                     /translation="MKKKIYALLLPLAVTGVFMVVVFTVNQLLFLASFLGNIHPSVKY
                     LFLILGCLLPAYAIFALFRFFSSPSKPELPESETSKQIQNYLEYLSKNIPTHHMHPEP
                     LRKEKDLRWLRTNLKLLEVDSLHQTKQIATRNFFVGAFAQNTSYGTTTSLINMLKVVW
                     KIYTIHHSEHHPMEFAALFRSVYRCLPLSDFKKEDIPAHIKPIIQSSFSNTLSSLLPG
                     GNLLTPFFLNLFLAGSTNTYLTCLAGIIATRHCQTISEEDRSVIIQQSMFEASFMLKE
                     IVRQCNPILSVTISNAVKKAGIESLDTVQSPSSGSTIAQDIVSHLAISLKQIIRENIT
                     TEKKGD"
     gene            complement(703023..704282)
                     /locus_tag="CPHA266_RS03255"
                     /old_locus_tag="Cpha266_0626"
     CDS             complement(703023..704282)
                     /locus_tag="CPHA266_RS03255"
                     /old_locus_tag="Cpha266_0626"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744514.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-nitropropane dioxygenase"
                     /protein_id="WP_011744514.1"
                     /db_xref="GI:500065047"
                     /translation="MIVDNFRLQLGKQEYVPLVIGGMGVNISTTELALAAERLGGIGH
                     ISDAETGYVCDQLFGTSFVSTKRKRYIDNINNPDKAKVLFDLGEVAEAQKKYIEHTVS
                     QKTGKGAIFLNCMEKLTMNNAQETLKVRLAAAMDAGIDGLTLAAGLNLRTLDLIQDHP
                     RFRDVKIGIIISSVRALSIFLKRAVRLQRLPEYIIVEGPLAGGHLGFSPDDWHTFDLK
                     TIFNEVIQFLKQENLAIPVIPAGGIFTGTDAAEYLAAGASAVQVATRFTISKEAGLPA
                     KVKQHYINATEEDIVVNMASTTGYPMRMLIQSPTLDYTMRPNCEGLGYLLENGGKCSY
                     IDAYQKALESRKSGEKLAIGEKTCLCTGMANYDCWTCGHMAYRLKETTNRLHDGSWQL
                     PAAEDIFLDYQFSRDHQIRLPEPEENA"
     gene            704589..705332
                     /gene="gpmA"
                     /locus_tag="CPHA266_RS03260"
                     /old_locus_tag="Cpha266_0627"
     CDS             704589..705332
                     /gene="gpmA"
                     /locus_tag="CPHA266_RS03260"
                     /old_locus_tag="Cpha266_0627"
                     /EC_number="5.4.2.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BE55.1"
                     /note="2,3-bisphosphoglycerate-dependent; catalyzes the
                     interconversion of 2-phosphoglycerate to
                     3-phosphoglycerate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglyceromutase"
                     /protein_id="WP_011744515.1"
                     /db_xref="GI:500065049"
                     /translation="MIKLVLLRHGESQWNRENRFTGWHDIDLTENGRNEAFQAGRLMK
                     EAGLVFDMAYTSVLKRAIRTLWNAMDSMDLMWISVFKSWRLNERHYGALQGLNKSETS
                     RKYGEEQVLVWRRSYDTPPPLLEKSDARYPGTDPRYGDLSEAEIPLSECLKDTVERFL
                     PIWHETIAPQLRKGKRVIIVAHGNSLRALVKYLDNISEEDIVGLNIPTGIPLVYELDD
                     DLKPLKNYYLGDQEALKKAVDAVAGQSKA"
     gene            705444..710045
                     /locus_tag="CPHA266_RS03265"
                     /old_locus_tag="Cpha266_0628"
     CDS             705444..710045
                     /locus_tag="CPHA266_RS03265"
                     /old_locus_tag="Cpha266_0628"
                     /EC_number="1.4.1.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744516.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate synthase"
                     /protein_id="WP_011744516.1"
                     /db_xref="GI:500065050"
                     /translation="MNDKHNVGLYDPQFEHDACGVGFVAHIKGIKSHDIVEQGLRINE
                     NLKHRGACGCEKNTGDGAGILLQVPDKFLRRVCAERNIDLPPEKQYGVGMVFLPPDIS
                     QRRAIEDICRQMIQAEGQKFLGFRKVTTNNATLGQTAKSQEPVVKQLFVGRSKDVESE
                     LDFERKLYVIRRRITKRVKYTAGLLGSSYFYISSLSYRTIVYKGMLLPEQVGEFYPEL
                     HDQDMESAIAMVHSRFSTNTFPSWDRAHPYRFLSHNGEINTLKGNVNWMKAREKNVSS
                     RVFGDAIEDIKPVILEDGSDSAILDNTFEFLALSGRSLAHAAMMIIPEPWSGNKAMDQ
                     KKRSFYEYHSCLMEPWDGPASVTFTDGIQIGAVLDRNGLRPSRYYITSDDLVIMASEV
                     GVLDIAPERILKKDRLQPGRMFLVDTAEGRIISDEEIKQTIASEQPYAEWIERNMIDL
                     ETLPDHPLMKNLDEDKYSLTARQKIFGYTQEDISMQIIPMSVKGVELVGSMGNDTPLA
                     VLSNRPKLLYDYFKQLFAQVTNPPIDSLREEIITSTTVMLGTEGNLLDSEEVNCRRLR
                     LPYPLLSNPDLEKIRGIEKPGFRAVTFPIFYDVANGGKGIESAMQDLYRQSEQAVHSG
                     VNIIILSDKGEMEKKRAPIPSLLAVSGMHNFLINAGLRTRVGLVLESAEPRTVHHFAM
                     LISYGAGAVNPYMAFETIRSLIASGHLKLDEKTAVKNYIKAGVKGVVKTMAKMGISTI
                     QSYRGAQIFEAVGLNSQLVDAYFTKTPTRIEGIGLDTVAEEVHKRHQTVFPPSGNKGD
                     RGLDAGGERKWRYNGEFHLFGPEAIHFLQHSCRTDDYRLFKKYENLIDDQSEHLCTIR
                     GLMDIRFSEHPVPLEEVESVEEILKRFKTGAMSYGSISKEAHETLAIAMNRIGGKSNT
                     GEGGEDPARYVRDANGDSRMSSIKQVASGRFGVTSEYLASASEIQIKMAQGAKPGEGG
                     QLPGSKVYPWVAKVRHSTPGVGLISPPPHHDIYSIEDLAQLIHDLKNANREARINVKL
                     VSTVGVGTIAAGVAKAHADVVLISGHDGGTGASPISSIMHAGMPWELGLAEAHQTLVL
                     NNLRSRIIVEADGQLKTARDIVIAAMLGAEEFGFATTTLVVMGCIMMRACQDDSCPVG
                     VATQNPELRRNFKGKPEHVVTFMRFLAEGVREYMARLGVRKLNDLVGRSELLGMKKTV
                     DHWKAQGVDLSKILYHAETGEHESRYCTVPQEHGLDDSLDLTTLLTICEPAIKRREKV
                     FSSLPIKNINRVVGTIIGYEVTKAHGSAGLPDDTIHLKFTGSAGQSFGAFIPKGMKLE
                     LEGDANDYVGKGLSGGKIIVYPPKNSVFVPEENIIIGNVGFYGATSGEAFISGMAGER
                     FCVRNSGLKAVVEAIGDHGCEYMTGGLVIILGKTGRNFAAGMSGGIAYVYDADGTFPE
                     FCNRDMVSLSSVQDAEELSSVHAMIEKHVEYTGSALGKSILAAWQTTGNKIVKVMPDD
                     YKRALDAMKEVRAAGLTGDEADMAAFEKNVHDPARVSGN"
     gene            710095..711570
                     /locus_tag="CPHA266_RS03270"
                     /old_locus_tag="Cpha266_0629"
     CDS             710095..711570
                     /locus_tag="CPHA266_RS03270"
                     /old_locus_tag="Cpha266_0629"
                     /EC_number="1.4.1.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744517.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate synthase subunit beta"
                     /protein_id="WP_011744517.1"
                     /db_xref="GI:500065051"
                     /translation="MGKVKGFMEFQRVVPSDSKPLERLKDWQEFHEEMPVSALREQGA
                     RCMDCGTPYCHTGFMLSGMASGCPIHNLIPEWNDYVYNGLWKDAYERLMKTNNFPEFT
                     GRVCPAPCEGSCVLGIIKPPVTIKNIECSIIEHAFAEGWVEPKIIAYRTGKRVAVIGS
                     GPAGLACADQLNKVGHSVTVFERDDRIGGLMMYGIPNMKLDKELVVQRRVNMMKSEGI
                     VFMESTEVGVDYPADKLLEEFDAVVLCTGATRPRDLEVEGRALSGVNYAMDFLRSSTK
                     SVLASTPPDISAVGKDVIVIGGGDTGTDCVASSLRQGCRSVMQLEIMPKPPLERQLDN
                     PWPEWPKTFKVDYGQEEAAAVQGEDPRKYAMMTKKFLSDDQGELCAVEVSSVEWVNVD
                     GRFVPQPLSGTEQIYPAQLVLLAMGFVGPEEHLLQAMQILQDERSNIKADEKSYRTSR
                     ERIFAAGDARRGQSLVVWAINEGRGAARECDRFLMGQTSLP"
     gene            711711..711980
                     /locus_tag="CPHA266_RS03275"
                     /old_locus_tag="Cpha266_0630"
     CDS             711711..711980
                     /locus_tag="CPHA266_RS03275"
                     /old_locus_tag="Cpha266_0630"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744518.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744518.1"
                     /db_xref="GI:500065053"
                     /translation="MEQQQLQELLTKLHAELEHVETVDESTVAVLAQLREDIQKLVHE
                     GDAHIKEPEPVSERLGEALKHFETDHPRLSLAIQHVLDSLARMGI"
     gene            712019..713329
                     /locus_tag="CPHA266_RS03280"
                     /old_locus_tag="Cpha266_0631"
     CDS             712019..713329
                     /locus_tag="CPHA266_RS03280"
                     /old_locus_tag="Cpha266_0631"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BE59.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent protease"
                     /protein_id="WP_011744519.1"
                     /db_xref="GI:500065055"
                     /translation="MTKEPVKGKGKTGNGNEQVLCSFCGRTTHEVNSMVAGPNAFICD
                     RCIKTSYEILRKEISAINPSAKRAQESTFQTRLISPKAIMESLGQYVVGQEIAKKSLA
                     VAVYNHYKRIDSQEWAHDSDEVVIEKSNILLIGPTGTGKTLLAQTLANLLDVPFTIAD
                     ATSLTEAGYVGDDVETILARLLYASDFNLERTERGIIYVDEIDKIARKSANVSITRDV
                     SGEGVQQALLKILEGSVVGVPPKGGRKHPEQQLININTRNILFICGGAFEGLDKLIAR
                     RVSKSSMGFGSKVKNKHTGYDPEILRFVTQDDLHEYGLIPEFIGRLPVISTLDPLDET
                     ALRSILVEPKNAIIKQYKKLFEMDGVELEFTDEALDKVVDIAIDRGTGARALRSVLES
                     VMIDIMFELPTLKGVKKCVITADTIENRSEPEFYSGDGKKKKIA"
     gene            713392..713468
                     /locus_tag="CPHA266_RS03285"
                     /old_locus_tag="Cpha266_R0012"
     tRNA            713392..713468
                     /locus_tag="CPHA266_RS03285"
                     /old_locus_tag="Cpha266_R0012"
                     /product="tRNA-Val"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:713426..713428,aa:Val,seq:gac)
     gene            713656..713850
                     /locus_tag="CPHA266_RS03290"
                     /old_locus_tag="Cpha266_0632"
     CDS             713656..713850
                     /locus_tag="CPHA266_RS03290"
                     /old_locus_tag="Cpha266_0632"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744520.1"
                     /db_xref="GI:500065056"
                     /translation="MQSEPVTRRFRLRKEVSEEFDLYVKAAQEKTKGADESLVLEAIL
                     KNHLKRDKGFRTWLQKQQEV"
     gene            714404..717913
                     /locus_tag="CPHA266_RS03295"
                     /old_locus_tag="Cpha266_0633"
     CDS             714404..717913
                     /locus_tag="CPHA266_RS03295"
                     /old_locus_tag="Cpha266_0633"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744521.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA helicase"
                     /protein_id="WP_011744521.1"
                     /db_xref="GI:500065059"
                     /translation="MRIEDIIQGSSLTGLEPSTVATVIAVVPIADGAVRVIYQTPDGT
                     LKERLLGRADEESVAVAISERPWSFDGDGEAFKLTVEAKRIDLAFLFDPMMAVHTSNV
                     EPLPHQITAVYESMLPRQPLRFVLADDPGAGKTIMAGLYIRELIMRADARRIVIVAPG
                     SLVEQWREELFEKFGLEFRVFTRDLEAATPSGNPFEDIDHLIVRLDQMARNEELQDKL
                     CAAGWDLVVFDEAHKLAAHFFGNKMQKTGRFKLAEKLGEQTRHLLLMTATPHNGKEED
                     FQLFLSLLDSDRFYGKFRDGVHKVDCSDLIRRMVKEKLVKFDGTPLFPERKAYTVNYQ
                     LSDLEAALYEAVTDYVKTEMGKADQLDGKRKGSVGFALTSLQRRLASSPEAIFQSLKR
                     RRERLERRLREEKMGARGQQLLAETLIDVPEDEDDFNAEEQETMEETLVVQATASQTI
                     SELEGEIIILHFLEQQAKALVASGKDRKWDELSRILQNEPQMRDAGGRMRKIIIFSEH
                     RDTLNYLHEKIAGVLGSHDAIVVIHGAVHRDDRRKAQELFRSDPEIRVLVATDAAGEG
                     INLQNANLMVNYDLPWNPNRLEQRFGRIHRIGQQEVCHLWNLVAKETREGDVYFRLLE
                     KLQVVSDALKGEVFNVLGEVFDGISLKDLLLEAIRYGDKPEVRARLSHKIDIALDLDH
                     LKEILNRDALAQESFSTERLFAVKEEMEKAEARRLQPFFVRSFFMKGFESLGGSIYPR
                     ESGRFEITRVPAELRERDRLITGRNRRDLAPVLHRYERVCFTKDAVRPVDKPGLAFAN
                     MIHPGHPLMLALSDLLLEQHANLLRQGTILVDPADDGDQPSLLFLLTHEVKSGDGMVI
                     SKRLQFVRVMPDGSATFAGWAPHLDLEPLASAQRPLLAETLAAPWLNAGLENRALALA
                     ASTLVPQHFSEVADRRIAHVDKTLAAVHERLTKEINFWSDRFEKLTDDKKAGKDVRLN
                     LENVRRTLSDLEARLEHRKKELLSMRHVTSATPVVLSGALVIPAGLLRVLQGEPASCS
                     STFSANPAARSRIEQLAMHAVRIAEEARGCHVVDVSAQKCGWDITSYPPAIDGKQPES
                     RHIEVKGRIKGATTITVTRNEMLYALNQAEKFVLAIVQIDENEQIDGPYYLRSPFDAE
                     PGWGVSSINYNIQDLLALAGGNQ"
     gene            717910..719418
                     /locus_tag="CPHA266_RS03300"
                     /old_locus_tag="Cpha266_0634"
     CDS             717910..719418
                     /locus_tag="CPHA266_RS03300"
                     /old_locus_tag="Cpha266_0634"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744522.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_011744522.1"
                     /db_xref="GI:500065061"
                     /translation="MSTSRRYRIFVSSVQKELAEERQSLKTFILNDALLRQFFEVFLF
                     EDIPASDRRPDNVYLEEVDRCDLYIGLFGDSYGSEGFNGLSPTEEEFDCATKAAKPRI
                     IFVKSESASGRHPKMQALIRKAGDQLIRRRYASIPELTAGVYASLVEYLGRWGAITIG
                     PFDASACRGAELTDISEEKVATFLDRAVHARGYAHGRGTPMHSALVHLNLLDHDRPSN
                     AAILLFGAQPQRFLLSSEVKCLHFHGTQVRKPIPSYQVYKGDLFQLVDSSIDFVMGKL
                     NRAVGTRALSNDAPVTYEIPRDAVAEAIVNAIAHRDYSSNASVQVMLFSDRLEVWNPG
                     SLPPSLTIDSLRRPHASVPHNPLIAESLFLTRIVERAGSGILDMIELCAESGLQPPEF
                     RQDAGSFIQTLWRPVQSGSTEESVTAQVGTKLALSQHQVEVLSNCFEDSELSKLMIIV
                     GRSDRTKFRHQVLNPLITAGLIEMTIPDKPRSSLQKYRITEKGRTWLTEIKE"
     gene            719415..722333
                     /locus_tag="CPHA266_RS03305"
                     /old_locus_tag="Cpha266_0635"
     CDS             719415..722333
                     /locus_tag="CPHA266_RS03305"
                     /old_locus_tag="Cpha266_0635"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744523.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744523.1"
                     /db_xref="GI:500065063"
                     /translation="MISDYPIKSPRKLIEVALPLDAINAACAYEKMPGIGAHPRGIHL
                     WWARRPLAAARAVLFAQLVNDPGYQQGCGFKYGKNKKEAAIERKRLFKIIEELVLWEN
                     TTNEEVLERARVEIRRSWREVCELNKEHPQAAELFNPEKMPAFHDPFAGGGAIPLEAQ
                     RLGLEAYASDLNPVAVLINKAMIEIPPKFAGRPPVGPEIENKQGKSLELPKIWPGATG
                     LAEDVRRYGSWMRDEAQKRIGHLYPPVEVTEEMARERSDLKPLVGKKLTVIAWLWTRT
                     VKSPNPAFTHVNVPLVSSYILANKDGKEVYVKPVIEGDKYYFLIKNGTPTTEAKDGTK
                     ATVRGANFRCIVSGAVIGSDYIKTEGKAGRIGQRLMAIVAEGTRGRVYLPPTLDAETV
                     AKDAAPTWRPSGDVPERLTGGTCVPYGLKEWGDIFTPRQLVALTILSDLLSEVRELVR
                     EDALASGLSDSEKGLGDGGSGVIAYAEAVSVYLAFAINRCADFCNSVTRWVPGNQKVM
                     NLFGKQAIPMTWDYPEAAILADTVGGFAPASKYVADCIGKLSPAAVGFASQADAQTQS
                     ISMAKIISTDPPYYDNIAYADLSDFFYVWLRKSLRLFLPGLFSTITVPKVEELVAAPY
                     RHGTKQKAETFFLTGMTEAIHNLAEQAHPEGPVTIYYAFKQSETSGQDGTSSPGWVTF
                     LSAVLSAGFAIVGTWPLRSEQEFRMIGMGANALASSIVLVCRKRSADAPSVSRREFIR
                     ELNGVLPEALDEMTKGSGEERSPVAPVDLSQAIIGPGMAVFSKYSAVLEADGTPMSVR
                     TALQLINRFLAEDDFDPDTQFCLHWFEQYGWNENLFGEADVLARSKSTSVDAMKEAGV
                     LQSGSGKVRLLKWAEYPSDWDPRTDKRMPVWEALHQLIRALKQGGESASGALLAALGG
                     KAEAVRQLAYRLYTLCERLGQAEDARAYNELITSWTGIESVANSIPKPSDPQLSLFDN
                     "
     gene            722346..725171
                     /locus_tag="CPHA266_RS03310"
                     /old_locus_tag="Cpha266_0636"
     CDS             722346..725171
                     /locus_tag="CPHA266_RS03310"
                     /old_locus_tag="Cpha266_0636"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744524.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744524.1"
                     /db_xref="GI:500065068"
                     /translation="MSLKPWREIIIPHSDVLNGIFQQSEFAADLTAVWTGRATPEYGD
                     ANAFYERTFITEGMGKLLIQVSQRLNSKGGEPVIQLQTSFGGGKTHTMLAVYHLATRH
                     CALGDLSGIPSLLDQAGVIDVPLAKVAVLDGTAHSPGQPWMHGDQAVCTLWGELAWQL
                     GGREGFALVQQTDANGTSPGKDVLCTLLTRFAPCVVLLDELVVYIRNFVESQPLSGGT
                     YDSNLSFIQSLTEAAKLVPNAVVLASLPESNSQAGGPRGVAALQALESVFNRVQALWK
                     TVAPEEAFEIVRRRLFETIRDINGRDEVCRAFADAYIAEGVKVPQETQEARYYDRMVQ
                     SYPIHPEVFTQLYEEWTTIEGFQRTRGVLKLLAKVIYRLWQDNNKDLMILPASIPLYD
                     GSARNELIYYLGPGWDPVIDRDIDGERAETTFIEANETRFGSVQAARRVARTVFLGSA
                     PSSVTMKPGIRGLDRARVLLGCLQPGQTSSLYSDALNRLANQLHYLNSSGDRAQEATR
                     YWFDIRANLRREMEERKMRFDDKNEVRGRMAEVLKKLVGSASFFDGTHIFTPHSDVPD
                     DSFLRLVVLSPEQYYSREESRFAFDGVLDHVRNNGAKPRYRGNRLIFLAPDHGALARL
                     RDSIRVALAWNSIVEDVAAMRLVLDNLQAQQAKKELQGAEDVLLRVARECYKWLLCPA
                     QHNHTDAKPIVEVYPLNTVGASLGSEIERVCIDTELVITTWSPIHLRDELKKLYWKPD
                     KSFCSAMEFWEDTLRYLFLPRLKTCSVLEQAIIKGAGSKDFYGTAYGLYEGVFEGFKF
                     GDANVQLDDTLLLIESGAAKKYEEEHAPKPPLVPLAGILGEGTPPLNNPAGSSQVGPG
                     TIPPTTGVTKSKTFIGTADVSAATARIRLLEIAEEIISVLASDPTAKIQVSVEISADF
                     PEGVSDQIKRAVSENASSLGFKNKTWE"
     gene            725278..729615
                     /locus_tag="CPHA266_RS03315"
                     /old_locus_tag="Cpha266_0637"
     CDS             725278..729615
                     /locus_tag="CPHA266_RS03315"
                     /old_locus_tag="Cpha266_0637"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744525.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467518.1"
                     /db_xref="GI:752831216"
                     /translation="MITFDSSYDFIELNRTFHEISKESSQNDDVDISQAFSGESFNWP
                     NLIKEYRIIILSEAGSGKTAEIRNVACKLREQGKPSFFLRLEHIPTDFEDAFEVGTYE
                     VFNEWLASAEEGWLFLDSVDEARLRHPGDFERAIRNLSRQISTAIDRTHIYITSRMTA
                     WRPKTDLDLCKAKLPYAMAAISNPDPQAEDEDPDGSLHIKTDLQDRDKPIFKIVSLND
                     LSSDQIALFVKARGIEESNAFLDAVERADAKWFTSRPQDLEELTEFWIDNGRIGTRLE
                     IIQNSINRRLAERDQGRADVYQLSADRARQGARLLAAATTLTHDPTIRVPDGLKNTKG
                     IAVQSILSDWDNKEQSTLLSRPIYDEAIYGTVRFHHRSVREYLTAEWFAELLKRETSR
                     RNIESLFFRNQYGMDIVVPTLRPILPWLAIMDVKILERVRKIAPEIIFEGGDPARLPV
                     EVRRQILREVCEQMADGVTGRSARSYEAVQRFANPDLTDEIRELIRKYADNDTLTEFL
                     LRMVWLGQLEGALSEAMSVALIPHAEKYARLSAFSAVKAIGDEDAQECIRQSFLNEAS
                     ELNREFLAELLKDLQPTEHTLRWLLVCLEKSETKVRFAGDHLTDAVTKFVAAADIELL
                     SQLVFGLNSLLDCPPIIAHYCEVSEKFQWLIMPACKAVERLILIRHPASFDSDTLAIL
                     RKCSAMHVHGINDLPEVKTEFSKLVPAWPELNRALFWFEVQKSREALDKKRGERLTDF
                     WAAGAWRALWKFEISDFDYVTEEISRQTFLDDKLVALSQAIHLYKAANRPSAWRLRLN
                     KLVKGNDELSERLRNYLRPPAESIELRRINQQNAKWNRLAEAERKKKESIHLDWKKFL
                     NDNLDEARAELRDKPGIITNSLFYLYHQAQDKKNTRWRYADNNWNTLIPEYGEEVAHF
                     YRDAVVSFWRCHEPKLRSEGAPFNETPWTVIIGLTGLEIEATETNEWPTNLSTEEVEL
                     ICKYASFEINGFPTWFPKLFEMYPKIVCDFLMQEIRYELSIEKPETDTYYILNDVSAM
                     SQWAWDQLAPSIYEFLEASEPKNLSNLEKLLKILQGSNLSDGLIEELSSRKCTILEDL
                     YHLARWFALWTSVAPKVAIESLKARIEEIVDPKEQTLFTMTFVTHLFLKRSAERRGEE
                     ASTRQVFQTPECLKSLYLLMHEYIRSQDDIEHTGPEAYSPGLRDDAQDARNSLFNVLN
                     KIPGKESFMALIDIANKHPDDAVRPWMMLHAKTRAEQDGDNEAWSPSQVRDFYEKLER
                     TPSNHTELAELAILRLLDLKDDLEHGDSSIASLLQRGATQETEMRKFIGWQLREKAFD
                     RYSIPQEEELADAKKPDLRFHGVSFDGPVPVELKLADNWTGPQLFERLENQLCGDYLR
                     DNRSGRGVFVLVYRGGKPHWEVPGSGNRVDFEGLTSALQEHWTQISPKFSNVDDIKVI
                     GIDLTKRSS"
     gene            729709..730281
                     /locus_tag="CPHA266_RS03320"
                     /old_locus_tag="Cpha266_0638"
     CDS             729709..730281
                     /locus_tag="CPHA266_RS03320"
                     /old_locus_tag="Cpha266_0638"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744526.1"
                     /db_xref="GI:500065071"
                     /translation="MNQIIKGKVYSHELDGWLVSWESESEYRHWCHQTNENFVENLLV
                     VMFNPGSLSGDGKNLRKDTTLRILREVCGPAGVNPFVVNLFDYASPSPDELFSNWEKR
                     DGCGLIFSKLEMIKFSAFIMAYGDYENRGERDNEIKERIALIKSHLSEAREILLPKNS
                     SGTPKHPMTWQRQKLKPTISKLLAEGIANC"
     gene            730830..731660
                     /locus_tag="CPHA266_RS03325"
                     /old_locus_tag="Cpha266_0639"
     CDS             730830..731660
                     /locus_tag="CPHA266_RS03325"
                     /old_locus_tag="Cpha266_0639"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744527.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744527.1"
                     /db_xref="GI:500065072"
                     /translation="MSVTVYEIITGQIIAQLENGVAPWRQPWSVGLPKNLVSGKVYRG
                     INLFLLSTAGCEYFLTRNQAEELGGTIRCKGLPVVFWKILERENKKTGEKELTPFMRY
                     YKVYPANGVEGLDVPSPIGENNSSIERAEAIIQGMPNRPVINYGGNDACYIPSRDEVR
                     VPALENFSDSADFYQTTYHELAHSTGHSSRLKREGVTQNWGFGSHEYSDEELLAEMTA
                     SFLSGVAGIEQKTMQSSAAYLNGWLKKMKADPKFIIQVSSRAQKAADYILGHHDEDPG
                     "
     gene            complement(731776..733281)
                     /locus_tag="CPHA266_RS03330"
                     /old_locus_tag="Cpha266_0640"
     CDS             complement(731776..733281)
                     /locus_tag="CPHA266_RS03330"
                     /old_locus_tag="Cpha266_0640"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744528.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell filamentation protein Fic"
                     /protein_id="WP_011744528.1"
                     /db_xref="GI:500065073"
                     /translation="MKTSLKNTTVDDSLILYAELNDAEIRASQRHLKTGLFKRIVSGV
                     LSASPEKEWPAIIALHRIRVLAALFPGAVIGYRSAFSGGMPVDGVMHLSYSYKRVVDL
                     PGLQVVLVKGHGNVQGDQPMSGRNIFFPSQARMLMENLTQSRGAIRKAMGRVAVEERL
                     ISIYESRGPEALNRIREEARTIAATLEFEKEFSVLNDLIGSILGTKSAQLATAAGQAL
                     AAGTPFDARRLALFETLAATLRAMPLMQKPSPTTTGSARFNFAFLESYFSNFIEGTEF
                     DVSEARRIVLEGKIIDQRPKDSHDILGVFRQVIDPGWSNQSMAPGEAVLHQLRQRHAD
                     LMKERPEAAPGDFKDRENFAGNTTFVSPRNVRGTMIEGSKLLPSVQSGMARALLAMFI
                     VSEVHPFIDGNGRLARLVMNAELSVVNACRVIVPTLFREEYLDCLRVLTRQGKPEPFI
                     SAMQKIQQWTAAFDYTDLDRVIEQMKACNAFEKSLKQYQLLNFSDLGTGSH"
     gene            <733485..734168
                     /locus_tag="CPHA266_RS03335"
                     /old_locus_tag="Cpha266_0641"
     CDS             <733485..734168
                     /locus_tag="CPHA266_RS03335"
                     /old_locus_tag="Cpha266_0641"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020650845.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_041467519.1"
                     /db_xref="GI:752831217"
                     /translation="VRAKRHASGFEGHITYIHGLLPVNEVIEKALRKTVAVFPELAVR
                     ELVANALIHQAFFVTGAGPMVEIFDDRIEITNPGEPLVDTQRFVDTPPKSRNETLASM
                     MRRFRICEERGSGIDKVIAQIEIYQLPAPLFEVPEGFTRVVLFAHKPLIAMDKAERVR
                     ACYLHACLKYVSREFLTNASLRERFGVEEKNKAAVSRYIREAVDAGVIKPFDEDAARK
                     LMKYVPFWA"
     gene            734898..736469
                     /locus_tag="CPHA266_RS03340"
                     /old_locus_tag="Cpha266_0642"
     CDS             734898..736469
                     /locus_tag="CPHA266_RS03340"
                     /old_locus_tag="Cpha266_0642"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011745977.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_011743927.1"
                     /db_xref="GI:500064010"
                     /translation="MRTQLKKLTMYNKVKEFAREGLSIRQISRKTGMDRVTVRKFLRM
                     TDEEFSAFLALQKRRLRKLQPYEQFVKDRVTDYPDCSATQVEDWLKEHHPVFPEVTTR
                     TIYSFVQWIRKAYDLPKPKGTPRAYHPVEQLPYGEQAQVDFGEYWMASADACKVKVHF
                     MIMLLSRSRRKFVSFSQQPITTRFVLEAHEQAFSFFEGIPHTLVYDQDSTIVTDENRG
                     AILYTEAFRKYLLHRSLKIHLCRKSDPESKGKIEAGVKYVKYNFLPGRRFVNLEVLNQ
                     EALLWLERTANAKEHATTRLIPDAEWQVEKQHLRPFEPLPYPISGTVGKEYHVRKDNT
                     ISYRGNFYSLPVGTYAGPGTLVVLEVRQNTLCLYAQEGRLLANHPIESGKGTVVINNN
                     HRRDTSSKLRELQDSLMLLFTNQEHAERFLESIHNRYPRYSRDQFLHVRNAISGCQQK
                     LIDDALAHCVDHHLFSSGEFHDILHHYRKQEEKQSHQAVFNTFRPKTLRSDMDRMLSF
                     VPDSSGITTYENIFS"
     gene            736475..737311
                     /locus_tag="CPHA266_RS03345"
                     /old_locus_tag="Cpha266_0643"
     CDS             736475..737311
                     /locus_tag="CPHA266_RS03345"
                     /old_locus_tag="Cpha266_0643"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011743928.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_011743928.1"
                     /db_xref="GI:500064011"
                     /translation="MERTITTIQEHARELNLTGLAGTVDLLLEEARKSEPSYSDFALT
                     LLESELSCRRKAHLERRRKIANLPLLHDLDHYDSGVQNGISQVQLQQLRQLLWLDQNF
                     NLILIGPSGTGKSYLAGGLCHEALKLGYHALFRTMDDLIQTIRFKEITAAAAREYKRL
                     LSAHLLVIDDIMMFPLEKSVAVGLFQLVNQLHEQTSFIITTNKSPKEWAEMLGDEVLA
                     TALLDRLLYKCEVIKLTGKSYRLEHRTTIFEQQQSPEGGGNRRKKQLPLQKGVGNHCK
                     MT"
     gene            737713..738519
                     /locus_tag="CPHA266_RS03350"
                     /old_locus_tag="Cpha266_0644"
     CDS             737713..738519
                     /locus_tag="CPHA266_RS03350"
                     /old_locus_tag="Cpha266_0644"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744530.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="WP_041467520.1"
                     /db_xref="GI:752831218"
                     /translation="MKQKHIYGFLAGVVIGVLGGLIGLGGAEFRLPLLIGLFAFPALD
                     AVILNKAMSLVVVTSALPFRASTVSWQAIADNWQVILNLLAGSLIGAWLGAGWATILR
                     SEGLYKIIAFLLLAIACVLAGSHMVHGSGKPLLENVIALAVSGVLAGFIIGIVAALLG
                     VAGGELLIPTLVILFGVNIKLAGSLSLAISLPTMLVSFARYSRDSSFSVLGANRSFLF
                     IMAAGSLCGTWIGGMLLGIVSESILIPMLVLLLILSAIKVWRHTLIGGAR"
     gene            738713..739903
                     /locus_tag="CPHA266_RS03355"
                     /old_locus_tag="Cpha266_0645"
     CDS             738713..739903
                     /locus_tag="CPHA266_RS03355"
                     /old_locus_tag="Cpha266_0645"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744531.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA"
                     /protein_id="WP_011744531.1"
                     /db_xref="GI:500065086"
                     /translation="MDKIRNPFSPGAGAPPPELAGRDGVLEQAAVLFGRVLKKRPEKS
                     LIMTGLRGVGKTVLLNEMERMALQAGYRTIFIEASVQKPLVVQLVSQLRSLLYELDRM
                     AGAGNKVRRGLAVLKSFVGGIKVSFGDVELGLDIEPEKGSADSGDLEVDLPSLFIAVG
                     EAAEERQCAVAIFIDEIQYFSSGELNALIMAMHKMQQRQLPLVLVGAGLPILPGLAGD
                     AKSYAERLLSFPDIGPLQENDSAKALQDPVRAEGVAFEPAALQEIYRLTKGYPYFLQE
                     WGYQAWNQSESSPITLHLVQETTKQVITRLDENFFRVRFDRLTDGEKKYLRAMAELGQ
                     GPYHTTEISGMLGVESSTALSPVRSKLIKKGMIYSPSHGLLNFTVPLFDEFMRRAIPD
                     LGTL"
     gene            740499..740927
                     /locus_tag="CPHA266_RS03360"
                     /old_locus_tag="Cpha266_0646"
     CDS             740499..740927
                     /locus_tag="CPHA266_RS03360"
                     /old_locus_tag="Cpha266_0646"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744532.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosylhomocysteine hydrolase"
                     /protein_id="WP_041467169.1"
                     /db_xref="GI:752830867"
                     /translation="MKSRLSIRDRMIRSVTMRRGEIVLRSDFEQMGSQSQISRIFSDF
                     VKEGRLVRLGHGVFAKARISSLTGKPVPREPLEVLAEETLRRLHIDAQPGQAQRDYAS
                     GKSTQVPVQSTFNTGCRRISRKLILGNHTIRYENNYRARS"
     gene            741053..741313
                     /locus_tag="CPHA266_RS03365"
                     /old_locus_tag="Cpha266_0647"
     CDS             741053..741313
                     /locus_tag="CPHA266_RS03365"
                     /old_locus_tag="Cpha266_0647"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744533.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744533.1"
                     /db_xref="GI:500065095"
                     /translation="MAAQHITLDIPEKILLAEKTDALAFGRELRVLAAVKLFEMGRLS
                     SGRASELAGMSRVEFLLSLNRYNVFPLASELHDLERDHASSH"
     gene            741297..741785
                     /locus_tag="CPHA266_RS03370"
                     /old_locus_tag="Cpha266_0648"
     CDS             741297..741785
                     /locus_tag="CPHA266_RS03370"
                     /old_locus_tag="Cpha266_0648"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744534.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744534.1"
                     /db_xref="GI:500065097"
                     /translation="MLQAISNTSPLLYLYRIGLIDRLPEIFGEIWTPEAVHVELMVGV
                     KSGYDVPTLSEYSWLRIINPKAQPSEWLSLDLGPGELSAMSLALENSHCIVLLDDMLA
                     RRTAHAAGLQVWGTLKVLLEIKAQGFISKVEPYVNRLTDAGMWVSDDVKRRILVLAGE
                     LE"
     gene            complement(741867..742166)
                     /locus_tag="CPHA266_RS03375"
     CDS             complement(741867..742166)
                     /locus_tag="CPHA266_RS03375"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467170.1"
                     /db_xref="GI:752830868"
                     /translation="MPALQFQFNPCQIMVTTISTMFCSSVILKKLAHEKIIQGSRGAL
                     ILFFGNEFYLKLATNSLKVASSSMLLLRVTYVLYAELELGVPSLQCKYHTEAIGH"
     gene            742217..742570
                     /locus_tag="CPHA266_RS03380"
                     /old_locus_tag="Cpha266_0649"
     CDS             742217..742570
                     /locus_tag="CPHA266_RS03380"
                     /old_locus_tag="Cpha266_0649"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012507577.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744535.1"
                     /db_xref="GI:500065099"
                     /translation="MREIVFFKTRAGKSPVEDYLDTLSEKEVQKVLWVLRLVKELPTV
                     STEYFKKLQNTDGIWEIRAKQASNAFRLLGFLDQGSLVVLTNGFSKKTQKTPASEIVL
                     AEKRKIEYLSRKNHG"
     gene            742563..742838
                     /locus_tag="CPHA266_RS03385"
                     /old_locus_tag="Cpha266_0650"
     CDS             742563..742838
                     /locus_tag="CPHA266_RS03385"
                     /old_locus_tag="Cpha266_0650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744536.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="WP_011744536.1"
                     /db_xref="GI:500065101"
                     /translation="MDDLERYIKKRKDESPDFAKTFEQGYEQFRIGELLRQARKRAGL
                     TQEDLAEKLHTKKSAVSRIENHSEDIRLSTLSHYAEALGKKLTVVIQ"
     gene            complement(743330..744118)
                     /locus_tag="CPHA266_RS03390"
                     /old_locus_tag="Cpha266_0651"
     CDS             complement(743330..744118)
                     /locus_tag="CPHA266_RS03390"
                     /old_locus_tag="Cpha266_0651"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011357269.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metallophosphoesterase"
                     /protein_id="WP_011744537.1"
                     /db_xref="GI:500065103"
                     /translation="MLFRVMSDIHNEFSREESSENWQVPKLSEDNESVLILAGDIGLL
                     SRKQTWFGFLSQCSKQFRDVFVIEGNHEWYHGNIEKHSWQNAIAEHGFHNVHTGQLIL
                     EEEKIAIIGTTLWTDFFGGNPIAMFDVSQGLNDYRLIKVGADYHRLRPEYLLALHHKQ
                     KKRLFEDVDHYTGLGYNVIVVTHHHPSLQGIAPCYWNDLLNAAYVSNLEKEVLSHKIN
                     YWICGHCHTAMEYSIGETRVICNPKGYPHEYGNGFDPLKTLNVQ"
     gene            744367..745587
                     /locus_tag="CPHA266_RS03395"
                     /old_locus_tag="Cpha266_0652"
     CDS             744367..745587
                     /locus_tag="CPHA266_RS03395"
                     /old_locus_tag="Cpha266_0652"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744160.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_011744160.1"
                     /db_xref="GI:500064243"
                     /translation="MNDLTLFQMALGLESPWYVSSSSFDVDQKRLDIRIDFKPGSTFC
                     CPQCGREGVKAYDTSEATWRHLNFFQHEAYLTVRVPRISCPECGILKLQSFPWSRRES
                     GFTLLFEAMIMIMAKSMPVKAIAAIVGEHDTRIWRIINHYVEKAREQEDHSAVTMVGV
                     DETSSKRGHNYVSLFVDLAVSKVLFATEGKDAATVKRFSEDLAAHKGDPALITEFCSD
                     MSPAFIKGVADNFTNAQLTFDKFHIMQVINNAVDEVRRQEQKERPELQRSRYIWLKNQ
                     NNLKASQRKRLDELSLPRLNLKTTRAYRMRLTFQEFFEQPQVLVEAFLKKWYFWATHS
                     QLQPMKEAAYTIKRHWSGILRWFTSRINNGVLEGINSLIQAAKARARGYRTTKNLINM
                     IYLISGKLNFGLPT"
     gene            745706..746320
                     /locus_tag="CPHA266_RS03400"
                     /old_locus_tag="Cpha266_0653"
     CDS             745706..746320
                     /locus_tag="CPHA266_RS03400"
                     /old_locus_tag="Cpha266_0653"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744538.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744538.1"
                     /db_xref="GI:500065105"
                     /translation="MLQQSTVAADKAKALILARGGLIRTREAISLGIHPRTLYSLRDS
                     GELEELSRGIYQLRGCKQLEYPDLVTVALRVPNGVLCLVSALSFHEMTTQVPHSVSLA
                     LEKGAEQPRIEYPPVTVFRFSSSCFKIGIETHQLDGVSVKIYSPEKTLVDCFKFRNRI
                     GMDIVLEALKLYRQRMQKNLHALMQYAEVCRVASVMKPYLEATL"
     gene            746317..747255
                     /locus_tag="CPHA266_RS03405"
                     /old_locus_tag="Cpha266_0654"
     CDS             746317..747255
                     /locus_tag="CPHA266_RS03405"
                     /old_locus_tag="Cpha266_0654"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744539.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744539.1"
                     /db_xref="GI:500065107"
                     /translation="MSAKEIKNIGASVRQRLLNKARQENRPFQELLQYYAMERFLYRL
                     SVSSFADRFILKGALLLRVWHAPLARPTMDIDMLGKTGNAPESITTIISQVLAVEKQG
                     DGIVFDPESITVEPITEDADYEGLRIRFRGDLDAARLTIQLDIGFGDKVYPDPVKESL
                     PSLLNFPQAELYCYSRESMIAEKFEVMAKLGILNSRMKDFYDIWMLSRQYDFEGVSLA
                     EAIRQTFAQRGTTLVQMKEIFSGEFIDEKQVQWNAFRKRIGLEYLPASFADVVQQVQV
                     FLSPAVEALRANRLFQDNWIAQDSWRSSHEKPEVGA"
     gene            complement(747757..748239)
                     /locus_tag="CPHA266_RS03410"
                     /old_locus_tag="Cpha266_0655"
     CDS             complement(747757..748239)
                     /locus_tag="CPHA266_RS03410"
                     /old_locus_tag="Cpha266_0655"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744540.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744540.1"
                     /db_xref="GI:500065109"
                     /translation="MGTSEDYGTGRVLENIRKALHVFDSTEGSLSNNEQSVRIQKKIQ
                     EFEPRILSFPEASDYIRKAVTIALGERVCRALHPGSVSTESVFLDELAETMVRSGQAR
                     IASIEDAEQTLKKSFQHPLIISKVSGRYQEICASYPPDCVYWRAEKRGLHCLLNRKNI
                     "
     gene            complement(748241..748694)
                     /locus_tag="CPHA266_RS03415"
                     /note="virulence factor; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            748982..750547
                     /gene="purH"
                     /locus_tag="CPHA266_RS03420"
                     /old_locus_tag="Cpha266_0657"
     CDS             748982..750547
                     /gene="purH"
                     /locus_tag="CPHA266_RS03420"
                     /old_locus_tag="Cpha266_0657"
                     /EC_number="2.1.2.3"
                     /EC_number="3.5.4.10"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BE85.1"
                     /note="involved in de novo purine biosynthesis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="purine biosynthesis protein purH"
                     /protein_id="WP_011744542.1"
                     /db_xref="GI:500065114"
                     /translation="MSDPVIKRALVSVSDKTGIVDFCRELSLLGVEVFSTGGTLKTLQ
                     DAGIAAASISTITGFPEIMDGRVKTLHPKIHGGLLAVRENPDHVNQANENGISFIDLV
                     VVNLYPFEATVAKPDVTFEDAIENIDIGGPSMLRSAAKNNESVTVVTDSADYALVLQE
                     MRNNNGATKRETRLALALKVFELTSRYDRAIASYLAGAQHEADSSMTVKLERELDMRY
                     GENPHQSAGLYRLTDENGTRSFSDYFEKLHGKELSYNNMLDIAAAVSLIEEFRGEEPT
                     VVIIKHTNPCGVAQAPTLAEAYRRAFSTDTQAPFGGIIAFNHPLDMEAATAVNEIFTE
                     ILIAPAFEDGVLEMLMKKKDRRLVRQTSALPKGGWEFKSTPFGMLVQERDSKIVTKED
                     LTVVTKRQPTEEEVADMMFAWKICKHIKSNTILYVKNRQTFGVGAGQMSRVDSSKIAR
                     WKASEVNLDLHGSVVASDAFFPFADGLLAAAEAGVTAVIQPGGSIRDNEVIEAADANN
                     LAMVFTGMRHFKH"
     gene            complement(750621..751583)
                     /locus_tag="CPHA266_RS03425"
                     /old_locus_tag="Cpha266_0658"
     CDS             complement(750621..751583)
                     /locus_tag="CPHA266_RS03425"
                     /old_locus_tag="Cpha266_0658"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744543.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744543.1"
                     /db_xref="GI:500065116"
                     /translation="MAEQTDSIIRAIKKEASRLGFCAIGFSSLKPQNLAVERLNNMID
                     EGRHGEMDYLANRIKERADPSLLLSGTKTIISAAMNYYRSTTPRRPDLPRISNYALIE
                     DYHIVLKDRLGQLLAKIQQLYPEPLNGLITIDSAPVFEKSWAEQAGIGASANNTLLII
                     PAAGSYVFIGEILIDKPFESDMKPLANLCGSCRKCIESCPTGALVSPGKIDARRCISY
                     LTVELKREFTAEESLMAGSWLFGCDCCQESCPYNRERRGPPEGVFHPKEQLENLTCEE
                     ILNLSGSGFKKLFFGTPVYRIGLRRLKRNARAVQENMNRTEIKP"
     gene            751713..753647
                     /locus_tag="CPHA266_RS03430"
                     /old_locus_tag="Cpha266_0659"
     CDS             751713..753647
                     /locus_tag="CPHA266_RS03430"
                     /old_locus_tag="Cpha266_0659"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744544.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="(2Fe-2S)-binding protein"
                     /protein_id="WP_011744544.1"
                     /db_xref="GI:500065122"
                     /translation="MQRREFISKFFRSAGIGAGAVAAGTAGLIGYYQPRKELYEVDNN
                     GSSEAQRPASSKKVVVVGGGLAGITASIELARHGFGVTLVESSSSLGGKLTGWSLDAL
                     GETFPVEHGFHGFFDQYYNLNEMFAFAGVDKAVFDASPGYPILFKNRPAEIYGQTPRY
                     FPFNILSVLWQSRSLDLVSFLKNYQGLWPVIGLLRYSYSKTFRDYDSIDFMTYCRRGN
                     ILPAFIDTVLHPFADATMNRMEVLSAAEALRYFHFYFMASPEGLSFRITNRDCMSALI
                     DPLRLKLEELGVTIRSGRKALRLRIEDEKVSGVVLQGSGGSGQIYSGIAVSDVPASGW
                     VVLAASEGVPVLVSRHDGGFVAFDARCTHMGCPVAPHPESGGFFCPCHAGKFDAAGNP
                     VSGPPKAPLQKLSVMQKGEQLLLTLPAGDSLADDDDFLECDYCIAASDVRGTRELVRL
                     SGLNKPDFERQVSSLGEADPYAVYRLWLDRPLLTAKFPFYTVSGYTYTDSVSIYSAFQ
                     EPFISWAKKHHGAVIELHAYAIAPEDVRAEEDIKAAMQKELHHLFPETEGATILHELY
                     MQQSNFTRWAPGDHAGRPGTETPLSNLFLAGDWIKVDAPVFLMEAAAFTGRMAANAIF
                     IKEKVKPVPLPIVSMDGLFA"
     gene            complement(753678..754865)
                     /locus_tag="CPHA266_RS03435"
                     /old_locus_tag="Cpha266_0660"
     CDS             complement(753678..754865)
                     /locus_tag="CPHA266_RS03435"
                     /old_locus_tag="Cpha266_0660"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744545.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase"
                     /protein_id="WP_011744545.1"
                     /db_xref="GI:500065124"
                     /translation="MSVFHFFERSKTDRLAVIHLLLTMFTVLAGIVPGRAYGSNFKPL
                     EALCQKALLEGVFPGASIAVRHEGKTVFHQAFGTIDCRTHATPADTSTVYDLASLTKA
                     VVTTSIAMQLWERDSLQLDQPVSRYFPAFTGKGKERVTIRHLMTHTSGLRAHTFFHKT
                     CRTPEDVVQAICSDTLITKPGIKTTYSDLGFIVLGRVLETITGKSLESNFHERFAVPL
                     GMKNTTFNPGNRFNGKIAATETDTSWHFNRLRPLVHDQNAALLGGVAGHAGLFSTSSD
                     LLKFTSMMMDGGIYKGRRFFKPETVRYFTSRNGTLPRALGWDLRSLEGSSSAGTLFST
                     QSWGHLGYTGTSIWIDPQKKLAVIILSNRVCPTSENIKIRAFRPELHNTVVQCISSTS
                     TDN"
     gene            complement(754843..755721)
                     /locus_tag="CPHA266_RS03440"
                     /old_locus_tag="Cpha266_0661"
     CDS             complement(754843..755721)
                     /locus_tag="CPHA266_RS03440"
                     /old_locus_tag="Cpha266_0661"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744546.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744546.1"
                     /db_xref="GI:500065126"
                     /translation="MRNPNALKWSDLKTGIFFILGIGFAAYLGLVIGKNSSLFTGVTT
                     IKIISNNMQGLAENNFVSVSGKKIGTVSKLDFVTSKDSLFVVAELRLRNEFAPLVSRD
                     AKATIKALGILGDKYVDITTGKGPAVQNGDYLVLQSEEGLADLTSGAGEALKKINLLL
                     DQLNNGKGVAGRLVSDEKMGTELAETVSSLKTTSAELSKVSREASHGNGLLPKLLNDK
                     AMAKNTEQTIERLNRAASETESLIAKINNGQGTIGQLQANPALYNNLNRSLSSLDSLL
                     MDLKENPKRYVRFSLF"
     gene            complement(755743..756477)
                     /locus_tag="CPHA266_RS03445"
                     /old_locus_tag="Cpha266_0662"
     CDS             complement(755743..756477)
                     /locus_tag="CPHA266_RS03445"
                     /old_locus_tag="Cpha266_0662"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744547.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_011744547.1"
                     /db_xref="GI:500065130"
                     /translation="MIELRNVSLKYGDREILDDISLTIADNSIKAILGPSGVGKSTIL
                     KLMLGLIKPNSGQVLIDGTDITKLKETELYPIRRKMGMVFQGNALFDSMTIDQNLGFF
                     LRENLNLSEKEIESRVMEQILFAGLEGYEDKLPESLSGGMRKRVAIGRALIFKPHMIL
                     FDEPTAGLDPVSSKKILTLISTLKKSNNLGAVIVTHIIDDVFNVADHVAVLYQGKMIF
                     DDVVNKLHESSHPFILSILSDKILEI"
     gene            complement(756482..757276)
                     /locus_tag="CPHA266_RS03450"
                     /old_locus_tag="Cpha266_0663"
     CDS             complement(756482..757276)
                     /locus_tag="CPHA266_RS03450"
                     /old_locus_tag="Cpha266_0663"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744548.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_011744548.1"
                     /db_xref="GI:500065132"
                     /translation="MNLAPATAFRKDINLRLKDFFLTMQEFFMFSVRAFLTIPKIKRY
                     WRDFLDQATICGTDSIPIVLVSAISIGSLLAIEVGNLLEDFGAKTMLGRSTSISVIRE
                     LGPLLMGLMLSARFGARNGAELGAMQISEQIDALRAFGTDPVAKLVMPRLIAALVMFL
                     PLTALSDFAGLHSAAYMAEHYHRLDPGMFWNAVYPRLAPKDFVVGFVKAPVFAIIITL
                     VSSFNGFSARGGTAGVGRSTIKGIVVSSGLVLVANFYVSKIVLENM"
     gene            complement(757415..758275)
                     /locus_tag="CPHA266_RS03455"
                     /old_locus_tag="Cpha266_0664"
     CDS             complement(757415..758275)
                     /locus_tag="CPHA266_RS03455"
                     /old_locus_tag="Cpha266_0664"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744549.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphotransferase"
                     /protein_id="WP_011744549.1"
                     /db_xref="GI:500065133"
                     /translation="MPYSLSGVRHNGFEKADLHIHTKCSDGIFTPEQIIEKAAAVGLK
                     AISITDHDSVLGIDKAKPLALTKGVELIPGVEMSSTFKGYDIHVLGYFFDYQQSELKQ
                     YLDHCRHLRTERAERMVGKLAKMGVKIGIEQIILKAQNGSVGRPHIAAVLQDGGYVKS
                     FSEAFSKYLGAHSPAYVKSIETHPRDVIRLINEASGLSFLAHPAHNVPDETLKQLITF
                     GLDGIEIVHPSHDLYKQNYYREIANEYFLLFSGGSDFHGMKERDDDAFGNITIPYEWV
                     TKMKSRLVKT"
     gene            complement(758295..758525)
                     /locus_tag="CPHA266_RS03460"
     CDS             complement(758295..758525)
                     /locus_tag="CPHA266_RS03460"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467171.1"
                     /db_xref="GI:752830869"
                     /translation="MLLAGFSHKRTDVNLFNGFTESSVLSRLVLKSHTTAFPGFNNRV
                     SVMLFSGNFLQKKIIFFSHTMTAIFFIYIKSK"
     gene            complement(758500..759348)
                     /locus_tag="CPHA266_RS03465"
                     /old_locus_tag="Cpha266_0665"
     CDS             complement(758500..759348)
                     /locus_tag="CPHA266_RS03465"
                     /old_locus_tag="Cpha266_0665"
                     /EC_number="3.6.1.27"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BE93.1"
                     /note="phosphatase activity in Escherichia coli not
                     kinase; involved in bacitracin resistance as bacitracin
                     supposedly sequesters undecaprenyl disphosphate which
                     reduces the pool of lipid carrier available to the cell;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP pyrophosphate phosphatase"
                     /protein_id="WP_011744550.1"
                     /db_xref="GI:500065134"
                     /translation="MTLFESIVLGVVQGLTEFLPVSSTAHLRIIPALAGWEDPGAAFT
                     AVVQLGTLAAVLIYFYKDIYAILAAVIQGIMKGRPFDTHEAAMGWMIAVGTLPIVICG
                     LLFKTEIETSLRSLYWVSGALIGFALLLLVAEWSVKKRLKQNMSMTSMDTIGWKEAIF
                     TGFAQCLALIPGASRSGVTITGGLFLNMSRESAARFSFLLSLPSVFAAALFELYHTWD
                     IIASSAGSIAAITAATITAGITGYLSIAFLISYLKKHTTSIFIIYRIILGAGILSLIA
                     AGRLQP"
     gene            complement(759345..760049)
                     /locus_tag="CPHA266_RS03470"
                     /old_locus_tag="Cpha266_0666"
     CDS             complement(759345..760049)
                     /locus_tag="CPHA266_RS03470"
                     /old_locus_tag="Cpha266_0666"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744551.1"
                     /note="HAM1-like protein; Rec-dependent growth; RgdB;
                     yggV; it is suspected that this protein functions to
                     remove misincorporated bases such as xanthine or
                     hypoxanthine; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyribonucleotide triphosphate
                     pyrophosphatase"
                     /protein_id="WP_011744551.1"
                     /db_xref="GI:500065135"
                     /translation="MPQSADNRIIVILATANRDKVKELRPLLEHISPLFTVHALHELG
                     VEVEIEETEDSLEGNALLKARAIFSLLSDRFPFMIALADDTGLEVEALHGAPGVYSAR
                     FAPMPDGRTPTYQDNVSHLLYCMNGIADRSARFRTVVALKGSLPSAQGSFLFERTAEG
                     LVEGSITLNQQGDEGFGYDPIFLVHATGKTYAEMSTDEKNTLSHRSLAVQKAITELRN
                     IFEQQCIPLTNSSTHQ"
     gene            complement(760071..760781)
                     /locus_tag="CPHA266_RS03475"
                     /old_locus_tag="Cpha266_0667"
     CDS             complement(760071..760781)
                     /locus_tag="CPHA266_RS03475"
                     /old_locus_tag="Cpha266_0667"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BE95.1"
                     /note="involved in the de novo synthesis of pyridoxine
                     (Vitamin B6); Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxine 5'-phosphate synthase"
                     /protein_id="WP_011744552.1"
                     /db_xref="GI:500065142"
                     /translation="MRLAVNIDHIATLRNARGEQEPDPVAAALLAERCGAAGIVCHLR
                     EDRRHIKDLDLARLREAVTTKLDLEMAMTGELQEIALKTKPELITLVPEKREELTTEG
                     GFDVARHFAVLKEFLKPLNDNGIEVSLFIEPEKKAVDLAREAGADLVELHTGLYAQKE
                     LENNTDLELQRIREAATYAKSIGLRVVAGHGLNYRNIGPFREIPEIEEVSIGHAIIAR
                     AVFTGLDEAVREMLRLIQ"
     gene            761185..763569
                     /locus_tag="CPHA266_RS03480"
                     /old_locus_tag="Cpha266_0668"
     CDS             761185..763569
                     /locus_tag="CPHA266_RS03480"
                     /old_locus_tag="Cpha266_0668"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744553.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutS"
                     /protein_id="WP_011744553.1"
                     /db_xref="GI:500065147"
                     /translation="MNPVSLKKLEFDKVANYAAQFCLSAMGRDRLLAAEPEVGRRELV
                     AELERVLELRNMLQEGSALPFSWLPDTRPLLKKLEILESYLEPEELQDIYHLLFSSVQ
                     LRKFMFFNREVYPLLNEFTIRLWLEKSLQTSIRRIIDEQSRVRDTASEELLLIRRELG
                     GSRELIRRKMERLQRRCQESGWLMEDTIAIKNGRLTLGLRVEYKYKIAGYIQDYSGSG
                     QTVFIEPAETLEISNRIQDLEISERREIERILKEMSGALRLELENLRYNEIILGDFDS
                     LYARARFAVETNSVLPGIADGQSLRIIRGFHPWLLISHHHKEVMPLDLDLDETDRVLV
                     ISGPNAGGKSVAMKTAGLLCCMLVHGYLLPCSESSVFPLFSDIFIEIGDDQSIENDLS
                     TFSSHLGAIRTILDVAGSGDLVLIDELCAGTDVEEGGAIARAVMEELLNRGTKTIVTT
                     HLGDLKAYAHEREGVLNGAMEFDRAGLVPTFRFVKGLPGNSFAFAMMKRMGFPVKMVE
                     RASEFMMDERIGLDRMLDDLSRLFEENRLLKQQLEGERADLAERVIALRAEEAGVERK
                     QRELRLGAARELQKEVEHARKEIREIVQEVRNAPADAKTVQDSRKKLGLKKQEAEKSE
                     SVLDAEAESAVHLDRSIREGDLVRILDSTASGEVESVNGESVVVQCGHFRLTTSLKNL
                     EKTSKTQVKKNLREPLLRQQKGSWSAITSEVDSTKLDLRGLSGDEAIMKIDRFIDTMR
                     LNRIHSAMILHGKGTGSLRQRTAEFLQQHGSVKSFRLGEWGEGGAGVTIVEIES"
     gene            763805..764401
                     /locus_tag="CPHA266_RS03485"
                     /old_locus_tag="Cpha266_0669"
     CDS             763805..764401
                     /locus_tag="CPHA266_RS03485"
                     /old_locus_tag="Cpha266_0669"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744554.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CDP-diacylglycerol--glycerol-3-phosphate
                     3-phosphatidyltransferase"
                     /protein_id="WP_041467521.1"
                     /db_xref="GI:752831219"
                     /translation="MTIPNQLTMLRIVLVPVFVALLLQDEPYVKLLGVFVFVVASLTD
                     AYDGYHARKYGETTRLGAFLDPLADKLLITAAFLLYVRMGYLVLWMVILVAVRDVVIT
                     ALRIYAEMKDRPVVTSKEAKYKTLMQNVFAYIIMALLLLREPVFFGSSIASAVNGFLV
                     SDYLDYMMLVVTIFTVYTGISYLTSNWRASFQSSSDEH"
     gene            764406..764882
                     /locus_tag="CPHA266_RS03490"
                     /old_locus_tag="Cpha266_0670"
     CDS             764406..764882
                     /locus_tag="CPHA266_RS03490"
                     /old_locus_tag="Cpha266_0670"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744555.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidylglycerophosphatase"
                     /protein_id="WP_041467522.1"
                     /db_xref="GI:752831220"
                     /translation="MKLFLAKVLSTCGGLGYFPAAPGTFVSFIAVLLFVFTPLCRDTA
                     ILFIVIAFGFFLGAWAGGVMESAFGDDPSIVTIDELVGQWIALAALPAGLPAVVLAFV
                     FFRFFDIAKPGLVDRAQQLPGGWGIMVDDLLAGIYANLSVRALLALFSLLHVTFPG"
     gene            complement(764861..766792)
                     /locus_tag="CPHA266_RS03495"
                     /old_locus_tag="Cpha266_0671"
     CDS             complement(764861..766792)
                     /locus_tag="CPHA266_RS03495"
                     /old_locus_tag="Cpha266_0671"
                     /EC_number="2.2.1.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744556.1"
                     /note="catalyzes the formation of 1-deoxy-D-xylulose
                     5-phosphate from pyruvate and D-glyceraldehyde
                     3-phosphate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-deoxy-D-xylulose-5-phosphate synthase"
                     /protein_id="WP_011744556.1"
                     /db_xref="GI:500065150"
                     /translation="MEDSIPVPVSQESSILASIHSPEDLKKLSLEDLQHVADECRREV
                     INLVAQNGGHFASSLGVVELSVALHYVYNSPRDKIVWDVGHQAYIHKILTGRRESMKT
                     NRQYGGLAGFPRIFESPYDAFGTGHASTSISAAAGMAAARDLSGGTEKMIAVIGDGSM
                     TGGMAFEAMNHLGDTKSDVLVILNDNQMAISPSTGGLKTHLVNIALNKTYNKTRKFIW
                     NSISLLNNDLGDTAKSLVRKLEDGIKAAFTPGAFFEALGLRYFGPIDGHNLEQLVKAL
                     KEMQELPHPKLLHVVTTKGKGFKPAEENQSKWHAHNGGFDTTTGKTIVTAQKAGPPKY
                     QEVFGETLVELALKDPRITAITAAMPSGTSLDLFQNALPNRFFDVGIAEQHAVTFAAG
                     LAIQGFKPVCAIYSTFLQRGYDQIIHDVAQQNLHVVFAIDRAGLVGEDGPTHHGAFDL
                     SFLQPIPNFVIMAPSDEQELRNMLYTALYHVTGPVAIRYPRGNGTGIALNKTLIPLEI
                     GKGRIIRQGNGIALLAAGPLVWRALEVAEALQKEGMNPLVADMRFIKPLDTELIEEIA
                     QQVTHLVVIEENSMIGGLGSGVIDYINSRKSKIPVLKTGLPDAFVTHGSMEELYRETG
                     LDVVGITKSIKDFYPGNVT"
     gene            complement(767007..767432)
                     /locus_tag="CPHA266_RS03500"
                     /old_locus_tag="Cpha266_0672"
     CDS             complement(767007..767432)
                     /locus_tag="CPHA266_RS03500"
                     /old_locus_tag="Cpha266_0672"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744557.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744557.1"
                     /db_xref="GI:500065151"
                     /translation="MIFQKHTISLETRNPIALIDITPMVNKALADSGVQQGQAIILSQ
                     HTTAFININEKENRLLEDMTTFLKRLVPRDGDYLHNLQPLDGRDNAHAHLLGLFMNSS
                     ETIPVSDGKLMIGQWQSIFFVELDGPRLRRNVLVQFSGI"
     gene            complement(767535..768977)
                     /locus_tag="CPHA266_RS03505"
                     /old_locus_tag="Cpha266_0673"
     CDS             complement(767535..768977)
                     /locus_tag="CPHA266_RS03505"
                     /old_locus_tag="Cpha266_0673"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744558.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-amylase"
                     /protein_id="WP_041467523.1"
                     /db_xref="GI:752831221"
                     /translation="MFPLVFEINTRIWLQKLSDQHQKNITLATVPDTEFTFFSECGFD
                     IVWLMGVWTPSRYSKAIATAHPGLRSSFLSYHDPLDPDTIVSSPYAIPSYTVHDKLGG
                     KDELLAFREKLNALGILLMLDFVPNHLALDNDWLPNHPEYFIPVSKDEQSQDPESCFE
                     YAAGKYLAHGKDPYFPSWTDTLQLNYANPATREMMRENLLMISSLCDGVRCDVAMLIL
                     KEIFNTTWSNLSGHMEDEFWLEAIAAVKNRFPDFIFLAEAYWNKEWDLQQLGFDFTYD
                     MPFYDHLTHAPVNVEKLMGHMQAQWEYQQHLCRFIENHDEPRAAEKIGLNNAVAALVL
                     LTAPGMHLIHENQMDGYKKKIPVQLNRQEPEAGDAELHLLYRRLFQLQKKAVFREGNI
                     EWLHLNIIRAAHCFGYHRYRNEEHAFILANFSATGISIAFSHPFLLNKNNNNLTILCT
                     SCRDKTPEILLDGETMHIRLAPHEGVVVTC"
     gene            769234..771438
                     /locus_tag="CPHA266_RS03510"
                     /old_locus_tag="Cpha266_0674"
     CDS             769234..771438
                     /locus_tag="CPHA266_RS03510"
                     /old_locus_tag="Cpha266_0674"
                     /EC_number="3.6.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744559.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase PcrA"
                     /protein_id="WP_011744559.1"
                     /db_xref="GI:500065157"
                     /translation="MTDFLLDLNDVQRQAVRATEGPVMVLAGAGSGKTRVITYRIAWL
                     IKNGYASAKNILALTFTNKAAGEMRHRVDVLLQQGSAGGLWIGTFHSIFARLLRNDIH
                     LLGYDRNFSIFDADDSKSLIRQSMGELNISPDSVPLNTLQGIISRAKNSFILPEEFRR
                     SAGDYNQQIAAKVYDLYTRKLRENNALDFDDLLIKPLELFREHPMVLEALQDTFRYLL
                     IDEYQDTNKAQYLAAKMLSAKHRNIFVVGDDAQSIYSWRGADISNILNFQDDYTDALT
                     FKLVENYRSTGTILQAANSVIRNNLRQIKKELVSHRSAGDPLTLIEARNERHEAEKIG
                     EYIHSIRIEKGYEFRSFAVFYRTNAQSRVLEDLMRQNRIPYKIFGSVSFYKRKEIKDA
                     VAYLRFLLNDRDSESLLRIINFPPRKIGETSIGKLREFAEAEGITLYEAITRADEGQF
                     QSRLVNSLKGFSSLIEALRLLAETGTVYAVLTELFSLTSIPLLLKEENTAESLARHEN
                     LQELLSMARDFSDNNPDQGSLGDFLETISLASNYDESQDSDNYVSLMTVHASKGLEFP
                     VVFITGLEERLFPLNCYEPEQLEEERRLFYVAMTRAQEKIFLSWAQTRYLYGQPQYCL
                     KSMFISEIDSSIVKTESGTVLADRKERQGTRNAVPESGGYRQRPAGAVSAPSQKPRES
                     GLREGSTVHHAVFGQGTVLDVQGRGAGQKALIRFRNAGEKTLMVQYANLRVL"
     gene            771476..772507
                     /locus_tag="CPHA266_RS03515"
                     /old_locus_tag="Cpha266_0675"
     CDS             771476..772507
                     /locus_tag="CPHA266_RS03515"
                     /old_locus_tag="Cpha266_0675"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744560.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744560.1"
                     /db_xref="GI:500065158"
                     /translation="MKILFGVQGTGNGHISRSRELVRRLKADGHEVDVIISGRKEDEL
                     REIEVFEPYRVMKGMTLVTFKGRMNYIETMFQLDLTRLMADVFTLDTEGTDLIITDFE
                     PITSLAARLRNIPSVGFGHQYAFRFDIPVARGNIFEKYTLLNFAPARYNAGLHWSDFN
                     QPVFPPVIPESLYEQKQPLVNRSKILVYLPFEELPDVSDFVSPFVDFEFFIYGKVQND
                     SDDGHLHFRGYSRAGFLKDLMECDGVVCNAGFELPGEALHLGKKLLLRPLDGQIEQES
                     NALAMVELGYGMAMHSLDGDMLADWLLKPGREPLHYAKTVDYIAEWIGSGEWDLLSKY
                     TEAAWKRLF"
     gene            772516..773094
                     /locus_tag="CPHA266_RS03520"
                     /old_locus_tag="Cpha266_0676"
     CDS             772516..773094
                     /locus_tag="CPHA266_RS03520"
                     /old_locus_tag="Cpha266_0676"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744561.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitroreductase"
                     /protein_id="WP_011744561.1"
                     /db_xref="GI:500065159"
                     /translation="MHFRDLVTRTRSCRRFDGSYRISKSALRDLVELACYAPSAKNLQ
                     PLKYIGVTDPDRFADIFSCLSWAGYLDEWSGPEESERPSAYLVMLGDRALSPFIACDS
                     GIAAQTIMLGATNMGLGGCMVGSVDRDRLRQLLGFAEWLDVLFVIALGKPVETIVIDQ
                     MAEEEDVRYFRDIHGIHHVPKRMVDDVLLGLH"
     gene            773124..773708
                     /locus_tag="CPHA266_RS03525"
                     /old_locus_tag="Cpha266_0677"
     CDS             773124..773708
                     /locus_tag="CPHA266_RS03525"
                     /old_locus_tag="Cpha266_0677"
                     /EC_number="2.3.2.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BEA5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="leucyl/phenylalanyl-tRNA--protein transferase"
                     /protein_id="WP_011744562.1"
                     /db_xref="GI:500065161"
                     /translation="MIRIDELLRAYRKGLFPMADPDDEKVYWCQPYKRAVVPLLSYMP
                     SRDVARILRRGEFEVRIDSDFEGVIRGCAAPRKSDSQTWISPEIMDAYLTLNQLGVAH
                     SVECWHHGELSGGLYGLSMGAAFFGESMFFRRSYASQVAFDHLVRRLKDRGYLLLDAQ
                     IMNPHLQKLGAVEIDHDEYMLQLDIALGKKIRFI"
     gene            773777..775078
                     /locus_tag="CPHA266_RS03530"
                     /old_locus_tag="Cpha266_0678"
     CDS             773777..775078
                     /locus_tag="CPHA266_RS03530"
                     /old_locus_tag="Cpha266_0678"
                     /EC_number="3.6.3.16"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744563.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arsenic ABC transporter ATPase"
                     /protein_id="WP_011744563.1"
                     /db_xref="GI:500065162"
                     /translation="MLSRDLTENQSQPRVIIYSGKGGTGKTTISSSTAVALARQNKKV
                     LIMSSDPAHSLSDVFDTQISRNDPQRIEKNLYGLEIDTIYELKKNMSGFQKFVSSSYK
                     NQGIDSGMASELTTQPGLDEIFALNRLVDEAQSGKWDAVVLDTSPTGNTLRLLAYPEI
                     IIGGNMGKQFFKLYKSMSSLARPLSGNSIPDGEFFNEVNVLLKQMEDINKFILSPEVT
                     FRLVLNPEKLSILETKRAYTFIHLYGINIDAIVINKILPTSKTVGEYFEFWADLHTKY
                     LMEIDNSFYPTPVFRCNLQRTEPIGSDALHEISKLVFGEQIPDKTFYEGKNFWIESRK
                     NAVTEDHREILCIRIPFLKDAEDVKVERMGTDIVVTVDRAQRIITLPRALYSLDLEEY
                     LIEDNLLRVVFKETPVEKDEVELSVNKNMLDKLRSMRRMKI"
     gene            775225..776106
                     /locus_tag="CPHA266_RS03535"
                     /old_locus_tag="Cpha266_0679"
     CDS             775225..776106
                     /locus_tag="CPHA266_RS03535"
                     /old_locus_tag="Cpha266_0679"
                     /EC_number="1.3.1.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744564.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-ACP reductase"
                     /protein_id="WP_011744564.1"
                     /db_xref="GI:500065163"
                     /translation="MPEKAHYGLLKGKKGIVFGPLDESSIGWQIALHAYREGAEIAIS
                     NVATALRFGNIEELALLCGNAPVIVCDASRNEDVDNCFKELKEKMGAVDFIVHSIGMS
                     QNIRKQLPYEELNYEWFMRTLDVSGLSLHRIVSYALKNDAINAGGSIVALSYIASQRN
                     YWTYSDMGDAKSLLESIARSYGPRLAKRAIRINTVSQSPTYTKAGSGIPGFEKMYEYS
                     DLMSPLGNASAEECAEYTMTLLSDLSRKVTMQNLFHDGGYSSMGATIPMIKLAHEVLN
                     DRELAARVGLDDVSPST"
     gene            776572..778797
                     /locus_tag="CPHA266_RS03540"
                     /old_locus_tag="Cpha266_0680"
     CDS             776572..778797
                     /locus_tag="CPHA266_RS03540"
                     /old_locus_tag="Cpha266_0680"
                     /EC_number="1.1.1.42"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744565.1"
                     /note="NADP-specific, catalyzes the formation of
                     2-oxoglutarate from isocitrate or oxalosuccinate; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isocitrate dehydrogenase"
                     /protein_id="WP_011744565.1"
                     /db_xref="GI:500065164"
                     /translation="MGKSSTIIYTKIDEAPALATYSLLPVIQAFAKGTGVDVETRDIS
                     LAGRIIANFPDNLTEEQKISDQLAELGQLALTPEANIIKLPNISASLPQLQAAIKELQ
                     SHGYNIPDYPEAPENDAEKEIQLRYAKVLGSAVNPVLREGNSDRRAPLSVKQFAKKHP
                     HKMGAWSNDSQSHVAHMHSGDFYGSEQSLTVQEPTSVRIEFVDGSGSVKVLKEKTALL
                     KGEVIDTAVMNIRSLRQFFADQIADAKASGILLSLHLKATMMKVSDPVMFGHAVTVFY
                     KDVFDKYAALIKELGVNVNNGLGDLYVKIKNLPDAQRAEIEADIQAVYATRPALAMVD
                     SDKGITNLHVPNDIIVDASMPVVIRDSGKMWGPDGKLHDTKAMIPDRCYATMYQAMVE
                     DCKAHGAFDPSTVGSVPNVGLMAQKAEEYGSHDKTFMAPGNGSVRVVDAAGSVLMEQP
                     VEEGDIFRMCQVKDAPVRDWVKLAVNRAKATGVPAVFWLDSNRAHDREIIAKVDEYLK
                     EYDTTGLEICILTPVEAMKFSLERFRAGKDTISVTGNVLRDYLTDLFPIIELGTSAKM
                     LSIVPLMNGGGLFETGAGGSAPKHVQQFQKEGYLRWDSLGEFSALAASLEYLANAFRN
                     SKAQVLADTLDQAIGKFLDNSKSPARKVGQIDNRGSHFYLALYWAEALAAQSGDQELQ
                     ARFAGVAQQLAENEAVINAELIGAQGSPVDMGGYYHPSDELTSKAMRPSATFNAIIDA
                     M"
     gene            complement(778942..779568)
                     /locus_tag="CPHA266_RS03545"
                     /old_locus_tag="Cpha266_0681"
     CDS             complement(778942..779568)
                     /locus_tag="CPHA266_RS03545"
                     /old_locus_tag="Cpha266_0681"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744566.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744566.1"
                     /db_xref="GI:500065165"
                     /translation="MKQAQNKFLSASIVTLLVLAGSAVAMLWLPEKISVDAYKSAFVA
                     LDAYRTTHPEENPRYLAVVDFTKPSFIKRLALIDLKTGEEFFYRVAHGKNSGELFASW
                     FSDTSESNMSSLGLYKVLETYSGDHGKAMRLEGLEPSVNSNAFSRDIVLHSAEYVSLR
                     YIFINLLTLNGPRIGRSNGCFVVSPHAIDEVVQKLNHGAFLYAWADSK"
     gene            complement(779681..780199)
                     /locus_tag="CPHA266_RS03550"
                     /old_locus_tag="Cpha266_0682"
     CDS             complement(779681..780199)
                     /locus_tag="CPHA266_RS03550"
                     /old_locus_tag="Cpha266_0682"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012509283.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467172.1"
                     /db_xref="GI:752830870"
                     /translation="MMMTCFSFLASANEQTVGIGERFGGGIVFYIFQPGEQGYVEGEQ
                     HGLIVALEDQGRGVEWSNVTTASVSGTTTGLGAGRDNTTLIISQDGHQNSAAKLCEDY
                     VFEGYSDWYLPSSEELDKLYSNKGLVYGFSDGHWSSSESGPGDVWANLDCGVSRYHMK
                     MIGIHVRAIRSF"
     gene            780201..780386
                     /locus_tag="CPHA266_RS03555"
     CDS             780201..780386
                     /locus_tag="CPHA266_RS03555"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467173.1"
                     /db_xref="GI:752830871"
                     /translation="MPVIVIPFHKLFIFMKLQVCVTISDTQWTVMESGESILHCKARK
                     RIEKKRDKRAQEQQWCK"
     gene            complement(780644..781123)
                     /locus_tag="CPHA266_RS03560"
                     /old_locus_tag="Cpha266_0683"
     CDS             complement(780644..781123)
                     /locus_tag="CPHA266_RS03560"
                     /old_locus_tag="Cpha266_0683"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744568.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744568.1"
                     /db_xref="GI:500065167"
                     /translation="MTFFRKTIAVLALVMATMTPIHTMAAEPVVASAPSAMVADNTKG
                     LYVVLTDADPMTQMMALILSTQTLDQGKSVQILLCGPAASLAVKNSKQIMFKPLNKSP
                     QMMLSALIAKGVQVEVCAVFLPNSNKTEADLIAGVGVAKPPVAARNMRADGIKLFTF"
     gene            complement(781473..782381)
                     /locus_tag="CPHA266_RS03565"
                     /old_locus_tag="Cpha266_0684"
     CDS             complement(781473..782381)
                     /locus_tag="CPHA266_RS03565"
                     /old_locus_tag="Cpha266_0684"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744569.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pirin"
                     /protein_id="WP_011744569.1"
                     /db_xref="GI:500065174"
                     /translation="MIAARKIGKVFKSKPVIEGAGVNLKRAFGFSQVPLFDPFLLLDD
                     FRSDNPADYLKGFPWHPHRGIETITYVLQGTVEHGDSLGNSGLITAGSVQWMTAGSGI
                     IHEEMPFGDRHGFLAGFQLWANLPASQKMTTPRYRQISSAEIPKLHLDNGVEIHLISG
                     HIEEQDGPVNNIVIDPEFLDITIPAGVTFTHHTIKGYTVLAYIIAGKGLFCREDEPFS
                     YETEGVNYFDMETEQFLENETLVLFTDGDTITVTTEDDPLRFLLISGMPLNEPIAWHG
                     PIVMNTQAELRKAFEEYQNGTFIQNG"
     gene            782628..783443
                     /locus_tag="CPHA266_RS03570"
                     /old_locus_tag="Cpha266_0685"
     CDS             782628..783443
                     /locus_tag="CPHA266_RS03570"
                     /old_locus_tag="Cpha266_0685"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744570.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metallophosphoesterase"
                     /protein_id="WP_011744570.1"
                     /db_xref="GI:500065175"
                     /translation="MGQKIVKVMFIGDVVGNPGLKMVDLLLKNFIKKYSVDFVICNGE
                     NAHNGKGMSLESLNQLLEAGVQVVTGGNHTWSNFNFFETLKTHPQVLRPQNYPKGTYG
                     KGYGIYKIPGGLGDIAVINLQGRTFMYPIDCPFRTADWVIKQLKDQVRYIFVDIHAEA
                     TAEKIALGWYLDGRVSAVIGTHTHVQTADERILPKGTGYCTDVGMTGPQTSVIGMQIK
                     SAVDRMLYQTPHKYECAEDDVHFSAVVVTFEAEKGKTVAIERIFYPEFDRGMS"
     gene            complement(783597..784595)
                     /locus_tag="CPHA266_RS03575"
                     /old_locus_tag="Cpha266_0686"
     CDS             complement(783597..784595)
                     /locus_tag="CPHA266_RS03575"
                     /old_locus_tag="Cpha266_0686"
                     /EC_number="3.1.3.11"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BEB4.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fructose-1,6-bisphosphatase"
                     /protein_id="WP_011744571.1"
                     /db_xref="GI:500065176"
                     /translation="MNLITIERHILEQQKFFPEFTGELTDLLNDVAFAAKLVRREVVR
                     AGLVDILGFTGDTNIQGEQVKKLDLFANDKIINAIGQHGRFAIMGSEENDGIIIPPKN
                     ETGSYALLFDPLDGSSNIDVNVSVGTIFSIYKLKGDDPGKASLNDCLQHGYEQVAAGY
                     VIYGSSVVMVYTTGHGVHGFTYDPTIGEFLLSHENIVTPKSGKYYSINEGSYGQFNEG
                     TKKYLDYIKEEDPATGRPYSTRYIGSLVADFHRNLLTGGIFVYPPTITHPNGKLRLMY
                     EANPLAFICEQAGGRATNGKERILDLQPSELHQRTPLYIGSEADVMIAEEFEQGKR"
     gene            784797..786521
                     /locus_tag="CPHA266_RS03580"
                     /old_locus_tag="Cpha266_0687"
     CDS             784797..786521
                     /locus_tag="CPHA266_RS03580"
                     /old_locus_tag="Cpha266_0687"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744572.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded DNA exonuclease RecJ"
                     /protein_id="WP_011744572.1"
                     /db_xref="GI:500065177"
                     /translation="MKRYRWKLLMPDEQMVSHLSGAINVSTPLSRALCNRGIATFDEA
                     KDFFRPSIHQLPSPFLFKDMLRAVDRVADALEKREKIMLYGDYDVDGTTGTALLYLFL
                     QERGAEVSYYINDRFTEGYGLSREGIETAVARNTGLIITVDCGIRAEEQILLCNDHGI
                     DVIICDHHEPHELPPAYAILNPKLGDCSYPFRELCGCGVAFRFIQAIAEQLDTGMESW
                     QKYFDLVAIATAADMVVLEKENRTYVREGLQRIRTSPRSSLAQMLGIMNVDADMMSMF
                     TIAFGIAPRINAAGRMESATLAVKWLLSDSVEDSQQHAGELEQLNALRRKIDAEIFIQ
                     AEKMIAGHFASYCSSIVLYDEEWHLGVLGIVASKMLEKYYLPTVIMGNMNGLVKGSVR
                     SVDGLNIYEVLQECGEYLEQFGGHNQAAGITLRPENLAGFRKRFDEICRDLQPVELRQ
                     KEVLIDSVLALEDVTDKFMNVLAEFAPYGYGNREPLFVSDQVLLQGRPRLLKERHVKF
                     SVRDKHDRIFDVIGFDRRDIYEDLAASNTPVVAMVYSLEKRSWNNREHWQIRLKDLSI
                     TQDQPWKE"
     gene            complement(786493..787410)
                     /locus_tag="CPHA266_RS03585"
                     /old_locus_tag="Cpha266_0688"
     CDS             complement(786493..787410)
                     /locus_tag="CPHA266_RS03585"
                     /old_locus_tag="Cpha266_0688"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744573.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744573.1"
                     /db_xref="GI:500065178"
                     /translation="MAKINSRTIKLLKTLIQLLVTCLALFLVLTKTDIAQLAGIIRKA
                     DPWYLLLALLFFNISKILNALRLNRFFKVIGIRLSASYNLKLYYLGMFYNLFLPGGIG
                     GDGYKIYVLKKNHSLKTINVFNAVLWDRICGIVALIVLSLILLLQSSFAAKLPDLVPY
                     AWGLLILLYPFALLLNKLFYRQFIPVFAVTTLESLIIQSTQVISALFILKAISSTTHI
                     IDYLSIFLMSTVATILPITIGGAGAREITFYYLLDYIHLETSTGVALSLIFFGISAIS
                     SLAGILGRTRHEKSLPSAEDSTPSMADPE"
     gene            complement(787397..788329)
                     /locus_tag="CPHA266_RS03590"
                     /old_locus_tag="Cpha266_0689"
     CDS             complement(787397..788329)
                     /locus_tag="CPHA266_RS03590"
                     /old_locus_tag="Cpha266_0689"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744574.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="family 2 glycosyl transferase"
                     /protein_id="WP_041467524.1"
                     /db_xref="GI:752831222"
                     /translation="MKLSVVIPVMNEEKSIKPLFDALAAALGSVDHEIILVDDGSTDG
                     TVAEIEAFAPPNARLVVLNKNYGQTTAMAAGIDSAHGELIATLDGDLQNDPGDIPMMM
                     SYLYDHDLDVIAGRRANRKDGMVLRKIPSAIANAIIRNITGVHIHDYGCTLKIFKKDV
                     AKNLGLYGELHRFIPVLVQLYGAKMEEVDVRHHPRQFGESKYGIGRTFKVLSDLLFMV
                     FFQKYSQKPMHLFGTLGFSTLFLGLAINLYLVALKILGHEIGGRPLLTLGVILTFIGI
                     QLITTGFIAEFIMRTYYESQNKKPYIIKKIVGKD"
     gene            complement(788344..789888)
                     /locus_tag="CPHA266_RS03595"
                     /old_locus_tag="Cpha266_0690"
     CDS             complement(788344..789888)
                     /locus_tag="CPHA266_RS03595"
                     /old_locus_tag="Cpha266_0690"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744575.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl hydrolase"
                     /protein_id="WP_011744575.1"
                     /db_xref="GI:500065180"
                     /translation="MLPERQNYNKIIHASIVGVLVIASFFYGLGSGPLFDVDEGAFSE
                     ATREMLATKNYLTTYLNGVPRFDKPILIYWFQALSVTLFGMTEFAFRLPSALASAIWA
                     GAIYLFARKELGSRRAFLAAALMILSLQVTIIAKAAIADALLNCFLAVSMFAVYRHLT
                     TGSKPARNLAFAAIGLGVLTKGPIAMLIPLAVSFLFSLQQRSLKKWLTTVLNPTGIII
                     FLLIVMPWYTLEYLDQGMAFIQGFFFKHNINRFNSSLEGHSGSLFYYFPVILLGLMPF
                     TGLLFTTLFNLKKLLAEPLNIFLAIWFGFVFIFFSLSGTKLPHYMIYGYTPLFLLMAR
                     VFDSGKHPKLLVVWPLLFITLLGALPYALPMAMERIDDAYITAILHDARIILDSTYLM
                     VIGVSGLLLVATITIPVLKASGRLIAQGVVLTLLVNLFLMPIAAELLQIPVREAAILA
                     RKEGYKVVMWKVYYPSFFVYSETFAERRAPEKGDIVLTTVKYLPGFDNPDVLYQKHGI
                     VLVNNK"
     gene            complement(789863..790486)
                     /locus_tag="CPHA266_RS03600"
                     /old_locus_tag="Cpha266_0691"
     CDS             complement(789863..790486)
                     /locus_tag="CPHA266_RS03600"
                     /old_locus_tag="Cpha266_0691"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744576.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoesterase"
                     /protein_id="WP_011744576.1"
                     /db_xref="GI:500065184"
                     /translation="MTSRRFWIPAAASSVLLIIFCYLYVDIPTALLMRQSNDSTFFSF
                     FSGITILGQSEWYLVPGFLLFILFRNGQKHAASAGLFVFSTVALSGLAADLIKYILGR
                     ARPKLYLNDGMYGMDFFRWEHAWTSFPSGHSATAFSAAAALSLLFPRFRLFFFTAAIL
                     IAFSRIAINKHYISDVLAGSLLGLASTAFLYQRYFMTHCNAAGETKL"
     gene            790664..791530
                     /locus_tag="CPHA266_RS03605"
                     /old_locus_tag="Cpha266_0692"
     CDS             790664..791530
                     /locus_tag="CPHA266_RS03605"
                     /old_locus_tag="Cpha266_0692"
                     /EC_number="3.5.1.10"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744577.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formyltetrahydrofolate deformylase"
                     /protein_id="WP_011744577.1"
                     /db_xref="GI:500065191"
                     /translation="MELNAEDEIILLLSCPDRPGLVSRITGFICDRGGNILNLNEHVD
                     TGDKTFFIRIAWSIESSPLSLDELERAFMPLALELGAAWKIRESGKKTRMAIFVSKYD
                     HCLQEILWRHSMGEFAIDIALIVSNHPDLKPLADHYGIDYHLFETDRKSKADVERDEL
                     ALLEQYGIDTVVLARYMQILSPHFVERYPSRIINIHHSFLPAFVGGNPYRQAYERGVK
                     IIGATSHYVTEDLDEGPIIEQDIIRITHKDRLADLIRKGRDLERMVLARAIRFHAEHR
                     ILVNGKKTVVFE"
     gene            791619..792557
                     /locus_tag="CPHA266_RS03610"
                     /old_locus_tag="Cpha266_0693"
     CDS             791619..792557
                     /locus_tag="CPHA266_RS03610"
                     /old_locus_tag="Cpha266_0693"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744578.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobalt transporter"
                     /protein_id="WP_011744578.1"
                     /db_xref="GI:500065193"
                     /translation="MANNAVSAGDHHHHSDGHDHVHHHAAKNIKTAFFLNLGFTLVEI
                     IGGFITGSTAILANAVHDLGDSFALGQAWYFERLSGEKSNARYSYGYKRFSLLGALIS
                     TVFLLGSSLFVLAGAVPRILHPHHPDAGGMILLAVIGVAVNGIAMARLSKESGMNARV
                     VALHLLEDVLGWLTVLLVGIVLIFWNLPVLDPVLAVLITLYILRGVVKNLMAQIPVFL
                     QAVPAELDLSAISAEIEAMSTVRAVHHAHIWSLDGSHNVFTVHLEVERMLDAEDYMQL
                     KDRIKTLVKQHGIYHSTVEIEFPGEICRNMPDAGTG"
     gene            793071..793595
                     /locus_tag="CPHA266_RS03615"
                     /old_locus_tag="Cpha266_0694"
     CDS             793071..793595
                     /locus_tag="CPHA266_RS03615"
                     /old_locus_tag="Cpha266_0694"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744579.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane lipoprotein Blc"
                     /protein_id="WP_011744579.1"
                     /db_xref="GI:500065195"
                     /translation="MKKLFLIFIILLAGCTGIPQGITVVEDFALDRYLGTWHEIARLD
                     NRFEKELDPVSATYSLAPDGSVKVVNKGFDLKKQEWKTIEGRGVFLDDRNTTQGALKV
                     SFFGPFYASYNVIDLDSAGYRWAMVCGRDKSYFWILSKDTVMEPAQLKALVAKAATLG
                     FDMARLRYPGRQNP"
     gene            793695..794120
                     /locus_tag="CPHA266_RS03620"
                     /old_locus_tag="Cpha266_0695"
     CDS             793695..794120
                     /locus_tag="CPHA266_RS03620"
                     /old_locus_tag="Cpha266_0695"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744580.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744580.1"
                     /db_xref="GI:500065196"
                     /translation="MAIMTEFLNLIVPVSVIEEKYPGGWERCLQDHKVAIGARVWFDD
                     FLFRDGAMNPTAMLQLLNEWWKLGFECYAEKDGKKYWKDVCVYEGSLEGTPMPCDWLA
                     EDPESRSVYLKGTAMGEIKGRDWDLIDDWEALPFPENGR"
     gene            complement(794138..>795242)
                     /locus_tag="CPHA266_RS03625"
                     /old_locus_tag="Cpha266_0696"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(795299..797023)
                     /locus_tag="CPHA266_RS03630"
                     /old_locus_tag="Cpha266_0697"
     CDS             complement(795299..797023)
                     /locus_tag="CPHA266_RS03630"
                     /old_locus_tag="Cpha266_0697"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744582.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_011744582.1"
                     /db_xref="GI:500065198"
                     /translation="MKTFFRLVALVKPYLWWMALAAFIGFATTGSGIGLLMTSAYIIA
                     KAALQPPMVALQVGIAGVRFFGLARGAFRYAERLISHNITFKILAKLRLWFYDAIEPL
                     APARLMHFKSGDLLQRVVDDIQSLENIYTRVLGPPLTALLVTALMWFLLGSYSVSAAM
                     IILCFHTLAGIGVPILTMQLSRGISVGIMKHKAEEQVLALDLIQGIGELQLYGNLPAH
                     LAAMQSAETGKLQLQRKNAVIEGLHESLTGLLMNGAVITILWTLIPSISSGATANGIA
                     LSVITLAVMASFEPFLPLPSTIKHIEADQHAGERLFEILDAKPETIAPANPIPFPSEH
                     AIQVKRLSFTYPGSTAKALDSLSFSVLPGEHIAIVGPSGAGKSTITALFMRFWNSREG
                     CINIGGHNITLFDPEELRRNIALVSQKTYLFAETIRENLTLAAPGATDDDLKKALTAA
                     GLSHFASKLDEWCGQHGMKLSGGERQRIAIARILLQRAPIMILDEATANLDGITEKEV
                     TETLTAISAGKTLITITHRLKAMEKYHRIFVLEKGKIVEQGVHSELMAGNGLYRRMWE
                     LQHMTELG"
     gene            complement(797020..798759)
                     /locus_tag="CPHA266_RS03635"
                     /old_locus_tag="Cpha266_0698"
     CDS             complement(797020..798759)
                     /locus_tag="CPHA266_RS03635"
                     /old_locus_tag="Cpha266_0698"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744583.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_011744583.1"
                     /db_xref="GI:500065199"
                     /translation="MNIDRRLFQLLKEERTPFILSIIAGILAAGMLVAQAYYLSHIID
                     SAFMRKTGIENLLLPLGLFALFSILRMAFNWFSHTEANRGTIIIRKKIFNRLTSTVGD
                     LGPIHAKSVQSGRLSTTLLKGVEALDAYFSQYIPQIFFALFTPLLIAGIILQGDPISG
                     GILLITAPLIPLFMILIGKSASAMTDKQWKTMSRMSGFFLDVLQGLPTLKLFAQSQRQ
                     HDAFEKSGETFRHATMNVLKVAFLSSLTLELVGTIGTAIVAVGIGLRLMTGHLTFQHA
                     LFVLILTPDFYLPLRQLGTKFHAGMEGVSASKELFAILDQSAPSAVQQVDFAVQEGAK
                     KSPIHFSDVSYTYPGSSRPALEGINATIPAEKTTAIIGPSGSGKSTLINLLLRFQDPG
                     KGSITINDNPIHAIPLEAWHKQISWVPQHPYLFNATLRENILLAKRDASSEEMEIALK
                     KTGLATFIKTLPQGLETMIGEEGARLSGGEAQRVALARAFLKNAPLLVLDEPTSHTDP
                     ELETVLRNSIQELMRGRTTVIIAHRLETIRSAEQIIVISEGKITQSGTHDELIAKGGF
                     YQEALLLQQESVS"
     gene            complement(799097..800110)
                     /locus_tag="CPHA266_RS03640"
                     /old_locus_tag="Cpha266_0699"
     CDS             complement(799097..800110)
                     /locus_tag="CPHA266_RS03640"
                     /old_locus_tag="Cpha266_0699"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744584.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C oxidase assembly protein"
                     /protein_id="WP_011744584.1"
                     /db_xref="GI:500065201"
                     /translation="MDLQTLWFILITVLFTGFFFLEGFDYGVGILLPFMSKDDLERRT
                     VINTIGPFWDANEVWLITAGGAMFAAFPEWYATLFSGFYVALLLMLAALIFRGVAFEF
                     RSKHDNPAWRNFWDWSIFFGSAIPAVLWGVALSNFIRGVPIDESMNYAGGFFNLLNPY
                     ALLCGITSFFIFTLHGAVFLTLKTTGTLHAKAMGFAKIIWGPATLLSFLFMIYTSTET
                     DLYQHLGINPGVIPVFSVLALLSVIFMLKKNASGWAFAMTGAAIAFSTITIFTGLYPR
                     VLVSSLKPEWSLTIYNASSSSYTLGIMSIIALIFVPIVLIYQGWSYWIFRSRVTKDSE
                     LEY"
     gene            complement(800128..801483)
                     /locus_tag="CPHA266_RS03645"
                     /old_locus_tag="Cpha266_0700"
     CDS             complement(800128..801483)
                     /locus_tag="CPHA266_RS03645"
                     /old_locus_tag="Cpha266_0700"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012466728.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome D ubiquinol oxidase subunit I"
                     /protein_id="WP_011744585.1"
                     /db_xref="GI:500065203"
                     /translation="MDTLLLARLQFAITSVFHFFFVPLTLGLSLFIALLETAYVKTGD
                     EKFKKLTKFWGNLFLINFAVGVVTGIVMEFQFGMNWSEYSRFVGDIFGVPLAIEALLA
                     FFIESTFLGIWVFGWNKLPKTLHAACFWLVAIGSNLSALWILVANSFMQSPVGFKMAA
                     DGSRAEMTDFAALLFNPYVWKQFPHVLAGGVVTGGFLIIAISSWHLIRGTNERSAFEA
                     AMKYGTIYAFIGTLLVTLAGHTQMQDLIKTQPMKVAAAEALWETENPASFSLFTVGNE
                     KELKDVFAIRIPGMLSFLAYNSFEGEVKGIKDLQKEYEQQYGPGSYIPSIITAYWSFR
                     FMVGAGTLMLLVSFLALIKVLKENYTFSPFLGALLFWSFLLPYIANSSGWILAEMGRQ
                     PWIVFGLLKTEAGVSPASVVSSGELLLSLVLFTLIYGILALADLFLLKKYAAAGIEAA
                     E"
     gene            complement(801793..802857)
                     /locus_tag="CPHA266_RS03650"
                     /old_locus_tag="Cpha266_0701"
     CDS             complement(801793..802857)
                     /locus_tag="CPHA266_RS03650"
                     /old_locus_tag="Cpha266_0701"
                     /EC_number="5.3.1.23"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744586.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methylthioribose-1-phosphate isomerase"
                     /protein_id="WP_011744586.1"
                     /db_xref="GI:500065205"
                     /translation="MIDAISFNEGTLRYLDQRYLPLREEHISTKDHREAIEAIKTLAV
                     RGAPLIGVAAAYTVILGINSYRGDKEGFPCFFGNLIADVEASRPTAVNLFFATKKLKA
                     VYDRNFNSDSLEVLFAKMLFEARQIHDDEIANCDAMAQHGVRQIREDLAEILKTRKLN
                     VLTHCNTGTLATGGSGTALGVIKLAWQEGLIEKVITAESRPLLQGLRLTAWELEQEKI
                     PFFSISDSSSAFLMQRGMIDFGIVGADRIAANGDTANKIGTCAHALSAWHHNIPFYIA
                     APVSTIDITLSDGTQIPIEERSADELRTIFGTQVATSTTPVINYAFDVTPGKFLRGII
                     TDKKAVVGDYLNGLGQLFAE"
     gene            complement(802880..803701)
                     /locus_tag="CPHA266_RS03655"
                     /old_locus_tag="Cpha266_0702"
     CDS             complement(802880..803701)
                     /locus_tag="CPHA266_RS03655"
                     /old_locus_tag="Cpha266_0702"
                     /EC_number="2.4.2.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744587.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="purine nucleoside phosphorylase"
                     /protein_id="WP_011744587.1"
                     /db_xref="GI:500065207"
                     /translation="MIAQQAKIQEAVTFIRKKTQTDYPIGIVLGTGLGALAKEIEVDF
                     SLDYADIPNFPISTVETHHGKLIFGTLAGKKVVAMQGRFHFYEGYSMQQIVFPIRVMK
                     HLGITTLGITNACGGLNPSYKKGDIMLIDDHINLLGSNPLIGPNNPETGSRFPDMCEP
                     YSNRILALAEQAALDNGIKVQRGVYIALSGPCLETRAEYRMLRLLGADVVGMSTVPEV
                     IAAVHQGTEVFGMSIVTDECFPDCLMPVSIEEIIEVSNHAEPKMTAIFKAVVSNL"
     gene            complement(803869..804558)
                     /locus_tag="CPHA266_RS03660"
                     /old_locus_tag="Cpha266_0703"
     CDS             complement(803869..804558)
                     /locus_tag="CPHA266_RS03660"
                     /old_locus_tag="Cpha266_0703"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744588.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine racemase"
                     /protein_id="WP_011744588.1"
                     /db_xref="GI:500065211"
                     /translation="MESIASNLNRIREQIGTLSVKAGREPSDVRLIAVSKTKPARLVR
                     EAFDAGQIEFGESYVQEFLEKRDDPLLQGLPLQWHFIGHLQSNKIRSIAGKVALVHGI
                     DRLSTAAELSRRSMQQNLHTEFLLEVNTSGEQTKYGISPDVLLSEAEKIFKLPNIALR
                     GLMTIASPDTDLARKEFRELRNLLEALKKNAPDPTLLTELSMGMSQDFESAIEEGATI
                     IRIGTAIFGWR"
     gene            complement(804567..805061)
                     /locus_tag="CPHA266_RS03665"
                     /old_locus_tag="Cpha266_0704"
     CDS             complement(804567..805061)
                     /locus_tag="CPHA266_RS03665"
                     /old_locus_tag="Cpha266_0704"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744589.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="WP_011744589.1"
                     /db_xref="GI:500065213"
                     /translation="MPDTFTIQTSLGDITIRLYDDTPLHRDNFKKLVSENYYDGIRFH
                     RVIEGFMIQTGDPLSRHENKRMLHGTGGPSTRIDAEIKHSNKKGTLAAARDNNPAKAS
                     SGSQFYINHADNNFLDGQYTVFGVVEEGMGVVEKIASVKTDPNDNPVDPVTITTIVPV
                     LQAS"
     gene            complement(805090..805770)
                     /locus_tag="CPHA266_RS03670"
                     /old_locus_tag="Cpha266_0705"
     CDS             complement(805090..805770)
                     /locus_tag="CPHA266_RS03670"
                     /old_locus_tag="Cpha266_0705"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744590.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744590.1"
                     /db_xref="GI:500065215"
                     /translation="MTEIKPDTLKQQPVKEKLVDQLLYIVIKYKTALIITLALIITAG
                     AGIFFWIRYQDTSEKEAALHLSRIAPLVDLGQYRAAIDGDSKIPGLKKIDEKYGHVLS
                     GKMAGLLLANTYYALRQPDSALTVFNRLSFKNKDLSAAALAGSGDCYTEKKQFDNAAK
                     AYEKAAETAENSTLKAQYLASAADSYLATKDVKKASDFYTRIIADYPGSTGAILSQRA
                     LWQISGQQ"
     gene            complement(805957..806724)
                     /locus_tag="CPHA266_RS03675"
                     /old_locus_tag="Cpha266_0706"
     CDS             complement(805957..806724)
                     /locus_tag="CPHA266_RS03675"
                     /old_locus_tag="Cpha266_0706"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744591.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TatD family hydrolase"
                     /protein_id="WP_011744591.1"
                     /db_xref="GI:500065216"
                     /translation="MFIDAHCHLSFPEFDQDRSEVIERLNAGGISLLIDPGTNSDTSR
                     KAIELASSHTFIYANVGLHPHEVTDTVNDSLINDLALLARSPKVVGIGEIGLDYHYPG
                     YNRTAQMDAFRRMLNLAKMLDLPAVIHCRDAWDDMLRILDDEKHSSLRGVMHCFSGDT
                     ALAGECLRRGFKLSIPGTVTYKRSLLPEVIDSVSLHDLLTETDAPYLAPIPHRGKRNE
                     PAFVQLVTQTIASIKNIPLDDAADAIESTARQLFQLA"
     gene            complement(806714..807220)
                     /locus_tag="CPHA266_RS03680"
                     /old_locus_tag="Cpha266_0707"
     CDS             complement(806714..807220)
                     /locus_tag="CPHA266_RS03680"
                     /old_locus_tag="Cpha266_0707"
                     /EC_number="3.4.23.36"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BED5.1"
                     /note="lipoprotein signal peptidase; integral membrane
                     protein that removes signal peptides from prolipoproteins
                     during lipoprotein biosynthesis; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptidase"
                     /protein_id="WP_011744592.1"
                     /db_xref="GI:500065218"
                     /translation="MNWFFTLASIVIVLDQLTKKIAVMILKEKESVTLIPDWLKFTYA
                     ENNGIAFGMEFAPKEVMILLVGTISLLIALYVFRSKNRTTRFILPFALVFGGGVGNMI
                     DRITGGKVIDFIHIDLYNGMIMGTWVSLWPIFNIADSAITIGACLLILFHSTIFPDQS
                     VQKNTDVH"
     gene            complement(807274..808161)
                     /gene="aroE"
                     /locus_tag="CPHA266_RS03685"
                     /old_locus_tag="Cpha266_0708"
     CDS             complement(807274..808161)
                     /gene="aroE"
                     /locus_tag="CPHA266_RS03685"
                     /old_locus_tag="Cpha266_0708"
                     /EC_number="1.1.1.25"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BED6.1"
                     /note="AroE; catalyzes the conversion of shikimate to
                     3-dehydroshikimate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate dehydrogenase"
                     /protein_id="WP_011744593.1"
                     /db_xref="GI:500065219"
                     /translation="MMQPEKILGLIGRNIAYSRSPLIHNTACDLLALPYVYTIFNIAS
                     ADLIEPAIAGARALGIAGLNVTTPYKTTVVPFLDELSPEAASIGAVNTIVNNNGHLAG
                     YNTDIAGFAAPLRPYAQRIKGNPVSVFGNGGAALAAIEAFRIFFHPCCVYLFVRDSAK
                     ASAMLENYVHRDIVTLCLIEELFSGESGAIAKIQRSLVIVNATPIGTAGRQNETETSI
                     LPLDTELLHPDHIVYDMVYNPLFTPLIKAAKASGAATISGIEMLLGQAARSFELWTGK
                     EMPLEQVRAVLINNLLSSP"
     gene            complement(808188..809585)
                     /locus_tag="CPHA266_RS03690"
                     /old_locus_tag="Cpha266_0709"
     CDS             complement(808188..809585)
                     /locus_tag="CPHA266_RS03690"
                     /old_locus_tag="Cpha266_0709"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744594.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744594.1"
                     /db_xref="GI:500065221"
                     /translation="MSLSDFFDENRHESSGLSQKEPPDLDDLESMYDAEELIDLISQL
                     NEDGFIQEALAVAQRLEAVSPYNAETWFHLGNCLTVNGYFNDALEAFNQAVLLSPADS
                     EMRLNYALAHFNTGSLDEALEILEDMYVDSSIEREYSYYRGIILQRLERFTESEKDFE
                     HCLELDPDFSDAWYELAYGKDLLGKLEESTACYNKALDHDPYNINAWYNNGLVLSKLK
                     RYDEALQCYDMSLALADDFSSAWYNRANVLAITGKIEEAAESYVKTLEFEPDDLNALY
                     NLGIAYEELEEYSEAILCYRRCIELNNDFHDAWFALACCYEAIEQYNEGSLAIIEALK
                     AIPDSIEFLLLKAEIEYNLNELEHSLETYRHIITLDPESPQIWVDYAMVLREAGYNNE
                     SIEALHQSLKLQPHSADAHFEIAAAYFAMGDKLSTLKALSKAFKIDPDKKQLFQSTFP
                     ELYQQDSVRKMLGIS"
     gene            complement(809697..811592)
                     /gene="uvrC"
                     /locus_tag="CPHA266_RS03695"
                     /old_locus_tag="Cpha266_0710"
     CDS             complement(809697..811592)
                     /gene="uvrC"
                     /locus_tag="CPHA266_RS03695"
                     /old_locus_tag="Cpha266_0710"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BED8.1"
                     /note="The UvrABC repair system catalyzes the recognition
                     and processing of DNA lesions. UvrC both incises the 5'
                     and 3' sides of the lesion. The N-terminal half is
                     responsible for the 3' incision and the C-terminal half is
                     responsible for the 5' incision; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="excinuclease ABC subunit C"
                     /protein_id="WP_011744595.1"
                     /db_xref="GI:500065222"
                     /translation="MDSNPLHHSNPPVGSLPLDKVASLPSSPGVYQFKNAQGRVIYIG
                     KAKNLRNRVRSYFRNPQQLFGKTLVMVGKIADIEVIITSSEVEALILENNLIKELKPR
                     YNVNLKDDKTYPYLVITNEPFPRILVTRQVKKDGSTWFGPYTEARQLRSILDFIGSIF
                     PIRSCKLRLSPENISRGKFKVCLDYHIHKCKGPCEGLLTEEEYLLMIVEITRLLKGKT
                     SATIRSLNERMLSFAKELKFEQAAELKTQIDSLKRYAERQKVVTSDTLDRDVFAVASR
                     NDDGCGVVFKIREGKLLGSERLYMNNTEGVSVQDLLARVVERYYLETCNLLPDEIFLQ
                     TELPAEEKETLENLLISKISAEGKQKRTIRLTVPIIGEKAHLIQLCRENARHHLEEYL
                     IQKQKRGEALREHSGLIALAELLHLPKTPNRIECFDNSHFHGTDYVSSMVAFVHGKAK
                     KSDYRKFKLKTVQGSDDYAAMHEVLTRRYSGTLSVELPLPDLIVVDGGKGQLSTAVKV
                     LVSLKLDIPVIGLAKRIEEIFTPHTSDPFNLPKTSPALKLIQQLRDEAHRFAVTYHRK
                     LRTERTLETELTTIQGIGEKTAQKLLRHFGSVDLIRTAGVDELRAAAGNKTAALLYRF
                     YHPLEEG"
     gene            complement(811733..811957)
                     /locus_tag="CPHA266_RS03700"
                     /old_locus_tag="Cpha266_0711"
     CDS             complement(811733..811957)
                     /locus_tag="CPHA266_RS03700"
                     /old_locus_tag="Cpha266_0711"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744596.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744596.1"
                     /db_xref="GI:500065224"
                     /translation="MSAIKKVAGILWALMGAGIIPLAIMQAMKEIALKPSEENWIFWS
                     IVIVVLMPIISFSLITFGVFALKGEYDAVD"
     gene            complement(811985..813562)
                     /locus_tag="CPHA266_RS03705"
                     /old_locus_tag="Cpha266_0712"
     CDS             complement(811985..813562)
                     /locus_tag="CPHA266_RS03705"
                     /old_locus_tag="Cpha266_0712"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744597.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_011744597.1"
                     /db_xref="GI:500065226"
                     /translation="MAKNVSNVSQNEEVTSIRRVITASSVGTLIEWYDFYIFGSLAKI
                     ISEQFFPKDNPTAALLATLATFAAGFVVRPFGALFFGRLGDLIGRKYTFLVTLIIMGG
                     STFAIGLVPGYKTIGFVAPAIVFVLRLLQGLALGGEYGGAATYVAEHSPSDKRGFWTS
                     FIQTTATIGLFVSLGVILIVRQTLGVETFTDWGWRIPFLLSIFLVAISVYIRMKMSES
                     PAFAKLKKEGKTSTNPLAESFKKKDNLKMVLLALLGATAGQGVVWYTGQFYALSFLQN
                     ACNVEFVQSNYIISIALLIGTPFFIIFGALSDKIGRKYIMMTGMLIAVVAYRPIYTVM
                     YEEANLKAKTEIKEKTTTEVALALKGADSVKTTITKKTFEDGTTYKETKKETTPVDLE
                     KKAELAAAGKLKPETKKETTLSESSYYKMIGLVLIQVLFVTMVYGPIAAFLVELFPTR
                     IRYTSMSLPYHIGNGVFGGLVPLISTRLVEATRPGPDLPPADPLAGLWYPIIIGAVCF
                     LIGSIYISGKTNNLDID"
     gene            complement(813638..814075)
                     /locus_tag="CPHA266_RS03710"
                     /old_locus_tag="Cpha266_0713"
     CDS             complement(813638..814075)
                     /locus_tag="CPHA266_RS03710"
                     /old_locus_tag="Cpha266_0713"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006365207.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein UspA"
                     /protein_id="WP_011744598.1"
                     /db_xref="GI:500065228"
                     /translation="MITIKKIICPVDFSGLSRKALSYANEFAKLSGGEVFLVGVVEND
                     PTINYSHGLETERAEEEKKLAALIEEEQMHGIVADYVIYEGFAEECILDYAKRKEADI
                     IIMGSHGRRGLKRMILGSVAEHVIRRAPCPVLVIKENEHEFIK"
     gene            814120..814305
                     /locus_tag="CPHA266_RS03715"
     CDS             814120..814305
                     /locus_tag="CPHA266_RS03715"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041467174.1"
                     /db_xref="GI:752830872"
                     /translation="MPDSVMQEKLLFSLSGANVIPEKPQSVIGYTGTGINKNSYLFFS
                     LSERTRPHEVSQPFLSV"
     gene            complement(814523..815656)
                     /locus_tag="CPHA266_RS03720"
                     /old_locus_tag="Cpha266_0714"
     CDS             complement(814523..815656)
                     /locus_tag="CPHA266_RS03720"
                     /old_locus_tag="Cpha266_0714"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744599.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744599.1"
                     /db_xref="GI:500065230"
                     /translation="MKKMLSLAAMFAVLSYASPASAEVKFGGDASVRLRGQFEDDEQR
                     VFGSYENSEDDLNFAYRLRLKASADLGSGYFFKALLTSDNAAAGWNTVNDNNREDAEI
                     DISNLYFGRMMENSHYMMGRLPLNSMNNPIFDLAMYPIPTYVGISGTTIGVGDIPVAT
                     YNMDRIFGLNYGAKVGPGELNATLIALDNDIKDDTDAEGNGLFNDGYALHLSYKANLG
                     NVTVEPQAIIALTNLDGLVYENVTPYIFGANVTIPAGKAKIGLSAFYTAADDGGNYTV
                     GGAAADVDYSGYLLRLKGEYGPFMAWVDYNNTNDKTNGDDIDYNNLFVWAQYNFKVYE
                     SAMGTFSLTPTVRYWAAGKDYNDGGENDEYSRLRTELVATMSF"
     gene            complement(<815942..817084)
                     /locus_tag="CPHA266_RS03725"
                     /note="coenzyme F420 hydrogenase; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            817268..818488
                     /locus_tag="CPHA266_RS03730"
                     /old_locus_tag="Cpha266_0716"
     CDS             817268..818488
                     /locus_tag="CPHA266_RS03730"
                     /old_locus_tag="Cpha266_0716"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744160.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_011744160.1"
                     /db_xref="GI:500064243"
                     /translation="MNDLTLFQMALGLESPWYVSSSSFDVDQKRLDIRIDFKPGSTFC
                     CPQCGREGVKAYDTSEATWRHLNFFQHEAYLTVRVPRISCPECGILKLQSFPWSRRES
                     GFTLLFEAMIMIMAKSMPVKAIAAIVGEHDTRIWRIINHYVEKAREQEDHSAVTMVGV
                     DETSSKRGHNYVSLFVDLAVSKVLFATEGKDAATVKRFSEDLAAHKGDPALITEFCSD
                     MSPAFIKGVADNFTNAQLTFDKFHIMQVINNAVDEVRRQEQKERPELQRSRYIWLKNQ
                     NNLKASQRKRLDELSLPRLNLKTTRAYRMRLTFQEFFEQPQVLVEAFLKKWYFWATHS
                     QLQPMKEAAYTIKRHWSGILRWFTSRINNGVLEGINSLIQAAKARARGYRTTKNLINM
                     IYLISGKLNFGLPT"
     gene            818626..819132
                     /locus_tag="CPHA266_RS03735"
                     /old_locus_tag="Cpha266_0717"
     CDS             818626..819132
                     /locus_tag="CPHA266_RS03735"
                     /old_locus_tag="Cpha266_0717"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744600.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX hydrolase"
                     /protein_id="WP_011744600.1"
                     /db_xref="GI:500065232"
                     /translation="MAQVNLRVSALCVQDDCVLLIEHKSFAPDDPELPGRYWILPGGV
                     VERGETLDEALRREMKEETGLSCSVGSLLFIKELLYPYPGAEEAGNMHHSVSLGFYCT
                     VTGGELITGKDPEYADDQQMIVEVKWIPVAELDHYELYPPFLEGYIRQHQSDNFSTAT
                     PEFFVSMQ"
     gene            complement(819658..820533)
                     /locus_tag="CPHA266_RS03740"
                     /old_locus_tag="Cpha266_0718"
     CDS             complement(819658..820533)
                     /locus_tag="CPHA266_RS03740"
                     /old_locus_tag="Cpha266_0718"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744601.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744601.1"
                     /db_xref="GI:500065234"
                     /translation="MKHKSMICRLLTVTAALTISSLQNATADPLLDPTFNTLFKPLMA
                     DPTEPRIAVMPWLNDNYLQLDIGTSVDLYQNDKKDFAVGVDFGTYSLLERGDNFKFPV
                     DTIDYMFGINATWKKNIASDSFPFDELSARVRLSHISAHFEDGHFDNETNQWIQGDCP
                     FEIPFTYSREFVNAVVALSSPDKRIYAGYQYIYHTSPGNISPHSFQAGVEIGRPDNIY
                     AALDYKLLPIWDESRNESQGYRGTLNLQAGTRLGFIGLDGVRLAYNYFNGMSRQGMYF
                     YRDESYSSLGMIIDL"
     gene            complement(820575..821501)
                     /locus_tag="CPHA266_RS03745"
                     /old_locus_tag="Cpha266_0719"
     CDS             complement(820575..821501)
                     /locus_tag="CPHA266_RS03745"
                     /old_locus_tag="Cpha266_0719"
                     /EC_number="2.1.3.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1BEE6.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate carbamoyltransferase"
                     /protein_id="WP_011744602.1"
                     /db_xref="GI:500065236"
                     /translation="MKHLTGLCELPLYEIQRLLDLAAVFKKELRTKAPAFAPTLLSKK
                     IALAFFENSTRTRFSFEIAAKHLGASTLNFTASSSSVSKGETLGDTIKNLEAMQVDAF
                     VIRHPSSGAADLITGITSKSVINAGDGSHEHPTQALLDMFTLKEHFGSLEGLNVFILG
                     DILHSRVARSNIFGMLTLGANVALCSPSTLLPPGTSDLGIRIFTDLDQAIQWADAAIV
                     LRLQLERATGGYLPSLGEYAVHFGLTDERLERIRKHLLVLHPGPINREIEISSRVADR
                     MQPPGFSSSLLLQQVTNGIAVRMAVLQTLLAE"
     gene            821732..822082
                     /locus_tag="CPHA266_RS03750"
                     /old_locus_tag="Cpha266_0720"
     CDS             821732..822082
                     /locus_tag="CPHA266_RS03750"
                     /old_locus_tag="Cpha266_0720"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744603.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrogenase nickel incorporation protein HypA"
                     /protein_id="WP_041467175.1"
                     /db_xref="GI:752830873"
                     /translation="MHEMSVAISIVDAVCETARKDGALSVSRIELVVGRLAGLQVESL
                     RFCFSSAAKGTLAEDAVLAVEEPEARGECGDCGSRFPVSFFYAECPVCRSLKVRIVSG
                     EEFMIQSIIIEEGE"
     gene            822088..822900
                     /locus_tag="CPHA266_RS03755"
                     /old_locus_tag="Cpha266_0721"
     CDS             822088..822900
                     /locus_tag="CPHA266_RS03755"
                     /old_locus_tag="Cpha266_0721"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744604.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrogenase nickel incorporation protein HypB"
                     /protein_id="WP_011744604.1"
                     /db_xref="GI:500065239"
                     /translation="MCDTCGCSTDGGALLRKPGDSDYHVHIGDEGHGHEHGHDHDHDR
                     HHHDHQAGRSRKIEVEQDVLLKNNLLAERNRGYFEARNILALNFLSSPGSGKTSLLEK
                     IIPMFRLKHPVAVIEGDQQTTNDADRIHALGVEVIQVNTGTGCHLDALMINRAVKELN
                     LQNNSLLCIENVGNLVCPAMFDLGEACKVVVISVTEGDDKPLKYPNMFHEADVCVLNK
                     TDLLDYVDFDSAQCKKNALSINHHLEWFEVSAKTGEGLELLMQWLENRMEQS"
     gene            822870..825191
                     /locus_tag="CPHA266_RS03760"
                     /old_locus_tag="Cpha266_0722"
     CDS             822870..825191
                     /locus_tag="CPHA266_RS03760"
                     /old_locus_tag="Cpha266_0722"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744605.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrogenase maturation protein HypF"
                     /protein_id="WP_011744605.1"
                     /db_xref="GI:500065241"
                     /translation="MARKQNGTELNVEPGIGEVRRGILVHGIVQGVGFRPFVYRTAKA
                     LGLRGFIKNTSSGVSVEVQGSEDLIGKFLFEVQQHAPPLAKIHSFEVRPMIPVEEDGF
                     SIELSLAGSEVETLISPDIALCVDCRRELADPENRRFQYPFINCTNCGPRFTIVEKIP
                     YDRQYTSMKGFAMCPICDKEYHDPLDRRFHAQPTACRDCGPRIELRDASGQKVRCIDA
                     LAEAAALLKDGKILALKGVGGFHLAVDARNDAAVRLLRERKGREEKPFAVMMSDMELV
                     RQFCDVEPEEASALLSPEAPIVLLVKRSMKGLSASIAPGNDRLGVMLPYSPLHSLLFD
                     RGADVLLMTSANFSEEPILHENREAMERLGGIADAFLLHDRPIHIRCDDSVTIFLSGK
                     LRQIRRSRGYVPAPVFLSGGGAPVMGTGGELKNTLCFLKGSKAILSQHIGDMKNYEAW
                     QHFEQIFRHLQGIFQVSPELLVHDLHPGYMTTQWAAAQPLPMLGVQHHHAHLVSCLAE
                     NRTDGPAIGIVLDGTGYGTDGMIWGGEVLIGDASEAERFASLEPMPLPGGDAAITQPW
                     RAALGYLFRSFSVLPELPFMSGKPAGLVLELLEKKLNTPETSSCGRLFDVVAALSGIC
                     DRITFEGQAAIALMQAAGGSIGREGFSFSFEENAGGLRILVAPLVREIADALGKGMSP
                     GEVSRRFHRTLVDCFLEITLKASQQSGVKTVALSGGVFQNELLFEALIQELEHAGYRV
                     LTHREVPTNDGGLCLGQAVIGRRFLEGRYRGVR"
     gene            825252..825527
                     /locus_tag="CPHA266_RS03765"
                     /old_locus_tag="Cpha266_0723"
     CDS             825252..825527
                     /locus_tag="CPHA266_RS03765"
                     /old_locus_tag="Cpha266_0723"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744606.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydantoin utilization protein B"
                     /protein_id="WP_011744606.1"
                     /db_xref="GI:500065243"
                     /translation="MCLAIPGKVLELFDENGLKMGSIDVNGTTTRACLEYVPEIRVGQ
                     YTIVHAGFALKIIDEEEAAESLKLWQDLVESGAFDDPDDELPSPETI"
     gene            825541..826632
                     /locus_tag="CPHA266_RS03770"
                     /old_locus_tag="Cpha266_0724"
     CDS             825541..826632
                     /locus_tag="CPHA266_RS03770"
                     /old_locus_tag="Cpha266_0724"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744607.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrogenase formation protein HypD"
                     /protein_id="WP_011744607.1"
                     /db_xref="GI:500065245"
                     /translation="MKFIDEYRDPKLALAILEEIRRKTTRAWTIMEICGGQTHSIIRN
                     GIDQLLPDAITLAHGPGCPVCVTPLETIERALLLAGMPEVILASFGDMLRVPGSSKDL
                     FLVRSEGGDVRFVFSPLDALQIARDNPHKEVVFLAVGFETTAPANAMAAYQAKREGIG
                     NFSLLVSQVMVPPAMRAILSSPDNKVEGFLAAGHVCAVMGYEEYEAVSGEFHVPIVPT
                     GFEPVDLLAGILKTIELLEDQKAEVFNRYGRVVSREGNLAARRLMDSVYMVSDRQWRG
                     IGLIPKSGLALREEYAAWDAEKKFDLSHITAGESPLCMSGSVLRGVLKPDACPAFGRE
                     CNPQHPLGATMVSSEGACAAYYNYHRNPF"
     gene            826635..827678
                     /locus_tag="CPHA266_RS03775"
                     /old_locus_tag="Cpha266_0725"
     CDS             826635..827678
                     /locus_tag="CPHA266_RS03775"
                     /old_locus_tag="Cpha266_0725"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011744608.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrogenase"
                     /protein_id="WP_011744608.1"
                     /db_xref="GI:500065247"
                     /translation="MTIELSCPVPISNHETVQMAHGAGGRLSQDLMRRIFMPHLHNIF
                     LDLLDDQAKLELPHGRVAFTTDTYVVSPIFFPGGTIGELAVNGTVNDLAAGGAIPKYL
                     SAGFVLEEGFSLPELDRVVASMAGAARKAGVQIVTGDTKVVEKGQCDKVFINTSGIGV
                     VREGVAVSCRNLQPGDAVILSGNVGDHGMAIMTSREGLSFQSRISSDCAALNGMIADV
                     LDAVPSIHAMRDPTRGGVAATLNELALASSVGIAIDEAAIPVRPDVRGACELLGIDPM
                     HVANEGKLVVVVQASEAEKVLEAMHSSEHGRDAVRIGSVVRDHPGMVIMRTVFGTRRI
                     VDLPLGEQLPRIC"
     gene            complement(827746..>828420)
                     /locus_tag="CPHA266_RS03780"
                     /old_locus_tag="Cpha266_0726"
     CDS             complement(827746..>828420)
                     /locus_tag="CPHA266_RS03780"
                     /old_locus_tag="Cpha266_0726"
                     /EC_number="1.8.1.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012508704.1"
                     /exception="unextendable partial coding region"
                     /note="Catalyzes the oxidation of dihydrolipoamide to
                     lipoamide; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrolipoamide dehydrogenase"
                     /protein_id="WP_041467525.1"
                     /db_xref="GI:752831223"
                     /translation="TTEKGVRVTYAGDQGSEHVLECDKLIVSVGRIPDTEKLNLAGIG
                     LQIDERGFIPVNDHCATVAEGVYAIGDVVRGPMLAHKAEDEGVMVAELIAGQNPRLDY
                     NSMPRVIYTTPEIAWAGKTEQQLRAEGRDYKTGQFPFAANGRALGPGDAEGFIKMLAD
                     AKTDEILGVHIIGANASELIAEAALALEFRAAAEDIARTCHPHPSLSEVMREAALALE
                     KRALNI"
     gene            complement(829084..829506)
                     /locus_tag="CPHA266_RS03785"
                     /old_locus_tag="Cpha266_0727"
     CDS             complement(829084..829506)
                     /locus_tag="CPHA266_RS03785"
                     /old_locus_tag="Cpha266_0727"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011744610.1"